Citrus Sinensis ID: 000694

Local Sequence Feature Prediction

Prediction and (Method)	Result

Residue Number Marker

Protein Sequence

Secondary Structure (PSIPRED)

Secondary Structure Prediction (SSPRO)

Coil and Loop (DISEMBL)

Flexible Loop (DISEMBL)

Low Complexity Region (SEG)

Disordered region (IsUnstruct)

Disordered Region (DISOPRED)

Disordered Region (DISEMBL)

Disordered Region (DISPRO)

Transmembrane Helix (TMHMM)

Transmembrane Helix (HMMTOP)

Transmembrane Helix (MEMSAT)

TM Helix, Signal Peptide (MEMSAT_SVM)

TM Helix, Signal Peptide (Phobius)

Signal Peptide (SignalP HMM Mode)

Signal Peptide (SignalP NN Mode)

Coiled Coils (COILS)

Positional Conservation

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820-------830-------840-------850-------860-------870-------880-------890-------900-------910-------920-------930-------940-------950-------960-------970-------980-------990------1000------1010------1020------1030------1040------1050------1060------1070------1080------1090------1100------1110------1120------1130------1140------1150------1160------1170------1180------1190------1200------1210------1220------1230------1240------1250------1260------1270------1280------1290------1300------1310------1320------1330------1340------135

MSINSMASISSSSSFHHDHEKPPGLEIIRALVVSINEFILEFITHVERWHALKLRCASKLNMKRKEFFEFSEHSILSNLYWGIDSIEAAIQAEWPEEKARRLCNSERLLQAPALLDEQEVTSGIPNCYLVSCAYFYLSVIKKLQEDELQVALHFLQALSVYPRLIGTEFAPELCKCLFPSLGLPKLQAMSGRKILESDETNGSDAMRLIARRYKHWLMYYQVLLHEETPQRHCGYREVSSSAVEAQFHTHEIRGRSESSSSIEHVPKLQTSSNKLMLYAKVHPLDPQEDVTNDTTVGTKACRKIPEIQEYGKDIKNLDEVPRLQLRTAGLRKKSSTKCLYDMLQESESDRSTTVGSCSTEIEEESDSEANMGIVKSLIANEGTSAVDRRPENFDQKLQAYCSSSGSESAKISFLRAPKRPMYKESNGTNSNRNFSRRFLSSSGHFNLSILELRDKISNGSCHVEGKISKQHKVQPSDCVLSSSPQQSCRFTEMDYRGSSERKKNSSGRKKFNEECLNGEKDAKSELLEIIEKAISSLFFSGDLRKCNKDYVVEVTTLYKMLNSKTGVKYDMLQDVILEQLLTAISASKEETVIRASVSILTTIILANESVIEDIKKKGLRLSDLATALKRNVPEAAILIYLIKPSPTEIKTLELLPTLVEVICTSKLYKGKLESVRLTPPAASLMIIEVLVTAFDYATNNMHLAAINSPRVLCGLLDVARHQNLEELISLATILVKCIQFDGQCRKYLSEFTAVAPLACLLQSGEKRAIMIALEFFHEILRIPRSSAIDLLQRIHKEGNINILHILKLSLQQLQSDYQLLAANLLLQLDTLENTTGKSVFTEEAMQVILKAVASEESSTMQLLSSFILSNIGGTFSWTGEPYTVAWLVKKAGLNSSWLQNMIRNFDWLDQSLQDRGVDSWSSKIAKSIIEIGKPIYYALEKGLKSKTKSVCRDSLTTIAWLSFEVSKSPNSVRHSACQILLDGVEQFLHPGLELEERLLACLCIYNYASGKGMQKLIRSSEGVRESLRRLSNVTWMAEELHKAADYYLPNISRISCVHTQILEASHKCSGAVTALIYYKGLLCSGFSDGSIKMWDIKKQSAMLVWDVKEHRKAVTSFSLFEPGESLLSGSADKTIGVWQMVQRKLELIEVIATKEPIRKLDTYGKTIFASTQGHRMKVIDSSRTLKDIYRSKGIKSMSVVQGKIYIGCMDSSIQELAVSNNVEREIKAPFKSWRLQSKPINSLVVYKDWLYSASSSVEGSNIKEWRRHRKPQISIAPEKGTTIQAMAVVEDFIYLNYNSSASSLQIWLRGTQQKVGRISAGSKITSLLTANDIVLCGTETGLIKGWIPL

cccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHcccccccccccccccHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHcccccccccccccccccccHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHccccccccccHHHHHHHHcccccccHHHccccccccccccccccHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHccccccccccHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHcccccHHHHHHcccccHHHHHHHHHHccHHHHHHHHHccccHHHHHHcccHHHHHHHHHccccccccccccccccHHHHHHHHHHHHHcccccccHHHHHHHccHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHcccccHHHHHHHcccHHHHHHHHHcccHHHHHHHHHHHHHHcccccHHHHHHHHHHHccHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHcccccccEEHHHHHHHHHHHHHccccHHHHHHHHHHHHHccccccccccHHHHHHHHHHHccccccccHHHcccccccHHHHHHHHHHHHHHHHHHHHHcccccEEEEEccccccccccccccEEEEEHHccccccccccHHHHHHHHHHcccccccccccccccHHHHHEEHHHcccccccHHHHHccccccccccccccccccHHHHHccccccccccccEEccccEEEEEccccccEEEEEEEcccEEEEEEccccEEEEEcccccEEEEEEcccccccEEEEEEcccccEEEEEcccccEEEEEccccEEEEEEEEcccccEEEEEEcccEEEEEEccccEEEEEcccccEEEEccccEEEEEEEccEEEEEEEcccccEEEccccccccccccccEEEcccccEEEEEEEcccEEEEEEEccccEEEEEcccccccccccccccccEEEEEEcccccEEEEEcccccEEEEEcccccEEEEEcccccEEEEEEcccEEEEEEccccEEEEccc

ccccHHHHHcccccccccccccccHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHcHHccccccccccccHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHccccccHHHHHHccHHcccccHHcHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHccccccccccccccccHHHcHHHHccccccccHHHHccccccccccHHHHHHHHHHcccccccccccccccccccccccccccccccccHHcccccccccccHHcccccccccccccccHHHcccccccccccccccHccccccccccccccccccccHHHHHccccccccccccccccccccccccccccccccccccccccccccccHHHHcccccccccccccccccccHHHHHHHHHHHHHHHHHccccHHHcHHHHHHHHHHHHHHHccccccEHHcccHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHccHHHHHHEccccccHHHHHHHHHHcHHHHHHHHHHccccHHHHHHHcHHHHHHHHHHccccccccccEccccHHHHHHHHHHHHHHccccccccHHHHHHccHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHcccHHHHHHHHcccHHHHHHHHccccHHHHHHHHHHHHHHHccHHHHHHHHHHHHHcccHHHHHHHHHHHHHcccHcHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHccccccccHHHHHHHHHHHccccccHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHccccccccEEEcccccccHHHHcccccccccHHHHHccccEEcccccccccccEEEEEEcccccEEEEEEEEcccEEEEEccccEEEEEEcccccEEEEEEEEcccccEEEEEEcccccEEEEcccccEEEEEEcccccEEEEEEccccccEEEEEEcccEEEEEccccEEEEEEcccccEEEEEEccEEEEEEcccEEEEEccccEEEEEEcccccEEEEEcccccEEEEcccEEEEEEccccEEEEEEcccccEEEEEEcccccEEEEEccccccEEEEEEEccccEEEEcccccEEEEEEcccccEEEEEEcccEEEEEEEcccEEEEEccccEEEEEEcc

msinsmasisssssfhhdhekppGLEIIRALVVSINEFILEFITHVERWHALKLRCASKLNMKRKEFFEFSEHSILSNLYWGIDSIEAAIQAEWPEEKARRLCNSERLlqapalldeqevtsgipncylVSCAYFYLSVIKKLQEDELQVALHFLQALSvyprligtefapelckclfpslglpklqaMSGRKilesdetngsDAMRLIARRYKHWLMYYQVLLheetpqrhcgyrevsssavEAQFhtheirgrsessssiehvpklqtssnklmlyakvhpldpqedvtndttvgtkacrkiPEIQeygkdiknldevprlqlrtaglrkkssTKCLYDMLQesesdrsttvgscsteieeesdseaNMGIVKSLIanegtsavdrrpenfdQKLQAYCSssgsesakisflrapkrpmykesngtnsnrnFSRRFLsssghfnlSILELRDkisngschvegkiskqhkvqpsdcvlssspqqscrftemdyrgsserkknssgrkkfNEECLNGEKDAKSELLEIIEKAISSLffsgdlrkcnKDYVVEVTTLYKMLnsktgvkydMLQDVILEQLLTAISASKEETVIRASVSILTTIILANESVIEDIKKKGLRLSDLATALKRNVPEAAILIYLikpspteiktlelLPTLVEVICTSklykgklesvrltppaaSLMIIEVLVTAFDYATNNMHLAAINSPRVLCGLLDVARHQNLEELISLATILVKCIQFDGQCRKYLSEFTAVAPLACLLQSGEKRAIMIALEFFHEILRIPRSSAIDLLQRIHKEGNINILHILKLSLQQLQSDYQLLAANLLLQLDtlenttgksvfTEEAMQVILKAVASEESSTMQLLSSFILsniggtfswtgepYTVAWLVKKAGLNSSWLQNMIRNFDWLDQslqdrgvdswSSKIAKSIIEIGKPIYYALEKGLKSKTKSVCRDSLTTIAWLSFevskspnsvrhSACQILLDGVEQFLHPGLELEERLLACLCIYNYASGKGMQKLIRSSEGVRESLRRLSNVTWMAEELHKAAdyylpnisrisCVHTQILEASHKCSGAVTALIYYKGLlcsgfsdgsikmWDIKKQSAMLVWDVKEHrkavtsfslfepgesllsgsadkTIGVWQMVQRKLELIEVIATkepirkldtygktifastqghrmkvidssrTLKDIYRSKGIKSMSVVQGKIYIGCMDSSIQELAVSNnvereikapfkswrlqskpinslvVYKDWLYSasssvegsnikewrrhrkpqisiapekgttIQAMAVVEDFIYLNYNSSASSLQIWLRGTqqkvgrisagsKITSLLTANDIVLCgtetglikgwipl

msinsmasisssssfhhdhekpPGLEIIRALVVSINEFILEFITHVERWHALKLRCASKLNMKRKEFFEFSEHSILSNLYWGIDSIEAAIQAEWPEEKARRLCNSERLLQAPALLDEQEVTSGIPNCYLVSCAYFYLSVIKKLQEDELQVALHFLQALSVYPRLIGTEFAPELCKCLFPSLGLPKLQAMSGRKIlesdetngsdaMRLIARRYKHWLMYYQVLLHEETPQRHCGYREVSSSAVEAQFHTHeirgrsessssiehvpKLQTSSNKLMLYAKVHpldpqedvtndttvgtkacrkipeiqeygkdiknldevprlqlrtaglrkksstkCLYDMlqesesdrsttvgSCSTEieeesdseanMGIVKSLIANEGTSAVDRRPENFDQKLQAYcsssgsesakisflrapkrpmykesngtnsnrnFSRRFLSSSGHFNLSILELRDKISNGSCHVEGKIskqhkvqpsdcvlssspqqscrftemdyrgsserkknssgrkkfneeclngEKDAKSELLEIIEKAISslffsgdlrkcNKDYVVEVTTLYKMLNSKTGVKYDMLQDVILEQLLTAISASKEETVIRASVSILTTIILANESVIEDIKKKGLRLSDLATALKRNVPEAAILIYLIKPSPTEIKTLELLPTLVEVICTSKlykgklesvrltpPAASLMIIEVLVTAFDYATNNMHLAAINSPRVLCGLLDVARHQNLEELISLATILVKCIQFDGQCRKYLSEFTAVAPLACLLQSGEKRAIMIALEFFHEILRIPRSSAIDLLQRIHKEGNINILHILKLSLQQLQSDYQLLAANLLLQLDTLENTTGKSVFTEEAMQVILKAVASEESSTMQLLSSFILSNIGGTFSWTGEPYTVAWLVKKAGLNSSWLQNMIRNFDWLDQSLQDRGVDSWSSKIAKSIIEIGKPIYYALEKGLKSKTKSVCRDSLTTIAWLSFEVSKSPNSVRHSACQILLDGVEQFLHPGLELEERLLACLCIYNYASGKGMQKLIRSSEGVRESLRRLSNVTWMAEELHKAADYYLPNISRISCVHTQILEASHKCSGAVTALIYYKGLLCSGFSDGSIKMWDIKKQSAMLVWDVKEHRKAVTsfslfepgesllsgsadkTIGVWQMVQRKLELIEViatkepirkldtygktifastqghrmkvidssrtlkdiyrskgiksmsvVQGKIYIGCMDSSIQELAVSNNVEREIKapfkswrlqskpiNSLVVYKDWLYSASSsvegsnikewrrhrkpqisiapekgttIQAMAVVEDFIYLNYNSSASSLQIWLRGTQQKVGRISAGSKITSLLTANDIVLCgtetglikgwipl

msinsmasisssssFHHDHEKPPGLEIIRALVVSINEFILEFITHVERWHALKLRCASKLNMKRKEFFEFSEHSILSNLYWGIDSIEAAIQAEWPEEKARRLCNSERLLQAPALLDEQEVTSGIPNCYLVSCAYFYLSVIKKLQEDELQVALHFLQALSVYPRLIGTEFAPELCKCLFPSLGLPKLQAMSGRKILESDETNGSDAMRLIARRYKHWLMYYQVLLHEETPQRHCGYREVSSSAVEAQFHTHeirgrsessssieHVPKLQTSSNKLMLYAKVHPLDPQEDVTNDTTVGTKACRKIPEIQEYGKDIKNLDEVPRLQLRTAGLRKKSSTKCLYDMLQESESDRSTTVGSCSTEIEEESDSEANMGIVKSLIANEGTSAVDRRPENFDQKLQAYCSSSGSESAKISFLRAPKRPMYKEsngtnsnrnfsrrflsssgHFNLSILELRDKISNGSCHVEGKISKQHKVQPSDCVLSSSPQQSCRFTEMDYRGSSERKKNSSGRKKFNEECLNGEKDAKSELLEIIEKAISSLFFSGDLRKCNKDYVVEVTTLYKMLNSKTGVKYDMLQDVILEQLLTAISASKEETVIRASVSILTTIILANESVIEDIKKKGLRLSDLATALKRNVPEAAILIYLIKPSPTEIKTLELLPTLVEVICTSKLYKGKLESVRLTPPAASLMIIEVLVTAFDYATNNMHLAAINSPRVLCGLLDVARHQNLEELISLATILVKCIQFDGQCRKYLSEFTAVAPLACLLQSGEKRAIMIALEFFHEILRIPRSSAIDLLQRIHKEGNINIlhilklslqqlqsdyqllaanlllqldtlentTGKSVFTEEAMQVILKAVASEESSTMQLLSSFILSNIGGTFSWTGEPYTVAWLVKKAGLNSSWLQNMIRNFDWLDQSLQDRGVDSWSSKIAKSIIEIGKPIYYALEKGLKSKTKSVCRDSLTTIAWLSFEVSKSPNSVRHSACQILLDGVEQFLHPGleleerllACLCIYNYASGKGMQKLIRSSEGVRESLRRLSNVTWMAEELHKAADYYLPNISRISCVHTQILEASHKCSGAVTALIYYKGLLCSGFSDGSIKMWDIKKQSAMLVWDVKEHRKAVTSFSLFEPGESLLSGSADKTIGVWQMVQRKLELIEVIATKEPIRKLDTYGKTIFASTQGHRMKVIDSSRTLKDIYRSKGIKSMSVVQGKIYIGCMDSSIQELAVSNNVEREIKAPFKSWRLQSKPINSLVVYKDWLYSASSSVEGSNIKEWRRHRKPQISIAPEKGTTIQAMAVVEDFIYLNYNSSASSLQIWLRGTQQKVGRISAGSKITSLLTANDIVLCGTETGLIKGWIPL

************************LEIIRALVVSINEFILEFITHVERWHALKLRCASKLNMKRKEFFEFSEHSILSNLYWGIDSIEAAIQAEWPEEKARRLCNSERLLQAPALLDEQEVTSGIPNCYLVSCAYFYLSVIKKLQEDELQVALHFLQALSVYPRLIGTEFAPELCKCLFPSLGLPKLQA****************AMRLIARRYKHWLMYYQVLLHEETPQRHCGYR****************************************LYAK**************TVGTKACRKIPEIQEYGKDIKNLDEVPRLQL**********************************************************************************************************************HFNLSILELRDKI*********************************************************************LLEIIEKAISSLFFSGDLRKCNKDYVVEVTTLYKMLNSKTGVKYDMLQDVILEQLLTAISASKEETVIRASVSILTTIILANESVIEDIKKKGLRLSDLATALKRNVPEAAILIYLIKPSPTEIKTLELLPTLVEVICTSKLYKGKLESVRLTPPAASLMIIEVLVTAFDYATNNMHLAAINSPRVLCGLLDVARHQNLEELISLATILVKCIQFDGQCRKYLSEFTAVAPLACLLQSGEKRAIMIALEFFHEILRIPRSSAIDLLQRIHKEGNINILHILKLSLQQLQSDYQLLAANLLLQLDTLENTTGKSVFTEEAMQVILKAVASEESSTMQLLSSFILSNIGGTFSWTGEPYTVAWLVKKAGLNSSWLQNMIRNFDWLDQSLQDRGVDSWSSKIAKSIIEIGKPIYYALEKGLKSKTKSVCRDSLTTIAWLSFEVSKSPNSVRHSACQILLDGVEQFLHPGLELEERLLACLCIYNYASGKGMQKLIRS**GVRESLRRLSNVTWMAEELHKAADYYLPNISRISCVHTQILEASHKCSGAVTALIYYKGLLCSGFSDGSIKMWDIKKQSAMLVWDVKEHRKAVTSFSLFEPGESLLSGSADKTIGVWQMVQRKLELIEVIATKEPIRKLDTYGKTIFASTQGHRMKVIDSSRTLKDIYRSKGIKSMSVVQGKIYIGCMDSSIQELAVSNNVEREIKAPFKSWRLQSKPINSLVVYKDWLYSAS**********W*******ISIAPEKGTTIQAMAVVEDFIYLNYNSSASSLQIWLRGTQQKVGRISAGSKITSLLTANDIVLCGTETGLIKGWI**

***********************GLEIIRALVVSINEFILEFITHVERWHALKLRCASK***************ILSNLYWGIDSIEAA*****************RLLQAPALLDEQEVTSGIPNCYLVSCAYFYLSVIKKLQEDELQVALHFLQALSVYPRLIGTEFAPELCKCLFPSLGLPKLQAMSGRK**************LIARRYKHWLMYYQVLLHEETPQRHCGYREV**************************************************************************************************************************************************************************************************************FNLSILELRD**********************************************************************ELLEIIEKAISSLFFSGDLRKCNKDYVVEVTTLYKMLNSKTGVKYDMLQDVILEQLLTAISASKEETVIRASVSILTTIILANESVIEDIKKKGLRLSDLATALKRNVPEAAILIYLIKPSPTEIKTLELLPTLVEVICTSKLYKGKLESVRLTPPAASLMIIEVLVTAFDYATNNMHLAAINSPRVLCGLLDVARHQNLEELISLATILVKCIQFDGQCRKYLSEFTAVAPLACLLQSGEKRAIMIALEFFHEILRIPRSSAIDLLQRIHKEGNINILHILKLSLQQLQSD*QLLAANLLLQLDTLENTTGKSVFTEEAMQVILKAVASEESSTMQLLSSFILSNIGGTFSWTGEPYTVAWLVKKAGLNS****************LQDRGVDSWSSKIAKSIIEIGKPIYYA*********KSVCRDSLTTIAWLSFEVSKSPNSVRHSACQILLDGVEQFLHPGLELEERLLACLCIYNYASGKGMQKLIRSSEGVRESLRRLSNVTWMAEELHKAADYYLPNISRISCVHTQILEASHKCSGAVTALIYYKGLLCSGFSDGSIKMWDIKKQSAMLVWDVKEHRKAVTSFSLFEPGESLLSGSADKTIGVWQMVQRKLELIEVIATKEPIRKLDTYGKTIFASTQGHRMKVIDSSRTLKDIYRSKGIKSMSVVQGKIYIGCMDSSIQELAVSNNVEREIKAPFKSWRLQSKPINSLVVYKDWLYSASSSVEGSNIKEWRRHRKPQISIAPEKGTTIQAMAVVEDFIYLNYNSSASSLQIWLRGTQQKVGRISAGSKITSLLTANDIVLCGTETGLIKGWIPL

********************KPPGLEIIRALVVSINEFILEFITHVERWHALKLRCASKLNMKRKEFFEFSEHSILSNLYWGIDSIEAAIQAEWPEEKARRLCNSERLLQAPALLDEQEVTSGIPNCYLVSCAYFYLSVIKKLQEDELQVALHFLQALSVYPRLIGTEFAPELCKCLFPSLGLPKLQAMSGRKILESDETNGSDAMRLIARRYKHWLMYYQVLLHEETPQRHCGYREVSSSAVEAQ******************VPKLQTSSNKLMLYAKVHPLDPQEDVTNDTTVGTKACRKIPEIQEYGKDIKNLDEVPRLQLRTAGLRKKSSTKCLYDMLQ************************ANMGIVKSLIANEGTSAVDRRPENFDQKLQAY**********ISFLRAPKRPMYKESNGTNSNRNFSRRFLSSSGHFNLSILELRDKISNGSCHVEGK*********************CRFT*********************EECLNGEKDAKSELLEIIEKAISSLFFSGDLRKCNKDYVVEVTTLYKMLNSKTGVKYDMLQDVILEQLLTAISASKEETVIRASVSILTTIILANESVIEDIKKKGLRLSDLATALKRNVPEAAILIYLIKPSPTEIKTLELLPTLVEVICTSKLYKGKLESVRLTPPAASLMIIEVLVTAFDYATNNMHLAAINSPRVLCGLLDVARHQNLEELISLATILVKCIQFDGQCRKYLSEFTAVAPLACLLQSGEKRAIMIALEFFHEILRIPRSSAIDLLQRIHKEGNINILHILKLSLQQLQSDYQLLAANLLLQLDTLENTTGKSVFTEEAMQVILKAVASEESSTMQLLSSFILSNIGGTFSWTGEPYTVAWLVKKAGLNSSWLQNMIRNFDWLDQSLQDRGVDSWSSKIAKSIIEIGKPIYYALEKGLKSKTKSVCRDSLTTIAWLSFEVSKSPNSVRHSACQILLDGVEQFLHPGLELEERLLACLCIYNYASGKGMQKLIRSSEGVRESLRRLSNVTWMAEELHKAADYYLPNISRISCVHTQILEASHKCSGAVTALIYYKGLLCSGFSDGSIKMWDIKKQSAMLVWDVKEHRKAVTSFSLFEPGESLLSGSADKTIGVWQMVQRKLELIEVIATKEPIRKLDTYGKTIFASTQGHRMKVIDSSRTLKDIYRSKGIKSMSVVQGKIYIGCMDSSIQELAVSNNVEREIKAPFKSWRLQSKPINSLVVYKDWLYSASSSVEGSNIKEWRRHRKPQISIAPEKGTTIQAMAVVEDFIYLNYNSSASSLQIWLRGTQQKVGRISAGSKITSLLTANDIVLCGTETGLIKGWIPL

********************KPPGLEIIRALVVSINEFILEFITHVERWHALKLRCASKLNMKRKEFFEFSEHSILSNLYWGIDSIEAAIQAEWPEEKARRLCNSERLLQAPALLDEQEVTSGIPNCYLVSCAYFYLSVIKKLQEDELQVALHFLQALSVYPRLIGTEFAPELCKCLFPSLGLPKLQAMSGRKILESDETNGSDAMRLIARRYKHWLMYYQVLLHEETPQR************************************************KVHP*DPQ***********KACRKIPEIQEYGKDIKNLDEVPRLQLRTAGLRKKSSTKCLYDMLQESE**************************************VDRRPENFDQKLQAYCSSSGSESAKISFLRAPKRPMYKESNGTN**RNF**RFLSSSGHFNLSILELRDKISN***************QPSDCVLSSSPQQSCRFTE**Y******************ECLNGEKDAKSELLEIIEKAISSLFFSGDLRKCNKDYVVEVTTLYKMLNSKTGVKYDMLQDVILEQLLTAISASKEETVIRASVSILTTIILANESVIEDIKKKGLRLSDLATALKRNVPEAAILIYLIKPSPTEIKTLELLPTLVEVICTSKLYKGKLESVRLTPPAASLMIIEVLVTAFDYATNNMHLAAINSPRVLCGLLDVARHQNLEELISLATILVKCIQFDGQCRKYLSEFTAVAPLACLLQSGEKRAIMIALEFFHEILRIPRSSAIDLLQRIHKEGNINILHILKLSLQQLQSDYQLLAANLLLQLDTLENTTGKSVFTEEAMQVILKAVASEESSTMQLLSSFILSNIGGTFSWTGEPYTVAWLVKKAGLNSSWLQNMIRNFDWLDQSLQDRGVDSWSSKIAKSIIEIGKPIYYALEKGLKSKTKSVCRDSLTTIAWLSFEVSKSPNSVRHSACQILLDGVEQFLHPGLELEERLLACLCIYNYASGKGMQKLIRSSEGVRESLRRLSNVTWMAEELHKAADYYLPNISRISCVHTQILEASHKCSGAVTALIYYKGLLCSGFSDGSIKMWDIKKQSAMLVWDVKEHRKAVTSFSLFEPGESLLSGSADKTIGVWQMVQRKLELIEVIATKEPIRKLDTYGKTIFASTQGHRMKVIDSSRTLKDIYRSKGIKSMSVVQGKIYIGCMDSSIQELAVSNNVEREIKAPFKSWRLQSKPINSLVVYKDWLYSASSSVEGSNIKEWRRHRKPQISIAPEKGTTIQAMAVVEDFIYLNYNSSASSLQIWLRGTQQKVGRISAGSKITSLLTANDIVLCGTETGLIKGWIPL

ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST

Original result of BLAST against SWISS-PROT Database

ID	Alignment graph	Length	Definition	RBH(Q2H)	RBH(H2Q)	Q cover	H cover	Identity	E-value
Query		1349	2.2.26 [Sep-21-2011]
C6L7U1		1485	Putative E3 ubiquitin-pro	N/A	no	0.590	0.536	0.284	5e-75
D1FP57		1485	Putative E3 ubiquitin-pro	N/A	no	0.590	0.536	0.284	6e-72
D1FP53		1488	Putative E3 ubiquitin-pro	N/A	no	0.639	0.579	0.262	6e-66
P90648		732	Myosin heavy chain kinase	yes	no	0.164	0.303	0.271	1e-08
Q6FT96		711	Mitochondrial division pr	yes	no	0.071	0.136	0.291	1e-05
Q6DRF9		387	WD repeat-containing prot	yes	no	0.100	0.351	0.235	7e-05
A7TNS8		669	CCR4-associated factor 4	N/A	no	0.080	0.162	0.260	8e-05
P87177		922	Uncharacterized WD repeat	yes	no	0.065	0.095	0.333	0.0001
P36130		643	CCR4-associated factor 4	yes	no	0.078	0.164	0.267	0.0001
A6ZZZ8		645	CCR4-associated factor 4	N/A	no	0.078	0.164	0.267	0.0001

>sp\|C6L7U1\|LIN1_LOTJA Putative E3 ubiquitin-protein ligase LIN-1 OS=Lotus japonicus GN=CERBERUS PE=2 SV=2	Back alignment and function desciption

 Score =  284 bits (726), Expect = 5e-75,   Method: Compositional matrix adjust.
 Identities = 238/836 (28%), Positives = 434/836 (51%), Gaps = 40/836 (4%)

Query: 534  ISSLFFSGDLRKCNKDYVVEVTTLYKMLNSKTGVKYDMLQDVILEQLLTAISASKEETVI 593
            ISSL  S +L +C ++ V+++  L K   +   +   + +  I+  L+  +SAS+   V+
Sbjct: 664  ISSLCTSENLPEC-EEAVLKIARLLKDSKTNPQIHSYLSKPTIINGLVEILSASRNREVL 722

Query: 594  RASVSILTTIILANESVIEDIKKKGLRLSDLATALKRNVPEAAILIYLIKPSPTEIKTLE 653
            R S+ IL+ +I  ++SV E +         LAT LK  + EAA+LIY ++P   ++   E
Sbjct: 723  RTSIYILSELIFTDDSVAETLNSVDSDFDCLATLLKNGLAEAALLIYQLRPVFAQLSAHE 782

Query: 654  LLPTLVEVICTSKLYKGKLESVRLTPPAASLMIIEVLVTAFDYATNNMHLAAINSPRVLC 713
            L+P+LV+VI          + V + P  A++ I+E  +   D  + +++ +++ S   + 
Sbjct: 783  LIPSLVDVIQNKNEELDDFQLV-IDPKDAAIAILEQTLMGGDEYSRSLNASSVISANGIP 841

Query: 714  GLLDVARHQNLEELISLATILVKCIQFDGQCRKYLSEFTAVAPLACLLQSGEKRAIMIAL 773
             L  V   + +E   S+ ++L+ C+Q +  C+  ++    ++P+  L  SG        +
Sbjct: 842  TL--VKYLERMEGRRSVVSVLLCCMQAEKSCKNLIANRIELSPVLELFHSGNDSVRGTCV 899

Query: 774  EFFHEILRIPRSSAID-LLQRIHKEGNINILHILKLSLQQLQSDYQLLAANLLLQLDTLE 832
            EF  E++++ R ++ + +L  I  EG  + +H   + LQ    ++QL  A+LLLQLD L 
Sbjct: 900  EFLSELVQLNRRTSCNQILHTIKDEGAFSTMHTFLVYLQMAPMEHQLAVASLLLQLDLLA 959

Query: 833  NTTGKSVFTEEAMQVILKAVASEESSTMQLLSSFILSNIGGTFSWTGEPYTVAWLVKKAG 892
                 S++ EEA++ +++A+  ++ S  Q+ +   L  + G  S +G+ YT AWL+K AG
Sbjct: 960  EPRKMSIYREEAVETLIEALWQKDFSNTQMKALDALLFLIGHISSSGKSYTEAWLLKIAG 1019

Query: 893  LNSSW-----LQNMIRNFDWLDQSLQD--RGVDSWSSKIAKSII--EIGKPIYYALEKGL 943
             +  +     ++ + ++ + L ++++D    ++SW  +IA  +   E G  I+ ALE+ L
Sbjct: 1020 FDQPYNALMKVEQLGQHDNDLIETMEDEKNALNSWQKRIASVLCNHENGS-IFKALEECL 1078

Query: 944  KSKTKSVCRDSLTTIAWLSFEVSKSPNS-VRHSACQILLDGVEQFLHPGLELEERLLACL 1002
            KS +  + +  L    WL+  +   P++ VR  A + LL+ V   L     LEE++LA L
Sbjct: 1079 KSNSLKMAKSCLVLATWLTHMLYTLPDTGVRDVARKSLLEEVINVLQSSKNLEEKILATL 1138

Query: 1003 CIYNYASGKGMQKLIRS-SEGVRESLRRLSNVTWMAEELHKAADYYLPNISRISCVH--- 1058
             +  + S     + +R  ++ +  +LRRL   + +A ++ K     + N+  +       
Sbjct: 1139 ALKTFISDPSTHEALRVYAKSIYRTLRRLKKYSVVAVDIMKV----ILNLKSVDVTELWS 1194

Query: 1059 -TQILEASHKCSGAVTALIYYKGLLCSGFSDGSIKMWDIKKQSAMLVWDVKEHRKAVTSF 1117
              +++E     +G V +++Y  G + SG +DG+IK+WD +K+   ++ +  EH KAVT  
Sbjct: 1195 CKEVVELDLSSNGEVLSMVYLNGQVLSGHTDGTIKVWDARKRIPRVIQETHEHTKAVT-- 1252

Query: 1118 SLFEPGESLLSGSADKTIGVWQMVQRKLELIEVIATKEPIRKLDTYGKTIFASTQGHRMK 1177
            SL   G+ L SGS DKTI VW +    ++ I+V   KE + +L    K     +QG  +K
Sbjct: 1253 SLCSSGDRLYSGSLDKTIRVWTIKSDGIKCIDVYDIKEAVHELAANDKLACYVSQGTGVK 1312

Query: 1178 VIDSSRTLKDIYRSKGIKSMSVVQGKIYIGCMDSSIQELAVSNNVEREIKAPFKSWR--L 1235
            V + S   K I  SK +KS++V   K+Y GC   SIQE+ +S          F   R  L
Sbjct: 1313 VFNWSEAPKLINFSKYVKSLAVAGDKLYCGCSGYSIQEVDLSTYTSNSF---FTGTRKLL 1369

Query: 1236 QSKPINSLVVYKDWLYSASSSVEGSNIKEWRRHRKPQISIAPEKGTTIQAMAVVEDFIYL 1295
              + I+SL ++ D+L++  SSV+ +  K +   +K  +  +   G  I  +A+  DFI+ 
Sbjct: 1370 GKQTIHSLQIHDDYLFACGSSVDATAGKIFSLSQKMVVG-SLSTGLDIHRIAINSDFIFA 1428

Query: 1296 NYNSSASSLQIWLRGTQQKVGRIS-AG--SKITSLLTAND--IVLCGTETGLIKGW 1346
               +   ++++WL+    +V  I  AG  +KITSL++  D  ++  G+  G I+ W
Sbjct: 1429 --GTKFGTIEVWLKDKFTRVASIKMAGGHTKITSLVSDVDGMMLFVGSSDGKIQVW 1482

Putative E3 ubiquitin-protein ligase involved in the rhizobial infection process. Plays an important role in the early steps of infection thread formation and in growth and differentiation of nodules.
Lotus japonicus (taxid: 34305)
EC: 6EC: .EC: 3EC: .EC: 2EC: .EC: -

>sp\|D1FP57\|LIN2_LOTJA Putative E3 ubiquitin-protein ligase LIN-2 OS=Lotus japonicus GN=LIN PE=1 SV=1	Back alignment and function description

>sp\|D1FP53\|LIN_MEDTR Putative E3 ubiquitin-protein ligase LIN OS=Medicago truncatula GN=LIN PE=2 SV=1	Back alignment and function description

>sp\|P90648\|MHCKB_DICDI Myosin heavy chain kinase B OS=Dictyostelium discoideum GN=mhkB PE=2 SV=1	Back alignment and function description

>sp\|Q6FT96\|MDV1_CANGA Mitochondrial division protein 1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=MDV1 PE=3 SV=1	Back alignment and function description

>sp\|Q6DRF9\|WDR55_DANRE WD repeat-containing protein 55 OS=Danio rerio GN=wdr55 PE=2 SV=2	Back alignment and function description

>sp\|A7TNS8\|CAF4_VANPO CCR4-associated factor 4 homolog OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=CAF4 PE=3 SV=1	Back alignment and function description

>sp\|P87177\|YB1C_SCHPO Uncharacterized WD repeat-containing protein C3D6.12 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC3D6.12 PE=1 SV=1	Back alignment and function description

>sp\|P36130\|CAF4_YEAST CCR4-associated factor 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CAF4 PE=1 SV=3	Back alignment and function description

>sp\|A6ZZZ8\|CAF4_YEAS7 CCR4-associated factor 4 OS=Saccharomyces cerevisiae (strain YJM789) GN=CAF4 PE=3 SV=2	Back alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST

Original result of BLAST against Nonredundant Database

GI	Alignment Graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		1349
359477261		1339	PREDICTED: putative E3 ubiquitin-protein	0.972	0.979	0.599	0.0
255551783		1357	nucleotide binding protein, putative [Ri	0.976	0.970	0.600	0.0
147796407		1378	hypothetical protein VITISV_010257 [Viti	0.967	0.947	0.599	0.0
296083364		1274	unnamed protein product [Vitis vinifera]	0.928	0.982	0.586	0.0
224130530		1305	predicted protein [Populus trichocarpa]	0.952	0.984	0.585	0.0
356558169		1302	PREDICTED: uncharacterized protein LOC10	0.951	0.985	0.538	0.0
449432864		1339	PREDICTED: putative E3 ubiquitin-protein	0.960	0.967	0.549	0.0
449515345		1313	PREDICTED: putative E3 ubiquitin-protein	0.942	0.968	0.546	0.0
334185156		1264	transducin/WD-40 repeat-containing prote	0.927	0.989	0.503	0.0
334185154		1261	transducin/WD-40 repeat-containing prote	0.922	0.987	0.501	0.0

>gi\|359477261\|ref\|XP_002269707.2\| PREDICTED: putative E3 ubiquitin-protein ligase LIN-1-like [Vitis vinifera]	Back alignment and taxonomy information

 Score = 1543 bits (3994), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 807/1346 (59%), Positives = 1014/1346 (75%), Gaps = 34/1346 (2%)

Query: 17   HDHEKPPGLEIIRALVVSINEFILEFITHVERWHALKLRCASKLNMKRKEFFEFSEHSIL 76
            HDHE+   L+ IRALVVS+N  I EF+ + E   +LKLRC+ KL ++++EFFEFSEHS++
Sbjct: 15   HDHERL-DLQSIRALVVSVNHHIHEFLANNETRKSLKLRCSLKLRIQKQEFFEFSEHSVI 73

Query: 77   SNLYWGIDSIEAAIQAEWPEEKARRLCNSERLLQAPALLDEQEVTSGIPNCYLVSCAYFY 136
            SNLYWGI+S+EAAI+A+WPEEK  RL NSE++LQ PALLDEQ  T GI N Y+V C+YFY
Sbjct: 74   SNLYWGIESVEAAIRAKWPEEKTSRLKNSEQMLQVPALLDEQGTTGGISNRYIVCCSYFY 133

Query: 137  LSVIKKLQEDELQVALHFLQALSVYPRLIGTEFAPELCKCLFPSLGLPKLQAMSGRK--- 193
            LS+++KLQ DE QVALHFLQAL V PRLI TEFAP LC+ LF +  + + Q + GR    
Sbjct: 134  LSIVRKLQRDEWQVALHFLQALMVSPRLIQTEFAPGLCENLFLTHSISERQNVGGRSFRS 193

Query: 194  --ILESDETNGSDAMRLIARRYKHWLMYYQVLLHEETPQRHCGYREVSSSAVEAQFHTHE 251
              ++ SDE    +A+R  A+RYK WLMYYQV+ + ETPQR  GY ++ S   ++ +++  
Sbjct: 194  VSLMNSDEGKPGEAIRETAKRYKSWLMYYQVMQYGETPQRPGGYNDILSPVDQSPYNS-- 251

Query: 252  IRGRSESSSSIEHVPKLQTSSNKLMLYAKVHPLDPQEDVTNDTTVGTKACRKIPEIQEYG 311
            + G+S S+ S   +    TS      + KVHPLDPQE + + T    KA R   EIQ+Y 
Sbjct: 252  MYGKSSSTKSSSSIAHGNTSLQTYRNFQKVHPLDPQESIIDSTGDKAKASRDNTEIQDYR 311

Query: 312  KDIKNLDEVPRLQLRTAGLRKKSSTKCLYDMLQESESDRSTTVGSCSTEIEEESDSEANM 371
            K + N D+V R       +++ S+ KCL D+L ES+SD  T+  S       + DSEA  
Sbjct: 312  KALNNSDQVSR-----QDIKRSSNIKCLQDILMESQSDTPTSDDSFDDNDSADGDSEAYA 366

Query: 372  GIVKSLIANEGTSAVDRRPENFDQKLQAYCSSSGSESAKISFLRAPKRPMYKESNGTNSN 431
               +S +      A   R E  DQ+ Q  C  S S             P+++E N  N  
Sbjct: 367  DETQSSMEAARIKADQGRMEISDQRFQNSCCISTSFP-----------PLHEEINEANIK 415

Query: 432  RNFSRRFLSSSGHFNLSILELRDKISNG--SCHVEGKISKQHKVQPSDC----VLSSSPQ 485
            + FS RF  S    NLSILEL  + S+   SCH + + + + +++P D      L+++  
Sbjct: 416  KLFSGRFSRSLNDLNLSILELGVEKSHTLWSCHAQEETTWR-RLEPDDFQILDCLAATSL 474

Query: 486  QSCRFTEMDY-RGSSERKK-NSSGRKKFNEECLNGEKDAKSELLEIIEKAISSLFFSGDL 543
            Q+  F +M++ +G+  RKK NSS RK  +E CL+ EKD+  ELL  ++KAIS L+FS   
Sbjct: 475  QNYMFAQMEHNQGNGARKKHNSSRRKNLHEVCLHPEKDSHGELLRALDKAISKLWFSEGQ 534

Query: 544  RKCNKDYVVEVTTLYKMLNSKTGVKYDMLQDVILEQLLTAISASKEETVIRASVSILTTI 603
             K ++D  VEVTT+Y+ML +KTGVKY +L+D IL+QLL++IS SK+E ++RASVSIL TI
Sbjct: 535  GKYDEDSSVEVTTIYEMLTNKTGVKYTLLKDAILDQLLSSISTSKKEGIVRASVSILLTI 594

Query: 604  ILANESVIEDIKKKGLRLSDLATALKRNVPEAAILIYLIKPSPTEIKTLELLPTLVEVIC 663
            I  N+SVI+DIKKKGL+L  LA ALKRNV EAA LIYLI PSPTEIKTLELLPTL+ V+C
Sbjct: 595  IAGNKSVIDDIKKKGLQLGHLANALKRNVYEAATLIYLINPSPTEIKTLELLPTLMNVVC 654

Query: 664  TSKLYKGKLESVRLTPPAASLMIIEVLVTAFDYATNNMHLAAINSPRVLCGLLDVARHQN 723
            TS  Y G   S+  TPPAASLMIIE L+ AFDYATN+MHLA I+SP+VL GLLDVAR+ N
Sbjct: 655  TSNNYAGGPASLP-TPPAASLMIIEALIAAFDYATNSMHLAEISSPQVLSGLLDVARNNN 713

Query: 724  LEELISLATILVKCIQFDGQCRKYLSEFTAVAPLACLLQSGEKRAIMIALEFFHEILRIP 783
            LEELI LATILVKC+QFDGQCR Y+S+FT +AP   LL+S ++R  +IALEFFHEILR+P
Sbjct: 714  LEELIPLATILVKCMQFDGQCRNYISQFTPMAPFIYLLRSNKRRVKLIALEFFHEILRMP 773

Query: 784  RSSAIDLLQRIHKEGNINILHILKLSLQQLQSDYQLLAANLLLQLDTLENTTGKSVFTEE 843
            RSSAI +LQ++ KEG+INI+HIL   LQQ Q+++QLLAANLLLQLD LE+++G+S+F EE
Sbjct: 774  RSSAISVLQQMKKEGSINIMHILLPCLQQSQAEHQLLAANLLLQLDQLEDSSGRSMFREE 833

Query: 844  AMQVILKAVASEESSTMQLLSSFILSNIGGTFSWTGEPYTVAWLVKKAGLNSSWLQNMIR 903
            AM+V+L+++  EE+S  Q+LS+FILSN+GGT+SWTGEPYTVAWLVKKAGL S + +NMIR
Sbjct: 834  AMEVLLESMVCEENSATQILSAFILSNLGGTYSWTGEPYTVAWLVKKAGLTSLYHRNMIR 893

Query: 904  NFDWLDQSLQDRGVDSWSSKIAKSIIEIGKPIYYALEKGLKSKTKSVCRDSLTTIAWLSF 963
            NFDWLDQSLQD G D+W SKI +SII+ G P+++ALEKGLKSK + V RD LT IAWL +
Sbjct: 894  NFDWLDQSLQDTGTDTWCSKIGRSIIKGGIPLFHALEKGLKSKVRRVSRDCLTAIAWLGY 953

Query: 964  EVSKSPNSVRHSACQILLDGVEQFLHPGLELEERLLACLCIYNYASGKGMQKLIRSSEGV 1023
            E++ +PN +R+SAC+ILL G+EQFLHPGL+LEERLLACLCIYNY SGKGMQKLI  SEGV
Sbjct: 954  EIATTPNELRYSACEILLSGIEQFLHPGLDLEERLLACLCIYNYTSGKGMQKLIHFSEGV 1013

Query: 1024 RESLRRLSNVTWMAEELHKAADYYLPNISRISCVHTQILEASHKCSGAVTALIYYKGLLC 1083
            RESL RLSN+TWMAEEL K ADY+LP  S ISCVHTQILE   KCSGAVTALIYY+G LC
Sbjct: 1014 RESLGRLSNITWMAEELLKIADYFLPYKSHISCVHTQILEMGRKCSGAVTALIYYRGQLC 1073

Query: 1084 SGFSDGSIKMWDIKKQSAMLVWDVKEHRKAVTSFSLFEPGESLLSGSADKTIGVWQMVQR 1143
            SG+SDGSIK+WDIK QSA LV D+KEHRKAVT FS FEPG+SLLSGSADKTI VWQMV+R
Sbjct: 1074 SGYSDGSIKVWDIKGQSATLVLDIKEHRKAVTCFSHFEPGDSLLSGSADKTIRVWQMVKR 1133

Query: 1144 KLELIEVIATKEPIRKLDTYGKTIFASTQGHRMKVIDSSRTLKDIYRSKGIKSMSVVQGK 1203
            K+E  EVI+TKEP++ LDT+G+ IF  T GH +KV D+SR +KDI +SK +K + VVQG+
Sbjct: 1134 KMECTEVISTKEPVQNLDTHGQLIFTVTHGHGVKVFDASRKVKDICKSKHVKCVRVVQGR 1193

Query: 1204 IYIGCMDSSIQELAVSNNVEREIKAPFKSWRLQSKPINSLVVYKDWLYSASSSVEGSNIK 1263
            +YIGCMDSSIQE+ ++   E+EI+AP KSWR+Q++PINS+VVYKDWLYSAS  VEGSN K
Sbjct: 1194 LYIGCMDSSIQEVVITRAREQEIRAPAKSWRMQNRPINSIVVYKDWLYSASDIVEGSNFK 1253

Query: 1264 EWRRHRKPQISIAPEKGTTIQAMAVVEDFIYLNYNSSASSLQIWLRGTQQKVGRISAGSK 1323
            EW+RH KPQ+S+ P+KG ++ AM +VEDFIYLN +SS S LQIWLRGTQQK GR+SAGS+
Sbjct: 1254 EWKRHSKPQMSMVPDKGASVLAMGIVEDFIYLNCSSSTSILQIWLRGTQQKAGRLSAGSR 1313

Query: 1324 ITSLLTANDIVLCGTETGLIKGWIPL 1349
            ITSLLTANDIVLCGTE GLIKGWIPL
Sbjct: 1314 ITSLLTANDIVLCGTEMGLIKGWIPL 1339

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi\|255551783\|ref\|XP_002516937.1\| nucleotide binding protein, putative [Ricinus communis] gi\|223544025\|gb\|EEF45551.1\| nucleotide binding protein, putative [Ricinus communis]	Back alignment and taxonomy information

>gi\|147796407\|emb\|CAN65866.1\| hypothetical protein VITISV_010257 [Vitis vinifera]	Back alignment and taxonomy information

>gi\|296083364\|emb\|CBI23000.3\| unnamed protein product [Vitis vinifera]	Back alignment and taxonomy information

>gi\|224130530\|ref\|XP_002328632.1\| predicted protein [Populus trichocarpa] gi\|222838614\|gb\|EEE76979.1\| predicted protein [Populus trichocarpa]	Back alignment and taxonomy information

>gi\|356558169\|ref\|XP_003547380.1\| PREDICTED: uncharacterized protein LOC100782870 [Glycine max]	Back alignment and taxonomy information

>gi\|449432864\|ref\|XP_004134218.1\| PREDICTED: putative E3 ubiquitin-protein ligase LIN-1-like [Cucumis sativus]	Back alignment and taxonomy information

>gi\|449515345\|ref\|XP_004164710.1\| PREDICTED: putative E3 ubiquitin-protein ligase LIN-1-like, partial [Cucumis sativus]	Back alignment and taxonomy information

>gi\|334185156\|ref\|NP_001189833.1\| transducin/WD-40 repeat-containing protein [Arabidopsis thaliana] gi\|332640951\|gb\|AEE74472.1\| transducin/WD-40 repeat-containing protein [Arabidopsis thaliana]	Back alignment and taxonomy information

>gi\|334185154\|ref\|NP_187344.5\| transducin/WD-40 repeat-containing protein [Arabidopsis thaliana] gi\|332640950\|gb\|AEE74471.1\| transducin/WD-40 repeat-containing protein [Arabidopsis thaliana]	Back alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST

Original result of BLAST against Gene Ontology (AMIGO)

ID	Alignment graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		1349
DICTYBASE\|DDB_G0289115		732	mhkB "myosin heavy chain kinas	0.199	0.367	0.268	2.9e-08
TAIR\|locus:2148965		876	TOZ "AT5G16750" [Arabidopsis t	0.200	0.308	0.243	3.3e-06
ZFIN\|ZDB-GENE-030131-8414		368	pak1ip1 "PAK1 interacting prot	0.140	0.513	0.243	6e-05
TAIR\|locus:2089855		955	AT3G21540 "AT3G21540" [Arabido	0.059	0.083	0.367	0.00012
TAIR\|locus:2032452		415	AT1G24130 "AT1G24130" [Arabido	0.209	0.681	0.231	0.00016
UNIPROTKB\|Q9NWT1		392	PAK1IP1 "p21-activated protein	0.141	0.487	0.243	0.00018
RGD\|1565353		382	Pak1ip1 "PAK1 interacting prot	0.060	0.212	0.380	0.00023
SGD\|S000001744		643	CAF4 "WD40 repeat-containing p	0.078	0.164	0.276	0.00024
UNIPROTKB\|F1NWB8		367	PAK1IP1 "p21-activated protein	0.106	0.389	0.265	0.00058
UNIPROTKB\|Q5ZKU8		369	PAK1IP1 "p21-activated protein	0.106	0.387	0.265	0.00058

DICTYBASE\|DDB_G0289115 mhkB "myosin heavy chain kinase B" [Dictyostelium discoideum (taxid:44689)]	Back alignment and assigned GO terms

 Score = 177 (67.4 bits), Expect = 2.9e-08, Sum P(2) = 2.9e-08
 Identities = 81/302 (26%), Positives = 139/302 (46%)

Query:  1015 KLIRSSEG--VRESLRRLSNV--TWMAEELHKAADYYLPNISRISCVHTQILEASHKCSG 1070
             KLI + +G  V   L    N+  T  ++   +  DY   N+    CV T  L+  H+  G
Sbjct:   452 KLIETIKGYHVTSHLCICDNLLFTGCSDNSIRVYDYKSQNME---CVQT--LKG-HE--G 503

Query:  1071 AVTALIYYKGLLCSGFSDGSIKMWDIKKQSAMLVWDVKEHRKAVTSFSLFEPGESLLSGS 1130
              V ++ Y    L SG SD SIK+WD+KK     ++ ++ H K V +  L +  + L SGS
Sbjct:   504 PVESICYNDQYLFSGSSDHSIKVWDLKKLRC--IFTLEGHDKPVHTVLLND--KYLFSGS 559

Query:  1131 ADKTIGVWQMVQRKLELIEVIATK-EPIRKLDTYGKTIFASTQGHRMKVIDSSRTLKDIY 1189
             +DKTI VW +  + LE    + +    ++ L   G+ +F+ +    +KV D  +T +  Y
Sbjct:   560 SDKTIKVWDL--KTLECKYTLESHARAVKTLCISGQYLFSGSNDKTIKVWDL-KTFRCNY 616

Query:  1190 RSKG----IKSMSVVQGKIYIGCMDSSIQELAVSNNVEREIKAPFKSWRLQSKPINSLVV 1245
               KG    + ++ ++   +Y G  D +I+   V N    E  A  +      + +  +V+
Sbjct:   617 TLKGHTKWVTTICILGTNLYSGSYDKTIR---VWNLKSLECSATLRG---HDRWVEHMVI 670

Query:  1246 YKDWLYSASSSVEGSNIKEWRRHRKPQISIAPEKGTTIQAMAVVEDFIYLNYNSSASSLQ 1305
                 L++AS   + + IK W        +       T+Q +AV ED   +   S   S++
Sbjct:   671 CDKLLFTAS---DDNTIKIWDLETLRCNTTLEGHNATVQCLAVWEDKKCVISCSHDQSIR 727

Query:  1306 IW 1307
             +W
Sbjct:   728 VW 729

GO:0018107 "peptidyl-threonine phosphorylation" evidence=IDA

GO:0031037 "myosin II filament disassembly" evidence=IMP

GO:0005826 "actomyosin contractile ring" evidence=IDA

GO:0005737 "cytoplasm" evidence=IDA

GO:0000910 "cytokinesis" evidence=IMP

GO:0046777 "protein autophosphorylation" evidence=IDA

GO:0045159 "myosin II binding" evidence=IPI

GO:0005524 "ATP binding" evidence=IEA;IC

GO:0004674 "protein serine/threonine kinase activity" evidence=IEA;IDA

GO:0016905 "myosin heavy chain kinase activity" evidence=IEA;IDA

GO:0016772 "transferase activity, transferring phosphorus-containing groups" evidence=IEA

GO:0006468 "protein phosphorylation" evidence=IEA

GO:0016740 "transferase activity" evidence=IEA

GO:0016310 "phosphorylation" evidence=IEA

GO:0016301 "kinase activity" evidence=IEA

GO:0000166 "nucleotide binding" evidence=IEA

TAIR\|locus:2148965 TOZ "AT5G16750" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

ZFIN\|ZDB-GENE-030131-8414 pak1ip1 "PAK1 interacting protein 1" [Danio rerio (taxid:7955)]	Back alignment and assigned GO terms

TAIR\|locus:2089855 AT3G21540 "AT3G21540" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2032452 AT1G24130 "AT1G24130" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

UNIPROTKB\|Q9NWT1 PAK1IP1 "p21-activated protein kinase-interacting protein 1" [Homo sapiens (taxid:9606)]	Back alignment and assigned GO terms

RGD\|1565353 Pak1ip1 "PAK1 interacting protein 1" [Rattus norvegicus (taxid:10116)]	Back alignment and assigned GO terms

SGD\|S000001744 CAF4 "WD40 repeat-containing protein associated with the CCR4-NOT complex" [Saccharomyces cerevisiae (taxid:4932)]	Back alignment and assigned GO terms

UNIPROTKB\|F1NWB8 PAK1IP1 "p21-activated protein kinase-interacting protein 1-like" [Gallus gallus (taxid:9031)]	Back alignment and assigned GO terms

UNIPROTKB\|Q5ZKU8 PAK1IP1 "p21-activated protein kinase-interacting protein 1-like" [Gallus gallus (taxid:9031)]	Back alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING

Original result from the STRING server

Your Input:
	fgenesh4_pg.C_scaffold_77000121	hypothetical protein (1305 aa)
		(Populus trichocarpa)
Predicted Functional Partners:
		Sorry, there are no predicted associations at the current settings.

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST

Original result of RPS-BLAST against CDD database part I

ID	Alignment Graph	Length	Definition	E-value
Query		1349
cd00200		289	cd00200, WD40, WD40 domain, found in a number of e	4e-09
cd00200		289	cd00200, WD40, WD40 domain, found in a number of e	4e-07
cd00200		289	cd00200, WD40, WD40 domain, found in a number of e	2e-06
COG2319		466	COG2319, COG2319, FOG: WD40 repeat [General functi	1e-04
COG2319		466	COG2319, COG2319, FOG: WD40 repeat [General functi	2e-04

>gnl|CDD|238121 cd00200, WD40, WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and bottom surface of the propeller are proposed to coordinate interactions with other proteins and/or small ligands; 7 copies of the repeat are present in this alignment

Back alignment and domain information

 Score = 58.9 bits (143), Expect = 4e-09
 Identities = 52/234 (22%), Positives = 86/234 (36%), Gaps = 41/234 (17%)

Query: 1081 LLCSGFSDGSIKMWDIKKQSAMLVWDVKEHRKAVTSFSLFEPGESLLSGSADKTIGVWQM 1140
             L SG SD +I++WD++      V  +  H   V+S +    G  L S S DKTI VW +
Sbjct: 65   YLASGSSDKTIRLWDLETGE--CVRTLTGHTSYVSSVAFSPDGRILSSSSRDKTIKVWDV 122

Query: 1141 VQRKLELIEVIATKEPIR--KLDTYGKTIFASTQGHRMKVIDSSRTLKDIYRSKG----I 1194
               K  L  +    + +        G  + +S+Q   +K+ D  RT K +    G    +
Sbjct: 123  ETGKC-LTTLRGHTDWVNSVAFSPDGTFVASSSQDGTIKLWD-LRTGKCVATLTGHTGEV 180

Query: 1195 KSMSVV--QGKIYIGCMDSSIQELAVSNNVEREIKAPFKSWRLQS-----------KPIN 1241
             S++      K+     D +I                 K W L +             +N
Sbjct: 181  NSVAFSPDGEKLLSSSSDGTI-----------------KLWDLSTGKCLGTLRGHENGVN 223

Query: 1242 SLVVYKDWLYSASSSVEGSNIKEWRRHRKPQISIAPEKGTTIQAMAVVEDFIYL 1295
            S+    D    AS S +G+ I+ W       +        ++ ++A   D   L
Sbjct: 224  SVAFSPDGYLLASGSEDGT-IRVWDLRTGECVQTLSGHTNSVTSLAWSPDGKRL 276

Length = 289

Back alignment and domain information

>gnl\|CDD\|225201 COG2319, COG2319, FOG: WD40 repeat [General function prediction only]	Back alignment and domain information

>gnl\|CDD\|225201 COG2319, COG2319, FOG: WD40 repeat [General function prediction only]	Back alignment and domain information

Conserved Domains Detected by HHsearch

Original result of HHsearch against CDD database

ID	Alignment Graph	Length	Definition	Probability
Query		1349
KOG0271		480	consensus Notchless-like WD40 repeat-containing pr	100.0
KOG0272		459	consensus U4/U6 small nuclear ribonucleoprotein Pr	99.98
KOG0293		519	consensus WD40 repeat-containing protein [Function	99.97
KOG0286		343	consensus G-protein beta subunit [General function	99.96
KOG0279		315	consensus G protein beta subunit-like protein [Sig	99.96
KOG0281		499	consensus Beta-TrCP (transducin repeats containing	99.96
KOG0271		480	consensus Notchless-like WD40 repeat-containing pr	99.96
KOG0285		460	consensus Pleiotropic regulator 1 [RNA processing	99.96
KOG0319		775	consensus WD40-repeat-containing subunit of the 18	99.96
KOG0295		406	consensus WD40 repeat-containing protein [Function	99.96
KOG0315		311	consensus G-protein beta subunit-like protein (con	99.96
KOG0273		524	consensus Beta-transducin family (WD-40 repeat) pr	99.96
KOG0272		459	consensus U4/U6 small nuclear ribonucleoprotein Pr	99.95
cd00200		289	WD40 WD40 domain, found in a number of eukaryotic	99.95
KOG0315		311	consensus G-protein beta subunit-like protein (con	99.95
KOG0265		338	consensus U5 snRNP-specific protein-like factor an	99.95
KOG0282		503	consensus mRNA splicing factor [Function unknown]	99.95
KOG0263		707	consensus Transcription initiation factor TFIID, s	99.94
KOG0286		343	consensus G-protein beta subunit [General function	99.94
KOG0313		423	consensus Microtubule binding protein YTM1 (contai	99.94
KOG0284		464	consensus Polyadenylation factor I complex, subuni	99.94
KOG0276		794	consensus Vesicle coat complex COPI, beta' subunit	99.93
KOG0279		315	consensus G protein beta subunit-like protein [Sig	99.93
KOG0316		307	consensus Conserved WD40 repeat-containing protein	99.93
KOG0319		775	consensus WD40-repeat-containing subunit of the 18	99.93
KOG0273		524	consensus Beta-transducin family (WD-40 repeat) pr	99.93
PLN00181		793	protein SPA1-RELATED; Provisional	99.93
KOG0318		603	consensus WD40 repeat stress protein/actin interac	99.93
KOG0266		456	consensus WD40 repeat-containing protein [General	99.93
KOG0292		1202	consensus Vesicle coat complex COPI, alpha subunit	99.93
KOG0281		499	consensus Beta-TrCP (transducin repeats containing	99.92
KOG0274		537	consensus Cdc4 and related F-box and WD-40 protein	99.92
KOG0291		893	consensus WD40-repeat-containing subunit of the 18	99.92
KOG0296		399	consensus Angio-associated migratory cell protein	99.92
KOG0288		459	consensus WD40 repeat protein TipD [General functi	99.92
KOG0645		312	consensus WD40 repeat protein [General function pr	99.92
KOG0291		893	consensus WD40-repeat-containing subunit of the 18	99.91
KOG0263		707	consensus Transcription initiation factor TFIID, s	99.91
KOG0285		460	consensus Pleiotropic regulator 1 [RNA processing	99.91
KOG0278		334	consensus Serine/threonine kinase receptor-associa	99.9
KOG0295		406	consensus WD40 repeat-containing protein [Function	99.9
KOG0301		745	consensus Phospholipase A2-activating protein (con	99.9
KOG0306		888	consensus WD40-repeat-containing subunit of the 18	99.9
cd00200		289	WD40 WD40 domain, found in a number of eukaryotic	99.9
KOG0284		464	consensus Polyadenylation factor I complex, subuni	99.9
KOG1407		313	consensus WD40 repeat protein [Function unknown]	99.9
KOG0318		603	consensus WD40 repeat stress protein/actin interac	99.9
KOG0276		794	consensus Vesicle coat complex COPI, beta' subunit	99.9
KOG0274		537	consensus Cdc4 and related F-box and WD-40 protein	99.9
KOG0268		433	consensus Sof1-like rRNA processing protein (conta	99.89
KOG0292		1202	consensus Vesicle coat complex COPI, alpha subunit	99.89
PLN00181		793	protein SPA1-RELATED; Provisional	99.88
KOG0278		334	consensus Serine/threonine kinase receptor-associa	99.88
KOG0266		456	consensus WD40 repeat-containing protein [General	99.88
KOG0316		307	consensus Conserved WD40 repeat-containing protein	99.87
KOG0647		347	consensus mRNA export protein (contains WD40 repea	99.87
KOG0275		508	consensus Conserved WD40 repeat-containing protein	99.87
KOG0296		399	consensus Angio-associated migratory cell protein	99.87
KOG0306		888	consensus WD40-repeat-containing subunit of the 18	99.87
KOG1446		311	consensus Histone H3 (Lys4) methyltransferase comp	99.86
KOG0265		338	consensus U5 snRNP-specific protein-like factor an	99.86
KOG1036		323	consensus Mitotic spindle checkpoint protein BUB3,	99.86
KOG0645		312	consensus WD40 repeat protein [General function pr	99.86
KOG0282		503	consensus mRNA splicing factor [Function unknown]	99.86
KOG0277		311	consensus Peroxisomal targeting signal type 2 rece	99.86
KOG0293		519	consensus WD40 repeat-containing protein [Function	99.85
KOG0313		423	consensus Microtubule binding protein YTM1 (contai	99.85
KOG0283		712	consensus WD40 repeat-containing protein [Function	99.85
KOG0643		327	consensus Translation initiation factor 3, subunit	99.85
KOG0294		362	consensus WD40 repeat-containing protein [Function	99.85
KOG0305		484	consensus Anaphase promoting complex, Cdc20, Cdh1,	99.84
KOG0305		484	consensus Anaphase promoting complex, Cdc20, Cdh1,	99.84
KOG0310		487	consensus Conserved WD40 repeat-containing protein	99.84
KOG0772		641	consensus Uncharacterized conserved protein, conta	99.83
PTZ00420		568	coronin; Provisional	99.83
KOG0299		479	consensus U3 snoRNP-associated protein (contains W	99.83
KOG0277		311	consensus Peroxisomal targeting signal type 2 rece	99.83
KOG0640		430	consensus mRNA cleavage stimulating factor complex	99.83
KOG0289		506	consensus mRNA splicing factor [General function p	99.82
KOG1539		910	consensus WD repeat protein [General function pred	99.82
KOG0973		942	consensus Histone transcription regulator HIRA, WD	99.82
KOG0300		481	consensus WD40 repeat-containing protein [Function	99.82
PTZ00421		493	coronin; Provisional	99.82
KOG0283		712	consensus WD40 repeat-containing protein [Function	99.81
KOG0308		735	consensus Conserved WD40 repeat-containing protein	99.81
TIGR03866		300	PQQ_ABC_repeats PQQ-dependent catabolism-associate	99.81
KOG0288		459	consensus WD40 repeat protein TipD [General functi	99.81
KOG0310		487	consensus Conserved WD40 repeat-containing protein	99.8
KOG1408		1080	consensus WD40 repeat protein [Function unknown]	99.8
KOG0308		735	consensus Conserved WD40 repeat-containing protein	99.8
KOG0301		745	consensus Phospholipase A2-activating protein (con	99.8
PTZ00421		493	coronin; Provisional	99.8
KOG0641		350	consensus WD40 repeat protein [General function pr	99.79
KOG1407		313	consensus WD40 repeat protein [Function unknown]	99.78
KOG0643		327	consensus Translation initiation factor 3, subunit	99.78
KOG0264		422	consensus Nucleosome remodeling factor, subunit CA	99.78
PTZ00420		568	coronin; Provisional	99.78
KOG0275		508	consensus Conserved WD40 repeat-containing protein	99.78
KOG2106		626	consensus Uncharacterized conserved protein, conta	99.78
KOG0650		733	consensus WD40 repeat nucleolar protein Bop1, invo	99.78
KOG0300		481	consensus WD40 repeat-containing protein [Function	99.77
KOG0294		362	consensus WD40 repeat-containing protein [Function	99.77
KOG0299		479	consensus U3 snoRNP-associated protein (contains W	99.77
KOG1332		299	consensus Vesicle coat complex COPII, subunit SEC1	99.77
KOG1446		311	consensus Histone H3 (Lys4) methyltransferase comp	99.75
KOG0772		641	consensus Uncharacterized conserved protein, conta	99.75
KOG0289		506	consensus mRNA splicing factor [General function p	99.75
KOG1539		910	consensus WD repeat protein [General function pred	99.74
KOG2048		691	consensus WD40 repeat protein [General function pr	99.74
TIGR03866		300	PQQ_ABC_repeats PQQ-dependent catabolism-associate	99.74
KOG2055		514	consensus WD40 repeat protein [General function pr	99.73
KOG2096		420	consensus WD40 repeat protein [General function pr	99.73
KOG0647		347	consensus mRNA export protein (contains WD40 repea	99.72
KOG1274		933	consensus WD40 repeat protein [General function pr	99.72
KOG1063		764	consensus RNA polymerase II elongator complex, sub	99.72
KOG0646		476	consensus WD40 repeat protein [General function pr	99.71
KOG0268		433	consensus Sof1-like rRNA processing protein (conta	99.71
KOG1036		323	consensus Mitotic spindle checkpoint protein BUB3,	99.71
KOG0973		942	consensus Histone transcription regulator HIRA, WD	99.71
KOG1274		933	consensus WD40 repeat protein [General function pr	99.71
KOG2445		361	consensus Nuclear pore complex component (sc Seh1)	99.71
KOG1332		299	consensus Vesicle coat complex COPII, subunit SEC1	99.71
KOG0646		476	consensus WD40 repeat protein [General function pr	99.71
KOG0639		705	consensus Transducin-like enhancer of split protei	99.71
KOG0321		720	consensus WD40 repeat-containing protein L2DTL [Fu	99.71
KOG0640		430	consensus mRNA cleavage stimulating factor complex	99.71
KOG1273		405	consensus WD40 repeat protein [General function pr	99.68
KOG0641		350	consensus WD40 repeat protein [General function pr	99.68
KOG4328		498	consensus WD40 protein [Function unknown]	99.68
KOG0270		463	consensus WD40 repeat-containing protein [Function	99.67
KOG2106		626	consensus Uncharacterized conserved protein, conta	99.67
KOG0321		720	consensus WD40 repeat-containing protein L2DTL [Fu	99.67
KOG0269		839	consensus WD40 repeat-containing protein [Function	99.66
KOG1408		1080	consensus WD40 repeat protein [Function unknown]	99.66
KOG4283		397	consensus Transcription-coupled repair protein CSA	99.66
KOG0269		839	consensus WD40 repeat-containing protein [Function	99.66
KOG0267		825	consensus Microtubule severing protein katanin p80	99.66
KOG0264		422	consensus Nucleosome remodeling factor, subunit CA	99.65
KOG0302		440	consensus Ribosome Assembly protein [General funct	99.65
KOG0642		577	consensus Cell-cycle nuclear protein, contains WD-	99.65
KOG0267		825	consensus Microtubule severing protein katanin p80	99.62
KOG2096		420	consensus WD40 repeat protein [General function pr	99.61
KOG4378		673	consensus Nuclear protein COP1 [Signal transductio	99.61
KOG0307		1049	consensus Vesicle coat complex COPII, subunit SEC3	99.6
COG2319		466	FOG: WD40 repeat [General function prediction only	99.6
KOG1538		1081	consensus Uncharacterized conserved protein WDR10,	99.59
KOG0322		323	consensus G-protein beta subunit-like protein GNB1	99.59
KOG4283		397	consensus Transcription-coupled repair protein CSA	99.58
KOG2048		691	consensus WD40 repeat protein [General function pr	99.57
KOG1063		764	consensus RNA polymerase II elongator complex, sub	99.57
KOG4378		673	consensus Nuclear protein COP1 [Signal transductio	99.57
KOG1188		376	consensus WD40 repeat protein [General function pr	99.56
KOG0639		705	consensus Transducin-like enhancer of split protei	99.56
COG2319		466	FOG: WD40 repeat [General function prediction only	99.55
KOG4328		498	consensus WD40 protein [Function unknown]	99.54
KOG1034		385	consensus Transcriptional repressor EED/ESC/FIE, r	99.54
KOG0644		1113	consensus Uncharacterized conserved protein, conta	99.53
KOG1007		370	consensus WD repeat protein TSSC1, WD repeat super	99.52
KOG0270		463	consensus WD40 repeat-containing protein [Function	99.52
KOG1517		1387	consensus Guanine nucleotide binding protein MIP1	99.5
KOG1517		1387	consensus Guanine nucleotide binding protein MIP1	99.5
KOG1240		1431	consensus Protein kinase containing WD40 repeats [	99.5
PRK11028		330	6-phosphogluconolactonase; Provisional	99.5
KOG1587		555	consensus Cytoplasmic dynein intermediate chain [C	99.49
KOG2919		406	consensus Guanine nucleotide-binding protein [Gene	99.49
KOG0650		733	consensus WD40 repeat nucleolar protein Bop1, invo	99.48
KOG0302		440	consensus Ribosome Assembly protein [General funct	99.48
KOG2055		514	consensus WD40 repeat protein [General function pr	99.47
KOG0290		364	consensus Conserved WD40 repeat-containing protein	99.45
KOG0649		325	consensus WD40 repeat protein [General function pr	99.45
KOG0649		325	consensus WD40 repeat protein [General function pr	99.44
KOG1334		559	consensus WD40 repeat protein [General function pr	99.44
KOG4227		609	consensus WD40 repeat protein [General function pr	99.43
KOG2110		391	consensus Uncharacterized conserved protein, conta	99.43
KOG1188		376	consensus WD40 repeat protein [General function pr	99.42
KOG1009		434	consensus Chromatin assembly complex 1 subunit B/C	99.39
KOG2919		406	consensus Guanine nucleotide-binding protein [Gene	99.38
KOG0303		472	consensus Actin-binding protein Coronin, contains	99.38
KOG2445		361	consensus Nuclear pore complex component (sc Seh1)	99.37
KOG1034		385	consensus Transcriptional repressor EED/ESC/FIE, r	99.37
KOG1240		1431	consensus Protein kinase containing WD40 repeats [	99.36
KOG1445		1012	consensus Tumor-specific antigen (contains WD repe	99.36
KOG0642		577	consensus Cell-cycle nuclear protein, contains WD-	99.36
KOG1273		405	consensus WD40 repeat protein [General function pr	99.36
KOG1587		555	consensus Cytoplasmic dynein intermediate chain [C	99.35
KOG1009		434	consensus Chromatin assembly complex 1 subunit B/C	99.29
KOG1963		792	consensus WD40 repeat protein [General function pr	99.27
KOG1272		545	consensus WD40-repeat-containing subunit of the 18	99.27
KOG0644		1113	consensus Uncharacterized conserved protein, conta	99.27
KOG0307		1049	consensus Vesicle coat complex COPII, subunit SEC3	99.26
PRK11028		330	6-phosphogluconolactonase; Provisional	99.26
KOG3881		412	consensus Uncharacterized conserved protein [Funct	99.25
KOG1310		758	consensus WD40 repeat protein [General function pr	99.25
KOG1538		1081	consensus Uncharacterized conserved protein WDR10,	99.25
PRK01742		429	tolB translocation protein TolB; Provisional	99.25
KOG1445		1012	consensus Tumor-specific antigen (contains WD repe	99.22
KOG1523		361	consensus Actin-related protein Arp2/3 complex, su	99.21
KOG1007		370	consensus WD repeat protein TSSC1, WD repeat super	99.19
KOG0771		398	consensus Prolactin regulatory element-binding pro	99.19
KOG2111		346	consensus Uncharacterized conserved protein, conta	99.18
KOG0303		472	consensus Actin-binding protein Coronin, contains	99.16
KOG4227		609	consensus WD40 repeat protein [General function pr	99.16
KOG1963		792	consensus WD40 repeat protein [General function pr	99.14
KOG2394		636	consensus WD40 protein DMR-N9 [General function pr	99.12
KOG1334		559	consensus WD40 repeat protein [General function pr	99.1
KOG1524		737	consensus WD40 repeat-containing protein CHE-2 [Ge	99.1
KOG2110		391	consensus Uncharacterized conserved protein, conta	99.05
KOG1524		737	consensus WD40 repeat-containing protein CHE-2 [Ge	99.04
KOG2321		703	consensus WD40 repeat protein [General function pr	99.03
PRK03629		429	tolB translocation protein TolB; Provisional	99.03
KOG0290		364	consensus Conserved WD40 repeat-containing protein	98.99
KOG4497		447	consensus Uncharacterized conserved protein WDR8,	98.99
KOG2111		346	consensus Uncharacterized conserved protein, conta	98.99
PRK04922		433	tolB translocation protein TolB; Provisional	98.98
PRK01742		429	tolB translocation protein TolB; Provisional	98.98
PRK05137		435	tolB translocation protein TolB; Provisional	98.97
KOG0322		323	consensus G-protein beta subunit-like protein GNB1	98.97
TIGR03300		377	assembly_YfgL outer membrane assembly lipoprotein	98.95
PF02239		369	Cytochrom_D1: Cytochrome D1 heme domain; PDB: 1NNO	98.94
KOG2321		703	consensus WD40 repeat protein [General function pr	98.92
KOG3881		412	consensus Uncharacterized conserved protein [Funct	98.88
PRK02889		427	tolB translocation protein TolB; Provisional	98.87
KOG1354		433	consensus Serine/threonine protein phosphatase 2A,	98.85
KOG0771		398	consensus Prolactin regulatory element-binding pro	98.84
TIGR03300		377	assembly_YfgL outer membrane assembly lipoprotein	98.83
KOG1310		758	consensus WD40 repeat protein [General function pr	98.82
KOG2041		1189	consensus WD40 repeat protein [General function pr	98.81
PRK04922		433	tolB translocation protein TolB; Provisional	98.81
PF10282		345	Lactonase: Lactonase, 7-bladed beta-propeller; Int	98.81
KOG1064		2439	consensus RAVE (regulator of V-ATPase assembly) co	98.75
PF02239		369	Cytochrom_D1: Cytochrome D1 heme domain; PDB: 1NNO	98.74
TIGR02800		417	propeller_TolB tol-pal system beta propeller repea	98.74
KOG0974		967	consensus WD-repeat protein WDR6, WD repeat superf	98.73
KOG2139		445	consensus WD40 repeat protein [General function pr	98.71
PF10282		345	Lactonase: Lactonase, 7-bladed beta-propeller; Int	98.7
PRK03629		429	tolB translocation protein TolB; Provisional	98.69
KOG4547		541	consensus WD40 repeat-containing protein [General	98.69
KOG2315		566	consensus Predicted translation initiation factor	98.66
KOG4190		1034	consensus Uncharacterized conserved protein [Funct	98.65
PF08662		194	eIF2A: Eukaryotic translation initiation factor eI	98.65
KOG0974		967	consensus WD-repeat protein WDR6, WD repeat superf	98.65
PRK00178		430	tolB translocation protein TolB; Provisional	98.64
KOG4547		541	consensus WD40 repeat-containing protein [General	98.64
TIGR02658		352	TTQ_MADH_Hv methylamine dehydrogenase heavy chain.	98.63
PRK11138		394	outer membrane biogenesis protein BamB; Provisiona	98.62
KOG1409		404	consensus Uncharacterized conserved protein, conta	98.61
PRK05137		435	tolB translocation protein TolB; Provisional	98.6
KOG1064		2439	consensus RAVE (regulator of V-ATPase assembly) co	98.6
KOG2139		445	consensus WD40 repeat protein [General function pr	98.59
PRK04792		448	tolB translocation protein TolB; Provisional	98.55
KOG2394		636	consensus WD40 protein DMR-N9 [General function pr	98.55
KOG1523		361	consensus Actin-related protein Arp2/3 complex, su	98.54
PRK02889		427	tolB translocation protein TolB; Provisional	98.54
KOG4497		447	consensus Uncharacterized conserved protein WDR8,	98.52
COG5170		460	CDC55 Serine/threonine protein phosphatase 2A, reg	98.49
KOG1409		404	consensus Uncharacterized conserved protein, conta	98.47
PF08662		194	eIF2A: Eukaryotic translation initiation factor eI	98.46
TIGR02658		352	TTQ_MADH_Hv methylamine dehydrogenase heavy chain.	98.45
KOG1272		545	consensus WD40-repeat-containing subunit of the 18	98.44
PF04762		928	IKI3: IKI3 family; InterPro: IPR006849 Members of	98.43
KOG0280		339	consensus Uncharacterized conserved protein [Amino	98.4
PRK01029		428	tolB translocation protein TolB; Provisional	98.4
TIGR02800		417	propeller_TolB tol-pal system beta propeller repea	98.36
PLN02919		1057	haloacid dehalogenase-like hydrolase family protei	98.35
KOG4714		319	consensus Nucleoporin [Nuclear structure]	98.33
COG2706		346	3-carboxymuconate cyclase [Carbohydrate transport	98.32
COG2706		346	3-carboxymuconate cyclase [Carbohydrate transport	98.27
PF13360		238	PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A	98.27
KOG2041		1189	consensus WD40 repeat protein [General function pr	98.26
PRK11138		394	outer membrane biogenesis protein BamB; Provisiona	98.25
PF13360		238	PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A	98.22
PRK04792		448	tolB translocation protein TolB; Provisional	98.2
PRK00178		430	tolB translocation protein TolB; Provisional	98.17
KOG0309		1081	consensus Conserved WD40 repeat-containing protein	98.09
COG5354		561	Uncharacterized protein, contains Trp-Asp (WD) rep	98.08
KOG4190		1034	consensus Uncharacterized conserved protein [Funct	98.05
KOG0280		339	consensus Uncharacterized conserved protein [Amino	98.02
KOG2315		566	consensus Predicted translation initiation factor	98.02
PF00400		39	WD40: WD domain, G-beta repeat; InterPro: IPR01978	98.01
KOG1912		1062	consensus WD40 repeat protein [General function pr	97.97
KOG0882		558	consensus Cyclophilin-related peptidyl-prolyl cis-	97.94
KOG4532		344	consensus WD40-like repeat containing protein [Gen	97.94
PF00400		39	WD40: WD domain, G-beta repeat; InterPro: IPR01978	97.93
KOG0309		1081	consensus Conserved WD40 repeat-containing protein	97.89
KOG2066		846	consensus Vacuolar assembly/sorting protein VPS41	97.89
COG4946		668	Uncharacterized protein related to the periplasmic	97.86
PF08450		246	SGL: SMP-30/Gluconolaconase/LRE-like region; Inter	97.86
KOG3914		390	consensus WD repeat protein WDR4 [Function unknown	97.86
KOG3914		390	consensus WD repeat protein WDR4 [Function unknown	97.83
PF15492		282	Nbas_N: Neuroblastoma-amplified sequence, N termin	97.82
KOG2695		425	consensus WD40 repeat protein [General function pr	97.82
KOG1920		1265	consensus IkappaB kinase complex, IKAP component [	97.82
PRK01029		428	tolB translocation protein TolB; Provisional	97.82
PLN02919		1057	haloacid dehalogenase-like hydrolase family protei	97.78
PRK04043		419	tolB translocation protein TolB; Provisional	97.76
KOG1832		1516	consensus HIV-1 Vpr-binding protein [Cell cycle co	97.73
PLN03200		2102	cellulose synthase-interactive protein; Provisiona	97.71
KOG2314		698	consensus Translation initiation factor 3, subunit	97.68
KOG1354		433	consensus Serine/threonine protein phosphatase 2A,	97.68
KOG2114		933	consensus Vacuolar assembly/sorting protein PEP5/V	97.66
COG4946		668	Uncharacterized protein related to the periplasmic	97.65
PF04762		928	IKI3: IKI3 family; InterPro: IPR006849 Members of	97.63
KOG1275		1118	consensus PAB-dependent poly(A) ribonuclease, subu	97.62
KOG4532		344	consensus WD40-like repeat containing protein [Gen	97.62
KOG4714		319	consensus Nucleoporin [Nuclear structure]	97.57
PF00780		275	CNH: CNH domain; InterPro: IPR001180 Based on sequ	97.57
COG5354		561	Uncharacterized protein, contains Trp-Asp (WD) rep	97.51
cd00216		488	PQQ_DH Dehydrogenases with pyrrolo-quinoline quino	97.47
KOG1832		1516	consensus HIV-1 Vpr-binding protein [Cell cycle co	97.43
PF07433		305	DUF1513: Protein of unknown function (DUF1513); In	97.43
cd00216		488	PQQ_DH Dehydrogenases with pyrrolo-quinoline quino	97.35
KOG3617		1416	consensus WD40 and TPR repeat-containing protein [	97.35
KOG2695		425	consensus WD40 repeat protein [General function pr	97.35
KOG1912		1062	consensus WD40 repeat protein [General function pr	97.34
KOG1645		463	consensus RING-finger-containing E3 ubiquitin liga	97.34
PF08450		246	SGL: SMP-30/Gluconolaconase/LRE-like region; Inter	97.34
KOG3621		726	consensus WD40 repeat-containing protein [General	97.33
PF06433		342	Me-amine-dh_H: Methylamine dehydrogenase heavy cha	97.27
KOG4649		354	consensus PQQ (pyrrolo-quinoline quinone) repeat p	97.22
PRK04043		419	tolB translocation protein TolB; Provisional	97.14
PLN03200		2102	cellulose synthase-interactive protein; Provisiona	97.12
PF07433		305	DUF1513: Protein of unknown function (DUF1513); In	97.09
KOG2066		846	consensus Vacuolar assembly/sorting protein VPS41	97.08
KOG1645		463	consensus RING-finger-containing E3 ubiquitin liga	97.03
COG5170		460	CDC55 Serine/threonine protein phosphatase 2A, reg	96.9
PF04841		410	Vps16_N: Vps16, N-terminal region; InterPro: IPR00	96.89
KOG1275		1118	consensus PAB-dependent poly(A) ribonuclease, subu	96.88
KOG1920		1265	consensus IkappaB kinase complex, IKAP component [	96.85
PF03178		321	CPSF_A: CPSF A subunit region; InterPro: IPR004871	96.83
PF15492		282	Nbas_N: Neuroblastoma-amplified sequence, N termin	96.81
KOG4649		354	consensus PQQ (pyrrolo-quinoline quinone) repeat p	96.8
KOG2114		933	consensus Vacuolar assembly/sorting protein PEP5/V	96.77
KOG0882		558	consensus Cyclophilin-related peptidyl-prolyl cis-	96.72
PF08596		395	Lgl_C: Lethal giant larvae(Lgl) like, C-terminal;	96.71
PF06433		342	Me-amine-dh_H: Methylamine dehydrogenase heavy cha	96.68
PF11768		545	DUF3312: Protein of unknown function (DUF3312); In	96.48
PF11768		545	DUF3312: Protein of unknown function (DUF3312); In	96.48
smart00320		40	WD40 WD40 repeats. Note that these repeats are per	96.43
PRK02888		635	nitrous-oxide reductase; Validated	96.43
PF08553		794	VID27: VID27 cytoplasmic protein; InterPro: IPR013	96.4
KOG4441		571	consensus Proteins containing BTB/POZ and Kelch do	96.34
PRK02888		635	nitrous-oxide reductase; Validated	96.29
smart00320		40	WD40 WD40 repeats. Note that these repeats are per	96.26
PF04053		443	Coatomer_WDAD: Coatomer WD associated region ; Int	96.21
KOG2314		698	consensus Translation initiation factor 3, subunit	96.17
PHA02713		557	hypothetical protein; Provisional	95.95
KOG4441		571	consensus Proteins containing BTB/POZ and Kelch do	95.9
KOG2395		644	consensus Protein involved in vacuole import and d	95.89
KOG1008		783	consensus Uncharacterized conserved protein, conta	95.87
PHA02713		557	hypothetical protein; Provisional	95.84
PF04053		443	Coatomer_WDAD: Coatomer WD associated region ; Int	95.7
PF00780		275	CNH: CNH domain; InterPro: IPR001180 Based on sequ	95.65
KOG3617		1416	consensus WD40 and TPR repeat-containing protein [	95.62
PF04841		410	Vps16_N: Vps16, N-terminal region; InterPro: IPR00	95.61
PF08596		395	Lgl_C: Lethal giant larvae(Lgl) like, C-terminal;	95.6
TIGR03075		527	PQQ_enz_alc_DH PQQ-dependent dehydrogenase, methan	95.4
COG3386		307	Gluconolactonase [Carbohydrate transport and metab	95.25
PF14783		111	BBS2_Mid: Ciliary BBSome complex subunit 2, middle	95.06
KOG3621		726	consensus WD40 repeat-containing protein [General	95.05
KOG2079		1206	consensus Vacuolar assembly/sorting protein VPS8 [	95.05
PF03178		321	CPSF_A: CPSF A subunit region; InterPro: IPR004871	94.97
PF06977		248	SdiA-regulated: SdiA-regulated; InterPro: IPR00972	94.91
KOG4640		665	consensus Anaphase-promoting complex (APC), subuni	94.9
KOG4640		665	consensus Anaphase-promoting complex (APC), subuni	94.84
KOG2444		238	consensus WD40 repeat protein [General function pr	94.62
PRK13616		591	lipoprotein LpqB; Provisional	94.27
PF00930		353	DPPIV_N: Dipeptidyl peptidase IV (DPP IV) N-termin	94.18
KOG1897		1096	consensus Damage-specific DNA binding complex, sub	94.13
PF05804		708	KAP: Kinesin-associated protein (KAP)	93.86
COG0823		425	TolB Periplasmic component of the Tol biopolymer t	93.55
PF14783		111	BBS2_Mid: Ciliary BBSome complex subunit 2, middle	93.53
PHA03098		534	kelch-like protein; Provisional	93.52
COG3490		366	Uncharacterized protein conserved in bacteria [Fun	93.49
TIGR03074		764	PQQ_membr_DH membrane-bound PQQ-dependent dehydrog	93.49
TIGR03075		527	PQQ_enz_alc_DH PQQ-dependent dehydrogenase, methan	93.33
KOG1008		783	consensus Uncharacterized conserved protein, conta	93.19
COG0823		425	TolB Periplasmic component of the Tol biopolymer t	93.17
COG3391		381	Uncharacterized conserved protein [Function unknow	93.11
PF01602		526	Adaptin_N: Adaptin N terminal region; InterPro: IP	93.09
PF05096		264	Glu_cyclase_2: Glutamine cyclotransferase; InterPr	93.02
PF05804		708	KAP: Kinesin-associated protein (KAP)	92.67
COG3391		381	Uncharacterized conserved protein [Function unknow	92.08
KOG2444		238	consensus WD40 repeat protein [General function pr	91.51
PF02897		414	Peptidase_S9_N: Prolyl oligopeptidase, N-terminal	91.48
PF08553		794	VID27: VID27 cytoplasmic protein; InterPro: IPR013	91.24
KOG2395		644	consensus Protein involved in vacuole import and d	91.0
PHA03098		534	kelch-like protein; Provisional	90.89
PF14727		418	PHTB1_N: PTHB1 N-terminus	90.72
COG3386		307	Gluconolactonase [Carbohydrate transport and metab	90.59
PF02897		414	Peptidase_S9_N: Prolyl oligopeptidase, N-terminal	90.51
COG5276		370	Uncharacterized conserved protein [Function unknow	90.3
KOG2079		1206	consensus Vacuolar assembly/sorting protein VPS8 [	90.28
KOG2280		829	consensus Vacuolar assembly/sorting protein VPS16	89.2
PF12234		631	Rav1p_C: RAVE protein 1 C terminal; InterPro: IPR0	89.2
PRK13800		897	putative oxidoreductase/HEAT repeat-containing pro	89.05
PHA02790		480	Kelch-like protein; Provisional	88.99
PHA02790		480	Kelch-like protein; Provisional	88.61
PF12894		47	Apc4_WD40: Anaphase-promoting complex subunit 4 WD	87.8
COG3490		366	Uncharacterized protein conserved in bacteria [Fun	87.76
PF10508		503	Proteasom_PSMB: Proteasome non-ATPase 26S subunit;	87.66
PF12894		47	Apc4_WD40: Anaphase-promoting complex subunit 4 WD	87.3
KOG4499		310	consensus Ca2+-binding protein Regucalcin/SMP30 [I	86.84
PF01602		526	Adaptin_N: Adaptin N terminal region; InterPro: IP	86.6
PF14583		386	Pectate_lyase22: Oligogalacturonate lyase; PDB: 3C	86.48
PF14761		215	HPS3_N: Hermansky-Pudlak syndrome 3	86.25
COG5276		370	Uncharacterized conserved protein [Function unknow	86.03
PF05096		264	Glu_cyclase_2: Glutamine cyclotransferase; InterPr	85.74
KOG3036		293	consensus Protein involved in cell differentiation	85.53
PF12234		631	Rav1p_C: RAVE protein 1 C terminal; InterPro: IPR0	85.2
KOG1897		1096	consensus Damage-specific DNA binding complex, sub	84.64
KOG4499		310	consensus Ca2+-binding protein Regucalcin/SMP30 [I	84.26
cd00020		120	ARM Armadillo/beta-catenin-like repeats. An approx	83.67
KOG2280		829	consensus Vacuolar assembly/sorting protein VPS16	83.26
KOG1916		1283	consensus Nuclear protein, contains WD40 repeats [	83.1
KOG1983		993	consensus Tomosyn and related SNARE-interacting pr	83.05
PF14655		415	RAB3GAP2_N: Rab3 GTPase-activating protein regulat	82.38
PRK09687		280	putative lyase; Provisional	82.14
KOG2171		1075	consensus Karyopherin (importin) beta 3 [Nuclear s	82.12
COG3292		671	Predicted periplasmic ligand-binding sensor domain	82.1
KOG2160		342	consensus Armadillo/beta-catenin-like repeat-conta	81.4
COG3204		316	Uncharacterized protein conserved in bacteria [Fun	81.32
cd00256		429	VATPase_H VATPase_H, regulatory vacuolar ATP synth	80.62
KOG0166		514	consensus Karyopherin (importin) alpha [Intracellu	80.35
PF10395		670	Utp8: Utp8 family; InterPro: IPR018843 Utp8 is an	80.11

>KOG0271 consensus Notchless-like WD40 repeat-containing protein [Function unknown]	Back alignment and domain information

Probab=100.00  E-value=5.7e-35  Score=324.67  Aligned_cols=280  Identities=18%  Similarity=0.256  Sum_probs=244.8

Q ss_pred             cccCCCCEEEEEEc-CC-EEEEEECCCcEEEEECCCCceeEEEEeccCCCcEEEEEEcCCCCEEEEEeCCCeEEEEEccC
Q 000694         1065 SHKCSGAVTALIYY-KG-LLCSGFSDGSIKMWDIKKQSAMLVWDVKEHRKAVTSFSLFEPGESLLSGSADKTIGVWQMVQ 1142 (1349)
Q Consensus      1065 ~~gH~~~Vt~Lafs-dg-~LaSGS~DGtIrVWDl~tg~~~~i~tL~gHss~VtsLafSpdg~~LaSGS~DGtIrVWDl~t 1142 (1349)
                      ..||.++|.|++|+ +| ++++|+.|.++|+||+.+..+  .++.++|...|.|++|+|||+.|+||+.||+|++||..+
T Consensus       111 ~~GH~e~Vl~~~fsp~g~~l~tGsGD~TvR~WD~~TeTp--~~t~KgH~~WVlcvawsPDgk~iASG~~dg~I~lwdpkt  188 (480)
T KOG0271|consen  111 IAGHGEAVLSVQFSPTGSRLVTGSGDTTVRLWDLDTETP--LFTCKGHKNWVLCVAWSPDGKKIASGSKDGSIRLWDPKT  188 (480)
T ss_pred             cCCCCCcEEEEEecCCCceEEecCCCceEEeeccCCCCc--ceeecCCccEEEEEEECCCcchhhccccCCeEEEecCCC
Confidence            57999999999996 44 799999999999999999765  889999999999999999999999999999999999999


Q ss_pred             CeEEEEEEecCCCCeEEec-------CCCCEEEEEecCCeEEEEecCC-cceeeccCCC--eEEEEe-eCCEEEEEeCCC
Q 000694         1143 RKLELIEVIATKEPIRKLD-------TYGKTIFASTQGHRMKVIDSSR-TLKDIYRSKG--IKSMSV-VQGKIYIGCMDS 1211 (1349)
Q Consensus      1143 g~~~~~~~~~h~~~V~sLs-------~~g~~LvsgS~DgtIkVWDl~~-~~~~~~~~~~--V~~La~-~dg~LlSGs~DG 1211 (1349)
                      |+..-..+.+|...|++++       +....+++++.||.++|||+.. .......+|.  |+|+.+ -+|.+++|+.|+
T Consensus       189 g~~~g~~l~gH~K~It~Lawep~hl~p~~r~las~skDg~vrIWd~~~~~~~~~lsgHT~~VTCvrwGG~gliySgS~Dr  268 (480)
T KOG0271|consen  189 GQQIGRALRGHKKWITALAWEPLHLVPPCRRLASSSKDGSVRIWDTKLGTCVRTLSGHTASVTCVRWGGEGLIYSGSQDR  268 (480)
T ss_pred             CCcccccccCcccceeEEeecccccCCCccceecccCCCCEEEEEccCceEEEEeccCccceEEEEEcCCceEEecCCCc
Confidence            9988888899999999865       5567899999999999999984 4444455554  999999 689999999999


Q ss_pred             cEEEEEccCCccccc-----------------------------------------------------------------
Q 000694         1212 SIQELAVSNNVEREI----------------------------------------------------------------- 1226 (1349)
Q Consensus      1212 sI~IWDl~t~~~~~i----------------------------------------------------------------- 1226 (1349)
                      +|++|+..+|.....                                                                 
T Consensus       269 tIkvw~a~dG~~~r~lkGHahwvN~lalsTdy~LRtgaf~~t~~~~~~~se~~~~Al~rY~~~~~~~~erlVSgsDd~tl  348 (480)
T KOG0271|consen  269 TIKVWRALDGKLCRELKGHAHWVNHLALSTDYVLRTGAFDHTGRKPKSFSEEQKKALERYEAVLKDSGERLVSGSDDFTL  348 (480)
T ss_pred             eEEEEEccchhHHHhhcccchheeeeeccchhhhhccccccccccCCChHHHHHHHHHHHHHhhccCcceeEEecCCceE
Confidence            999999866421100                                                                 


Q ss_pred             --------cccccccccCCCCeEEEEEcCCceEEEEEecCCCeEEEEECCCCCeEEEecCCCCCeEEEEEecCCCEEEEE
Q 000694         1227 --------KAPFKSWRLQSKPINSLVVYKDWLYSASSSVEGSNIKEWRRHRKPQISIAPEKGTTIQAMAVVEDFIYLNYN 1298 (1349)
Q Consensus      1227 --------~~~lk~~~~h~~~I~sL~~~pd~i~las~S~dDgtIrIWDl~t~~li~tl~gH~~~VtsLafSPDg~~LaSG 1298 (1349)
                              ..+.....+|...|+.+.|+||+.++++.+- |+.|++||.++|+.+.+|+||-+.|+.++|+.|.++|++|
T Consensus       349 flW~p~~~kkpi~rmtgHq~lVn~V~fSPd~r~IASaSF-DkSVkLW~g~tGk~lasfRGHv~~VYqvawsaDsRLlVS~  427 (480)
T KOG0271|consen  349 FLWNPFKSKKPITRMTGHQALVNHVSFSPDGRYIASASF-DKSVKLWDGRTGKFLASFRGHVAAVYQVAWSADSRLLVSG  427 (480)
T ss_pred             EEecccccccchhhhhchhhheeeEEECCCccEEEEeec-ccceeeeeCCCcchhhhhhhccceeEEEEeccCccEEEEc
Confidence                    1111223456677899999999999998774 7799999999999999999999999999999999999999


Q ss_pred             eCCCcEEEEECCCCcEEEEEeCCCC-eEEEEE--cCCEEEEEECCCcEEEee
Q 000694         1299 SSASSLQIWLRGTQQKVGRISAGSK-ITSLLT--ANDIVLCGTETGLIKGWI 1347 (1349)
Q Consensus      1299 S~DGtVrVWDl~tg~~l~sl~~hs~-VtsLs~--dg~~LaSGS~DGtIrIWD 1347 (1349)
                      |.|.+++||++++.+....+.+|.. |.++.|  ||+.+++|+.|..+++|.
T Consensus       428 SkDsTLKvw~V~tkKl~~DLpGh~DEVf~vDwspDG~rV~sggkdkv~~lw~  479 (480)
T KOG0271|consen  428 SKDSTLKVWDVRTKKLKQDLPGHADEVFAVDWSPDGQRVASGGKDKVLRLWR  479 (480)
T ss_pred             CCCceEEEEEeeeeeecccCCCCCceEEEEEecCCCceeecCCCceEEEeec
Confidence            9999999999999999999998665 999988  588999999999999995

>KOG0272 consensus U4/U6 small nuclear ribonucleoprotein Prp4 (contains WD40 repeats) [RNA processing and modification]	Back alignment and domain information

>KOG0293 consensus WD40 repeat-containing protein [Function unknown]	Back alignment and domain information

>KOG0286 consensus G-protein beta subunit [General function prediction only]	Back alignment and domain information

>KOG0279 consensus G protein beta subunit-like protein [Signal transduction mechanisms]	Back alignment and domain information

>KOG0281 consensus Beta-TrCP (transducin repeats containing)/Slimb proteins [Function unknown]	Back alignment and domain information

>KOG0271 consensus Notchless-like WD40 repeat-containing protein [Function unknown]	Back alignment and domain information

>KOG0285 consensus Pleiotropic regulator 1 [RNA processing and modification]	Back alignment and domain information

>KOG0319 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification]	Back alignment and domain information

>KOG0295 consensus WD40 repeat-containing protein [Function unknown]	Back alignment and domain information

>KOG0315 consensus G-protein beta subunit-like protein (contains WD40 repeats) [General function prediction only]	Back alignment and domain information

>KOG0273 consensus Beta-transducin family (WD-40 repeat) protein [Chromatin structure and dynamics]	Back alignment and domain information

>KOG0272 consensus U4/U6 small nuclear ribonucleoprotein Prp4 (contains WD40 repeats) [RNA processing and modification]	Back alignment and domain information

>cd00200 WD40 WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and botto

Back alignment and domain information

>KOG0315 consensus G-protein beta subunit-like protein (contains WD40 repeats) [General function prediction only]	Back alignment and domain information

>KOG0265 consensus U5 snRNP-specific protein-like factor and related proteins [RNA processing and modification]	Back alignment and domain information

>KOG0282 consensus mRNA splicing factor [Function unknown]	Back alignment and domain information

>KOG0263 consensus Transcription initiation factor TFIID, subunit TAF5 (also component of histone acetyltransferase SAGA) [Transcription]	Back alignment and domain information

>KOG0286 consensus G-protein beta subunit [General function prediction only]	Back alignment and domain information

>KOG0313 consensus Microtubule binding protein YTM1 (contains WD40 repeats) [Cytoskeleton]	Back alignment and domain information

>KOG0284 consensus Polyadenylation factor I complex, subunit PFS2 [RNA processing and modification]	Back alignment and domain information

>KOG0276 consensus Vesicle coat complex COPI, beta' subunit [Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>KOG0279 consensus G protein beta subunit-like protein [Signal transduction mechanisms]	Back alignment and domain information

>KOG0316 consensus Conserved WD40 repeat-containing protein [Function unknown]	Back alignment and domain information

>KOG0319 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification]	Back alignment and domain information

>KOG0273 consensus Beta-transducin family (WD-40 repeat) protein [Chromatin structure and dynamics]	Back alignment and domain information

>PLN00181 protein SPA1-RELATED; Provisional	Back alignment and domain information

>KOG0318 consensus WD40 repeat stress protein/actin interacting protein [Cytoskeleton]	Back alignment and domain information

>KOG0266 consensus WD40 repeat-containing protein [General function prediction only]	Back alignment and domain information

>KOG0292 consensus Vesicle coat complex COPI, alpha subunit [Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>KOG0281 consensus Beta-TrCP (transducin repeats containing)/Slimb proteins [Function unknown]	Back alignment and domain information

>KOG0274 consensus Cdc4 and related F-box and WD-40 proteins [General function prediction only]	Back alignment and domain information

>KOG0291 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification]	Back alignment and domain information

>KOG0296 consensus Angio-associated migratory cell protein (contains WD40 repeats) [Function unknown]	Back alignment and domain information

>KOG0288 consensus WD40 repeat protein TipD [General function prediction only]	Back alignment and domain information

>KOG0645 consensus WD40 repeat protein [General function prediction only]	Back alignment and domain information

>KOG0291 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification]	Back alignment and domain information

>KOG0263 consensus Transcription initiation factor TFIID, subunit TAF5 (also component of histone acetyltransferase SAGA) [Transcription]	Back alignment and domain information

>KOG0285 consensus Pleiotropic regulator 1 [RNA processing and modification]	Back alignment and domain information

>KOG0278 consensus Serine/threonine kinase receptor-associated protein [Lipid transport and metabolism]	Back alignment and domain information

>KOG0295 consensus WD40 repeat-containing protein [Function unknown]	Back alignment and domain information

>KOG0301 consensus Phospholipase A2-activating protein (contains WD40 repeats) [Lipid transport and metabolism]	Back alignment and domain information

>KOG0306 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification]	Back alignment and domain information

Back alignment and domain information

>KOG0284 consensus Polyadenylation factor I complex, subunit PFS2 [RNA processing and modification]	Back alignment and domain information

>KOG1407 consensus WD40 repeat protein [Function unknown]	Back alignment and domain information

>KOG0318 consensus WD40 repeat stress protein/actin interacting protein [Cytoskeleton]	Back alignment and domain information

>KOG0276 consensus Vesicle coat complex COPI, beta' subunit [Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>KOG0274 consensus Cdc4 and related F-box and WD-40 proteins [General function prediction only]	Back alignment and domain information

>KOG0268 consensus Sof1-like rRNA processing protein (contains WD40 repeats) [RNA processing and modification]	Back alignment and domain information

>KOG0292 consensus Vesicle coat complex COPI, alpha subunit [Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>PLN00181 protein SPA1-RELATED; Provisional	Back alignment and domain information

>KOG0278 consensus Serine/threonine kinase receptor-associated protein [Lipid transport and metabolism]	Back alignment and domain information

>KOG0266 consensus WD40 repeat-containing protein [General function prediction only]	Back alignment and domain information

>KOG0316 consensus Conserved WD40 repeat-containing protein [Function unknown]	Back alignment and domain information

>KOG0647 consensus mRNA export protein (contains WD40 repeats) [RNA processing and modification]	Back alignment and domain information

>KOG0275 consensus Conserved WD40 repeat-containing protein [General function prediction only]	Back alignment and domain information

>KOG0296 consensus Angio-associated migratory cell protein (contains WD40 repeats) [Function unknown]	Back alignment and domain information

>KOG0306 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification]	Back alignment and domain information

>KOG1446 consensus Histone H3 (Lys4) methyltransferase complex and RNA cleavage factor II complex, subunit SWD2 [RNA processing and modification; Chromatin structure and dynamics; Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG0265 consensus U5 snRNP-specific protein-like factor and related proteins [RNA processing and modification]	Back alignment and domain information

>KOG1036 consensus Mitotic spindle checkpoint protein BUB3, WD repeat superfamily [Cell cycle control, cell division, chromosome partitioning]	Back alignment and domain information

>KOG0645 consensus WD40 repeat protein [General function prediction only]	Back alignment and domain information

>KOG0282 consensus mRNA splicing factor [Function unknown]	Back alignment and domain information

>KOG0277 consensus Peroxisomal targeting signal type 2 receptor [Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>KOG0293 consensus WD40 repeat-containing protein [Function unknown]	Back alignment and domain information

>KOG0313 consensus Microtubule binding protein YTM1 (contains WD40 repeats) [Cytoskeleton]	Back alignment and domain information

>KOG0283 consensus WD40 repeat-containing protein [Function unknown]	Back alignment and domain information

>KOG0643 consensus Translation initiation factor 3, subunit i (eIF-3i)/TGF-beta receptor-interacting protein (TRIP-1) [Translation, ribosomal structure and biogenesis; Signal transduction mechanisms]	Back alignment and domain information

>KOG0294 consensus WD40 repeat-containing protein [Function unknown]	Back alignment and domain information

>KOG0305 consensus Anaphase promoting complex, Cdc20, Cdh1, and Ama1 subunits [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG0305 consensus Anaphase promoting complex, Cdc20, Cdh1, and Ama1 subunits [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG0310 consensus Conserved WD40 repeat-containing protein [Function unknown]	Back alignment and domain information

>KOG0772 consensus Uncharacterized conserved protein, contains WD40 repeat [Function unknown]	Back alignment and domain information

>PTZ00420 coronin; Provisional	Back alignment and domain information

>KOG0299 consensus U3 snoRNP-associated protein (contains WD40 repeats) [RNA processing and modification]	Back alignment and domain information

>KOG0277 consensus Peroxisomal targeting signal type 2 receptor [Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>KOG0640 consensus mRNA cleavage stimulating factor complex; subunit 1 [RNA processing and modification]	Back alignment and domain information

>KOG0289 consensus mRNA splicing factor [General function prediction only]	Back alignment and domain information

>KOG1539 consensus WD repeat protein [General function prediction only]	Back alignment and domain information

>KOG0973 consensus Histone transcription regulator HIRA, WD repeat superfamily [Cell cycle control, cell division, chromosome partitioning; Transcription]	Back alignment and domain information

>KOG0300 consensus WD40 repeat-containing protein [Function unknown]	Back alignment and domain information

>PTZ00421 coronin; Provisional	Back alignment and domain information

>KOG0283 consensus WD40 repeat-containing protein [Function unknown]	Back alignment and domain information

>KOG0308 consensus Conserved WD40 repeat-containing protein [Function unknown]	Back alignment and domain information

>TIGR03866 PQQ_ABC_repeats PQQ-dependent catabolism-associated beta-propeller protein	Back alignment and domain information

>KOG0288 consensus WD40 repeat protein TipD [General function prediction only]	Back alignment and domain information

>KOG0310 consensus Conserved WD40 repeat-containing protein [Function unknown]	Back alignment and domain information

>KOG1408 consensus WD40 repeat protein [Function unknown]	Back alignment and domain information

>KOG0308 consensus Conserved WD40 repeat-containing protein [Function unknown]	Back alignment and domain information

>KOG0301 consensus Phospholipase A2-activating protein (contains WD40 repeats) [Lipid transport and metabolism]	Back alignment and domain information

>PTZ00421 coronin; Provisional	Back alignment and domain information

>KOG0641 consensus WD40 repeat protein [General function prediction only]	Back alignment and domain information

>KOG1407 consensus WD40 repeat protein [Function unknown]	Back alignment and domain information

>KOG0643 consensus Translation initiation factor 3, subunit i (eIF-3i)/TGF-beta receptor-interacting protein (TRIP-1) [Translation, ribosomal structure and biogenesis; Signal transduction mechanisms]	Back alignment and domain information

>KOG0264 consensus Nucleosome remodeling factor, subunit CAF1/NURF55/MSI1 [Chromatin structure and dynamics]	Back alignment and domain information

>PTZ00420 coronin; Provisional	Back alignment and domain information

>KOG0275 consensus Conserved WD40 repeat-containing protein [General function prediction only]	Back alignment and domain information

>KOG2106 consensus Uncharacterized conserved protein, contains HELP and WD40 domains [Function unknown]	Back alignment and domain information

>KOG0650 consensus WD40 repeat nucleolar protein Bop1, involved in ribosome biogenesis [Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>KOG0300 consensus WD40 repeat-containing protein [Function unknown]	Back alignment and domain information

>KOG0294 consensus WD40 repeat-containing protein [Function unknown]	Back alignment and domain information

>KOG0299 consensus U3 snoRNP-associated protein (contains WD40 repeats) [RNA processing and modification]	Back alignment and domain information

>KOG1332 consensus Vesicle coat complex COPII, subunit SEC13 [Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>KOG1446 consensus Histone H3 (Lys4) methyltransferase complex and RNA cleavage factor II complex, subunit SWD2 [RNA processing and modification; Chromatin structure and dynamics; Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG0772 consensus Uncharacterized conserved protein, contains WD40 repeat [Function unknown]	Back alignment and domain information

>KOG0289 consensus mRNA splicing factor [General function prediction only]	Back alignment and domain information

>KOG1539 consensus WD repeat protein [General function prediction only]	Back alignment and domain information

>KOG2048 consensus WD40 repeat protein [General function prediction only]	Back alignment and domain information

>TIGR03866 PQQ_ABC_repeats PQQ-dependent catabolism-associated beta-propeller protein	Back alignment and domain information

>KOG2055 consensus WD40 repeat protein [General function prediction only]	Back alignment and domain information

>KOG2096 consensus WD40 repeat protein [General function prediction only]	Back alignment and domain information

>KOG0647 consensus mRNA export protein (contains WD40 repeats) [RNA processing and modification]	Back alignment and domain information

>KOG1274 consensus WD40 repeat protein [General function prediction only]	Back alignment and domain information

>KOG1063 consensus RNA polymerase II elongator complex, subunit ELP2, WD repeat superfamily [Chromatin structure and dynamics; Transcription]	Back alignment and domain information

>KOG0646 consensus WD40 repeat protein [General function prediction only]	Back alignment and domain information

>KOG0268 consensus Sof1-like rRNA processing protein (contains WD40 repeats) [RNA processing and modification]	Back alignment and domain information

>KOG1036 consensus Mitotic spindle checkpoint protein BUB3, WD repeat superfamily [Cell cycle control, cell division, chromosome partitioning]	Back alignment and domain information

>KOG0973 consensus Histone transcription regulator HIRA, WD repeat superfamily [Cell cycle control, cell division, chromosome partitioning; Transcription]	Back alignment and domain information

>KOG1274 consensus WD40 repeat protein [General function prediction only]	Back alignment and domain information

>KOG2445 consensus Nuclear pore complex component (sc Seh1) [Nuclear structure; Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>KOG1332 consensus Vesicle coat complex COPII, subunit SEC13 [Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>KOG0646 consensus WD40 repeat protein [General function prediction only]	Back alignment and domain information

>KOG0639 consensus Transducin-like enhancer of split protein (contains WD40 repeats) [Chromatin structure and dynamics]	Back alignment and domain information

>KOG0321 consensus WD40 repeat-containing protein L2DTL [Function unknown]	Back alignment and domain information

>KOG0640 consensus mRNA cleavage stimulating factor complex; subunit 1 [RNA processing and modification]	Back alignment and domain information

>KOG1273 consensus WD40 repeat protein [General function prediction only]	Back alignment and domain information

>KOG0641 consensus WD40 repeat protein [General function prediction only]	Back alignment and domain information

>KOG4328 consensus WD40 protein [Function unknown]	Back alignment and domain information

>KOG0270 consensus WD40 repeat-containing protein [Function unknown]	Back alignment and domain information

>KOG2106 consensus Uncharacterized conserved protein, contains HELP and WD40 domains [Function unknown]	Back alignment and domain information

>KOG0321 consensus WD40 repeat-containing protein L2DTL [Function unknown]	Back alignment and domain information

>KOG0269 consensus WD40 repeat-containing protein [Function unknown]	Back alignment and domain information

>KOG1408 consensus WD40 repeat protein [Function unknown]	Back alignment and domain information

>KOG4283 consensus Transcription-coupled repair protein CSA, contains WD40 domain [Transcription; Replication, recombination and repair]	Back alignment and domain information

>KOG0269 consensus WD40 repeat-containing protein [Function unknown]	Back alignment and domain information

>KOG0267 consensus Microtubule severing protein katanin p80 subunit B (contains WD40 repeats) [Cell cycle control, cell division, chromosome partitioning]	Back alignment and domain information

>KOG0264 consensus Nucleosome remodeling factor, subunit CAF1/NURF55/MSI1 [Chromatin structure and dynamics]	Back alignment and domain information

>KOG0302 consensus Ribosome Assembly protein [General function prediction only]	Back alignment and domain information

>KOG0642 consensus Cell-cycle nuclear protein, contains WD-40 repeats [Cell cycle control, cell division, chromosome partitioning]	Back alignment and domain information

>KOG0267 consensus Microtubule severing protein katanin p80 subunit B (contains WD40 repeats) [Cell cycle control, cell division, chromosome partitioning]	Back alignment and domain information

>KOG2096 consensus WD40 repeat protein [General function prediction only]	Back alignment and domain information

>KOG4378 consensus Nuclear protein COP1 [Signal transduction mechanisms]	Back alignment and domain information

>KOG0307 consensus Vesicle coat complex COPII, subunit SEC31 [Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>COG2319 FOG: WD40 repeat [General function prediction only]	Back alignment and domain information

>KOG1538 consensus Uncharacterized conserved protein WDR10, contains WD40 repeats [General function prediction only]	Back alignment and domain information

>KOG0322 consensus G-protein beta subunit-like protein GNB1L, contains WD repeats [General function prediction only]	Back alignment and domain information

>KOG4283 consensus Transcription-coupled repair protein CSA, contains WD40 domain [Transcription; Replication, recombination and repair]	Back alignment and domain information

>KOG2048 consensus WD40 repeat protein [General function prediction only]	Back alignment and domain information

>KOG1063 consensus RNA polymerase II elongator complex, subunit ELP2, WD repeat superfamily [Chromatin structure and dynamics; Transcription]	Back alignment and domain information

>KOG4378 consensus Nuclear protein COP1 [Signal transduction mechanisms]	Back alignment and domain information

>KOG1188 consensus WD40 repeat protein [General function prediction only]	Back alignment and domain information

>KOG0639 consensus Transducin-like enhancer of split protein (contains WD40 repeats) [Chromatin structure and dynamics]	Back alignment and domain information

>COG2319 FOG: WD40 repeat [General function prediction only]	Back alignment and domain information

>KOG4328 consensus WD40 protein [Function unknown]	Back alignment and domain information

>KOG1034 consensus Transcriptional repressor EED/ESC/FIE, required for transcriptional silencing, WD repeat superfamily [Transcription]	Back alignment and domain information

>KOG0644 consensus Uncharacterized conserved protein, contains WD40 repeat and BROMO domains [General function prediction only]	Back alignment and domain information

>KOG1007 consensus WD repeat protein TSSC1, WD repeat superfamily [Function unknown]	Back alignment and domain information

>KOG0270 consensus WD40 repeat-containing protein [Function unknown]	Back alignment and domain information

>KOG1517 consensus Guanine nucleotide binding protein MIP1 [Cell cycle control, cell division, chromosome partitioning]	Back alignment and domain information

>KOG1517 consensus Guanine nucleotide binding protein MIP1 [Cell cycle control, cell division, chromosome partitioning]	Back alignment and domain information

>KOG1240 consensus Protein kinase containing WD40 repeats [Signal transduction mechanisms]	Back alignment and domain information

>PRK11028 6-phosphogluconolactonase; Provisional	Back alignment and domain information

>KOG1587 consensus Cytoplasmic dynein intermediate chain [Cytoskeleton]	Back alignment and domain information

>KOG2919 consensus Guanine nucleotide-binding protein [General function prediction only]	Back alignment and domain information

>KOG0650 consensus WD40 repeat nucleolar protein Bop1, involved in ribosome biogenesis [Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>KOG0302 consensus Ribosome Assembly protein [General function prediction only]	Back alignment and domain information

>KOG2055 consensus WD40 repeat protein [General function prediction only]	Back alignment and domain information

>KOG0290 consensus Conserved WD40 repeat-containing protein AN11 [Function unknown]	Back alignment and domain information

>KOG0649 consensus WD40 repeat protein [General function prediction only]	Back alignment and domain information

>KOG0649 consensus WD40 repeat protein [General function prediction only]	Back alignment and domain information

>KOG1334 consensus WD40 repeat protein [General function prediction only]	Back alignment and domain information

>KOG4227 consensus WD40 repeat protein [General function prediction only]	Back alignment and domain information

>KOG2110 consensus Uncharacterized conserved protein, contains WD40 repeats [Function unknown]	Back alignment and domain information

>KOG1188 consensus WD40 repeat protein [General function prediction only]	Back alignment and domain information

>KOG1009 consensus Chromatin assembly complex 1 subunit B/CAC2 (contains WD40 repeats) [Chromatin structure and dynamics; Replication, recombination and repair]	Back alignment and domain information

>KOG2919 consensus Guanine nucleotide-binding protein [General function prediction only]	Back alignment and domain information

>KOG0303 consensus Actin-binding protein Coronin, contains WD40 repeats [Cytoskeleton]	Back alignment and domain information

>KOG2445 consensus Nuclear pore complex component (sc Seh1) [Nuclear structure; Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>KOG1034 consensus Transcriptional repressor EED/ESC/FIE, required for transcriptional silencing, WD repeat superfamily [Transcription]	Back alignment and domain information

>KOG1240 consensus Protein kinase containing WD40 repeats [Signal transduction mechanisms]	Back alignment and domain information

>KOG1445 consensus Tumor-specific antigen (contains WD repeats) [Cytoskeleton]	Back alignment and domain information

>KOG0642 consensus Cell-cycle nuclear protein, contains WD-40 repeats [Cell cycle control, cell division, chromosome partitioning]	Back alignment and domain information

>KOG1273 consensus WD40 repeat protein [General function prediction only]	Back alignment and domain information

>KOG1587 consensus Cytoplasmic dynein intermediate chain [Cytoskeleton]	Back alignment and domain information

>KOG1009 consensus Chromatin assembly complex 1 subunit B/CAC2 (contains WD40 repeats) [Chromatin structure and dynamics; Replication, recombination and repair]	Back alignment and domain information

>KOG1963 consensus WD40 repeat protein [General function prediction only]	Back alignment and domain information

>KOG1272 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification]	Back alignment and domain information

>KOG0644 consensus Uncharacterized conserved protein, contains WD40 repeat and BROMO domains [General function prediction only]	Back alignment and domain information

>KOG0307 consensus Vesicle coat complex COPII, subunit SEC31 [Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>PRK11028 6-phosphogluconolactonase; Provisional	Back alignment and domain information

>KOG3881 consensus Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>KOG1310 consensus WD40 repeat protein [General function prediction only]	Back alignment and domain information

>KOG1538 consensus Uncharacterized conserved protein WDR10, contains WD40 repeats [General function prediction only]	Back alignment and domain information

>PRK01742 tolB translocation protein TolB; Provisional	Back alignment and domain information

>KOG1445 consensus Tumor-specific antigen (contains WD repeats) [Cytoskeleton]	Back alignment and domain information

>KOG1523 consensus Actin-related protein Arp2/3 complex, subunit ARPC1/p41-ARC [Cytoskeleton]	Back alignment and domain information

>KOG1007 consensus WD repeat protein TSSC1, WD repeat superfamily [Function unknown]	Back alignment and domain information

>KOG0771 consensus Prolactin regulatory element-binding protein/Protein transport protein SEC12p [Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>KOG2111 consensus Uncharacterized conserved protein, contains WD40 repeats [Function unknown]	Back alignment and domain information

>KOG0303 consensus Actin-binding protein Coronin, contains WD40 repeats [Cytoskeleton]	Back alignment and domain information

>KOG4227 consensus WD40 repeat protein [General function prediction only]	Back alignment and domain information

>KOG1963 consensus WD40 repeat protein [General function prediction only]	Back alignment and domain information

>KOG2394 consensus WD40 protein DMR-N9 [General function prediction only]	Back alignment and domain information

>KOG1334 consensus WD40 repeat protein [General function prediction only]	Back alignment and domain information

>KOG1524 consensus WD40 repeat-containing protein CHE-2 [General function prediction only]	Back alignment and domain information

>KOG2110 consensus Uncharacterized conserved protein, contains WD40 repeats [Function unknown]	Back alignment and domain information

>KOG1524 consensus WD40 repeat-containing protein CHE-2 [General function prediction only]	Back alignment and domain information

>KOG2321 consensus WD40 repeat protein [General function prediction only]	Back alignment and domain information

>PRK03629 tolB translocation protein TolB; Provisional	Back alignment and domain information

>KOG0290 consensus Conserved WD40 repeat-containing protein AN11 [Function unknown]	Back alignment and domain information

>KOG4497 consensus Uncharacterized conserved protein WDR8, contains WD repeats [General function prediction only]	Back alignment and domain information

>KOG2111 consensus Uncharacterized conserved protein, contains WD40 repeats [Function unknown]	Back alignment and domain information

>PRK04922 tolB translocation protein TolB; Provisional	Back alignment and domain information

>PRK01742 tolB translocation protein TolB; Provisional	Back alignment and domain information

>PRK05137 tolB translocation protein TolB; Provisional	Back alignment and domain information

>KOG0322 consensus G-protein beta subunit-like protein GNB1L, contains WD repeats [General function prediction only]	Back alignment and domain information

>TIGR03300 assembly_YfgL outer membrane assembly lipoprotein YfgL	Back alignment and domain information

>PF02239 Cytochrom_D1: Cytochrome D1 heme domain; PDB: 1NNO_B 1HZU_A 1N15_B 1N50_A 1GJQ_A 1BL9_B 1NIR_B 1N90_B 1HZV_A 1AOQ_A	Back alignment and domain information

>KOG2321 consensus WD40 repeat protein [General function prediction only]	Back alignment and domain information

>KOG3881 consensus Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>PRK02889 tolB translocation protein TolB; Provisional	Back alignment and domain information

>KOG1354 consensus Serine/threonine protein phosphatase 2A, regulatory subunit [Signal transduction mechanisms]	Back alignment and domain information

>KOG0771 consensus Prolactin regulatory element-binding protein/Protein transport protein SEC12p [Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>TIGR03300 assembly_YfgL outer membrane assembly lipoprotein YfgL	Back alignment and domain information

>KOG1310 consensus WD40 repeat protein [General function prediction only]	Back alignment and domain information

>KOG2041 consensus WD40 repeat protein [General function prediction only]	Back alignment and domain information

>PRK04922 tolB translocation protein TolB; Provisional	Back alignment and domain information

>PF10282 Lactonase: Lactonase, 7-bladed beta-propeller; InterPro: IPR019405 6-phosphogluconolactonases (6PGL) 3	Back alignment and domain information

>KOG1064 consensus RAVE (regulator of V-ATPase assembly) complex subunit RAV1/DMX protein, WD repeat superfamily [General function prediction only]	Back alignment and domain information

>PF02239 Cytochrom_D1: Cytochrome D1 heme domain; PDB: 1NNO_B 1HZU_A 1N15_B 1N50_A 1GJQ_A 1BL9_B 1NIR_B 1N90_B 1HZV_A 1AOQ_A	Back alignment and domain information

>TIGR02800 propeller_TolB tol-pal system beta propeller repeat protein TolB	Back alignment and domain information

>KOG0974 consensus WD-repeat protein WDR6, WD repeat superfamily [General function prediction only]	Back alignment and domain information

>KOG2139 consensus WD40 repeat protein [General function prediction only]	Back alignment and domain information

>PF10282 Lactonase: Lactonase, 7-bladed beta-propeller; InterPro: IPR019405 6-phosphogluconolactonases (6PGL) 3	Back alignment and domain information

>PRK03629 tolB translocation protein TolB; Provisional	Back alignment and domain information

>KOG4547 consensus WD40 repeat-containing protein [General function prediction only]	Back alignment and domain information

>KOG2315 consensus Predicted translation initiation factor related to eIF-3a [Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>KOG4190 consensus Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>PF08662 eIF2A: Eukaryotic translation initiation factor eIF2A; InterPro: IPR013979 This entry contains beta propellor domains found in eukaryotic translation initiation factors and TolB domain-containing proteins	Back alignment and domain information

>KOG0974 consensus WD-repeat protein WDR6, WD repeat superfamily [General function prediction only]	Back alignment and domain information

>PRK00178 tolB translocation protein TolB; Provisional	Back alignment and domain information

>KOG4547 consensus WD40 repeat-containing protein [General function prediction only]	Back alignment and domain information

>TIGR02658 TTQ_MADH_Hv methylamine dehydrogenase heavy chain	Back alignment and domain information

>PRK11138 outer membrane biogenesis protein BamB; Provisional	Back alignment and domain information

>KOG1409 consensus Uncharacterized conserved protein, contains WD40 repeats and FYVE domains [Function unknown]	Back alignment and domain information

>PRK05137 tolB translocation protein TolB; Provisional	Back alignment and domain information

>KOG1064 consensus RAVE (regulator of V-ATPase assembly) complex subunit RAV1/DMX protein, WD repeat superfamily [General function prediction only]	Back alignment and domain information

>KOG2139 consensus WD40 repeat protein [General function prediction only]	Back alignment and domain information

>PRK04792 tolB translocation protein TolB; Provisional	Back alignment and domain information

>KOG2394 consensus WD40 protein DMR-N9 [General function prediction only]	Back alignment and domain information

>KOG1523 consensus Actin-related protein Arp2/3 complex, subunit ARPC1/p41-ARC [Cytoskeleton]	Back alignment and domain information

>PRK02889 tolB translocation protein TolB; Provisional	Back alignment and domain information

>KOG4497 consensus Uncharacterized conserved protein WDR8, contains WD repeats [General function prediction only]	Back alignment and domain information

>COG5170 CDC55 Serine/threonine protein phosphatase 2A, regulatory subunit [Signal transduction mechanisms]	Back alignment and domain information

>KOG1409 consensus Uncharacterized conserved protein, contains WD40 repeats and FYVE domains [Function unknown]	Back alignment and domain information

>PF08662 eIF2A: Eukaryotic translation initiation factor eIF2A; InterPro: IPR013979 This entry contains beta propellor domains found in eukaryotic translation initiation factors and TolB domain-containing proteins	Back alignment and domain information

>TIGR02658 TTQ_MADH_Hv methylamine dehydrogenase heavy chain	Back alignment and domain information

>KOG1272 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification]	Back alignment and domain information

>PF04762 IKI3: IKI3 family; InterPro: IPR006849 Members of this family are components of the elongator multi-subunit component of a novel RNA polymerase II holoenzyme for transcriptional elongation []	Back alignment and domain information

>KOG0280 consensus Uncharacterized conserved protein [Amino acid transport and metabolism]	Back alignment and domain information

>PRK01029 tolB translocation protein TolB; Provisional	Back alignment and domain information

>TIGR02800 propeller_TolB tol-pal system beta propeller repeat protein TolB	Back alignment and domain information

>PLN02919 haloacid dehalogenase-like hydrolase family protein	Back alignment and domain information

>KOG4714 consensus Nucleoporin [Nuclear structure]	Back alignment and domain information

>COG2706 3-carboxymuconate cyclase [Carbohydrate transport and metabolism]	Back alignment and domain information

>COG2706 3-carboxymuconate cyclase [Carbohydrate transport and metabolism]	Back alignment and domain information

>PF13360 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 3Q54_A 2YH3_A 3PRW_A 3P1L_A 3Q7M_A 3Q7O_A 3Q7N_A	Back alignment and domain information

>KOG2041 consensus WD40 repeat protein [General function prediction only]	Back alignment and domain information

>PRK11138 outer membrane biogenesis protein BamB; Provisional	Back alignment and domain information

>PF13360 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 3Q54_A 2YH3_A 3PRW_A 3P1L_A 3Q7M_A 3Q7O_A 3Q7N_A	Back alignment and domain information

>PRK04792 tolB translocation protein TolB; Provisional	Back alignment and domain information

>PRK00178 tolB translocation protein TolB; Provisional	Back alignment and domain information

>KOG0309 consensus Conserved WD40 repeat-containing protein [Function unknown]	Back alignment and domain information

>COG5354 Uncharacterized protein, contains Trp-Asp (WD) repeat [General function prediction only]	Back alignment and domain information

>KOG4190 consensus Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>KOG0280 consensus Uncharacterized conserved protein [Amino acid transport and metabolism]	Back alignment and domain information

>KOG2315 consensus Predicted translation initiation factor related to eIF-3a [Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>PF00400 WD40: WD domain, G-beta repeat; InterPro: IPR019781 WD-40 repeats (also known as WD or beta-transducin repeats) are short ~40 amino acid motifs, often terminating in a Trp-Asp (W-D) dipeptide	Back alignment and domain information

>KOG1912 consensus WD40 repeat protein [General function prediction only]	Back alignment and domain information

>KOG0882 consensus Cyclophilin-related peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG4532 consensus WD40-like repeat containing protein [General function prediction only]	Back alignment and domain information

>PF00400 WD40: WD domain, G-beta repeat; InterPro: IPR019781 WD-40 repeats (also known as WD or beta-transducin repeats) are short ~40 amino acid motifs, often terminating in a Trp-Asp (W-D) dipeptide	Back alignment and domain information

>KOG0309 consensus Conserved WD40 repeat-containing protein [Function unknown]	Back alignment and domain information

>KOG2066 consensus Vacuolar assembly/sorting protein VPS41 [Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>COG4946 Uncharacterized protein related to the periplasmic component of the Tol biopolymer transport system [Function unknown]	Back alignment and domain information

>PF08450 SGL: SMP-30/Gluconolaconase/LRE-like region; InterPro: IPR013658 This family describes a region that is found in proteins expressed by a variety of eukaryotic and prokaryotic species	Back alignment and domain information

>KOG3914 consensus WD repeat protein WDR4 [Function unknown]	Back alignment and domain information

>KOG3914 consensus WD repeat protein WDR4 [Function unknown]	Back alignment and domain information

>PF15492 Nbas_N: Neuroblastoma-amplified sequence, N terminal	Back alignment and domain information

>KOG2695 consensus WD40 repeat protein [General function prediction only]	Back alignment and domain information

>KOG1920 consensus IkappaB kinase complex, IKAP component [Transcription]	Back alignment and domain information

>PRK01029 tolB translocation protein TolB; Provisional	Back alignment and domain information

>PLN02919 haloacid dehalogenase-like hydrolase family protein	Back alignment and domain information

>PRK04043 tolB translocation protein TolB; Provisional	Back alignment and domain information

>KOG1832 consensus HIV-1 Vpr-binding protein [Cell cycle control, cell division, chromosome partitioning]	Back alignment and domain information

>PLN03200 cellulose synthase-interactive protein; Provisional	Back alignment and domain information

>KOG2314 consensus Translation initiation factor 3, subunit b (eIF-3b) [Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>KOG1354 consensus Serine/threonine protein phosphatase 2A, regulatory subunit [Signal transduction mechanisms]	Back alignment and domain information

>KOG2114 consensus Vacuolar assembly/sorting protein PEP5/VPS11 [Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>COG4946 Uncharacterized protein related to the periplasmic component of the Tol biopolymer transport system [Function unknown]	Back alignment and domain information

>PF04762 IKI3: IKI3 family; InterPro: IPR006849 Members of this family are components of the elongator multi-subunit component of a novel RNA polymerase II holoenzyme for transcriptional elongation []	Back alignment and domain information

>KOG1275 consensus PAB-dependent poly(A) ribonuclease, subunit PAN2 [Replication, recombination and repair]	Back alignment and domain information

>KOG4532 consensus WD40-like repeat containing protein [General function prediction only]	Back alignment and domain information

>KOG4714 consensus Nucleoporin [Nuclear structure]	Back alignment and domain information

>PF00780 CNH: CNH domain; InterPro: IPR001180 Based on sequence similarities a domain of homology has been identified in the following proteins []: Citron and Citron kinase	Back alignment and domain information

>COG5354 Uncharacterized protein, contains Trp-Asp (WD) repeat [General function prediction only]	Back alignment and domain information

>cd00216 PQQ_DH Dehydrogenases with pyrrolo-quinoline quinone (PQQ) as cofactor, like ethanol, methanol, and membrane bound glucose dehydrogenases	Back alignment and domain information

>KOG1832 consensus HIV-1 Vpr-binding protein [Cell cycle control, cell division, chromosome partitioning]	Back alignment and domain information

>PF07433 DUF1513: Protein of unknown function (DUF1513); InterPro: IPR008311 There are currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function	Back alignment and domain information

>cd00216 PQQ_DH Dehydrogenases with pyrrolo-quinoline quinone (PQQ) as cofactor, like ethanol, methanol, and membrane bound glucose dehydrogenases	Back alignment and domain information

>KOG3617 consensus WD40 and TPR repeat-containing protein [General function prediction only]	Back alignment and domain information

>KOG2695 consensus WD40 repeat protein [General function prediction only]	Back alignment and domain information

>KOG1912 consensus WD40 repeat protein [General function prediction only]	Back alignment and domain information

>KOG1645 consensus RING-finger-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PF08450 SGL: SMP-30/Gluconolaconase/LRE-like region; InterPro: IPR013658 This family describes a region that is found in proteins expressed by a variety of eukaryotic and prokaryotic species	Back alignment and domain information

>KOG3621 consensus WD40 repeat-containing protein [General function prediction only]	Back alignment and domain information

>PF06433 Me-amine-dh_H: Methylamine dehydrogenase heavy chain (MADH); InterPro: IPR009451 Methylamine dehydrogenase (1	Back alignment and domain information

>KOG4649 consensus PQQ (pyrrolo-quinoline quinone) repeat protein [Secondary metabolites biosynthesis, transport and catabolism]	Back alignment and domain information

>PRK04043 tolB translocation protein TolB; Provisional	Back alignment and domain information

>PLN03200 cellulose synthase-interactive protein; Provisional	Back alignment and domain information

>PF07433 DUF1513: Protein of unknown function (DUF1513); InterPro: IPR008311 There are currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function	Back alignment and domain information

>KOG2066 consensus Vacuolar assembly/sorting protein VPS41 [Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>KOG1645 consensus RING-finger-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>COG5170 CDC55 Serine/threonine protein phosphatase 2A, regulatory subunit [Signal transduction mechanisms]	Back alignment and domain information

>PF04841 Vps16_N: Vps16, N-terminal region; InterPro: IPR006926 This protein forms part of the Class C vacuolar protein sorting (Vps) complex	Back alignment and domain information

>KOG1275 consensus PAB-dependent poly(A) ribonuclease, subunit PAN2 [Replication, recombination and repair]	Back alignment and domain information

>KOG1920 consensus IkappaB kinase complex, IKAP component [Transcription]	Back alignment and domain information

>PF03178 CPSF_A: CPSF A subunit region; InterPro: IPR004871 This family includes a region that lies towards the C terminus of the cleavage and polyadenylation specificity factor (CPSF) A (160 kDa) subunit	Back alignment and domain information

>PF15492 Nbas_N: Neuroblastoma-amplified sequence, N terminal	Back alignment and domain information

>KOG4649 consensus PQQ (pyrrolo-quinoline quinone) repeat protein [Secondary metabolites biosynthesis, transport and catabolism]	Back alignment and domain information

>KOG2114 consensus Vacuolar assembly/sorting protein PEP5/VPS11 [Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>KOG0882 consensus Cyclophilin-related peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PF08596 Lgl_C: Lethal giant larvae(Lgl) like, C-terminal; InterPro: IPR013905 The Lethal giant larvae (Lgl) tumour suppressor protein is conserved from yeast to mammals	Back alignment and domain information

>PF06433 Me-amine-dh_H: Methylamine dehydrogenase heavy chain (MADH); InterPro: IPR009451 Methylamine dehydrogenase (1	Back alignment and domain information

>PF11768 DUF3312: Protein of unknown function (DUF3312); InterPro: IPR024511 This is a eukaryotic family of uncharacterised proteins that contain WD40 repeats	Back alignment and domain information

>PF11768 DUF3312: Protein of unknown function (DUF3312); InterPro: IPR024511 This is a eukaryotic family of uncharacterised proteins that contain WD40 repeats	Back alignment and domain information

>smart00320 WD40 WD40 repeats	Back alignment and domain information

>PRK02888 nitrous-oxide reductase; Validated	Back alignment and domain information

>PF08553 VID27: VID27 cytoplasmic protein; InterPro: IPR013863 This entry represents fungal and plant proteins and contains many hypothetical proteins	Back alignment and domain information

>KOG4441 consensus Proteins containing BTB/POZ and Kelch domains, involved in regulatory/signal transduction processes [Signal transduction mechanisms; General function prediction only]	Back alignment and domain information

>PRK02888 nitrous-oxide reductase; Validated	Back alignment and domain information

>smart00320 WD40 WD40 repeats	Back alignment and domain information

>PF04053 Coatomer_WDAD: Coatomer WD associated region ; InterPro: IPR006692 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment	Back alignment and domain information

>KOG2314 consensus Translation initiation factor 3, subunit b (eIF-3b) [Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>PHA02713 hypothetical protein; Provisional	Back alignment and domain information

>KOG4441 consensus Proteins containing BTB/POZ and Kelch domains, involved in regulatory/signal transduction processes [Signal transduction mechanisms; General function prediction only]	Back alignment and domain information

>KOG2395 consensus Protein involved in vacuole import and degradation [Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>KOG1008 consensus Uncharacterized conserved protein, contains WD40 repeats [Function unknown]	Back alignment and domain information

>PHA02713 hypothetical protein; Provisional	Back alignment and domain information

>PF04053 Coatomer_WDAD: Coatomer WD associated region ; InterPro: IPR006692 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment	Back alignment and domain information

>PF00780 CNH: CNH domain; InterPro: IPR001180 Based on sequence similarities a domain of homology has been identified in the following proteins []: Citron and Citron kinase	Back alignment and domain information

>KOG3617 consensus WD40 and TPR repeat-containing protein [General function prediction only]	Back alignment and domain information

>PF04841 Vps16_N: Vps16, N-terminal region; InterPro: IPR006926 This protein forms part of the Class C vacuolar protein sorting (Vps) complex	Back alignment and domain information

>PF08596 Lgl_C: Lethal giant larvae(Lgl) like, C-terminal; InterPro: IPR013905 The Lethal giant larvae (Lgl) tumour suppressor protein is conserved from yeast to mammals	Back alignment and domain information

>TIGR03075 PQQ_enz_alc_DH PQQ-dependent dehydrogenase, methanol/ethanol family	Back alignment and domain information

>COG3386 Gluconolactonase [Carbohydrate transport and metabolism]	Back alignment and domain information

>PF14783 BBS2_Mid: Ciliary BBSome complex subunit 2, middle region	Back alignment and domain information

>KOG3621 consensus WD40 repeat-containing protein [General function prediction only]	Back alignment and domain information

>KOG2079 consensus Vacuolar assembly/sorting protein VPS8 [Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>PF03178 CPSF_A: CPSF A subunit region; InterPro: IPR004871 This family includes a region that lies towards the C terminus of the cleavage and polyadenylation specificity factor (CPSF) A (160 kDa) subunit	Back alignment and domain information

>PF06977 SdiA-regulated: SdiA-regulated; InterPro: IPR009722 This entry represents a conserved region approximately 100 residues long within a number of hypothetical bacterial proteins that may be regulated by SdiA, a member of the LuxR family of transcriptional regulators []	Back alignment and domain information

>KOG4640 consensus Anaphase-promoting complex (APC), subunit 4 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG4640 consensus Anaphase-promoting complex (APC), subunit 4 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG2444 consensus WD40 repeat protein [General function prediction only]	Back alignment and domain information

>PRK13616 lipoprotein LpqB; Provisional	Back alignment and domain information

>PF00930 DPPIV_N: Dipeptidyl peptidase IV (DPP IV) N-terminal region; InterPro: IPR002469 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families	Back alignment and domain information

>KOG1897 consensus Damage-specific DNA binding complex, subunit DDB1 [Replication, recombination and repair]	Back alignment and domain information

>PF05804 KAP: Kinesin-associated protein (KAP)	Back alignment and domain information

>COG0823 TolB Periplasmic component of the Tol biopolymer transport system [Intracellular trafficking and secretion]	Back alignment and domain information

>PF14783 BBS2_Mid: Ciliary BBSome complex subunit 2, middle region	Back alignment and domain information

>PHA03098 kelch-like protein; Provisional	Back alignment and domain information

>COG3490 Uncharacterized protein conserved in bacteria [Function unknown]	Back alignment and domain information

>TIGR03074 PQQ_membr_DH membrane-bound PQQ-dependent dehydrogenase, glucose/quinate/shikimate family	Back alignment and domain information

>TIGR03075 PQQ_enz_alc_DH PQQ-dependent dehydrogenase, methanol/ethanol family	Back alignment and domain information

>KOG1008 consensus Uncharacterized conserved protein, contains WD40 repeats [Function unknown]	Back alignment and domain information

>COG0823 TolB Periplasmic component of the Tol biopolymer transport system [Intracellular trafficking and secretion]	Back alignment and domain information

>COG3391 Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>PF01602 Adaptin_N: Adaptin N terminal region; InterPro: IPR002553 Proteins synthesized on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment	Back alignment and domain information

>PF05096 Glu_cyclase_2: Glutamine cyclotransferase; InterPro: IPR007788 This family of enzymes 2	Back alignment and domain information

>PF05804 KAP: Kinesin-associated protein (KAP)	Back alignment and domain information

>COG3391 Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>KOG2444 consensus WD40 repeat protein [General function prediction only]	Back alignment and domain information

>PF02897 Peptidase_S9_N: Prolyl oligopeptidase, N-terminal beta-propeller domain; InterPro: IPR004106 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families	Back alignment and domain information

>PF08553 VID27: VID27 cytoplasmic protein; InterPro: IPR013863 This entry represents fungal and plant proteins and contains many hypothetical proteins	Back alignment and domain information

>KOG2395 consensus Protein involved in vacuole import and degradation [Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>PHA03098 kelch-like protein; Provisional	Back alignment and domain information

>PF14727 PHTB1_N: PTHB1 N-terminus	Back alignment and domain information

>COG3386 Gluconolactonase [Carbohydrate transport and metabolism]	Back alignment and domain information

>PF02897 Peptidase_S9_N: Prolyl oligopeptidase, N-terminal beta-propeller domain; InterPro: IPR004106 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families	Back alignment and domain information

>COG5276 Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>KOG2079 consensus Vacuolar assembly/sorting protein VPS8 [Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>KOG2280 consensus Vacuolar assembly/sorting protein VPS16 [Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>PF12234 Rav1p_C: RAVE protein 1 C terminal; InterPro: IPR022033 This domain family is found in eukaryotes, and is typically between 621 and 644 amino acids in length	Back alignment and domain information

>PRK13800 putative oxidoreductase/HEAT repeat-containing protein; Provisional	Back alignment and domain information

>PHA02790 Kelch-like protein; Provisional	Back alignment and domain information

>PHA02790 Kelch-like protein; Provisional	Back alignment and domain information

>PF12894 Apc4_WD40: Anaphase-promoting complex subunit 4 WD40 domain	Back alignment and domain information

>COG3490 Uncharacterized protein conserved in bacteria [Function unknown]	Back alignment and domain information

>PF10508 Proteasom_PSMB: Proteasome non-ATPase 26S subunit; InterPro: IPR019538 The 26S proteasome is an enzymatic complex that degrades ubiquitinated proteins in eukaryotic cells	Back alignment and domain information

>PF12894 Apc4_WD40: Anaphase-promoting complex subunit 4 WD40 domain	Back alignment and domain information

>KOG4499 consensus Ca2+-binding protein Regucalcin/SMP30 [Inorganic ion transport and metabolism; Signal transduction mechanisms]	Back alignment and domain information

>PF01602 Adaptin_N: Adaptin N terminal region; InterPro: IPR002553 Proteins synthesized on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment	Back alignment and domain information

>PF14583 Pectate_lyase22: Oligogalacturonate lyase; PDB: 3C5M_C 3PE7_A	Back alignment and domain information

>PF14761 HPS3_N: Hermansky-Pudlak syndrome 3	Back alignment and domain information

>COG5276 Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>PF05096 Glu_cyclase_2: Glutamine cyclotransferase; InterPro: IPR007788 This family of enzymes 2	Back alignment and domain information

>KOG3036 consensus Protein involved in cell differentiation/sexual development [General function prediction only]	Back alignment and domain information

>PF12234 Rav1p_C: RAVE protein 1 C terminal; InterPro: IPR022033 This domain family is found in eukaryotes, and is typically between 621 and 644 amino acids in length	Back alignment and domain information

>KOG1897 consensus Damage-specific DNA binding complex, subunit DDB1 [Replication, recombination and repair]	Back alignment and domain information

>KOG4499 consensus Ca2+-binding protein Regucalcin/SMP30 [Inorganic ion transport and metabolism; Signal transduction mechanisms]	Back alignment and domain information

>cd00020 ARM Armadillo/beta-catenin-like repeats	Back alignment and domain information

>KOG2280 consensus Vacuolar assembly/sorting protein VPS16 [Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>KOG1916 consensus Nuclear protein, contains WD40 repeats [General function prediction only]	Back alignment and domain information

>KOG1983 consensus Tomosyn and related SNARE-interacting proteins [Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>PF14655 RAB3GAP2_N: Rab3 GTPase-activating protein regulatory subunit N-terminus	Back alignment and domain information

>PRK09687 putative lyase; Provisional	Back alignment and domain information

>KOG2171 consensus Karyopherin (importin) beta 3 [Nuclear structure; Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>COG3292 Predicted periplasmic ligand-binding sensor domain [Signal transduction mechanisms]	Back alignment and domain information

>KOG2160 consensus Armadillo/beta-catenin-like repeat-containing protein [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>COG3204 Uncharacterized protein conserved in bacteria [Function unknown]	Back alignment and domain information

>cd00256 VATPase_H VATPase_H, regulatory vacuolar ATP synthase subunit H (Vma13p); activation component of the peripheral V1 complex of V-ATPase, a heteromultimeric enzyme which uses ATP to actively transport protons into organelles and extracellular compartments	Back alignment and domain information

>KOG0166 consensus Karyopherin (importin) alpha [Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>PF10395 Utp8: Utp8 family; InterPro: IPR018843 Utp8 is an essential component of the nuclear tRNA export machinery in Saccharomyces cerevisiae (Baker's yeast)	Back alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST

Original result of BLAST against Protein Data Bank

ID	Alignment Graph	Length	Definition	E-value
Query		1349
1erj_A		393	Crystal Structure Of The C-Terminal Wd40 Domain Of		4e-05

>pdb|1ERJ|A Chain A, Crystal Structure Of The C-Terminal Wd40 Domain Of Tup1 Length = 393

Back alignment and structure

Iteration: 1

Score = 47.8 bits (112), Expect = 4e-05, Method: Compositional matrix adjust. Identities = 30/104 (28%), Positives = 53/104 (50%), Gaps = 7/104 (6%) Query: 1081 LLCSGFSDGSIKMWDIKKQSAMLVWDVKEHRKAVTSFSLFEPGESLLSGSADKTIGVWQM 1140 L +G D I++WDI+ + +++ ++ H + + S F G+ L+SGS D+T+ +W + Sbjct: 137 FLATGAEDRLIRIWDIENRKIVMI--LQGHEQDIYSLDYFPSGDKLVSGSGDRTVRIWDL 194 Query: 1141 VQRKLEL---IEVIATKEPIRKLDTYGKTIFASTQGHRMKVIDS 1181 + L IE T + D GK I A + ++V DS Sbjct: 195 RTGQCSLTLSIEDGVTTVAVSPGD--GKYIAAGSLDRAVRVWDS 236

PyMOL of 1erj

Structure Templates Detected by HHsearch

Original result of HHsearch against PDB70 database

No hit with probability above 80.00

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST

Original result of RPS-BLAST against SCOP70(version1.75) database

ID	Alignment Graph	Length	Definition	E-value
Query		1349
d1k8kc_		371	b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1	4e-08
d1tbga_		340	b.69.4.1 (A:) beta1-subunit of the signal-transduc	5e-08
d1tbga_		340	b.69.4.1 (A:) beta1-subunit of the signal-transduc	6e-05
d1tbga_		340	b.69.4.1 (A:) beta1-subunit of the signal-transduc	2e-04
d1nr0a2		299	b.69.4.1 (A:313-611) Actin interacting protein 1 {	9e-08
d1nr0a2		299	b.69.4.1 (A:313-611) Actin interacting protein 1 {	0.002
d1pgua1		325	b.69.4.1 (A:2-326) Actin interacting protein 1 {Ba	1e-07
d1vyhc1		317	b.69.4.1 (C:92-408) Platelet-activating factor ace	2e-07
d1vyhc1		317	b.69.4.1 (C:92-408) Platelet-activating factor ace	7e-06
d1vyhc1		317	b.69.4.1 (C:92-408) Platelet-activating factor ace	3e-05
d1pgua2		287	b.69.4.1 (A:327-613) Actin interacting protein 1 {	2e-07
d1gxra_		337	b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Hum	5e-07
d1gxra_		337	b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Hum	0.002
d1erja_		388	b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yea	3e-06
d1p22a2		293	b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (be	4e-06
d1p22a2		293	b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (be	0.002
d1nr0a1		311	b.69.4.1 (A:2-312) Actin interacting protein 1 {Ne	8e-06
d1nr0a1		311	b.69.4.1 (A:2-312) Actin interacting protein 1 {Ne	0.003
d1nexb2		355	b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker'	5e-05
d1nexb2		355	b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker'	1e-04
d2ovrb2		342	b.69.4.1 (B:2365-2706) F-box/WD repeat-containing	6e-05
d2ovrb2		342	b.69.4.1 (B:2365-2706) F-box/WD repeat-containing	0.004
d1sq9a_		393	b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Bake	1e-04
d1yfqa_		342	b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Bake	3e-04
d1k32a3		360	b.69.9.1 (A:320-679) Tricorn protease domain 2 {Ar	4e-04

>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} Length = 371	Back information, alignment and structure


class: All beta proteins
fold: 7-bladed beta-propeller
superfamily: WD40 repeat-like
family: WD40-repeat
domain: Arp2/3 complex 41 kDa subunit ARPC1
species: Cow (Bos taurus) [TaxId: 9913]

 Score = 54.5 bits (129), Expect = 4e-08
 Identities = 9/60 (15%), Positives = 24/60 (40%)

Query: 1081 LLCSGFSDGSIKMWDIKKQSAMLVWDVKEHRKAVTSFSLFEPGESLLSGSADKTIGVWQM 1140
             +    ++  + +++      + V ++KEH   VT          +++   D+   VW +
Sbjct: 21   QIAICPNNHEVHIYEKSGNKWVQVHELKEHNGQVTGVDWAPDSNRIVTCGTDRNAYVWTL 80

PyMOL of d1k8kc_

>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Length = 340	Back information, alignment and structure

>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Length = 340	Back information, alignment and structure

>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Length = 340	Back information, alignment and structure

>d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 299	Back information, alignment and structure

>d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 299	Back information, alignment and structure

>d1pgua1 b.69.4.1 (A:2-326) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 325	Back information, alignment and structure

>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Length = 317	Back information, alignment and structure

>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Length = 317	Back information, alignment and structure

>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Length = 317	Back information, alignment and structure

>d1pgua2 b.69.4.1 (A:327-613) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 287	Back information, alignment and structure

>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 337	Back information, alignment and structure

>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 337	Back information, alignment and structure

>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 388	Back information, alignment and structure

>d1p22a2 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} Length = 293	Back information, alignment and structure

>d1p22a2 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} Length = 293	Back information, alignment and structure

>d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 311	Back information, alignment and structure

>d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 311	Back information, alignment and structure

>d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 355	Back information, alignment and structure

>d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 355	Back information, alignment and structure

>d2ovrb2 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Length = 342	Back information, alignment and structure

>d2ovrb2 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Length = 342	Back information, alignment and structure

>d1sq9a_ b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 393	Back information, alignment and structure

>d1yfqa_ b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 342	Back information, alignment and structure

>d1k32a3 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Length = 360	Back information, alignment and structure

Homologous Domains Detected by HHsearch

Original result of HHsearch against SCOP70(version1.75) database

ID	Alignment Graph	Length	Definition	Probability
Query		1349
d1gxra_		337	Groucho/tle1, C-terminal domain {Human (Homo sapie	100.0
d1erja_		388	Tup1, C-terminal domain {Baker's yeast (Saccharomy	100.0
d1tbga_		340	beta1-subunit of the signal-transducing G protein	100.0
d1nr0a1		311	Actin interacting protein 1 {Nematode (Caenorhabdi	100.0
d1vyhc1		317	Platelet-activating factor acetylhydrolase IB subu	100.0
d1k8kc_		371	Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taur	100.0
d1nr0a2		299	Actin interacting protein 1 {Nematode (Caenorhabdi	99.98
d1nexb2		355	Cdc4 propeller domain {Baker's yeast (Saccharomyce	99.98
d1p22a2		293	F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Hom	99.97
d2ovrb2		342	F-box/WD repeat-containing protein 7, FBXW7 {Human	99.97
d1gxra_		337	Groucho/tle1, C-terminal domain {Human (Homo sapie	99.97
d1sq9a_		393	Antiviral protein Ski8 (Ski8p) {Baker's yeast (Sac	99.97
d1nexb2		355	Cdc4 propeller domain {Baker's yeast (Saccharomyce	99.96
d1yfqa_		342	Cell cycle arrest protein BUB3 {Baker's yeast (Sac	99.96
d1nr0a1		311	Actin interacting protein 1 {Nematode (Caenorhabdi	99.96
d1pgua1		325	Actin interacting protein 1 {Baker's yeast (Saccha	99.96
d1pgua2		287	Actin interacting protein 1 {Baker's yeast (Saccha	99.96
d1erja_		388	Tup1, C-terminal domain {Baker's yeast (Saccharomy	99.96
d2ovrb2		342	F-box/WD repeat-containing protein 7, FBXW7 {Human	99.95
d1vyhc1		317	Platelet-activating factor acetylhydrolase IB subu	99.95
d1tbga_		340	beta1-subunit of the signal-transducing G protein	99.95
d1k8kc_		371	Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taur	99.95
d1nr0a2		299	Actin interacting protein 1 {Nematode (Caenorhabdi	99.94
d1p22a2		293	F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Hom	99.92
d1sq9a_		393	Antiviral protein Ski8 (Ski8p) {Baker's yeast (Sac	99.91
d1pgua1		325	Actin interacting protein 1 {Baker's yeast (Saccha	99.91
d1pgua2		287	Actin interacting protein 1 {Baker's yeast (Saccha	99.88
d1yfqa_		342	Cell cycle arrest protein BUB3 {Baker's yeast (Sac	99.87
d1hzua2		426	C-terminal (heme d1) domain of cytochrome cd1-nitr	99.86
d1l0qa2		301	Surface layer protein {Archaeon Methanosarcina maz	99.84
d1k32a3		360	Tricorn protease domain 2 {Archaeon Thermoplasma a	99.83
d1k32a3		360	Tricorn protease domain 2 {Archaeon Thermoplasma a	99.82
d1pbyb_		337	Quinohemoprotein amine dehydrogenase B chain {Para	99.77
d1hzua2		426	C-terminal (heme d1) domain of cytochrome cd1-nitr	99.76
d1qksa2		432	C-terminal (heme d1) domain of cytochrome cd1-nitr	99.74
d1jmxb_		346	Quinohemoprotein amine dehydrogenase B chain {Pseu	99.74
d1l0qa2		301	Surface layer protein {Archaeon Methanosarcina maz	99.74
d1qksa2		432	C-terminal (heme d1) domain of cytochrome cd1-nitr	99.69
d2madh_		373	Methylamine dehydrogenase, H-chain {Gram negative	99.69
d1ri6a_		333	Putative isomerase YbhE {Escherichia coli [TaxId:	99.66
d1pbyb_		337	Quinohemoprotein amine dehydrogenase B chain {Para	99.65
d2madh_		373	Methylamine dehydrogenase, H-chain {Gram negative	99.61
d2bbkh_		355	Methylamine dehydrogenase, H-chain {Paracoccus den	99.58
d1jmxb_		346	Quinohemoprotein amine dehydrogenase B chain {Pseu	99.56
d1ri6a_		333	Putative isomerase YbhE {Escherichia coli [TaxId:	99.55
d2bbkh_		355	Methylamine dehydrogenase, H-chain {Paracoccus den	99.46
d1mdah_		368	Methylamine dehydrogenase, H-chain {Paracoccus den	99.41
d1mdah_		368	Methylamine dehydrogenase, H-chain {Paracoccus den	99.27
d2bgra1		470	Dipeptidyl peptidase IV/CD26, N-terminal domain {P	99.11
d2bgra1		470	Dipeptidyl peptidase IV/CD26, N-terminal domain {P	98.82
d1qnia2		441	Nitrous oxide reductase, N-terminal domain {Pseudo	98.81
d1qnia2		441	Nitrous oxide reductase, N-terminal domain {Pseudo	98.76
d1q1sc_		434	Importin alpha {Mouse (Mus musculus) [TaxId: 10090	98.49
d2hqsa1		269	TolB, C-terminal domain {Escherichia coli [TaxId:	98.48
d1jdha_		529	beta-Catenin {Human (Homo sapiens) [TaxId: 9606]}	98.36
d1jdha_		529	beta-Catenin {Human (Homo sapiens) [TaxId: 9606]}	98.27
d1jofa_		365	3-carboxy-cis,cis-mucoante lactonizing enzyme {Neu	98.26
d1q1sc_		434	Importin alpha {Mouse (Mus musculus) [TaxId: 10090	98.17
d2p4oa1		302	Hypothetical protein All0351 homologue {Nostoc pun	98.08
d2p4oa1		302	Hypothetical protein All0351 homologue {Nostoc pun	98.05
d1rwia_		260	Serine/threonine-protein kinase PknD {Mycobacteriu	97.97
d1pjxa_		314	Diisopropylfluorophosphatase (phosphotriesterase,	97.89
d1q7fa_		279	Brain tumor cg10719-pa {Fruit fly (Drosophila mela	97.8
d1wa5b_		503	Karyopherin alpha {Baker's yeast (Saccharomyces ce	97.74
d1jofa_		365	3-carboxy-cis,cis-mucoante lactonizing enzyme {Neu	97.73
d1pjxa_		314	Diisopropylfluorophosphatase (phosphotriesterase,	97.64
d1q7fa_		279	Brain tumor cg10719-pa {Fruit fly (Drosophila mela	97.51
d1wa5b_		503	Karyopherin alpha {Baker's yeast (Saccharomyces ce	97.35
d1rwia_		260	Serine/threonine-protein kinase PknD {Mycobacteriu	97.3
d1xqra1		264	Hsp70-binding protein 1 (HspBP1) {Human (Homo sapi	97.19
d1xfda1		465	Dipeptidyl aminopeptidase-like protein 6, DPP6, N-	97.03
d1xqra1		264	Hsp70-binding protein 1 (HspBP1) {Human (Homo sapi	96.52
d2dg1a1		319	Lactonase Drp35 {Staphylococcus aureus [TaxId: 128	96.39
d2ghsa1		295	Regucalcin {Agrobacterium tumefaciens [TaxId: 358]	96.34
d1k32a2		281	Tricorn protease N-terminal domain {Archaeon Therm	96.15
d1xm9a1		457	Plakophilin 1 {Human (Homo sapiens) [TaxId: 9606]}	95.74
d1xm9a1		457	Plakophilin 1 {Human (Homo sapiens) [TaxId: 9606]}	95.54
d1xfda1		465	Dipeptidyl aminopeptidase-like protein 6, DPP6, N-	94.2
d2dg1a1		319	Lactonase Drp35 {Staphylococcus aureus [TaxId: 128	94.0
d1k3ia3		387	Galactose oxidase, central domain {Fungi (Fusarium	91.0
d1kb0a2		573	Quinoprotein alcohol dehydrogenase, N-terminal dom	87.94
d2ad6a1		571	Methanol dehydrogenase, heavy chain {Methylophilus	87.84
d1k32a2		281	Tricorn protease N-terminal domain {Archaeon Therm	80.55
d2ghsa1		295	Regucalcin {Agrobacterium tumefaciens [TaxId: 358]	80.47

>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

class: All beta proteins
fold: 7-bladed beta-propeller
superfamily: WD40 repeat-like
family: WD40-repeat
domain: Groucho/tle1, C-terminal domain
species: Human (Homo sapiens) [TaxId: 9606]

Probab=100.00  E-value=1.3e-30  Score=243.38  Aligned_cols=273  Identities=14%  Similarity=0.219  Sum_probs=222.7

Q ss_pred             CCCCCEEEEEEC-CC-EEEEEECCCCEEEEECCCCC---EEEEEEECCCCCCEEEEEECCCCCEEEEEECCCEEEEEECC
Q ss_conf             688878999981-99-99999879919999889996---14899841478768999995899999999489819999856
Q 000694         1067 KCSGAVTALIYY-KG-LLCSGFSDGSIKMWDIKKQS---AMLVWDVKEHRKAVTSFSLFEPGESLLSGSADKTIGVWQMV 1141 (1349)
Q Consensus      1067 gH~~~VtsIafs-dg-~LaSGS~DGtIrIWDl~s~~---~~li~tL~gHss~VtsIafSPdg~~LvSGS~DGtIrIWDl~ 1141 (1349)
                      +|.+.|+|++|+ +| +|++|+ ||.|+|||+.++.   ........+|.+.|.+++|+|++++|++|+.||+|++||+.
T Consensus        49 ~H~~~V~~v~fs~~g~~latg~-dg~V~iWd~~~~~~~~~~~~~~~~~h~~~I~~v~~s~dg~~l~s~~~dg~i~iwd~~  127 (337)
T d1gxra_          49 NHGEVVCAVTISNPTRHVYTGG-KGCVKVWDISHPGNKSPVSQLDCLNRDNYIRSCKLLPDGCTLIVGGEASTLSIWDLA  127 (337)
T ss_dssp             CCSSCCCEEEECSSSSEEEEEC-BSEEEEEETTSTTCCSCSEEEECSCTTSBEEEEEECTTSSEEEEEESSSEEEEEECC
T ss_pred             CCCCCEEEEEECCCCCEEEEEE-CCEEEEEECCCCCCCCEEEEEEECCCCCCEEEEEECCCCCEEEEEECCCCCCCCCCC
T ss_conf             9999289999989999999997-998899773677633116876404889968999986799889886123321111111


Q ss_pred             CCEEE-EEEEECCCCCEEE--ECCCCCEEEEEECCCEEEEEECCCC-CEEECC--CCCEEEEEE-ECC-EEEEEECCCCE
Q ss_conf             89189-9987247888587--5279997999943981999956985-200004--778479985-099-79999679829
Q 000694         1142 QRKLE-LIEVIATKEPIRK--LDTYGKTIFASTQGHRMKVIDSSRT-LKDIYR--SKGIKSMSV-VQG-KIYIGCMDSSI 1213 (1349)
Q Consensus      1142 tgkl~-~~~~~~h~~~I~s--Ls~~g~~IvsgS~DgtIkIWDl~~~-~~~~~~--~~~V~sIa~-~dg-~LiSGs~DGsI 1213 (1349)
                      ..... ......|...+..  +.+++..+++++.++.+++|++... ......  ...+.++++ +++ .+++|+.|+.+
T Consensus       128 ~~~~~~~~~~~~~~~~v~~~~~~~~~~~l~s~~~d~~i~~~~~~~~~~~~~~~~~~~~v~~l~~s~~~~~~~~~~~d~~v  207 (337)
T d1gxra_         128 APTPRIKAELTSSAPACYALAISPDSKVCFSCCSDGNIAVWDLHNQTLVRQFQGHTDGASCIDISNDGTKLWTGGLDNTV  207 (337)
T ss_dssp             CC--EEEEEEECSSSCEEEEEECTTSSEEEEEETTSCEEEEETTTTEEEEEECCCSSCEEEEEECTTSSEEEEEETTSEE
T ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
T ss_conf             11111111111111111111111111111111111111111111111111111111111101234443211223566553


Q ss_pred             EEEECCCCCCCCCCCCCCCCCCCCCCEEEEEECCCCEEEEEEECCCCEEEEEECCCCCEEEEECCCCCCEEEEEEECCCC
Q ss_conf             99984577200002564112358988599998189419999962899499997999973898247898758999926999
Q 000694         1214 QELAVSNNVEREIKAPFKSWRLQSKPINSLVVYKDWLYSASSSVEGSNIKEWRRHRKPQISIAPEKGTTIQAMAVVEDFI 1293 (1349)
Q Consensus      1214 ~IWDl~t~~~~~I~~~~k~~~~h~~~I~sI~~spd~i~lvs~S~dDgtIrIWDi~t~~li~~l~gH~~~VtsIafSPDg~ 1293 (1349)
                      ++||+++++....       ..+...+.++.+++++..+++++ .++.+++||.+++... ....|...|++++|+|++.
T Consensus       208 ~i~d~~~~~~~~~-------~~~~~~i~~l~~~~~~~~l~~~~-~d~~i~i~d~~~~~~~-~~~~~~~~i~~v~~s~~g~  278 (337)
T d1gxra_         208 RSWDLREGRQLQQ-------HDFTSQIFSLGYCPTGEWLAVGM-ESSNVEVLHVNKPDKY-QLHLHESCVLSLKFAYCGK  278 (337)
T ss_dssp             EEEETTTTEEEEE-------EECSSCEEEEEECTTSSEEEEEE-TTSCEEEEETTSSCEE-EECCCSSCEEEEEECTTSS
T ss_pred             CCCCCCCCEEECC-------CCCCCCEEEEEECCCCCCCCEEC-CCCCCCCCCCCCCCCC-CCCCCCCCCCEEEECCCCC
T ss_conf             2111111000002-------46666157999715303000000-2564211111111100-0012456541699989999


Q ss_pred             EEEEEECCCCEEEEECCCCCEEEEEECCCCEEEEEEC--CCEEEEEECCCCEEEEECC
Q ss_conf             9999968991999988999179999279976999983--9999999889919995079
Q 000694         1294 YLNYNSSASSLQIWLRGTQQKVGRISAGSKITSLLTA--NDIVLCGTETGLIKGWIPL 1349 (1349)
Q Consensus      1294 ~LaSGS~DGtIrIWDl~sg~~i~sl~~~s~VtsLs~d--g~~LvSGS~DGtIrIWD~L 1349 (1349)
                      ++++|+.||.|++|+..+++.+..+.++..|++++|+  +++|++|+.||+|++||.+
T Consensus       279 ~l~s~s~Dg~i~iwd~~~~~~~~~~~~~~~v~~~~~s~d~~~l~t~s~D~~I~vWdl~  336 (337)
T d1gxra_         279 WFVSTGKDNLLNAWRTPYGASIFQSKESSSVLSCDISVDDKYIVTGSGDKKATVYEVI  336 (337)
T ss_dssp             EEEEEETTSEEEEEETTTCCEEEEEECSSCEEEEEECTTSCEEEEEETTSCEEEEEEE
T ss_pred             EEEEEECCCEEEEEECCCCCEEEECCCCCCEEEEEEECCCCEEEEEECCCEEEEEEEE
T ss_conf             9999948996999989999799992699987999992799999999089969999778

PyMOL of d1gxra_

>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]}	Back information, alignment and structure

>d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]}	Back information, alignment and structure

>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]}	Back information, alignment and structure

>d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]}	Back information, alignment and structure

>d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1p22a2 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2ovrb2 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1sq9a_ b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1yfqa_ b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]}	Back information, alignment and structure

>d1pgua1 b.69.4.1 (A:2-326) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1pgua2 b.69.4.1 (A:327-613) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d2ovrb2 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]}	Back information, alignment and structure

>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]}	Back information, alignment and structure

>d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]}	Back information, alignment and structure

>d1p22a2 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1sq9a_ b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1pgua1 b.69.4.1 (A:2-326) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1pgua2 b.69.4.1 (A:327-613) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1yfqa_ b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1hzua2 b.70.2.1 (A:118-543) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Pseudomonas aeruginosa [TaxId: 287]}	Back information, alignment and structure

>d1l0qa2 b.69.2.3 (A:1-301) Surface layer protein {Archaeon Methanosarcina mazei [TaxId: 2209]}	Back information, alignment and structure

>d1k32a3 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Archaeon Thermoplasma acidophilum [TaxId: 2303]}	Back information, alignment and structure

>d1k32a3 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Archaeon Thermoplasma acidophilum [TaxId: 2303]}	Back information, alignment and structure

>d1pbyb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Paracoccus denitrificans [TaxId: 266]}	Back information, alignment and structure

>d1hzua2 b.70.2.1 (A:118-543) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Pseudomonas aeruginosa [TaxId: 287]}	Back information, alignment and structure

>d1qksa2 b.70.2.1 (A:136-567) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Paracoccus denitrificans [TaxId: 266]}	Back information, alignment and structure

>d1jmxb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Pseudomonas putida [TaxId: 303]}	Back information, alignment and structure

>d1l0qa2 b.69.2.3 (A:1-301) Surface layer protein {Archaeon Methanosarcina mazei [TaxId: 2209]}	Back information, alignment and structure

>d1qksa2 b.70.2.1 (A:136-567) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Paracoccus denitrificans [TaxId: 266]}	Back information, alignment and structure

>d2madh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Gram negative methylotrophic bacteria (Thiobacillus versutus) [TaxId: 34007]}	Back information, alignment and structure

>d1ri6a_ b.69.11.1 (A:) Putative isomerase YbhE {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1pbyb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Paracoccus denitrificans [TaxId: 266]}	Back information, alignment and structure

>d2madh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Gram negative methylotrophic bacteria (Thiobacillus versutus) [TaxId: 34007]}	Back information, alignment and structure

>d2bbkh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]}	Back information, alignment and structure

>d1jmxb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Pseudomonas putida [TaxId: 303]}	Back information, alignment and structure

>d1ri6a_ b.69.11.1 (A:) Putative isomerase YbhE {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d2bbkh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]}	Back information, alignment and structure

>d1mdah_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]}	Back information, alignment and structure

>d1mdah_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]}	Back information, alignment and structure

>d2bgra1 b.70.3.1 (A:39-508) Dipeptidyl peptidase IV/CD26, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]}	Back information, alignment and structure

>d2bgra1 b.70.3.1 (A:39-508) Dipeptidyl peptidase IV/CD26, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]}	Back information, alignment and structure

>d1qnia2 b.69.3.1 (A:10-450) Nitrous oxide reductase, N-terminal domain {Pseudomonas nautica [TaxId: 2743]}	Back information, alignment and structure

>d1qnia2 b.69.3.1 (A:10-450) Nitrous oxide reductase, N-terminal domain {Pseudomonas nautica [TaxId: 2743]}	Back information, alignment and structure

>d1q1sc_ a.118.1.1 (C:) Importin alpha {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d2hqsa1 b.68.4.1 (A:163-431) TolB, C-terminal domain {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1jdha_ a.118.1.1 (A:) beta-Catenin {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1jdha_ a.118.1.1 (A:) beta-Catenin {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1jofa_ b.69.10.1 (A:) 3-carboxy-cis,cis-mucoante lactonizing enzyme {Neurospora crassa [TaxId: 5141]}	Back information, alignment and structure

>d1q1sc_ a.118.1.1 (C:) Importin alpha {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d2p4oa1 b.68.6.3 (A:4-305) Hypothetical protein All0351 homologue {Nostoc punctiforme [TaxId: 272131]}	Back information, alignment and structure

>d2p4oa1 b.68.6.3 (A:4-305) Hypothetical protein All0351 homologue {Nostoc punctiforme [TaxId: 272131]}	Back information, alignment and structure

>d1rwia_ b.68.9.1 (A:) Serine/threonine-protein kinase PknD {Mycobacterium tuberculosis [TaxId: 1773]}	Back information, alignment and structure

>d1pjxa_ b.68.6.1 (A:) Diisopropylfluorophosphatase (phosphotriesterase, DFP) {Squid (Loligo vulgaris) [TaxId: 6622]}	Back information, alignment and structure

>d1q7fa_ b.68.9.1 (A:) Brain tumor cg10719-pa {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}	Back information, alignment and structure

>d1wa5b_ a.118.1.1 (B:) Karyopherin alpha {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1jofa_ b.69.10.1 (A:) 3-carboxy-cis,cis-mucoante lactonizing enzyme {Neurospora crassa [TaxId: 5141]}	Back information, alignment and structure

>d1pjxa_ b.68.6.1 (A:) Diisopropylfluorophosphatase (phosphotriesterase, DFP) {Squid (Loligo vulgaris) [TaxId: 6622]}	Back information, alignment and structure

>d1q7fa_ b.68.9.1 (A:) Brain tumor cg10719-pa {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}	Back information, alignment and structure

>d1wa5b_ a.118.1.1 (B:) Karyopherin alpha {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1rwia_ b.68.9.1 (A:) Serine/threonine-protein kinase PknD {Mycobacterium tuberculosis [TaxId: 1773]}	Back information, alignment and structure

>d1xqra1 a.118.1.21 (A:87-350) Hsp70-binding protein 1 (HspBP1) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1xfda1 b.70.3.1 (A:127-591) Dipeptidyl aminopeptidase-like protein 6, DPP6, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1xqra1 a.118.1.21 (A:87-350) Hsp70-binding protein 1 (HspBP1) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2dg1a1 b.68.6.1 (A:6-324) Lactonase Drp35 {Staphylococcus aureus [TaxId: 1280]}	Back information, alignment and structure

>d2ghsa1 b.68.6.1 (A:20-314) Regucalcin {Agrobacterium tumefaciens [TaxId: 358]}	Back information, alignment and structure

>d1k32a2 b.68.7.1 (A:39-319) Tricorn protease N-terminal domain {Archaeon Thermoplasma acidophilum [TaxId: 2303]}	Back information, alignment and structure

>d1xm9a1 a.118.1.24 (A:244-700) Plakophilin 1 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1xm9a1 a.118.1.24 (A:244-700) Plakophilin 1 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1xfda1 b.70.3.1 (A:127-591) Dipeptidyl aminopeptidase-like protein 6, DPP6, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2dg1a1 b.68.6.1 (A:6-324) Lactonase Drp35 {Staphylococcus aureus [TaxId: 1280]}	Back information, alignment and structure

>d1k3ia3 b.69.1.1 (A:151-537) Galactose oxidase, central domain {Fungi (Fusarium sp.) [TaxId: 29916]}	Back information, alignment and structure

>d1kb0a2 b.70.1.1 (A:1-573) Quinoprotein alcohol dehydrogenase, N-terminal domain {Comamonas testosteroni [TaxId: 285]}	Back information, alignment and structure

>d2ad6a1 b.70.1.1 (A:1-571) Methanol dehydrogenase, heavy chain {Methylophilus methylotrophus, w3a1 [TaxId: 17]}	Back information, alignment and structure

>d1k32a2 b.68.7.1 (A:39-319) Tricorn protease N-terminal domain {Archaeon Thermoplasma acidophilum [TaxId: 2303]}	Back information, alignment and structure

>d2ghsa1 b.68.6.1 (A:20-314) Regucalcin {Agrobacterium tumefaciens [TaxId: 358]}	Back information, alignment and structure