Citrus Sinensis ID: 000695
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 1349 | ||||||
| 255564713 | 1872 | eukaryotic translation initiation factor | 0.982 | 0.708 | 0.686 | 0.0 | |
| 359489732 | 1863 | PREDICTED: protein KIAA0664 homolog [Vit | 0.975 | 0.706 | 0.682 | 0.0 | |
| 356520282 | 1840 | PREDICTED: uncharacterized protein LOC10 | 0.966 | 0.708 | 0.648 | 0.0 | |
| 356560227 | 1846 | PREDICTED: protein TIF31 homolog [Glycin | 0.968 | 0.707 | 0.641 | 0.0 | |
| 449487415 | 1856 | PREDICTED: LOW QUALITY PROTEIN: uncharac | 0.954 | 0.693 | 0.632 | 0.0 | |
| 449445826 | 1856 | PREDICTED: uncharacterized protein LOC10 | 0.954 | 0.693 | 0.632 | 0.0 | |
| 358349301 | 1350 | hypothetical protein MTR_139s0028 [Medic | 0.952 | 0.951 | 0.613 | 0.0 | |
| 334182214 | 1787 | tetratricopeptide repeat-containing prot | 0.899 | 0.678 | 0.574 | 0.0 | |
| 42561588 | 1797 | tetratricopeptide repeat-containing prot | 0.899 | 0.675 | 0.570 | 0.0 | |
| 297842986 | 1793 | tetratricopeptide repeat-containing prot | 0.901 | 0.678 | 0.568 | 0.0 |
| >gi|255564713|ref|XP_002523351.1| eukaryotic translation initiation factor 3 subunit, putative [Ricinus communis] gi|223537439|gb|EEF39067.1| eukaryotic translation initiation factor 3 subunit, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
Score = 1816 bits (4704), Expect = 0.0, Method: Compositional matrix adjust.
Identities = 926/1349 (68%), Positives = 1081/1349 (80%), Gaps = 23/1349 (1%)
Query: 2 FVERLLEESIAKLEEEKPEREHFVRWELGACWIQHLQDQKNAEKDKKLSKEKAKKLSNEK 61
FVER+LEESIAKLE E+ E++HFVRWELGACWIQHLQDQKN EKDKK EK K+ S+EK
Sbjct: 544 FVERILEESIAKLEHEELEQDHFVRWELGACWIQHLQDQKNTEKDKKSPTEKNKRPSSEK 603
Query: 62 AKSEMKVEGLGTPLKSLKNNRKKSEGSNHKIHSETLKSQADGVNGESEKATSASIEARLE 121
EMKVEGLGTPL+SLKN++KK E +N KI SE +S DG+ GE E A SAS+E++LE
Sbjct: 604 ---EMKVEGLGTPLRSLKNSKKKLEETNMKIQSERSRSSIDGMVGEIENANSASMESQLE 660
Query: 122 SRDKENELALKNLLSDEAFARLKESETGLHCKSLEELIDLSHNYYVEVALPKLVTDFGSL 181
+ KENEL L+ +LSD AF RL+ES+TGLHCKSL+EL+D+S YY++VALPKLV DFGSL
Sbjct: 661 TTAKENELTLQMMLSDSAFTRLRESDTGLHCKSLQELLDMSQKYYIDVALPKLVADFGSL 720
Query: 182 ELSPVDGRTLTDFMHTRGLQMRSLGHVVKLSEKLSHVQSLCIHEMIVRAFKHIIQAVISA 241
ELSPVDGRTLTDFMHTRGL+MRSLGHVVKLSEKLSHVQSLCIHEMIVRA+KHI+QAVI+A
Sbjct: 721 ELSPVDGRTLTDFMHTRGLRMRSLGHVVKLSEKLSHVQSLCIHEMIVRAYKHILQAVIAA 780
Query: 242 VGNTQRMAVSIAAALNLMLGVHESDGLNKSHNVHPLVWRWLELFLMKRYEWDLNGLNFKD 301
V N ++MA+SIAAALNLMLGV E +KS++V+ LVW+WLE+FL KRYEWDL+ NFKD
Sbjct: 781 VVNHEKMAISIAAALNLMLGVPERGDSDKSYHVNSLVWKWLEVFLKKRYEWDLSRSNFKD 840
Query: 302 VRKFAILRGLCHKVGIELVSRDFDMDSPSPFRKIDVVSLVPVHKQAACSSADGRQLLESS 361
VRKFAILRGLCHKVGIELV RDFDMDSP PFRK D+VSLVPVHKQAACSSADGRQLLESS
Sbjct: 841 VRKFAILRGLCHKVGIELVPRDFDMDSPHPFRKSDIVSLVPVHKQAACSSADGRQLLESS 900
Query: 362 KTALDKGKLEDAVTYGTKALAKLVAVCGPYHRMTAGAYSLLAVVLYHTGDFNQATIYQQK 421
KTALDKGKLEDAVTYGTKALAKLVAVCGPYHRMTAGAYSLLAVVLYHTGDFNQATIYQQK
Sbjct: 901 KTALDKGKLEDAVTYGTKALAKLVAVCGPYHRMTAGAYSLLAVVLYHTGDFNQATIYQQK 960
Query: 422 ALDINERELGLDHPDTMKSYGDLAVFYYRLQHTELALKYVKRALYLLHLTCGPSHPNTAA 481
ALDINERELGLDHPDTMKSYGDLAVFYYRLQHTELALKYVKRALYLLHLTCGPSHPNTAA
Sbjct: 961 ALDINERELGLDHPDTMKSYGDLAVFYYRLQHTELALKYVKRALYLLHLTCGPSHPNTAA 1020
Query: 482 TYINVAMMEEGLGNVHVALRYLHKALKCNQRLLGPDHIQTAASYHAIAIALSLMEAYPLS 541
TYINVAMMEEGLGNVH+ALRYLHKALKCNQRLLGPDHIQTAASYHAIAIALSLMEAYPLS
Sbjct: 1021 TYINVAMMEEGLGNVHIALRYLHKALKCNQRLLGPDHIQTAASYHAIAIALSLMEAYPLS 1080
Query: 542 VQHEQTTLQILRAKLGPDDLRTQDAAAWLEYFESKAFEQQEAARNGTRKPDASIASKGHL 601
VQHEQTTLQILRAKLGPDDLRTQDAAAWLEYFESKAFEQQEAARNGTRKPDASIASKGHL
Sbjct: 1081 VQHEQTTLQILRAKLGPDDLRTQDAAAWLEYFESKAFEQQEAARNGTRKPDASIASKGHL 1140
Query: 602 SVSDLLDYINPSHDTKGRNVSTLKRKTYVAKVKGNFYQDNNLTSPDGSSKEVLRESSDEE 661
SVSDLLDYINPS DTKGR+ +++RK+Y+AK+K ++L S + S +E+ +E+ DEE
Sbjct: 1141 SVSDLLDYINPSRDTKGRDFVSVRRKSYIAKMKEKTNPVSDLPSSNESPQEIPQEAIDEE 1200
Query: 662 THAPEPESDTDVNQGSSIPFQQQELVVEESAVEKPNITEEISSAIHEEGDDGWQPVQRLR 721
TH P +T SS Q Q+ +VEE+A +K I E+ I EGDDGWQPVQR R
Sbjct: 1201 THMPIASQET-----SSTQVQFQQPIVEETADKKSGIVSEVLPEILAEGDDGWQPVQRPR 1255
Query: 722 SAGSYGRRLKQRRATIGKVHSYQKRNADAVIDYSSAKSSHHSSRYYLLKKRAVSHGSSAD 781
SAGSYGRRLKQRR I KV YQK+ DA +DY K++H ++RYYLLKKR +SHGS D
Sbjct: 1256 SAGSYGRRLKQRRGIISKV--YQKKIVDANMDYPPVKNTHQNNRYYLLKKRPLSHGSYVD 1313
Query: 782 HHPVTTFHGTKFGRRVVKAVAYRVKSMPSSAKTGTVEASINGSEPSSSPSESRPASAPND 841
HH GTKFGRR+VKAV YRVKS+PS KT E S +G + SS ES SA +D
Sbjct: 1314 HHASNPSQGTKFGRRIVKAVTYRVKSIPSVNKTAPTENSKSGVKTFSS-LESAQLSASSD 1372
Query: 842 TSSVKNSIISLGKSPSYKEVAVAPPGTIAMLQVRVPQSDNPDNQEFSFGKPEDGTMEEKE 901
VK+S++SLGKSPSYKEVA+APPGTIA QV +PQ+DN DN++ G ++ T+E E
Sbjct: 1373 AGQVKSSVVSLGKSPSYKEVALAPPGTIAKFQVWLPQNDNSDNKDIGVGGSKEETIEAIE 1432
Query: 902 NVNTNVTG-AEKTNEEKSDSVLDATDNLKEETGVHPNREETHISDGLEDNPSVVVSESER 960
N + VT A+K N +DS D+LK+ T V +E++ ++ E+N +V ++
Sbjct: 1433 NASEVVTVLADKDNSSATDS----NDHLKDVTDVIEEKEDSQSNNAKEENALMVARKTIE 1488
Query: 961 GVGSVVDIHKVVQDGILINGIPNSIDSPTSE-FYEKDSSESIESHDNTKSTLQVVDDLKE 1019
+V++H V+Q+ I I+ IPNSID P+ E +EKDS+ E N+ T V+DL++
Sbjct: 1489 SESGIVEVHGVMQNSISIDRIPNSIDFPSKEPPFEKDSAGEFEPQCNSNPTSPEVEDLRD 1548
Query: 1020 KPSVFNPGDTRGLPNRKLSASAVPFNPSPAVARASAVAINMTLPPGPGAVTAVAPWPVNM 1079
+ + G+TRGLPN+KLSASA PFNPSP++ARA+ V++N++LPPGPG+V AVAPWPVNM
Sbjct: 1549 RSLATSSGETRGLPNKKLSASAAPFNPSPSIARAAPVSMNISLPPGPGSVPAVAPWPVNM 1608
Query: 1080 TLHPRPATVLPTVNPMCSSPHQPYPSPPSTPNMMQPLPFMYPPYTQPQGVPTSTFPVTTS 1139
TLHP PATVLP V+PM S H PYPSPP+TPNMMQPLPF+YPPY+Q Q VPTSTFPVT++
Sbjct: 1609 TLHPGPATVLPPVSPMPSP-HHPYPSPPATPNMMQPLPFIYPPYSQSQAVPTSTFPVTSN 1667
Query: 1140 AFHHNHFSWQCNGNSNVPEFIPGPFLPGYHPMEFSVPPPVVEPILDPIMQPKAQSGDLDS 1199
AFH NHFSWQCN N V EFIP PG H MEFSV PPV EPI D ++PK Q + S
Sbjct: 1668 AFHPNHFSWQCNVNHRVNEFIPSTIWPGCHGMEFSVLPPVTEPIPDSALEPKVQFENPGS 1727
Query: 1200 SCSASILPENIDAVGDAEKEVDLLASKSMDNANEVAGIGRETVRGEFVKENGHLNLCGTE 1259
+ +LP +I V +A++EV+LLA ++ DNAN++AG VR E VKENGH NL E
Sbjct: 1728 ASPPPVLPADIVNVEEAKREVNLLAPEATDNANDLAG-----VRLENVKENGHSNLGEVE 1782
Query: 1260 NAGSEPVHFTSQNQSLRRNVEREIEGEKTFSILVRGRRNRKQTLRIPISLLSRPYGSQSF 1319
+G++ H+ S + ER+I+GEKTFSIL+RGRRNRKQTLR+PISLL+RPYGSQSF
Sbjct: 1783 ISGNDSSHYKSFKKDGSNTDERKIDGEKTFSILIRGRRNRKQTLRMPISLLNRPYGSQSF 1842
Query: 1320 KVIYNRVIRGSEAPKSFSFSSTGDSTATA 1348
KVIYNRV+RGSEAPKS F S D TA+A
Sbjct: 1843 KVIYNRVVRGSEAPKSTCFPSAKDCTASA 1871
|
Source: Ricinus communis Species: Ricinus communis Genus: Ricinus Family: Euphorbiaceae Order: Malpighiales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|359489732|ref|XP_002278370.2| PREDICTED: protein KIAA0664 homolog [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|356520282|ref|XP_003528792.1| PREDICTED: uncharacterized protein LOC100808136 [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|356560227|ref|XP_003548395.1| PREDICTED: protein TIF31 homolog [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|449487415|ref|XP_004157615.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC101229361 [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|449445826|ref|XP_004140673.1| PREDICTED: uncharacterized protein LOC101210514 [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|358349301|ref|XP_003638677.1| hypothetical protein MTR_139s0028 [Medicago truncatula] gi|355504612|gb|AES85815.1| hypothetical protein MTR_139s0028 [Medicago truncatula] | Back alignment and taxonomy information |
|---|
| >gi|334182214|ref|NP_001184884.1| tetratricopeptide repeat-containing protein [Arabidopsis thaliana] gi|332189151|gb|AEE27272.1| tetratricopeptide repeat-containing protein [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|42561588|ref|NP_171639.3| tetratricopeptide repeat-containing protein [Arabidopsis thaliana] gi|332189150|gb|AEE27271.1| tetratricopeptide repeat-containing protein [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|297842986|ref|XP_002889374.1| tetratricopeptide repeat-containing protein [Arabidopsis lyrata subsp. lyrata] gi|297335216|gb|EFH65633.1| tetratricopeptide repeat-containing protein [Arabidopsis lyrata subsp. lyrata] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 1349 | ||||||
| TAIR|locus:2035327 | 1797 | AT1G01320 [Arabidopsis thalian | 0.750 | 0.563 | 0.601 | 0.0 | |
| TAIR|locus:2037783 | 1608 | AT1G15290 [Arabidopsis thalian | 0.492 | 0.412 | 0.583 | 5.4e-212 | |
| DICTYBASE|DDB_G0292806 | 1320 | cluA "CluA protein" [Dictyoste | 0.449 | 0.459 | 0.261 | 4.2e-46 | |
| UNIPROTKB|B4MY63 | 1441 | clu "Protein clueless" [Drosop | 0.247 | 0.231 | 0.286 | 3.9e-39 | |
| UNIPROTKB|B4P6P7 | 1451 | clu "Protein clueless" [Drosop | 0.307 | 0.286 | 0.264 | 7.7e-39 | |
| UNIPROTKB|B4GAM1 | 1435 | clu "Protein clueless" [Drosop | 0.247 | 0.232 | 0.280 | 8.5e-39 | |
| UNIPROTKB|Q291J5 | 1435 | clu "Protein clueless" [Drosop | 0.247 | 0.232 | 0.277 | 2.9e-38 | |
| UNIPROTKB|B3MIW0 | 1450 | clu "Protein clueless" [Drosop | 0.296 | 0.275 | 0.258 | 3.1e-38 | |
| UNIPROTKB|B4JW99 | 1494 | clu "Protein clueless" [Drosop | 0.275 | 0.248 | 0.268 | 1.8e-37 | |
| FB|FBgn0034087 | 1448 | clu "clueless" [Drosophila mel | 0.247 | 0.230 | 0.275 | 3.8e-37 |
| TAIR|locus:2035327 AT1G01320 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 2963 (1048.1 bits), Expect = 0., Sum P(4) = 0.
Identities = 649/1079 (60%), Positives = 769/1079 (71%)
Query: 2 FVERLLEESIAKLEEEKPEREHFVRWELGACWIQHLQDQXXXXXXXXXXXXXXXXXXXXX 61
FV ++LEESIAKLE E+ +R+ +RWELGACWIQHLQDQ
Sbjct: 527 FVSKMLEESIAKLEGEEIDRDSIMRWELGACWIQHLQDQKNTEKDKKQTGEKSKNE---- 582
Query: 62 XXXXMKVEGLGTPLKSLKNNRKKSEGSNHKIHSETLKSQADGVNGESEKATSASIEARLE 121
+KVEGLG PLKSL +++KK++ S+ K L SQ D V+ E++ T+AS+++ E
Sbjct: 583 ----LKVEGLGKPLKSLNSSKKKTDVSSPKTPQTALSSQVDAVSSEAD--TAASLQSDAE 636
Query: 122 SRDKENELALKNLLSDEAFARLKESETGLHCKSLEELIDLSHNYYVEVALPKLVTDFGSL 181
+EN L LKNLLSD AF RLKES+TGLH KSL+EL+DL+ NYY EVA+PKLV DFGSL
Sbjct: 637 KNAQENVLILKNLLSDAAFTRLKESDTGLHHKSLQELVDLAQNYYTEVAIPKLVADFGSL 696
Query: 182 ELSPVDGRTLTDFMHTRGLQMRSLGHVVKLSEKLSHVQSLCIHEMIVRAFKHIIQAVISA 241
ELSPVDGRTLTDFMHTRGL+MRSLG+VVKLS+KLSHVQSLC+HEMIVRA KHI+QAVISA
Sbjct: 697 ELSPVDGRTLTDFMHTRGLRMRSLGYVVKLSDKLSHVQSLCVHEMIVRALKHILQAVISA 756
Query: 242 VG-NTQRMAVSIAAALNLMLGVHESDGLNKSH--NVHPLVWRWLELFLMKRYEWDLNGLN 298
V +T ++A+ +AAALN+MLG+ E+ + NVHPL++RWLE FL KRY++DLN +
Sbjct: 757 VATDTDKIAIKVAAALNMMLGIPENVAATPHNPWNVHPLIFRWLEKFLKKRYDYDLNAFS 816
Query: 299 FKDVRKFAILRGLCHKVGIELVSRDFDMDSPSPFRKIDVVSLVPVHK--------QAACS 350
+KD+RKFAILRGLCHKVGIEL+ RDFDMDSP+PFRK DVVSLVPVHK QAACS
Sbjct: 817 YKDLRKFAILRGLCHKVGIELIPRDFDMDSPAPFRKTDVVSLVPVHKTFYFKSMQQAACS 876
Query: 351 SADGRQLLESSKTALDKGKLEDAVTYGTKALAKLVAVCGPYHRMTAGAYSLLAVVLYHTG 410
SADGRQLLESSKTALDKGKLEDAVTYGTKALAKLVAVCGPYHRMTAGAYSLLAVVLYHTG
Sbjct: 877 SADGRQLLESSKTALDKGKLEDAVTYGTKALAKLVAVCGPYHRMTAGAYSLLAVVLYHTG 936
Query: 411 DFNQATIYQQKALDINERELGLDHPDTMKSYGDLAVFYYRLQHTELALKYVKRALYLLHL 470
DFNQATIYQQKALDINERELGLDHPDTMKSYGDLAVFYYRLQHTELALKYVKRALYLLHL
Sbjct: 937 DFNQATIYQQKALDINERELGLDHPDTMKSYGDLAVFYYRLQHTELALKYVKRALYLLHL 996
Query: 471 TCGPSHPNTAATYINVAMMEEGLGNVHVALRYLHKALKCNQRLLGPDHIQTAASYHAIAI 530
TCGPSHPNTAATYINVAMMEEGLGNVHVALRYLHKALKCNQRLLGPDHIQTAASYHAIAI
Sbjct: 997 TCGPSHPNTAATYINVAMMEEGLGNVHVALRYLHKALKCNQRLLGPDHIQTAASYHAIAI 1056
Query: 531 ALSLMEAYPLSVQHEQTTLQILRAKLGPDDLRTQDAAAWLEYFESKAFEQQEAARNGTRK 590
ALSLMEAY LSVQHEQTTL+ILRAKLGPDDLRTQDAAAWLEYFESKAFEQQEAARNGT K
Sbjct: 1057 ALSLMEAYHLSVQHEQTTLRILRAKLGPDDLRTQDAAAWLEYFESKAFEQQEAARNGTPK 1116
Query: 591 PDASIASKGHLSVSDLLDYINPSHDTKGRNVSTLKRKTYVAKVKGNFYQDN---NLTS-P 646
PDASIASKGHLSVSDLLDYINPSH+ KG+ KRK Y+ K+K Q N +L P
Sbjct: 1117 PDASIASKGHLSVSDLLDYINPSHNAKGKESVAAKRKNYILKLKEKSKQSNVSEHLVEIP 1176
Query: 647 DGSSKEVLRESSDEETHAPEPESDTDVNQGSSIPFQQQEL--VVEESAVEKPN-ITE-EI 702
KE+ E + EET + E +S + ++ P ++ V+E++ ++ N IT ++
Sbjct: 1177 REKQKEMSEEDT-EETGSEEGKSSEENHETILAPVEEPPSPPVIEDATMDNSNPITSSDV 1235
Query: 703 SSAI-HEEG-DDGWQPVQRLRSAGSYGRRLKQRRATIGKVHSYQKRNADAVIDY-XXXXX 759
S+ H +G +DGWQPVQR RSAGSYGRR+KQRRA+IGKV++YQK+N +A ID
Sbjct: 1236 STEPQHPDGSEDGWQPVQRPRSAGSYGRRMKQRRASIGKVYTYQKKNVEADIDNPLFQNA 1295
Query: 760 XXXXXRYYLLKKRAVSHGSSADHH-PVTTFHGTKFGXXXXXXXXXXXXS-MPSS--AKTG 815
+YY+LKKR S+ S ADHH P T GTKFG S PSS AKT
Sbjct: 1296 TQQNDKYYILKKRTASYSSYADHHSPGLTTQGTKFGRKIVKTLAYRVKSTQPSSGNAKTA 1355
Query: 816 TVEASINGXXXXXXXXX--XXXXXXXNDTSSVKNSIISLGKSPSYKEVAVAPPGTIAMLQ 873
+ +G ++ KNS++SLGKSPSYKEVA+APPG+IA Q
Sbjct: 1356 GETSEEDGLKTDASSVEPPTLSSTVQSEAYHTKNSVVSLGKSPSYKEVALAPPGSIAKYQ 1415
Query: 874 VRVPQSDNPDNQEFSFGKPEDGTMEEKENVNTNVTGAEKTNEEKSDSVLDATDNLKEETG 933
V VPQ++ D QE D ME+K T++ E T +E+ + L+ + +K+E
Sbjct: 1416 VWVPQAEVSDKQE-------DDEMEKKTEQGTSM---ELTRDEQMITGLE--EEVKKEIS 1463
Query: 934 VHPNREETHISDGLEDNPXXXXXXXXXXXXXXXDIHKVVQDGILINGIPNSIDSPTSEFY 993
P E++I+ G E+ I++ + G GI + E
Sbjct: 1464 ADP---ESNITQGEEE--IKVELQPSEGVLGGSHINENDESG---GGIQVE-EQVEVELI 1514
Query: 994 EKDSSESIESHDNTKSTLQVV---DDLKEKPSVF--NPGD-TRGL-PNRKLSASAVPFN 1045
++ I S + Q+ +DLK K S+ + GD +RGL PN+KLSASA PFN
Sbjct: 1515 NDGVTDMIHSTREQQVIDQLAADSEDLKAKLSISTTDSGDASRGLLPNKKLSASAAPFN 1573
|
|
| TAIR|locus:2037783 AT1G15290 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| DICTYBASE|DDB_G0292806 cluA "CluA protein" [Dictyostelium discoideum (taxid:44689)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|B4MY63 clu "Protein clueless" [Drosophila willistoni (taxid:7260)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|B4P6P7 clu "Protein clueless" [Drosophila yakuba (taxid:7245)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|B4GAM1 clu "Protein clueless" [Drosophila persimilis (taxid:7234)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q291J5 clu "Protein clueless" [Drosophila pseudoobscura pseudoobscura (taxid:46245)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|B3MIW0 clu "Protein clueless" [Drosophila ananassae (taxid:7217)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|B4JW99 clu "Protein clueless" [Drosophila grimshawi (taxid:7222)] | Back alignment and assigned GO terms |
|---|
| FB|FBgn0034087 clu "clueless" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
| GSVIVG00027051001 | SubName- Full=Chromosome chr15 scaffold_40, whole genome shotgun sequence; (1918 aa) | |||||||
(Vitis vinifera) | ||||||||
| Sorry, there are no predicted associations at the current settings. |
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 1349 | |||
| pfam12807 | 169 | pfam12807, eIF3_p135, Translation initiation facto | 5e-44 | |
| pfam13424 | 78 | pfam13424, TPR_12, Tetratricopeptide repeat | 2e-14 | |
| pfam13424 | 78 | pfam13424, TPR_12, Tetratricopeptide repeat | 1e-12 | |
| pfam13424 | 78 | pfam13424, TPR_12, Tetratricopeptide repeat | 2e-11 | |
| cd00189 | 100 | cd00189, TPR, Tetratricopeptide repeat domain; typ | 1e-10 | |
| COG0457 | 291 | COG0457, NrfG, FOG: TPR repeat [General function p | 6e-08 | |
| pfam13374 | 42 | pfam13374, TPR_10, Tetratricopeptide repeat | 7e-08 | |
| cd00189 | 100 | cd00189, TPR, Tetratricopeptide repeat domain; typ | 1e-07 | |
| pfam13424 | 78 | pfam13424, TPR_12, Tetratricopeptide repeat | 5e-07 | |
| COG0457 | 291 | COG0457, NrfG, FOG: TPR repeat [General function p | 5e-07 | |
| pfam13374 | 42 | pfam13374, TPR_10, Tetratricopeptide repeat | 1e-06 | |
| COG0457 | 291 | COG0457, NrfG, FOG: TPR repeat [General function p | 2e-06 | |
| cd00189 | 100 | cd00189, TPR, Tetratricopeptide repeat domain; typ | 4e-06 | |
| pfam13908 | 177 | pfam13908, Shisa, Wnt and FGF inhibitory regulator | 3e-05 | |
| pfam13414 | 69 | pfam13414, TPR_11, TPR repeat | 2e-04 | |
| PRK10263 | 1355 | PRK10263, PRK10263, DNA translocase FtsK; Provisio | 3e-04 | |
| TIGR02521 | 234 | TIGR02521, type_IV_pilW, type IV pilus biogenesis/ | 0.001 | |
| PHA03247 | 3151 | PHA03247, PHA03247, large tegument protein UL36; P | 0.004 |
| >gnl|CDD|221783 pfam12807, eIF3_p135, Translation initiation factor eIF3 subunit 135 | Back alignment and domain information |
|---|
Score = 157 bits (398), Expect = 5e-44
Identities = 56/170 (32%), Positives = 89/170 (52%), Gaps = 22/170 (12%)
Query: 179 GSLELSPVDGRTLTDFMHTRGLQMRSLGHVVKLSEK-LSHVQSLCIHEMIVRAFKHIIQA 237
SLELSP+DG++LT+ +H RG+ MR LG V KL+ K L H++ LC+ EMI RA KHI++
Sbjct: 1 ISLELSPMDGQSLTELLHRRGINMRYLGKVAKLASKRLPHLKRLCVSEMIARAAKHILRT 60
Query: 238 VISAVGNTQRMAVSIAAALNLMLGVH-ESDGLNKSHNVHPL----------------VWR 280
+ V ++ +I+ LN +LG D + +W
Sbjct: 61 YLRGV-PAPDLSAAISHFLNCLLGSESNPDPEAEIDESRSASYPEDDFAWEKLTPEELWS 119
Query: 281 WLELFLMKRYEWDLNGLNF---KDVRKFAILRGLCHKVGIELVSRDFDMD 327
+E R+ ++L ++K ++LR +C KVGI+L+ R++D D
Sbjct: 120 EIEKEAKDRFRYELKEDWKDEQYGLQKISLLREICLKVGIQLLLREYDFD 169
|
Translation initiation factor eIF3 is a multi-subunit protein complex required for initiation of protein biosynthesis in eukaryotic cells. The complex promotes ribosome dissociation, the binding of the initiator methionyl-tRNA to the 40 S ribosomal subunit, and mRNA recruitment to the ribosome. The protein product from TIF31 genes in yeast is p135 which associates with the eIF3 but does not seem to be necessary for protein translation initiation. Length = 169 |
| >gnl|CDD|205602 pfam13424, TPR_12, Tetratricopeptide repeat | Back alignment and domain information |
|---|
| >gnl|CDD|205602 pfam13424, TPR_12, Tetratricopeptide repeat | Back alignment and domain information |
|---|
| >gnl|CDD|205602 pfam13424, TPR_12, Tetratricopeptide repeat | Back alignment and domain information |
|---|
| >gnl|CDD|238112 cd00189, TPR, Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]- X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and Cdc27p components of the cyclosome/APC, the Pex5p/Pas10p receptor for peroxisomal targeting signals, the Tom70p co-receptor for mitochondrial targeting signals, Ser/Thr phosphatase 5C and the p110 subunit of O-GlcNAc transferase; three copies of the repeat are present here | Back alignment and domain information |
|---|
| >gnl|CDD|223533 COG0457, NrfG, FOG: TPR repeat [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|205553 pfam13374, TPR_10, Tetratricopeptide repeat | Back alignment and domain information |
|---|
| >gnl|CDD|238112 cd00189, TPR, Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]- X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and Cdc27p components of the cyclosome/APC, the Pex5p/Pas10p receptor for peroxisomal targeting signals, the Tom70p co-receptor for mitochondrial targeting signals, Ser/Thr phosphatase 5C and the p110 subunit of O-GlcNAc transferase; three copies of the repeat are present here | Back alignment and domain information |
|---|
| >gnl|CDD|205602 pfam13424, TPR_12, Tetratricopeptide repeat | Back alignment and domain information |
|---|
| >gnl|CDD|223533 COG0457, NrfG, FOG: TPR repeat [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|205553 pfam13374, TPR_10, Tetratricopeptide repeat | Back alignment and domain information |
|---|
| >gnl|CDD|223533 COG0457, NrfG, FOG: TPR repeat [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|238112 cd00189, TPR, Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]- X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and Cdc27p components of the cyclosome/APC, the Pex5p/Pas10p receptor for peroxisomal targeting signals, the Tom70p co-receptor for mitochondrial targeting signals, Ser/Thr phosphatase 5C and the p110 subunit of O-GlcNAc transferase; three copies of the repeat are present here | Back alignment and domain information |
|---|
| >gnl|CDD|222449 pfam13908, Shisa, Wnt and FGF inhibitory regulator | Back alignment and domain information |
|---|
| >gnl|CDD|222112 pfam13414, TPR_11, TPR repeat | Back alignment and domain information |
|---|
| >gnl|CDD|236669 PRK10263, PRK10263, DNA translocase FtsK; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|131573 TIGR02521, type_IV_pilW, type IV pilus biogenesis/stability protein PilW | Back alignment and domain information |
|---|
| >gnl|CDD|223021 PHA03247, PHA03247, large tegument protein UL36; Provisional | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 1349 | |||
| KOG1839 | 1236 | consensus Uncharacterized protein CLU1/cluA/TIF31 | 100.0 | |
| PF12807 | 169 | eIF3_p135: Translation initiation factor eIF3 subu | 99.97 | |
| KOG1840 | 508 | consensus Kinesin light chain [Cytoskeleton] | 99.95 | |
| KOG1839 | 1236 | consensus Uncharacterized protein CLU1/cluA/TIF31 | 99.93 | |
| KOG1840 | 508 | consensus Kinesin light chain [Cytoskeleton] | 99.89 | |
| KOG4626 | 966 | consensus O-linked N-acetylglucosamine transferase | 99.87 | |
| KOG4626 | 966 | consensus O-linked N-acetylglucosamine transferase | 99.84 | |
| TIGR00990 | 615 | 3a0801s09 mitochondrial precursor proteins import | 99.73 | |
| TIGR00990 | 615 | 3a0801s09 mitochondrial precursor proteins import | 99.67 | |
| KOG1130 | 639 | consensus Predicted G-alpha GTPase interaction pro | 99.66 | |
| KOG1126 | 638 | consensus DNA-binding cell division cycle control | 99.57 | |
| TIGR02521 | 234 | type_IV_pilW type IV pilus biogenesis/stability pr | 99.57 | |
| KOG1130 | 639 | consensus Predicted G-alpha GTPase interaction pro | 99.55 | |
| PRK11788 | 389 | tetratricopeptide repeat protein; Provisional | 99.55 | |
| PRK11788 | 389 | tetratricopeptide repeat protein; Provisional | 99.53 | |
| PRK15174 | 656 | Vi polysaccharide export protein VexE; Provisional | 99.52 | |
| PRK11189 | 296 | lipoprotein NlpI; Provisional | 99.48 | |
| PRK15174 | 656 | Vi polysaccharide export protein VexE; Provisional | 99.48 | |
| TIGR02917 | 899 | PEP_TPR_lipo putative PEP-CTERM system TPR-repeat | 99.47 | |
| KOG1155 | 559 | consensus Anaphase-promoting complex (APC), Cdc23 | 99.46 | |
| PRK11447 | 1157 | cellulose synthase subunit BcsC; Provisional | 99.45 | |
| PRK11447 | 1157 | cellulose synthase subunit BcsC; Provisional | 99.45 | |
| COG3063 | 250 | PilF Tfp pilus assembly protein PilF [Cell motilit | 99.44 | |
| TIGR02917 | 899 | PEP_TPR_lipo putative PEP-CTERM system TPR-repeat | 99.42 | |
| KOG0547 | 606 | consensus Translocase of outer mitochondrial membr | 99.4 | |
| PRK09782 | 987 | bacteriophage N4 receptor, outer membrane subunit; | 99.4 | |
| KOG1126 | 638 | consensus DNA-binding cell division cycle control | 99.37 | |
| PRK12370 | 553 | invasion protein regulator; Provisional | 99.36 | |
| PRK12370 | 553 | invasion protein regulator; Provisional | 99.34 | |
| PRK09782 | 987 | bacteriophage N4 receptor, outer membrane subunit; | 99.34 | |
| TIGR02521 | 234 | type_IV_pilW type IV pilus biogenesis/stability pr | 99.34 | |
| PRK04841 | 903 | transcriptional regulator MalT; Provisional | 99.34 | |
| TIGR03302 | 235 | OM_YfiO outer membrane assembly lipoprotein YfiO. | 99.33 | |
| COG3063 | 250 | PilF Tfp pilus assembly protein PilF [Cell motilit | 99.31 | |
| PRK11189 | 296 | lipoprotein NlpI; Provisional | 99.3 | |
| KOG0547 | 606 | consensus Translocase of outer mitochondrial membr | 99.3 | |
| KOG1155 | 559 | consensus Anaphase-promoting complex (APC), Cdc23 | 99.28 | |
| KOG2002 | 1018 | consensus TPR-containing nuclear phosphoprotein th | 99.26 | |
| KOG2003 | 840 | consensus TPR repeat-containing protein [General f | 99.24 | |
| KOG2003 | 840 | consensus TPR repeat-containing protein [General f | 99.23 | |
| KOG1129 | 478 | consensus TPR repeat-containing protein [General f | 99.22 | |
| KOG1173 | 611 | consensus Anaphase-promoting complex (APC), Cdc16 | 99.22 | |
| TIGR03302 | 235 | OM_YfiO outer membrane assembly lipoprotein YfiO. | 99.19 | |
| PRK10049 | 765 | pgaA outer membrane protein PgaA; Provisional | 99.19 | |
| PRK10049 | 765 | pgaA outer membrane protein PgaA; Provisional | 99.18 | |
| KOG1125 | 579 | consensus TPR repeat-containing protein [General f | 99.18 | |
| PRK04841 | 903 | transcriptional regulator MalT; Provisional | 99.14 | |
| KOG2002 | 1018 | consensus TPR-containing nuclear phosphoprotein th | 99.13 | |
| PF14938 | 282 | SNAP: Soluble NSF attachment protein, SNAP; PDB: 1 | 99.13 | |
| cd05804 | 355 | StaR_like StaR_like; a well-conserved protein foun | 99.11 | |
| KOG1173 | 611 | consensus Anaphase-promoting complex (APC), Cdc16 | 99.11 | |
| KOG1941 | 518 | consensus Acetylcholine receptor-associated protei | 99.1 | |
| PF13429 | 280 | TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2 | 99.09 | |
| PF14938 | 282 | SNAP: Soluble NSF attachment protein, SNAP; PDB: 1 | 99.09 | |
| PF13424 | 78 | TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15 | 99.06 | |
| KOG1941 | 518 | consensus Acetylcholine receptor-associated protei | 99.06 | |
| KOG1129 | 478 | consensus TPR repeat-containing protein [General f | 99.03 | |
| PF13424 | 78 | TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15 | 99.02 | |
| COG2956 | 389 | Predicted N-acetylglucosaminyl transferase [Carboh | 99.02 | |
| KOG1125 | 579 | consensus TPR repeat-containing protein [General f | 99.02 | |
| KOG2076 | 895 | consensus RNA polymerase III transcription factor | 99.01 | |
| KOG0624 | 504 | consensus dsRNA-activated protein kinase inhibitor | 99.01 | |
| cd05804 | 355 | StaR_like StaR_like; a well-conserved protein foun | 99.0 | |
| PF13429 | 280 | TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2 | 98.96 | |
| KOG0550 | 486 | consensus Molecular chaperone (DnaJ superfamily) [ | 98.93 | |
| TIGR00540 | 409 | hemY_coli hemY protein. This is an uncharacterized | 98.93 | |
| TIGR00540 | 409 | hemY_coli hemY protein. This is an uncharacterized | 98.93 | |
| PRK15359 | 144 | type III secretion system chaperone protein SscB; | 98.93 | |
| PRK15179 | 694 | Vi polysaccharide biosynthesis protein TviE; Provi | 98.91 | |
| PRK10747 | 398 | putative protoheme IX biogenesis protein; Provisio | 98.89 | |
| CHL00033 | 168 | ycf3 photosystem I assembly protein Ycf3 | 98.89 | |
| PRK10747 | 398 | putative protoheme IX biogenesis protein; Provisio | 98.86 | |
| PRK15179 | 694 | Vi polysaccharide biosynthesis protein TviE; Provi | 98.85 | |
| PRK15359 | 144 | type III secretion system chaperone protein SscB; | 98.83 | |
| CHL00033 | 168 | ycf3 photosystem I assembly protein Ycf3 | 98.83 | |
| KOG4162 | 799 | consensus Predicted calmodulin-binding protein [Si | 98.83 | |
| KOG0548 | 539 | consensus Molecular co-chaperone STI1 [Posttransla | 98.81 | |
| KOG1174 | 564 | consensus Anaphase-promoting complex (APC), subuni | 98.79 | |
| PRK10370 | 198 | formate-dependent nitrite reductase complex subuni | 98.78 | |
| PRK10370 | 198 | formate-dependent nitrite reductase complex subuni | 98.78 | |
| KOG0548 | 539 | consensus Molecular co-chaperone STI1 [Posttransla | 98.75 | |
| KOG0550 | 486 | consensus Molecular chaperone (DnaJ superfamily) [ | 98.73 | |
| COG2956 | 389 | Predicted N-acetylglucosaminyl transferase [Carboh | 98.72 | |
| KOG1174 | 564 | consensus Anaphase-promoting complex (APC), subuni | 98.72 | |
| KOG0495 | 913 | consensus HAT repeat protein [RNA processing and m | 98.72 | |
| KOG0553 | 304 | consensus TPR repeat-containing protein [General f | 98.71 | |
| PLN02789 | 320 | farnesyltranstransferase | 98.7 | |
| PLN03218 | 1060 | maturation of RBCL 1; Provisional | 98.67 | |
| PRK02603 | 172 | photosystem I assembly protein Ycf3; Provisional | 98.67 | |
| PF13525 | 203 | YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M | 98.66 | |
| TIGR02552 | 135 | LcrH_SycD type III secretion low calcium response | 98.66 | |
| PF12569 | 517 | NARP1: NMDA receptor-regulated protein 1 ; InterPr | 98.66 | |
| PRK14574 | 822 | hmsH outer membrane protein; Provisional | 98.62 | |
| PRK02603 | 172 | photosystem I assembly protein Ycf3; Provisional | 98.61 | |
| TIGR02552 | 135 | LcrH_SycD type III secretion low calcium response | 98.6 | |
| PRK14720 | 906 | transcript cleavage factor/unknown domain fusion p | 98.58 | |
| PLN03218 | 1060 | maturation of RBCL 1; Provisional | 98.58 | |
| TIGR02795 | 119 | tol_pal_ybgF tol-pal system protein YbgF. Members | 98.58 | |
| PRK15363 | 157 | pathogenicity island 2 chaperone protein SscA; Pro | 98.58 | |
| PRK10866 | 243 | outer membrane biogenesis protein BamD; Provisiona | 98.57 | |
| KOG1156 | 700 | consensus N-terminal acetyltransferase [Chromatin | 98.57 | |
| COG5010 | 257 | TadD Flp pilus assembly protein TadD, contains TPR | 98.55 | |
| PLN03088 | 356 | SGT1, suppressor of G2 allele of SKP1; Provisional | 98.55 | |
| PRK15363 | 157 | pathogenicity island 2 chaperone protein SscA; Pro | 98.54 | |
| PF09976 | 145 | TPR_21: Tetratricopeptide repeat; InterPro: IPR018 | 98.54 | |
| TIGR02795 | 119 | tol_pal_ybgF tol-pal system protein YbgF. Members | 98.52 | |
| PRK14720 | 906 | transcript cleavage factor/unknown domain fusion p | 98.51 | |
| PRK14574 | 822 | hmsH outer membrane protein; Provisional | 98.5 | |
| KOG2076 | 895 | consensus RNA polymerase III transcription factor | 98.49 | |
| PLN02789 | 320 | farnesyltranstransferase | 98.47 | |
| PLN03081 | 697 | pentatricopeptide (PPR) repeat-containing protein; | 98.46 | |
| PLN03081 | 697 | pentatricopeptide (PPR) repeat-containing protein; | 98.45 | |
| KOG1585 | 308 | consensus Protein required for fusion of vesicles | 98.43 | |
| PLN03088 | 356 | SGT1, suppressor of G2 allele of SKP1; Provisional | 98.41 | |
| KOG2376 | 652 | consensus Signal recognition particle, subunit Srp | 98.41 | |
| COG5010 | 257 | TadD Flp pilus assembly protein TadD, contains TPR | 98.4 | |
| KOG0553 | 304 | consensus TPR repeat-containing protein [General f | 98.39 | |
| KOG2376 | 652 | consensus Signal recognition particle, subunit Srp | 98.38 | |
| COG4783 | 484 | Putative Zn-dependent protease, contains TPR repea | 98.37 | |
| KOG1128 | 777 | consensus Uncharacterized conserved protein, conta | 98.36 | |
| PF09976 | 145 | TPR_21: Tetratricopeptide repeat; InterPro: IPR018 | 98.35 | |
| PF13525 | 203 | YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M | 98.33 | |
| KOG0624 | 504 | consensus dsRNA-activated protein kinase inhibitor | 98.3 | |
| KOG0495 | 913 | consensus HAT repeat protein [RNA processing and m | 98.27 | |
| KOG1585 | 308 | consensus Protein required for fusion of vesicles | 98.27 | |
| cd00189 | 100 | TPR Tetratricopeptide repeat domain; typically con | 98.27 | |
| PLN03077 | 857 | Protein ECB2; Provisional | 98.25 | |
| PRK10153 | 517 | DNA-binding transcriptional activator CadC; Provis | 98.23 | |
| KOG1127 | 1238 | consensus TPR repeat-containing protein [RNA proce | 98.2 | |
| KOG4162 | 799 | consensus Predicted calmodulin-binding protein [Si | 98.19 | |
| cd00189 | 100 | TPR Tetratricopeptide repeat domain; typically con | 98.19 | |
| PF12688 | 120 | TPR_5: Tetratrico peptide repeat | 98.16 | |
| PRK10866 | 243 | outer membrane biogenesis protein BamD; Provisiona | 98.15 | |
| PLN03077 | 857 | Protein ECB2; Provisional | 98.14 | |
| KOG0543 | 397 | consensus FKBP-type peptidyl-prolyl cis-trans isom | 98.13 | |
| KOG3617 | 1416 | consensus WD40 and TPR repeat-containing protein [ | 98.11 | |
| PF13414 | 69 | TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A | 98.1 | |
| PRK10803 | 263 | tol-pal system protein YbgF; Provisional | 98.1 | |
| COG0457 | 291 | NrfG FOG: TPR repeat [General function prediction | 98.08 | |
| KOG3060 | 289 | consensus Uncharacterized conserved protein [Funct | 98.08 | |
| COG3071 | 400 | HemY Uncharacterized enzyme of heme biosynthesis [ | 98.07 | |
| PF13414 | 69 | TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A | 98.07 | |
| PF12895 | 84 | Apc3: Anaphase-promoting complex, cyclosome, subun | 98.04 | |
| KOG0543 | 397 | consensus FKBP-type peptidyl-prolyl cis-trans isom | 98.04 | |
| PF12688 | 120 | TPR_5: Tetratrico peptide repeat | 98.03 | |
| PRK10803 | 263 | tol-pal system protein YbgF; Provisional | 98.03 | |
| KOG3785 | 557 | consensus Uncharacterized conserved protein [Funct | 98.0 | |
| KOG3060 | 289 | consensus Uncharacterized conserved protein [Funct | 98.0 | |
| KOG1127 | 1238 | consensus TPR repeat-containing protein [RNA proce | 97.98 | |
| PF12895 | 84 | Apc3: Anaphase-promoting complex, cyclosome, subun | 97.97 | |
| PF12569 | 517 | NARP1: NMDA receptor-regulated protein 1 ; InterPr | 97.93 | |
| KOG4340 | 459 | consensus Uncharacterized conserved protein [Funct | 97.93 | |
| KOG1128 | 777 | consensus Uncharacterized conserved protein, conta | 97.93 | |
| KOG2300 | 629 | consensus Uncharacterized conserved protein [Funct | 97.91 | |
| PRK10153 | 517 | DNA-binding transcriptional activator CadC; Provis | 97.9 | |
| KOG1156 | 700 | consensus N-terminal acetyltransferase [Chromatin | 97.88 | |
| PRK11906 | 458 | transcriptional regulator; Provisional | 97.87 | |
| COG4783 | 484 | Putative Zn-dependent protease, contains TPR repea | 97.86 | |
| KOG2047 | 835 | consensus mRNA splicing factor [RNA processing and | 97.79 | |
| KOG4555 | 175 | consensus TPR repeat-containing protein [Function | 97.78 | |
| COG2909 | 894 | MalT ATP-dependent transcriptional regulator [Tran | 97.73 | |
| KOG2300 | 629 | consensus Uncharacterized conserved protein [Funct | 97.72 | |
| KOG2047 | 835 | consensus mRNA splicing factor [RNA processing and | 97.71 | |
| COG0457 | 291 | NrfG FOG: TPR repeat [General function prediction | 97.68 | |
| PF04733 | 290 | Coatomer_E: Coatomer epsilon subunit; InterPro: IP | 97.68 | |
| PF13432 | 65 | TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL | 97.68 | |
| KOG4555 | 175 | consensus TPR repeat-containing protein [Function | 97.65 | |
| COG3071 | 400 | HemY Uncharacterized enzyme of heme biosynthesis [ | 97.64 | |
| COG4105 | 254 | ComL DNA uptake lipoprotein [General function pred | 97.63 | |
| PF09295 | 395 | ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); Inter | 97.62 | |
| COG1729 | 262 | Uncharacterized protein conserved in bacteria [Fun | 97.62 | |
| KOG3617 | 1416 | consensus WD40 and TPR repeat-containing protein [ | 97.62 | |
| PF13432 | 65 | TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL | 97.61 | |
| KOG1070 | 1710 | consensus rRNA processing protein Rrp5 [RNA proces | 97.61 | |
| PLN03098 | 453 | LPA1 LOW PSII ACCUMULATION1; Provisional | 97.57 | |
| KOG3616 | 1636 | consensus Selective LIM binding factor [Transcript | 97.56 | |
| COG4785 | 297 | NlpI Lipoprotein NlpI, contains TPR repeats [Gener | 97.56 | |
| PF09295 | 395 | ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); Inter | 97.54 | |
| KOG3785 | 557 | consensus Uncharacterized conserved protein [Funct | 97.52 | |
| PF08631 | 278 | SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: | 97.52 | |
| PRK15331 | 165 | chaperone protein SicA; Provisional | 97.51 | |
| PRK11906 | 458 | transcriptional regulator; Provisional | 97.49 | |
| KOG1586 | 288 | consensus Protein required for fusion of vesicles | 97.49 | |
| PF13374 | 42 | TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT | 97.47 | |
| KOG1070 | 1710 | consensus rRNA processing protein Rrp5 [RNA proces | 97.45 | |
| KOG1586 | 288 | consensus Protein required for fusion of vesicles | 97.44 | |
| PLN03098 | 453 | LPA1 LOW PSII ACCUMULATION1; Provisional | 97.44 | |
| COG2909 | 894 | MalT ATP-dependent transcriptional regulator [Tran | 97.43 | |
| COG1729 | 262 | Uncharacterized protein conserved in bacteria [Fun | 97.38 | |
| KOG4234 | 271 | consensus TPR repeat-containing protein [General f | 97.36 | |
| PF10345 | 608 | Cohesin_load: Cohesin loading factor; InterPro: IP | 97.34 | |
| PF13374 | 42 | TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT | 97.34 | |
| COG4235 | 287 | Cytochrome c biogenesis factor [Posttranslational | 97.3 | |
| COG4700 | 251 | Uncharacterized protein conserved in bacteria cont | 97.3 | |
| KOG4234 | 271 | consensus TPR repeat-containing protein [General f | 97.3 | |
| KOG4648 | 536 | consensus Uncharacterized conserved protein, conta | 97.29 | |
| COG4785 | 297 | NlpI Lipoprotein NlpI, contains TPR repeats [Gener | 97.28 | |
| KOG4340 | 459 | consensus Uncharacterized conserved protein [Funct | 97.21 | |
| PF13512 | 142 | TPR_18: Tetratricopeptide repeat | 97.2 | |
| COG5159 | 421 | RPN6 26S proteasome regulatory complex component [ | 97.2 | |
| PRK15331 | 165 | chaperone protein SicA; Provisional | 97.18 | |
| PF10300 | 468 | DUF3808: Protein of unknown function (DUF3808); In | 97.14 | |
| PF12968 | 144 | DUF3856: Domain of Unknown Function (DUF3856); Int | 97.12 | |
| KOG3616 | 1636 | consensus Selective LIM binding factor [Transcript | 97.08 | |
| COG4235 | 287 | Cytochrome c biogenesis factor [Posttranslational | 97.08 | |
| COG3898 | 531 | Uncharacterized membrane-bound protein [Function u | 97.05 | |
| PF13512 | 142 | TPR_18: Tetratricopeptide repeat | 96.98 | |
| KOG4642 | 284 | consensus Chaperone-dependent E3 ubiquitin protein | 96.97 | |
| PF13371 | 73 | TPR_9: Tetratricopeptide repeat | 96.96 | |
| PF13371 | 73 | TPR_9: Tetratricopeptide repeat | 96.93 | |
| KOG2471 | 696 | consensus TPR repeat-containing protein [General f | 96.88 | |
| COG4105 | 254 | ComL DNA uptake lipoprotein [General function pred | 96.88 | |
| PF09986 | 214 | DUF2225: Uncharacterized protein conserved in bact | 96.85 | |
| PF13281 | 374 | DUF4071: Domain of unknown function (DUF4071) | 96.85 | |
| PF14559 | 68 | TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN | 96.84 | |
| KOG1915 | 677 | consensus Cell cycle control protein (crooked neck | 96.82 | |
| KOG3081 | 299 | consensus Vesicle coat complex COPI, epsilon subun | 96.77 | |
| PF12968 | 144 | DUF3856: Domain of Unknown Function (DUF3856); Int | 96.73 | |
| PF04184 | 539 | ST7: ST7 protein; InterPro: IPR007311 The ST7 (for | 96.72 | |
| PF10345 | 608 | Cohesin_load: Cohesin loading factor; InterPro: IP | 96.71 | |
| PF14559 | 68 | TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN | 96.7 | |
| KOG1915 | 677 | consensus Cell cycle control protein (crooked neck | 96.69 | |
| KOG4648 | 536 | consensus Uncharacterized conserved protein, conta | 96.69 | |
| PF09986 | 214 | DUF2225: Uncharacterized protein conserved in bact | 96.68 | |
| KOG1464 | 440 | consensus COP9 signalosome, subunit CSN2 [Posttran | 96.68 | |
| KOG2796 | 366 | consensus Uncharacterized conserved protein [Funct | 96.64 | |
| KOG3081 | 299 | consensus Vesicle coat complex COPI, epsilon subun | 96.63 | |
| PF04733 | 290 | Coatomer_E: Coatomer epsilon subunit; InterPro: IP | 96.57 | |
| PF10602 | 177 | RPN7: 26S proteasome subunit RPN7; InterPro: IPR01 | 96.54 | |
| PF10300 | 468 | DUF3808: Protein of unknown function (DUF3808); In | 96.52 | |
| KOG2796 | 366 | consensus Uncharacterized conserved protein [Funct | 96.47 | |
| PF02259 | 352 | FAT: FAT domain; InterPro: IPR003151 The FAT domai | 96.47 | |
| COG4700 | 251 | Uncharacterized protein conserved in bacteria cont | 96.44 | |
| KOG1463 | 411 | consensus 26S proteasome regulatory complex, subun | 96.42 | |
| PF03704 | 146 | BTAD: Bacterial transcriptional activator domain; | 96.33 | |
| PF03704 | 146 | BTAD: Bacterial transcriptional activator domain; | 96.33 | |
| KOG4642 | 284 | consensus Chaperone-dependent E3 ubiquitin protein | 96.29 | |
| KOG0551 | 390 | consensus Hsp90 co-chaperone CNS1 (contains TPR re | 96.29 | |
| PF04184 | 539 | ST7: ST7 protein; InterPro: IPR007311 The ST7 (for | 96.27 | |
| KOG2471 | 696 | consensus TPR repeat-containing protein [General f | 96.19 | |
| KOG2041 | 1189 | consensus WD40 repeat protein [General function pr | 96.17 | |
| PF08631 | 278 | SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: | 96.12 | |
| KOG2610 | 491 | consensus Uncharacterized conserved protein [Funct | 96.11 | |
| PF10602 | 177 | RPN7: 26S proteasome subunit RPN7; InterPro: IPR01 | 95.99 | |
| COG3118 | 304 | Thioredoxin domain-containing protein [Posttransla | 95.95 | |
| KOG1464 | 440 | consensus COP9 signalosome, subunit CSN2 [Posttran | 95.86 | |
| KOG0545 | 329 | consensus Aryl-hydrocarbon receptor-interacting pr | 95.69 | |
| KOG0545 | 329 | consensus Aryl-hydrocarbon receptor-interacting pr | 95.68 | |
| PF12862 | 94 | Apc5: Anaphase-promoting complex subunit 5 | 95.54 | |
| PF12862 | 94 | Apc5: Anaphase-promoting complex subunit 5 | 95.48 | |
| COG2976 | 207 | Uncharacterized protein conserved in bacteria [Fun | 95.45 | |
| PF04910 | 360 | Tcf25: Transcriptional repressor TCF25; InterPro: | 95.28 | |
| PF11817 | 247 | Foie-gras_1: Foie gras liver health family 1; Inte | 95.28 | |
| COG2976 | 207 | Uncharacterized protein conserved in bacteria [Fun | 95.2 | |
| PF02259 | 352 | FAT: FAT domain; InterPro: IPR003151 The FAT domai | 95.02 | |
| KOG2610 | 491 | consensus Uncharacterized conserved protein [Funct | 95.01 | |
| KOG0985 | 1666 | consensus Vesicle coat protein clathrin, heavy cha | 94.91 | |
| PF13176 | 36 | TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_ | 94.83 | |
| PF08626 | 1185 | TRAPPC9-Trs120: Transport protein Trs120 or TRAPPC | 94.74 | |
| PF00515 | 34 | TPR_1: Tetratricopeptide repeat; InterPro: IPR0014 | 94.73 | |
| PF12739 | 414 | TRAPPC-Trs85: ER-Golgi trafficking TRAPP I complex | 94.7 | |
| COG5159 | 421 | RPN6 26S proteasome regulatory complex component [ | 94.65 | |
| PF05843 | 280 | Suf: Suppressor of forked protein (Suf); InterPro: | 94.53 | |
| PF07719 | 34 | TPR_2: Tetratricopeptide repeat; InterPro: IPR0131 | 94.47 | |
| KOG1550 | 552 | consensus Extracellular protein SEL-1 and related | 94.45 | |
| PF13176 | 36 | TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_ | 94.35 | |
| KOG4322 | 482 | consensus Anaphase-promoting complex (APC), subuni | 94.33 | |
| COG0790 | 292 | FOG: TPR repeat, SEL1 subfamily [General function | 94.32 | |
| PF00515 | 34 | TPR_1: Tetratricopeptide repeat; InterPro: IPR0014 | 94.29 | |
| KOG2053 | 932 | consensus Mitochondrial inheritance and actin cyto | 94.16 | |
| PF13281 | 374 | DUF4071: Domain of unknown function (DUF4071) | 94.14 | |
| COG0790 | 292 | FOG: TPR repeat, SEL1 subfamily [General function | 93.98 | |
| COG3898 | 531 | Uncharacterized membrane-bound protein [Function u | 93.97 | |
| KOG0551 | 390 | consensus Hsp90 co-chaperone CNS1 (contains TPR re | 93.96 | |
| PF05843 | 280 | Suf: Suppressor of forked protein (Suf); InterPro: | 93.56 | |
| KOG4814 | 872 | consensus Uncharacterized conserved protein [Funct | 93.53 | |
| PF07719 | 34 | TPR_2: Tetratricopeptide repeat; InterPro: IPR0131 | 93.48 | |
| PF13181 | 34 | TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_ | 93.44 | |
| KOG0376 | 476 | consensus Serine-threonine phosphatase 2A, catalyt | 93.35 | |
| PF13428 | 44 | TPR_14: Tetratricopeptide repeat | 93.28 | |
| PF12739 | 414 | TRAPPC-Trs85: ER-Golgi trafficking TRAPP I complex | 93.26 | |
| KOG1463 | 411 | consensus 26S proteasome regulatory complex, subun | 93.25 | |
| PF00244 | 236 | 14-3-3: 14-3-3 protein; InterPro: IPR023410 The 14 | 93.21 | |
| PF06552 | 186 | TOM20_plant: Plant specific mitochondrial import r | 92.97 | |
| PF13431 | 34 | TPR_17: Tetratricopeptide repeat | 92.96 | |
| PF13428 | 44 | TPR_14: Tetratricopeptide repeat | 92.92 | |
| KOG4014 | 248 | consensus Uncharacterized conserved protein (conta | 92.71 | |
| PF13181 | 34 | TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_ | 92.62 | |
| KOG1308 | 377 | consensus Hsp70-interacting protein Hip/Transient | 92.57 | |
| KOG4563 | 400 | consensus Cell cycle-regulated histone H1-binding | 92.47 | |
| COG3118 | 304 | Thioredoxin domain-containing protein [Posttransla | 92.43 | |
| KOG2041 | 1189 | consensus WD40 repeat protein [General function pr | 92.43 | |
| KOG1550 | 552 | consensus Extracellular protein SEL-1 and related | 92.4 | |
| KOG1538 | 1081 | consensus Uncharacterized conserved protein WDR10, | 92.36 | |
| KOG4814 | 872 | consensus Uncharacterized conserved protein [Funct | 92.31 | |
| PF06552 | 186 | TOM20_plant: Plant specific mitochondrial import r | 92.21 | |
| KOG2561 | 568 | consensus Adaptor protein NUB1, contains UBA domai | 92.14 | |
| PF08626 | 1185 | TRAPPC9-Trs120: Transport protein Trs120 or TRAPPC | 91.99 | |
| PF13431 | 34 | TPR_17: Tetratricopeptide repeat | 91.88 | |
| KOG2581 | 493 | consensus 26S proteasome regulatory complex, subun | 91.74 | |
| KOG1538 | 1081 | consensus Uncharacterized conserved protein WDR10, | 91.69 | |
| PF04910 | 360 | Tcf25: Transcriptional repressor TCF25; InterPro: | 91.61 | |
| KOG1924 | 1102 | consensus RhoA GTPase effector DIA/Diaphanous [Sig | 91.4 | |
| smart00101 | 244 | 14_3_3 14-3-3 homologues. 14-3-3 homologues mediat | 91.2 | |
| PF08424 | 321 | NRDE-2: NRDE-2, necessary for RNA interference; In | 91.07 | |
| KOG4322 | 482 | consensus Anaphase-promoting complex (APC), subuni | 91.03 | |
| PF08424 | 321 | NRDE-2: NRDE-2, necessary for RNA interference; In | 90.93 | |
| KOG2053 | 932 | consensus Mitochondrial inheritance and actin cyto | 90.92 | |
| KOG3783 | 546 | consensus Uncharacterized conserved protein [Funct | 90.92 | |
| PF11817 | 247 | Foie-gras_1: Foie gras liver health family 1; Inte | 90.78 | |
| KOG1914 | 656 | consensus mRNA cleavage and polyadenylation factor | 90.67 | |
| KOG0376 | 476 | consensus Serine-threonine phosphatase 2A, catalyt | 90.56 | |
| KOG1920 | 1265 | consensus IkappaB kinase complex, IKAP component [ | 90.38 | |
| KOG0985 | 1666 | consensus Vesicle coat protein clathrin, heavy cha | 90.36 | |
| PF10579 | 80 | Rapsyn_N: Rapsyn N-terminal myristoylation and lin | 90.35 | |
| PF11207 | 203 | DUF2989: Protein of unknown function (DUF2989); In | 90.25 | |
| KOG2581 | 493 | consensus 26S proteasome regulatory complex, subun | 89.95 | |
| KOG0686 | 466 | consensus COP9 signalosome, subunit CSN1 [Posttran | 88.7 | |
| PF10579 | 80 | Rapsyn_N: Rapsyn N-terminal myristoylation and lin | 87.38 | |
| PF09670 | 379 | Cas_Cas02710: CRISPR-associated protein (Cas_Cas02 | 87.09 | |
| PF15015 | 569 | NYD-SP12_N: Spermatogenesis-associated, N-terminal | 87.0 | |
| KOG0508 | 615 | consensus Ankyrin repeat protein [General function | 86.98 | |
| PF10952 | 140 | DUF2753: Protein of unknown function (DUF2753); In | 86.84 | |
| KOG0307 | 1049 | consensus Vesicle coat complex COPII, subunit SEC3 | 86.66 | |
| KOG2422 | 665 | consensus Uncharacterized conserved protein [Funct | 86.54 | |
| PF13174 | 33 | TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_ | 86.01 | |
| PF04781 | 111 | DUF627: Protein of unknown function (DUF627); Inte | 85.89 | |
| PF15015 | 569 | NYD-SP12_N: Spermatogenesis-associated, N-terminal | 85.65 | |
| KOG1308 | 377 | consensus Hsp70-interacting protein Hip/Transient | 85.35 | |
| KOG0687 | 393 | consensus 26S proteasome regulatory complex, subun | 85.05 | |
| PF10516 | 38 | SHNi-TPR: SHNi-TPR; InterPro: IPR019544 The tetrat | 84.57 | |
| KOG0508 | 615 | consensus Ankyrin repeat protein [General function | 84.19 | |
| PF13174 | 33 | TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_ | 83.98 | |
| PF04190 | 260 | DUF410: Protein of unknown function (DUF410) ; Int | 83.95 | |
| PF10516 | 38 | SHNi-TPR: SHNi-TPR; InterPro: IPR019544 The tetrat | 83.68 | |
| KOG1924 | 1102 | consensus RhoA GTPase effector DIA/Diaphanous [Sig | 83.48 | |
| KOG0686 | 466 | consensus COP9 signalosome, subunit CSN1 [Posttran | 83.35 | |
| PF04190 | 260 | DUF410: Protein of unknown function (DUF410) ; Int | 83.11 | |
| KOG4507 | 886 | consensus Uncharacterized conserved protein, conta | 83.07 | |
| COG5187 | 412 | RPN7 26S proteasome regulatory complex component, | 83.03 | |
| KOG1914 | 656 | consensus mRNA cleavage and polyadenylation factor | 82.95 | |
| COG4649 | 221 | Uncharacterized protein conserved in bacteria [Fun | 82.36 | |
| PF09613 | 160 | HrpB1_HrpK: Bacterial type III secretion protein ( | 82.01 | |
| smart00028 | 34 | TPR Tetratricopeptide repeats. Repeats present in | 81.87 | |
| smart00028 | 34 | TPR Tetratricopeptide repeats. Repeats present in | 81.65 | |
| COG5187 | 412 | RPN7 26S proteasome regulatory complex component, | 81.47 | |
| KOG4507 | 886 | consensus Uncharacterized conserved protein, conta | 81.23 | |
| KOG0687 | 393 | consensus 26S proteasome regulatory complex, subun | 80.56 | |
| PF09670 | 379 | Cas_Cas02710: CRISPR-associated protein (Cas_Cas02 | 80.36 |
| >KOG1839 consensus Uncharacterized protein CLU1/cluA/TIF31 involved in mitochondrial morphology/distribution, also found associated with eIF-3 [General function prediction only] | Back alignment and domain information |
|---|
Probab=100.00 E-value=4e-42 Score=430.57 Aligned_cols=455 Identities=27% Similarity=0.399 Sum_probs=407.2
Q ss_pred HHHHhhcCCcccccccc----cccccccccChHHHHHHHHHHHHHchHHHHHHHhccCCCCCcCchhHHHHHHhchhhhh
Q 000695 128 ELALKNLLSDEAFARLK----ESETGLHCKSLEELIDLSHNYYVEVALPKLVTDFGSLELSPVDGRTLTDFMHTRGLQMR 203 (1349)
Q Consensus 128 ~~~~~~~lspDAFt~~~----~~~~~~e~~~~eelVe~As~yL~~~vIP~fV~D~~s~~~sPiDG~sLTe~LH~rGINmR 203 (1349)
..+...-+|||.|.... ..........+++.+.++.+||....||.||+++..+.++|+||++|+++||..|||+|
T Consensus 656 ~~~~~~~fnp~~f~s~~v~~~~t~~~~~a~~~~qk~~d~~Erll~~~iPd~~Ks~~d~sv~p~dgq~l~~aL~~~g~n~r 735 (1236)
T KOG1839|consen 656 AVCGPYGFNPAGFYSLAVVLYHTEDFNQAAIQQQKVLDINERLLGLDIPDTMKSYGDLSVFPYDGQHLELALHYVGRNLR 735 (1236)
T ss_pred hhhcccccCccccccCceEecCccccchhhhhhHhHHHHHHHHhccccchhHHhccccceeeecccHHHHHHHHhhHHHH
Confidence 34455669999999831 11222224556778899999999999999999999999999999999999999999999
Q ss_pred hhhhHHHHhh-------hhHHHHHHHHHHHHHHHHHHHHHHHHHhhCChhHHHHHHHHHHHhhhccccCCCCC-------
Q 000695 204 SLGHVVKLSE-------KLSHVQSLCIHEMIVRAFKHIIQAVISAVGNTQRMAVSIAAALNLMLGVHESDGLN------- 269 (1349)
Q Consensus 204 YLG~Va~l~~-------~L~~l~~L~i~EMIARAaKhILR~~lr~l~~~~~la~aIAhfLNcLLGs~~~~~~~------- 269 (1349)
|||+++.+.. .+.++-+|++-|+++|++||+|+.++|.+ ...++..+++|||||+|+..++....
T Consensus 736 yLg~~~~~~~~~~~a~~~~v~l~~l~~~ei~~RslKhvlK~~~r~l-~~~~i~ta~SH~ln~~ls~~~~av~~~~t~~~~ 814 (1236)
T KOG1839|consen 736 YLGKTCGLSHPNTAATYINVALMELGVGEIALRSLKHVLKDNLRLL-GADHIQTAASHALNCLLSVMEAAVQKEQTTLEI 814 (1236)
T ss_pred HhhccccccCccccchhhhHHHHHHHHHHHHHHHHHHHHHHHHhhc-chhHHHHHHHHHHHHHhhcccccCCCccchHHH
Confidence 9999998753 26788899999999999999999999985 77899999999999999984441100
Q ss_pred ---C---------------------CCCCchHHHHHHHHHHHHhhcccccCCChh------hcchHHHHHHHHHHHhhHH
Q 000695 270 ---K---------------------SHNVHPLVWRWLELFLMKRYEWDLNGLNFK------DVRKFAILRGLCHKVGIEL 319 (1349)
Q Consensus 270 ---k---------------------s~~~~~llw~~I~~~lr~RF~y~L~~~~l~------~l~klaLLReLc~KlGIqL 319 (1349)
+ ..-....+|++|+.....+|.+........ ...++++.+..|.+.||+.
T Consensus 815 ~ka~~~~~~~~~~g~~k~~~S~~s~~~l~~s~L~~~I~~d~~~~~~~~~~~~~~~~i~~~~~~~~~~~~~~~~~~~~i~~ 894 (1236)
T KOG1839|consen 815 LKAKDLRTQDAAAGTPKPDASISSKGHLSVSDLLKYITADSKNKFTAAHDVKSRETILLKNGKSKIAVEKLEKKKRELQK 894 (1236)
T ss_pred HhhhhhhhhhhccCCCCcccccccccccchhHHHHhccccccccccchhhhhHHHHHhhhcccchhHHHHHHHHhhhcch
Confidence 0 001235689999999888888877654433 4557889999999999999
Q ss_pred hhccccCCCC---CCchHHHHHhhhhhhhhhcCChHHHHHHHHHHHHHHHcCChHHHHHHHHHHHHHHHHhhCCCChhhH
Q 000695 320 VSRDFDMDSP---SPFRKIDVVSLVPVHKQAACSSADGRQLLESSKTALDKGKLEDAVTYGTKALAKLVAVCGPYHRMTA 396 (1349)
Q Consensus 320 ~aRdY~fdsa---~~F~~eDIl~LvPvvK~s~~sss~A~~LlelG~~yl~qGdyeEAlel~eeALel~eqvlG~dhp~~A 396 (1349)
..+.|+|+.. ..|..+||+++.|++|+..+...++...++.|...+.+|.+.+|.+ .-+++.++..++|..|++++
T Consensus 895 ~~r~~~~e~~~~ks~f~~~Di~~~~p~ik~s~P~~~~a~~~~e~gq~~~~e~~~~~~~~-~~~slnl~~~v~~~~h~~~~ 973 (1236)
T KOG1839|consen 895 PARNYDFESSEPKSEFNDSDILNLRPVIKHSSPTVSEAKDSPEQGQEALLEDGFSEAYE-LPESLNLLNNVMGVLHPEVA 973 (1236)
T ss_pred hhhhccccccCCCCCCCcccccccccccccCCCccchhhhhhhhhhhhhcccchhhhhh-hhhhhhHHHHhhhhcchhHH
Confidence 9999999884 7899999999999999999999999999999999999999999999 99999999999999999999
Q ss_pred HHHHHHHHHHHhcCCHHHHHHHHHHHHHHHHHhcCCCCchhHHHHHHHHHHHHHcCCHHHHHHHHHHHHHHHHHhcCCCC
Q 000695 397 GAYSLLAVVLYHTGDFNQATIYQQKALDINERELGLDHPDTMKSYGDLAVFYYRLQHTELALKYVKRALYLLHLTCGPSH 476 (1349)
Q Consensus 397 ~ay~~LA~ay~~lGdyeeAle~~qKALeI~ErilG~Dhpdta~ay~NLA~ly~~lGdyeeALe~yerALel~e~l~G~dh 476 (1349)
.+|..|+.++..+|++++|+.+.++|+.+.++..|.+++++...|.+|+.+++..++...|+..+.++++++...+|++|
T Consensus 974 ~~~~~La~l~~~~~d~~~Ai~~~~ka~ii~eR~~g~ds~~t~~~y~nlal~~f~~~~~~~al~~~~ra~~l~~Ls~ge~h 1053 (1236)
T KOG1839|consen 974 SKYRSLAKLSNRLGDNQEAIAQQRKACIISERVLGKDSPNTKLAYGNLALYEFAVKNLSGALKSLNRALKLKLLSSGEDH 1053 (1236)
T ss_pred HHHHHHHHHHhhhcchHHHHHhcccceeeechhccCCCHHHHHHhhHHHHHHHhccCccchhhhHHHHHHhhccccCCCC
Confidence 99999999999999999999999999999999999999999999999999999999999999999999999999999999
Q ss_pred hhHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHhcCCCcHHHHHHHHHHHHHHHhcCChhHHHHHHHHHHHHHHHhc
Q 000695 477 PNTAATYINVAMMEEGLGNVHVALRYLHKALKCNQRLLGPDHIQTAASYHAIAIALSLMEAYPLSVQHEQTTLQILRAKL 556 (1349)
Q Consensus 477 P~~a~al~NLA~iy~~lGdydeAle~LekALei~ekllG~dhp~tA~a~~nLA~ay~~lGdydEAie~lekALeI~kk~L 556 (1349)
|.++.+..+++.++...++++.|+++++.|+++..+++|+.+..++.++..+|+++..++++..|+.+.+.++.||+..+
T Consensus 1054 P~~a~~~~nle~l~~~v~e~d~al~~le~A~a~~~~v~g~~~l~~~~~~~~~a~l~~s~~dfr~al~~ek~t~~iy~~ql 1133 (1236)
T KOG1839|consen 1054 PPTALSFINLELLLLGVEEADTALRYLESALAKNKKVLGPKELETALSYHALARLFESMKDFRNALEHEKVTYGIYKEQL 1133 (1236)
T ss_pred CchhhhhhHHHHHHhhHHHHHHHHHHHHHHHHHHhhhcCccchhhhhHHHHHHHHHhhhHHHHHHHHHHhhHHHHHHHhh
Confidence 99999999999999999999999999999999999999999999999999999999999999999999999999999999
Q ss_pred CCCCHHHHHHHHHHHHHHHHhHHHHHHH
Q 000695 557 GPDDLRTQDAAAWLEYFESKAFEQQEAA 584 (1349)
Q Consensus 557 G~dhp~T~eal~~La~L~qk~~eqAEAl 584 (1349)
|++|.++.++..|+......+...+.++
T Consensus 1134 g~~hsrt~~S~~~~~~~T~~~v~~Qk~~ 1161 (1236)
T KOG1839|consen 1134 GPDHSRTKESSEWLNLSTAIAVKIQKKL 1161 (1236)
T ss_pred CCCcccchhhHHHHHHhhHHHHHHHHHH
Confidence 9999999999999987766666555544
|
|
| >PF12807 eIF3_p135: Translation initiation factor eIF3 subunit 135 | Back alignment and domain information |
|---|
| >KOG1840 consensus Kinesin light chain [Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG1839 consensus Uncharacterized protein CLU1/cluA/TIF31 involved in mitochondrial morphology/distribution, also found associated with eIF-3 [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1840 consensus Kinesin light chain [Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG4626 consensus O-linked N-acetylglucosamine transferase OGT [Carbohydrate transport and metabolism; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG4626 consensus O-linked N-acetylglucosamine transferase OGT [Carbohydrate transport and metabolism; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >TIGR00990 3a0801s09 mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) | Back alignment and domain information |
|---|
| >TIGR00990 3a0801s09 mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) | Back alignment and domain information |
|---|
| >KOG1130 consensus Predicted G-alpha GTPase interaction protein, contains GoLoco domain [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG1126 consensus DNA-binding cell division cycle control protein [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >TIGR02521 type_IV_pilW type IV pilus biogenesis/stability protein PilW | Back alignment and domain information |
|---|
| >KOG1130 consensus Predicted G-alpha GTPase interaction protein, contains GoLoco domain [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PRK11788 tetratricopeptide repeat protein; Provisional | Back alignment and domain information |
|---|
| >PRK11788 tetratricopeptide repeat protein; Provisional | Back alignment and domain information |
|---|
| >PRK15174 Vi polysaccharide export protein VexE; Provisional | Back alignment and domain information |
|---|
| >PRK11189 lipoprotein NlpI; Provisional | Back alignment and domain information |
|---|
| >PRK15174 Vi polysaccharide export protein VexE; Provisional | Back alignment and domain information |
|---|
| >TIGR02917 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat lipoprotein | Back alignment and domain information |
|---|
| >KOG1155 consensus Anaphase-promoting complex (APC), Cdc23 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK11447 cellulose synthase subunit BcsC; Provisional | Back alignment and domain information |
|---|
| >PRK11447 cellulose synthase subunit BcsC; Provisional | Back alignment and domain information |
|---|
| >COG3063 PilF Tfp pilus assembly protein PilF [Cell motility and secretion / Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >TIGR02917 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat lipoprotein | Back alignment and domain information |
|---|
| >KOG0547 consensus Translocase of outer mitochondrial membrane complex, subunit TOM70/TOM72 [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >PRK09782 bacteriophage N4 receptor, outer membrane subunit; Provisional | Back alignment and domain information |
|---|
| >KOG1126 consensus DNA-binding cell division cycle control protein [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >PRK12370 invasion protein regulator; Provisional | Back alignment and domain information |
|---|
| >PRK12370 invasion protein regulator; Provisional | Back alignment and domain information |
|---|
| >PRK09782 bacteriophage N4 receptor, outer membrane subunit; Provisional | Back alignment and domain information |
|---|
| >TIGR02521 type_IV_pilW type IV pilus biogenesis/stability protein PilW | Back alignment and domain information |
|---|
| >PRK04841 transcriptional regulator MalT; Provisional | Back alignment and domain information |
|---|
| >TIGR03302 OM_YfiO outer membrane assembly lipoprotein YfiO | Back alignment and domain information |
|---|
| >COG3063 PilF Tfp pilus assembly protein PilF [Cell motility and secretion / Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >PRK11189 lipoprotein NlpI; Provisional | Back alignment and domain information |
|---|
| >KOG0547 consensus Translocase of outer mitochondrial membrane complex, subunit TOM70/TOM72 [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >KOG1155 consensus Anaphase-promoting complex (APC), Cdc23 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG2002 consensus TPR-containing nuclear phosphoprotein that regulates K(+) uptake [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >KOG2003 consensus TPR repeat-containing protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG2003 consensus TPR repeat-containing protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1129 consensus TPR repeat-containing protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1173 consensus Anaphase-promoting complex (APC), Cdc16 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >TIGR03302 OM_YfiO outer membrane assembly lipoprotein YfiO | Back alignment and domain information |
|---|
| >PRK10049 pgaA outer membrane protein PgaA; Provisional | Back alignment and domain information |
|---|
| >PRK10049 pgaA outer membrane protein PgaA; Provisional | Back alignment and domain information |
|---|
| >KOG1125 consensus TPR repeat-containing protein [General function prediction only] | Back alignment and domain information |
|---|
| >PRK04841 transcriptional regulator MalT; Provisional | Back alignment and domain information |
|---|
| >KOG2002 consensus TPR-containing nuclear phosphoprotein that regulates K(+) uptake [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PF14938 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1QQE_A 2IFU_A | Back alignment and domain information |
|---|
| >cd05804 StaR_like StaR_like; a well-conserved protein found in bacteria, plants, and animals | Back alignment and domain information |
|---|
| >KOG1173 consensus Anaphase-promoting complex (APC), Cdc16 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG1941 consensus Acetylcholine receptor-associated protein of the synapse (rapsyn) [Extracellular structures] | Back alignment and domain information |
|---|
| >PF13429 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2_B | Back alignment and domain information |
|---|
| >PF14938 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1QQE_A 2IFU_A | Back alignment and domain information |
|---|
| >PF13424 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 4A1S_B 3CEQ_B 3EDT_H | Back alignment and domain information |
|---|
| >KOG1941 consensus Acetylcholine receptor-associated protein of the synapse (rapsyn) [Extracellular structures] | Back alignment and domain information |
|---|
| >KOG1129 consensus TPR repeat-containing protein [General function prediction only] | Back alignment and domain information |
|---|
| >PF13424 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 4A1S_B 3CEQ_B 3EDT_H | Back alignment and domain information |
|---|
| >COG2956 Predicted N-acetylglucosaminyl transferase [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >KOG1125 consensus TPR repeat-containing protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG2076 consensus RNA polymerase III transcription factor TFIIIC [Transcription] | Back alignment and domain information |
|---|
| >KOG0624 consensus dsRNA-activated protein kinase inhibitor P58, contains TPR and DnaJ domains [Defense mechanisms] | Back alignment and domain information |
|---|
| >cd05804 StaR_like StaR_like; a well-conserved protein found in bacteria, plants, and animals | Back alignment and domain information |
|---|
| >PF13429 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2_B | Back alignment and domain information |
|---|
| >KOG0550 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >TIGR00540 hemY_coli hemY protein | Back alignment and domain information |
|---|
| >TIGR00540 hemY_coli hemY protein | Back alignment and domain information |
|---|
| >PRK15359 type III secretion system chaperone protein SscB; Provisional | Back alignment and domain information |
|---|
| >PRK15179 Vi polysaccharide biosynthesis protein TviE; Provisional | Back alignment and domain information |
|---|
| >PRK10747 putative protoheme IX biogenesis protein; Provisional | Back alignment and domain information |
|---|
| >CHL00033 ycf3 photosystem I assembly protein Ycf3 | Back alignment and domain information |
|---|
| >PRK10747 putative protoheme IX biogenesis protein; Provisional | Back alignment and domain information |
|---|
| >PRK15179 Vi polysaccharide biosynthesis protein TviE; Provisional | Back alignment and domain information |
|---|
| >PRK15359 type III secretion system chaperone protein SscB; Provisional | Back alignment and domain information |
|---|
| >CHL00033 ycf3 photosystem I assembly protein Ycf3 | Back alignment and domain information |
|---|
| >KOG4162 consensus Predicted calmodulin-binding protein [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0548 consensus Molecular co-chaperone STI1 [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG1174 consensus Anaphase-promoting complex (APC), subunit 7 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK10370 formate-dependent nitrite reductase complex subunit NrfG; Provisional | Back alignment and domain information |
|---|
| >PRK10370 formate-dependent nitrite reductase complex subunit NrfG; Provisional | Back alignment and domain information |
|---|
| >KOG0548 consensus Molecular co-chaperone STI1 [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0550 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >COG2956 Predicted N-acetylglucosaminyl transferase [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >KOG1174 consensus Anaphase-promoting complex (APC), subunit 7 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0495 consensus HAT repeat protein [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG0553 consensus TPR repeat-containing protein [General function prediction only] | Back alignment and domain information |
|---|
| >PLN02789 farnesyltranstransferase | Back alignment and domain information |
|---|
| >PLN03218 maturation of RBCL 1; Provisional | Back alignment and domain information |
|---|
| >PRK02603 photosystem I assembly protein Ycf3; Provisional | Back alignment and domain information |
|---|
| >PF13525 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M_A 2YHC_A | Back alignment and domain information |
|---|
| >TIGR02552 LcrH_SycD type III secretion low calcium response chaperone LcrH/SycD | Back alignment and domain information |
|---|
| >PF12569 NARP1: NMDA receptor-regulated protein 1 ; InterPro: IPR021183 This group represents N-terminal acetyltransferase A (NatA) auxiliary subunit and represents a non-catalytic component of the NatA N-terminal acetyltransferase, which catalyzes acetylation of proteins beginning with Met-Ser, Met-Gly and Met-Ala | Back alignment and domain information |
|---|
| >PRK14574 hmsH outer membrane protein; Provisional | Back alignment and domain information |
|---|
| >PRK02603 photosystem I assembly protein Ycf3; Provisional | Back alignment and domain information |
|---|
| >TIGR02552 LcrH_SycD type III secretion low calcium response chaperone LcrH/SycD | Back alignment and domain information |
|---|
| >PRK14720 transcript cleavage factor/unknown domain fusion protein; Provisional | Back alignment and domain information |
|---|
| >PLN03218 maturation of RBCL 1; Provisional | Back alignment and domain information |
|---|
| >TIGR02795 tol_pal_ybgF tol-pal system protein YbgF | Back alignment and domain information |
|---|
| >PRK15363 pathogenicity island 2 chaperone protein SscA; Provisional | Back alignment and domain information |
|---|
| >PRK10866 outer membrane biogenesis protein BamD; Provisional | Back alignment and domain information |
|---|
| >KOG1156 consensus N-terminal acetyltransferase [Chromatin structure and dynamics] | Back alignment and domain information |
|---|
| >COG5010 TadD Flp pilus assembly protein TadD, contains TPR repeats [Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >PLN03088 SGT1, suppressor of G2 allele of SKP1; Provisional | Back alignment and domain information |
|---|
| >PRK15363 pathogenicity island 2 chaperone protein SscA; Provisional | Back alignment and domain information |
|---|
| >PF09976 TPR_21: Tetratricopeptide repeat; InterPro: IPR018704 This domain, found in various hypothetical prokaryotic proteins, has no known function | Back alignment and domain information |
|---|
| >TIGR02795 tol_pal_ybgF tol-pal system protein YbgF | Back alignment and domain information |
|---|
| >PRK14720 transcript cleavage factor/unknown domain fusion protein; Provisional | Back alignment and domain information |
|---|
| >PRK14574 hmsH outer membrane protein; Provisional | Back alignment and domain information |
|---|
| >KOG2076 consensus RNA polymerase III transcription factor TFIIIC [Transcription] | Back alignment and domain information |
|---|
| >PLN02789 farnesyltranstransferase | Back alignment and domain information |
|---|
| >PLN03081 pentatricopeptide (PPR) repeat-containing protein; Provisional | Back alignment and domain information |
|---|
| >PLN03081 pentatricopeptide (PPR) repeat-containing protein; Provisional | Back alignment and domain information |
|---|
| >KOG1585 consensus Protein required for fusion of vesicles in vesicular transport, gamma-SNAP [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >PLN03088 SGT1, suppressor of G2 allele of SKP1; Provisional | Back alignment and domain information |
|---|
| >KOG2376 consensus Signal recognition particle, subunit Srp72 [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >COG5010 TadD Flp pilus assembly protein TadD, contains TPR repeats [Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >KOG0553 consensus TPR repeat-containing protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG2376 consensus Signal recognition particle, subunit Srp72 [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >COG4783 Putative Zn-dependent protease, contains TPR repeats [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1128 consensus Uncharacterized conserved protein, contains TPR repeats [General function prediction only] | Back alignment and domain information |
|---|
| >PF09976 TPR_21: Tetratricopeptide repeat; InterPro: IPR018704 This domain, found in various hypothetical prokaryotic proteins, has no known function | Back alignment and domain information |
|---|
| >PF13525 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M_A 2YHC_A | Back alignment and domain information |
|---|
| >KOG0624 consensus dsRNA-activated protein kinase inhibitor P58, contains TPR and DnaJ domains [Defense mechanisms] | Back alignment and domain information |
|---|
| >KOG0495 consensus HAT repeat protein [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG1585 consensus Protein required for fusion of vesicles in vesicular transport, gamma-SNAP [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >cd00189 TPR Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and C | Back alignment and domain information |
|---|
| >PLN03077 Protein ECB2; Provisional | Back alignment and domain information |
|---|
| >PRK10153 DNA-binding transcriptional activator CadC; Provisional | Back alignment and domain information |
|---|
| >KOG1127 consensus TPR repeat-containing protein [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG4162 consensus Predicted calmodulin-binding protein [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >cd00189 TPR Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and C | Back alignment and domain information |
|---|
| >PF12688 TPR_5: Tetratrico peptide repeat | Back alignment and domain information |
|---|
| >PRK10866 outer membrane biogenesis protein BamD; Provisional | Back alignment and domain information |
|---|
| >PLN03077 Protein ECB2; Provisional | Back alignment and domain information |
|---|
| >KOG0543 consensus FKBP-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG3617 consensus WD40 and TPR repeat-containing protein [General function prediction only] | Back alignment and domain information |
|---|
| >PF13414 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2PL2_B 3IEG_B 2FBN_A | Back alignment and domain information |
|---|
| >PRK10803 tol-pal system protein YbgF; Provisional | Back alignment and domain information |
|---|
| >COG0457 NrfG FOG: TPR repeat [General function prediction only] | Back alignment and domain information |
|---|
| >KOG3060 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >COG3071 HemY Uncharacterized enzyme of heme biosynthesis [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >PF13414 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2PL2_B 3IEG_B 2FBN_A | Back alignment and domain information |
|---|
| >PF12895 Apc3: Anaphase-promoting complex, cyclosome, subunit 3; PDB: 3KAE_D 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2XPI_A 3ULQ_A | Back alignment and domain information |
|---|
| >KOG0543 consensus FKBP-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF12688 TPR_5: Tetratrico peptide repeat | Back alignment and domain information |
|---|
| >PRK10803 tol-pal system protein YbgF; Provisional | Back alignment and domain information |
|---|
| >KOG3785 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG3060 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG1127 consensus TPR repeat-containing protein [RNA processing and modification] | Back alignment and domain information |
|---|
| >PF12895 Apc3: Anaphase-promoting complex, cyclosome, subunit 3; PDB: 3KAE_D 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2XPI_A 3ULQ_A | Back alignment and domain information |
|---|
| >PF12569 NARP1: NMDA receptor-regulated protein 1 ; InterPro: IPR021183 This group represents N-terminal acetyltransferase A (NatA) auxiliary subunit and represents a non-catalytic component of the NatA N-terminal acetyltransferase, which catalyzes acetylation of proteins beginning with Met-Ser, Met-Gly and Met-Ala | Back alignment and domain information |
|---|
| >KOG4340 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG1128 consensus Uncharacterized conserved protein, contains TPR repeats [General function prediction only] | Back alignment and domain information |
|---|
| >KOG2300 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >PRK10153 DNA-binding transcriptional activator CadC; Provisional | Back alignment and domain information |
|---|
| >KOG1156 consensus N-terminal acetyltransferase [Chromatin structure and dynamics] | Back alignment and domain information |
|---|
| >PRK11906 transcriptional regulator; Provisional | Back alignment and domain information |
|---|
| >COG4783 Putative Zn-dependent protease, contains TPR repeats [General function prediction only] | Back alignment and domain information |
|---|
| >KOG2047 consensus mRNA splicing factor [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG4555 consensus TPR repeat-containing protein [Function unknown] | Back alignment and domain information |
|---|
| >COG2909 MalT ATP-dependent transcriptional regulator [Transcription] | Back alignment and domain information |
|---|
| >KOG2300 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG2047 consensus mRNA splicing factor [RNA processing and modification] | Back alignment and domain information |
|---|
| >COG0457 NrfG FOG: TPR repeat [General function prediction only] | Back alignment and domain information |
|---|
| >PF04733 Coatomer_E: Coatomer epsilon subunit; InterPro: IPR006822 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment | Back alignment and domain information |
|---|
| >PF13432 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL_A 3CVQ_A 3CV0_A 2GW1_B 3CVN_A 3QKY_A 2PL2_B | Back alignment and domain information |
|---|
| >KOG4555 consensus TPR repeat-containing protein [Function unknown] | Back alignment and domain information |
|---|
| >COG3071 HemY Uncharacterized enzyme of heme biosynthesis [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >COG4105 ComL DNA uptake lipoprotein [General function prediction only] | Back alignment and domain information |
|---|
| >PF09295 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); InterPro: IPR015374 ChAPs (Chs5p-Arf1p-binding proteins) are required for the export of specialised cargo from the Golgi | Back alignment and domain information |
|---|
| >COG1729 Uncharacterized protein conserved in bacteria [Function unknown] | Back alignment and domain information |
|---|
| >KOG3617 consensus WD40 and TPR repeat-containing protein [General function prediction only] | Back alignment and domain information |
|---|
| >PF13432 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL_A 3CVQ_A 3CV0_A 2GW1_B 3CVN_A 3QKY_A 2PL2_B | Back alignment and domain information |
|---|
| >KOG1070 consensus rRNA processing protein Rrp5 [RNA processing and modification] | Back alignment and domain information |
|---|
| >PLN03098 LPA1 LOW PSII ACCUMULATION1; Provisional | Back alignment and domain information |
|---|
| >KOG3616 consensus Selective LIM binding factor [Transcription] | Back alignment and domain information |
|---|
| >COG4785 NlpI Lipoprotein NlpI, contains TPR repeats [General function prediction only] | Back alignment and domain information |
|---|
| >PF09295 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); InterPro: IPR015374 ChAPs (Chs5p-Arf1p-binding proteins) are required for the export of specialised cargo from the Golgi | Back alignment and domain information |
|---|
| >KOG3785 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >PF08631 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: IPR013940 SPO22 is a meiosis-specific protein with similarity to phospholipase A2, involved in completion of nuclear divisions during meiosis; induced early in meiosis [] | Back alignment and domain information |
|---|
| >PRK15331 chaperone protein SicA; Provisional | Back alignment and domain information |
|---|
| >PRK11906 transcriptional regulator; Provisional | Back alignment and domain information |
|---|
| >KOG1586 consensus Protein required for fusion of vesicles in vesicular transport, alpha-SNAP [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >PF13374 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT_H 3NF1_A | Back alignment and domain information |
|---|
| >KOG1070 consensus rRNA processing protein Rrp5 [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG1586 consensus Protein required for fusion of vesicles in vesicular transport, alpha-SNAP [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >PLN03098 LPA1 LOW PSII ACCUMULATION1; Provisional | Back alignment and domain information |
|---|
| >COG2909 MalT ATP-dependent transcriptional regulator [Transcription] | Back alignment and domain information |
|---|
| >COG1729 Uncharacterized protein conserved in bacteria [Function unknown] | Back alignment and domain information |
|---|
| >KOG4234 consensus TPR repeat-containing protein [General function prediction only] | Back alignment and domain information |
|---|
| >PF10345 Cohesin_load: Cohesin loading factor; InterPro: IPR019440 Cohesin loading factor is a conserved protein that has been characterised in fungi | Back alignment and domain information |
|---|
| >PF13374 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT_H 3NF1_A | Back alignment and domain information |
|---|
| >COG4235 Cytochrome c biogenesis factor [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >COG4700 Uncharacterized protein conserved in bacteria containing a divergent form of TPR repeats [Function unknown] | Back alignment and domain information |
|---|
| >KOG4234 consensus TPR repeat-containing protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG4648 consensus Uncharacterized conserved protein, contains LRR repeats [Function unknown] | Back alignment and domain information |
|---|
| >COG4785 NlpI Lipoprotein NlpI, contains TPR repeats [General function prediction only] | Back alignment and domain information |
|---|
| >KOG4340 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >PF13512 TPR_18: Tetratricopeptide repeat | Back alignment and domain information |
|---|
| >COG5159 RPN6 26S proteasome regulatory complex component [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK15331 chaperone protein SicA; Provisional | Back alignment and domain information |
|---|
| >PF10300 DUF3808: Protein of unknown function (DUF3808); InterPro: IPR019412 This entry represents a family of proteins conserved from fungi to humans | Back alignment and domain information |
|---|
| >PF12968 DUF3856: Domain of Unknown Function (DUF3856); InterPro: IPR024552 This domain of unknown function is found in a small group of tetratricopeptide-like proteins, which includes the uncharacterised protein Q8KAL8 from SWISSPROT | Back alignment and domain information |
|---|
| >KOG3616 consensus Selective LIM binding factor [Transcription] | Back alignment and domain information |
|---|
| >COG4235 Cytochrome c biogenesis factor [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >COG3898 Uncharacterized membrane-bound protein [Function unknown] | Back alignment and domain information |
|---|
| >PF13512 TPR_18: Tetratricopeptide repeat | Back alignment and domain information |
|---|
| >KOG4642 consensus Chaperone-dependent E3 ubiquitin protein ligase (contains TPR repeats) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF13371 TPR_9: Tetratricopeptide repeat | Back alignment and domain information |
|---|
| >PF13371 TPR_9: Tetratricopeptide repeat | Back alignment and domain information |
|---|
| >KOG2471 consensus TPR repeat-containing protein [General function prediction only] | Back alignment and domain information |
|---|
| >COG4105 ComL DNA uptake lipoprotein [General function prediction only] | Back alignment and domain information |
|---|
| >PF09986 DUF2225: Uncharacterized protein conserved in bacteria (DUF2225); InterPro: IPR018708 This conserved bacterial family has no known function | Back alignment and domain information |
|---|
| >PF13281 DUF4071: Domain of unknown function (DUF4071) | Back alignment and domain information |
|---|
| >PF14559 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN_B 3QOU_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 3FP3_A 3LCA_A | Back alignment and domain information |
|---|
| >KOG1915 consensus Cell cycle control protein (crooked neck) [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >KOG3081 consensus Vesicle coat complex COPI, epsilon subunit [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >PF12968 DUF3856: Domain of Unknown Function (DUF3856); InterPro: IPR024552 This domain of unknown function is found in a small group of tetratricopeptide-like proteins, which includes the uncharacterised protein Q8KAL8 from SWISSPROT | Back alignment and domain information |
|---|
| >PF04184 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for suppression of tumorigenicity 7) protein is thought to be a tumour suppressor gene | Back alignment and domain information |
|---|
| >PF10345 Cohesin_load: Cohesin loading factor; InterPro: IPR019440 Cohesin loading factor is a conserved protein that has been characterised in fungi | Back alignment and domain information |
|---|
| >PF14559 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN_B 3QOU_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 3FP3_A 3LCA_A | Back alignment and domain information |
|---|
| >KOG1915 consensus Cell cycle control protein (crooked neck) [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >KOG4648 consensus Uncharacterized conserved protein, contains LRR repeats [Function unknown] | Back alignment and domain information |
|---|
| >PF09986 DUF2225: Uncharacterized protein conserved in bacteria (DUF2225); InterPro: IPR018708 This conserved bacterial family has no known function | Back alignment and domain information |
|---|
| >KOG1464 consensus COP9 signalosome, subunit CSN2 [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG2796 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG3081 consensus Vesicle coat complex COPI, epsilon subunit [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >PF04733 Coatomer_E: Coatomer epsilon subunit; InterPro: IPR006822 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment | Back alignment and domain information |
|---|
| >PF10602 RPN7: 26S proteasome subunit RPN7; InterPro: IPR019585 This entry represents the regulatory subunit RPN7 (known as the non-ATPase regulatory subunit 6 in higher eukaryotes) of the 26S proteasome | Back alignment and domain information |
|---|
| >PF10300 DUF3808: Protein of unknown function (DUF3808); InterPro: IPR019412 This entry represents a family of proteins conserved from fungi to humans | Back alignment and domain information |
|---|
| >KOG2796 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >PF02259 FAT: FAT domain; InterPro: IPR003151 The FAT domain is a domain present in the PIK-related kinases | Back alignment and domain information |
|---|
| >COG4700 Uncharacterized protein conserved in bacteria containing a divergent form of TPR repeats [Function unknown] | Back alignment and domain information |
|---|
| >KOG1463 consensus 26S proteasome regulatory complex, subunit RPN6/PSMD11 [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF03704 BTAD: Bacterial transcriptional activator domain; InterPro: IPR005158 Found in the DNRI/REDD/AFSR family of regulators, this region of AFSR (P25941 from SWISSPROT) along with the C-terminal region is capable of independently directing actinorhodin production | Back alignment and domain information |
|---|
| >PF03704 BTAD: Bacterial transcriptional activator domain; InterPro: IPR005158 Found in the DNRI/REDD/AFSR family of regulators, this region of AFSR (P25941 from SWISSPROT) along with the C-terminal region is capable of independently directing actinorhodin production | Back alignment and domain information |
|---|
| >KOG4642 consensus Chaperone-dependent E3 ubiquitin protein ligase (contains TPR repeats) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0551 consensus Hsp90 co-chaperone CNS1 (contains TPR repeats) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF04184 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for suppression of tumorigenicity 7) protein is thought to be a tumour suppressor gene | Back alignment and domain information |
|---|
| >KOG2471 consensus TPR repeat-containing protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG2041 consensus WD40 repeat protein [General function prediction only] | Back alignment and domain information |
|---|
| >PF08631 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: IPR013940 SPO22 is a meiosis-specific protein with similarity to phospholipase A2, involved in completion of nuclear divisions during meiosis; induced early in meiosis [] | Back alignment and domain information |
|---|
| >KOG2610 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >PF10602 RPN7: 26S proteasome subunit RPN7; InterPro: IPR019585 This entry represents the regulatory subunit RPN7 (known as the non-ATPase regulatory subunit 6 in higher eukaryotes) of the 26S proteasome | Back alignment and domain information |
|---|
| >COG3118 Thioredoxin domain-containing protein [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG1464 consensus COP9 signalosome, subunit CSN2 [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0545 consensus Aryl-hydrocarbon receptor-interacting protein [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0545 consensus Aryl-hydrocarbon receptor-interacting protein [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF12862 Apc5: Anaphase-promoting complex subunit 5 | Back alignment and domain information |
|---|
| >PF12862 Apc5: Anaphase-promoting complex subunit 5 | Back alignment and domain information |
|---|
| >COG2976 Uncharacterized protein conserved in bacteria [Function unknown] | Back alignment and domain information |
|---|
| >PF04910 Tcf25: Transcriptional repressor TCF25; InterPro: IPR006994 This entry appears to represent a novel family of basic helix-loop-helix (bHLH) proteins that control differentiation and development of a variety of organs [, ] | Back alignment and domain information |
|---|
| >PF11817 Foie-gras_1: Foie gras liver health family 1; InterPro: IPR021773 Mutating the gene foie gras in zebrafish has been shown to affect development; the mutants develop large, lipid-filled hepatocytes in the liver, resembling those in individuals with fatty liver disease [] | Back alignment and domain information |
|---|
| >COG2976 Uncharacterized protein conserved in bacteria [Function unknown] | Back alignment and domain information |
|---|
| >PF02259 FAT: FAT domain; InterPro: IPR003151 The FAT domain is a domain present in the PIK-related kinases | Back alignment and domain information |
|---|
| >KOG2610 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG0985 consensus Vesicle coat protein clathrin, heavy chain [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >PF13176 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_A 3RO2_A | Back alignment and domain information |
|---|
| >PF08626 TRAPPC9-Trs120: Transport protein Trs120 or TRAPPC9, TRAPP II complex subunit; InterPro: IPR013935 The trafficking protein particle complex TRAPP is a multi-protein complex needed in the early stages of the secretory pathway | Back alignment and domain information |
|---|
| >PF00515 TPR_1: Tetratricopeptide repeat; InterPro: IPR001440 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] | Back alignment and domain information |
|---|
| >PF12739 TRAPPC-Trs85: ER-Golgi trafficking TRAPP I complex 85 kDa subunit; InterPro: IPR024420 This entry represents Trs85, a subunit of the TRAPP III complex [] | Back alignment and domain information |
|---|
| >COG5159 RPN6 26S proteasome regulatory complex component [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF05843 Suf: Suppressor of forked protein (Suf); InterPro: IPR008847 This domain consists of several eukaryotic suppressor of forked (Suf) like proteins | Back alignment and domain information |
|---|
| >PF07719 TPR_2: Tetratricopeptide repeat; InterPro: IPR013105 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] | Back alignment and domain information |
|---|
| >KOG1550 consensus Extracellular protein SEL-1 and related proteins [Cell wall/membrane/envelope biogenesis; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF13176 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_A 3RO2_A | Back alignment and domain information |
|---|
| >KOG4322 consensus Anaphase-promoting complex (APC), subunit 5 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >COG0790 FOG: TPR repeat, SEL1 subfamily [General function prediction only] | Back alignment and domain information |
|---|
| >PF00515 TPR_1: Tetratricopeptide repeat; InterPro: IPR001440 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] | Back alignment and domain information |
|---|
| >KOG2053 consensus Mitochondrial inheritance and actin cytoskeleton organization protein [Cytoskeleton] | Back alignment and domain information |
|---|
| >PF13281 DUF4071: Domain of unknown function (DUF4071) | Back alignment and domain information |
|---|
| >COG0790 FOG: TPR repeat, SEL1 subfamily [General function prediction only] | Back alignment and domain information |
|---|
| >COG3898 Uncharacterized membrane-bound protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG0551 consensus Hsp90 co-chaperone CNS1 (contains TPR repeats) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF05843 Suf: Suppressor of forked protein (Suf); InterPro: IPR008847 This domain consists of several eukaryotic suppressor of forked (Suf) like proteins | Back alignment and domain information |
|---|
| >KOG4814 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >PF07719 TPR_2: Tetratricopeptide repeat; InterPro: IPR013105 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] | Back alignment and domain information |
|---|
| >PF13181 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_C 2KCV_A 2KCL_A 3FP3_A 3LCA_A 3FP4_A 3FP2_A 1W3B_B 1ELW_A | Back alignment and domain information |
|---|
| >KOG0376 consensus Serine-threonine phosphatase 2A, catalytic subunit [General function prediction only] | Back alignment and domain information |
|---|
| >PF13428 TPR_14: Tetratricopeptide repeat | Back alignment and domain information |
|---|
| >PF12739 TRAPPC-Trs85: ER-Golgi trafficking TRAPP I complex 85 kDa subunit; InterPro: IPR024420 This entry represents Trs85, a subunit of the TRAPP III complex [] | Back alignment and domain information |
|---|
| >KOG1463 consensus 26S proteasome regulatory complex, subunit RPN6/PSMD11 [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF00244 14-3-3: 14-3-3 protein; InterPro: IPR023410 The 14-3-3 proteins are a large family of approximately 30kDa acidic proteins which exist primarily as homo- and heterodimeric within all eukaryotic cells [, ] | Back alignment and domain information |
|---|
| >PF06552 TOM20_plant: Plant specific mitochondrial import receptor subunit TOM20; InterPro: IPR010547 This family consists of several plant specific mitochondrial import receptor subunit TOM20 (translocase of outer membrane 20 kDa subunit) proteins | Back alignment and domain information |
|---|
| >PF13431 TPR_17: Tetratricopeptide repeat | Back alignment and domain information |
|---|
| >PF13428 TPR_14: Tetratricopeptide repeat | Back alignment and domain information |
|---|
| >KOG4014 consensus Uncharacterized conserved protein (contains TPR repeat) [Function unknown] | Back alignment and domain information |
|---|
| >PF13181 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_C 2KCV_A 2KCL_A 3FP3_A 3LCA_A 3FP4_A 3FP2_A 1W3B_B 1ELW_A | Back alignment and domain information |
|---|
| >KOG1308 consensus Hsp70-interacting protein Hip/Transient component of progesterone receptor complexes and an Hsp70-binding protein [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG4563 consensus Cell cycle-regulated histone H1-binding protein [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >COG3118 Thioredoxin domain-containing protein [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG2041 consensus WD40 repeat protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1550 consensus Extracellular protein SEL-1 and related proteins [Cell wall/membrane/envelope biogenesis; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG1538 consensus Uncharacterized conserved protein WDR10, contains WD40 repeats [General function prediction only] | Back alignment and domain information |
|---|
| >KOG4814 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >PF06552 TOM20_plant: Plant specific mitochondrial import receptor subunit TOM20; InterPro: IPR010547 This family consists of several plant specific mitochondrial import receptor subunit TOM20 (translocase of outer membrane 20 kDa subunit) proteins | Back alignment and domain information |
|---|
| >KOG2561 consensus Adaptor protein NUB1, contains UBA domain [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF08626 TRAPPC9-Trs120: Transport protein Trs120 or TRAPPC9, TRAPP II complex subunit; InterPro: IPR013935 The trafficking protein particle complex TRAPP is a multi-protein complex needed in the early stages of the secretory pathway | Back alignment and domain information |
|---|
| >PF13431 TPR_17: Tetratricopeptide repeat | Back alignment and domain information |
|---|
| >KOG2581 consensus 26S proteasome regulatory complex, subunit RPN3/PSMD3 [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG1538 consensus Uncharacterized conserved protein WDR10, contains WD40 repeats [General function prediction only] | Back alignment and domain information |
|---|
| >PF04910 Tcf25: Transcriptional repressor TCF25; InterPro: IPR006994 This entry appears to represent a novel family of basic helix-loop-helix (bHLH) proteins that control differentiation and development of a variety of organs [, ] | Back alignment and domain information |
|---|
| >KOG1924 consensus RhoA GTPase effector DIA/Diaphanous [Signal transduction mechanisms; Cytoskeleton] | Back alignment and domain information |
|---|
| >smart00101 14_3_3 14-3-3 homologues | Back alignment and domain information |
|---|
| >PF08424 NRDE-2: NRDE-2, necessary for RNA interference; InterPro: IPR013633 This is domain is found in eukaryotic proteins of unknown function | Back alignment and domain information |
|---|
| >KOG4322 consensus Anaphase-promoting complex (APC), subunit 5 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF08424 NRDE-2: NRDE-2, necessary for RNA interference; InterPro: IPR013633 This is domain is found in eukaryotic proteins of unknown function | Back alignment and domain information |
|---|
| >KOG2053 consensus Mitochondrial inheritance and actin cytoskeleton organization protein [Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG3783 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >PF11817 Foie-gras_1: Foie gras liver health family 1; InterPro: IPR021773 Mutating the gene foie gras in zebrafish has been shown to affect development; the mutants develop large, lipid-filled hepatocytes in the liver, resembling those in individuals with fatty liver disease [] | Back alignment and domain information |
|---|
| >KOG1914 consensus mRNA cleavage and polyadenylation factor I complex, subunit RNA14 [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG0376 consensus Serine-threonine phosphatase 2A, catalytic subunit [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1920 consensus IkappaB kinase complex, IKAP component [Transcription] | Back alignment and domain information |
|---|
| >KOG0985 consensus Vesicle coat protein clathrin, heavy chain [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >PF10579 Rapsyn_N: Rapsyn N-terminal myristoylation and linker region; InterPro: IPR019568 Neuromuscular junction formation relies upon the clustering of acetylcholine receptors and other proteins in the muscle membrane | Back alignment and domain information |
|---|
| >PF11207 DUF2989: Protein of unknown function (DUF2989); InterPro: IPR021372 Some members in this bacterial family of proteins are annotated as lipoproteins however this cannot be confirmed | Back alignment and domain information |
|---|
| >KOG2581 consensus 26S proteasome regulatory complex, subunit RPN3/PSMD3 [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0686 consensus COP9 signalosome, subunit CSN1 [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF10579 Rapsyn_N: Rapsyn N-terminal myristoylation and linker region; InterPro: IPR019568 Neuromuscular junction formation relies upon the clustering of acetylcholine receptors and other proteins in the muscle membrane | Back alignment and domain information |
|---|
| >PF09670 Cas_Cas02710: CRISPR-associated protein (Cas_Cas02710) | Back alignment and domain information |
|---|
| >PF15015 NYD-SP12_N: Spermatogenesis-associated, N-terminal | Back alignment and domain information |
|---|
| >KOG0508 consensus Ankyrin repeat protein [General function prediction only] | Back alignment and domain information |
|---|
| >PF10952 DUF2753: Protein of unknown function (DUF2753); InterPro: IPR020206 This entry represents a group of uncharacterised proteins | Back alignment and domain information |
|---|
| >KOG0307 consensus Vesicle coat complex COPII, subunit SEC31 [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >KOG2422 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >PF13174 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_A 3URZ_B 2Q7F_A | Back alignment and domain information |
|---|
| >PF04781 DUF627: Protein of unknown function (DUF627); InterPro: IPR006866 This domain represents the N-terminal region of several plant proteins of unknown function | Back alignment and domain information |
|---|
| >PF15015 NYD-SP12_N: Spermatogenesis-associated, N-terminal | Back alignment and domain information |
|---|
| >KOG1308 consensus Hsp70-interacting protein Hip/Transient component of progesterone receptor complexes and an Hsp70-binding protein [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0687 consensus 26S proteasome regulatory complex, subunit RPN7/PSMD6 [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF10516 SHNi-TPR: SHNi-TPR; InterPro: IPR019544 The tetratrico peptide repeat region (TPR) is a structural motif present in a wide range of proteins [, , ] | Back alignment and domain information |
|---|
| >KOG0508 consensus Ankyrin repeat protein [General function prediction only] | Back alignment and domain information |
|---|
| >PF13174 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_A 3URZ_B 2Q7F_A | Back alignment and domain information |
|---|
| >PF04190 DUF410: Protein of unknown function (DUF410) ; InterPro: IPR007317 This is a family of conserved eukaryotic proteins with undetermined function | Back alignment and domain information |
|---|
| >PF10516 SHNi-TPR: SHNi-TPR; InterPro: IPR019544 The tetratrico peptide repeat region (TPR) is a structural motif present in a wide range of proteins [, , ] | Back alignment and domain information |
|---|
| >KOG1924 consensus RhoA GTPase effector DIA/Diaphanous [Signal transduction mechanisms; Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG0686 consensus COP9 signalosome, subunit CSN1 [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF04190 DUF410: Protein of unknown function (DUF410) ; InterPro: IPR007317 This is a family of conserved eukaryotic proteins with undetermined function | Back alignment and domain information |
|---|
| >KOG4507 consensus Uncharacterized conserved protein, contains TPR repeats [Function unknown] | Back alignment and domain information |
|---|
| >COG5187 RPN7 26S proteasome regulatory complex component, contains PCI domain [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG1914 consensus mRNA cleavage and polyadenylation factor I complex, subunit RNA14 [RNA processing and modification] | Back alignment and domain information |
|---|
| >COG4649 Uncharacterized protein conserved in bacteria [Function unknown] | Back alignment and domain information |
|---|
| >PF09613 HrpB1_HrpK: Bacterial type III secretion protein (HrpB1_HrpK); InterPro: IPR013394 This family of proteins is encoded by genes found within type III secretion operons in a limited range of species including Xanthomonas, Ralstonia and Burkholderia | Back alignment and domain information |
|---|
| >smart00028 TPR Tetratricopeptide repeats | Back alignment and domain information |
|---|
| >smart00028 TPR Tetratricopeptide repeats | Back alignment and domain information |
|---|
| >COG5187 RPN7 26S proteasome regulatory complex component, contains PCI domain [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG4507 consensus Uncharacterized conserved protein, contains TPR repeats [Function unknown] | Back alignment and domain information |
|---|
| >KOG0687 consensus 26S proteasome regulatory complex, subunit RPN7/PSMD6 [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF09670 Cas_Cas02710: CRISPR-associated protein (Cas_Cas02710) | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 1349 | ||||
| 3nf1_A | 311 | Crystal Structure Of The Tpr Domain Of Kinesin Ligh | 4e-10 | ||
| 3nf1_A | 311 | Crystal Structure Of The Tpr Domain Of Kinesin Ligh | 3e-09 | ||
| 3ceq_A | 283 | The Tpr Domain Of Human Kinesin Light Chain 2 (Hklc | 1e-08 | ||
| 3ceq_A | 283 | The Tpr Domain Of Human Kinesin Light Chain 2 (Hklc | 6e-06 | ||
| 3edt_B | 283 | Crystal Structure Of The Mutated S328n Hklc2 Tpr Do | 1e-08 | ||
| 3edt_B | 283 | Crystal Structure Of The Mutated S328n Hklc2 Tpr Do | 4e-06 | ||
| 2fo7_A | 136 | Crystal Structure Of An 8 Repeat Consensus Tpr Supe | 3e-04 | ||
| 2fo7_A | 136 | Crystal Structure Of An 8 Repeat Consensus Tpr Supe | 9e-04 | ||
| 2wqh_A | 125 | Crystal Structure Of Ctpr3y3 Length = 125 | 3e-04 |
| >pdb|3NF1|A Chain A, Crystal Structure Of The Tpr Domain Of Kinesin Light Chain 1 Length = 311 | Back alignment and structure |
|
| >pdb|3NF1|A Chain A, Crystal Structure Of The Tpr Domain Of Kinesin Light Chain 1 Length = 311 | Back alignment and structure |
| >pdb|3CEQ|A Chain A, The Tpr Domain Of Human Kinesin Light Chain 2 (Hklc2) Length = 283 | Back alignment and structure |
| >pdb|3CEQ|A Chain A, The Tpr Domain Of Human Kinesin Light Chain 2 (Hklc2) Length = 283 | Back alignment and structure |
| >pdb|3EDT|B Chain B, Crystal Structure Of The Mutated S328n Hklc2 Tpr Domain Length = 283 | Back alignment and structure |
| >pdb|3EDT|B Chain B, Crystal Structure Of The Mutated S328n Hklc2 Tpr Domain Length = 283 | Back alignment and structure |
| >pdb|2FO7|A Chain A, Crystal Structure Of An 8 Repeat Consensus Tpr Superhelix (Trigonal Crystal Form) Length = 136 | Back alignment and structure |
| >pdb|2FO7|A Chain A, Crystal Structure Of An 8 Repeat Consensus Tpr Superhelix (Trigonal Crystal Form) Length = 136 | Back alignment and structure |
| >pdb|2WQH|A Chain A, Crystal Structure Of Ctpr3y3 Length = 125 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 1349 | |||
| 3nf1_A | 311 | KLC 1, kinesin light chain 1; TPR, structural geno | 2e-38 | |
| 3nf1_A | 311 | KLC 1, kinesin light chain 1; TPR, structural geno | 3e-35 | |
| 3nf1_A | 311 | KLC 1, kinesin light chain 1; TPR, structural geno | 2e-34 | |
| 3nf1_A | 311 | KLC 1, kinesin light chain 1; TPR, structural geno | 8e-34 | |
| 3nf1_A | 311 | KLC 1, kinesin light chain 1; TPR, structural geno | 2e-24 | |
| 3nf1_A | 311 | KLC 1, kinesin light chain 1; TPR, structural geno | 4e-06 | |
| 3nf1_A | 311 | KLC 1, kinesin light chain 1; TPR, structural geno | 2e-04 | |
| 3edt_B | 283 | KLC 2, kinesin light chain 2; superhelical, struct | 1e-36 | |
| 3edt_B | 283 | KLC 2, kinesin light chain 2; superhelical, struct | 4e-35 | |
| 3edt_B | 283 | KLC 2, kinesin light chain 2; superhelical, struct | 2e-34 | |
| 3edt_B | 283 | KLC 2, kinesin light chain 2; superhelical, struct | 3e-29 | |
| 3edt_B | 283 | KLC 2, kinesin light chain 2; superhelical, struct | 1e-05 | |
| 3gw4_A | 203 | Uncharacterized protein; structural genomics, PSI- | 1e-23 | |
| 3gw4_A | 203 | Uncharacterized protein; structural genomics, PSI- | 9e-09 | |
| 3sf4_A | 406 | G-protein-signaling modulator 2; tetratricopeptide | 2e-22 | |
| 3sf4_A | 406 | G-protein-signaling modulator 2; tetratricopeptide | 1e-21 | |
| 3sf4_A | 406 | G-protein-signaling modulator 2; tetratricopeptide | 1e-18 | |
| 3sf4_A | 406 | G-protein-signaling modulator 2; tetratricopeptide | 4e-18 | |
| 3sf4_A | 406 | G-protein-signaling modulator 2; tetratricopeptide | 9e-18 | |
| 3sf4_A | 406 | G-protein-signaling modulator 2; tetratricopeptide | 1e-17 | |
| 3sf4_A | 406 | G-protein-signaling modulator 2; tetratricopeptide | 2e-09 | |
| 3sf4_A | 406 | G-protein-signaling modulator 2; tetratricopeptide | 3e-09 | |
| 3sf4_A | 406 | G-protein-signaling modulator 2; tetratricopeptide | 5e-04 | |
| 3ro2_A | 338 | PINS homolog, G-protein-signaling modulator 2; TPR | 8e-22 | |
| 3ro2_A | 338 | PINS homolog, G-protein-signaling modulator 2; TPR | 3e-20 | |
| 3ro2_A | 338 | PINS homolog, G-protein-signaling modulator 2; TPR | 5e-20 | |
| 4a1s_A | 411 | PINS, partner of inscuteable; cell cycle, LGN, mit | 1e-21 | |
| 4a1s_A | 411 | PINS, partner of inscuteable; cell cycle, LGN, mit | 3e-21 | |
| 4a1s_A | 411 | PINS, partner of inscuteable; cell cycle, LGN, mit | 2e-20 | |
| 4a1s_A | 411 | PINS, partner of inscuteable; cell cycle, LGN, mit | 5e-19 | |
| 4a1s_A | 411 | PINS, partner of inscuteable; cell cycle, LGN, mit | 1e-17 | |
| 4a1s_A | 411 | PINS, partner of inscuteable; cell cycle, LGN, mit | 5e-17 | |
| 4a1s_A | 411 | PINS, partner of inscuteable; cell cycle, LGN, mit | 7e-04 | |
| 3ro3_A | 164 | PINS homolog, G-protein-signaling modulator 2; asy | 3e-21 | |
| 3ro3_A | 164 | PINS homolog, G-protein-signaling modulator 2; asy | 9e-11 | |
| 3q15_A | 378 | PSP28, response regulator aspartate phosphatase H; | 6e-21 | |
| 3q15_A | 378 | PSP28, response regulator aspartate phosphatase H; | 4e-19 | |
| 3q15_A | 378 | PSP28, response regulator aspartate phosphatase H; | 1e-14 | |
| 3q15_A | 378 | PSP28, response regulator aspartate phosphatase H; | 2e-14 | |
| 3q15_A | 378 | PSP28, response regulator aspartate phosphatase H; | 8e-12 | |
| 3ulq_A | 383 | Response regulator aspartate phosphatase F; tetrat | 2e-20 | |
| 3ulq_A | 383 | Response regulator aspartate phosphatase F; tetrat | 1e-19 | |
| 3ulq_A | 383 | Response regulator aspartate phosphatase F; tetrat | 3e-18 | |
| 3ulq_A | 383 | Response regulator aspartate phosphatase F; tetrat | 4e-13 | |
| 3ulq_A | 383 | Response regulator aspartate phosphatase F; tetrat | 1e-09 | |
| 3ulq_A | 383 | Response regulator aspartate phosphatase F; tetrat | 4e-08 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 2e-15 | |
| 2ifu_A | 307 | Gamma-SNAP; membrane fusion, snare complex disasse | 1e-13 | |
| 2ifu_A | 307 | Gamma-SNAP; membrane fusion, snare complex disasse | 5e-10 | |
| 2ifu_A | 307 | Gamma-SNAP; membrane fusion, snare complex disasse | 6e-10 | |
| 3tax_A | 723 | UDP-N-acetylglucosamine--peptide N- acetylglucosam | 1e-13 | |
| 3tax_A | 723 | UDP-N-acetylglucosamine--peptide N- acetylglucosam | 2e-09 | |
| 3tax_A | 723 | UDP-N-acetylglucosamine--peptide N- acetylglucosam | 5e-04 | |
| 2xpi_A | 597 | Anaphase-promoting complex subunit CUT9; cell cycl | 4e-13 | |
| 2xpi_A | 597 | Anaphase-promoting complex subunit CUT9; cell cycl | 3e-12 | |
| 2xpi_A | 597 | Anaphase-promoting complex subunit CUT9; cell cycl | 4e-12 | |
| 2xpi_A | 597 | Anaphase-promoting complex subunit CUT9; cell cycl | 1e-11 | |
| 2xpi_A | 597 | Anaphase-promoting complex subunit CUT9; cell cycl | 3e-08 | |
| 3hym_B | 330 | Cell division cycle protein 16 homolog; APC, anaph | 4e-13 | |
| 3hym_B | 330 | Cell division cycle protein 16 homolog; APC, anaph | 4e-12 | |
| 3hym_B | 330 | Cell division cycle protein 16 homolog; APC, anaph | 4e-11 | |
| 3hym_B | 330 | Cell division cycle protein 16 homolog; APC, anaph | 4e-07 | |
| 1hz4_A | 373 | MALT regulatory protein; two-helix bundles, helix | 7e-13 | |
| 1hz4_A | 373 | MALT regulatory protein; two-helix bundles, helix | 6e-12 | |
| 1hz4_A | 373 | MALT regulatory protein; two-helix bundles, helix | 2e-10 | |
| 1hz4_A | 373 | MALT regulatory protein; two-helix bundles, helix | 4e-06 | |
| 1w3b_A | 388 | UDP-N-acetylglucosamine--peptide N-acetylglucosami | 5e-12 | |
| 1w3b_A | 388 | UDP-N-acetylglucosamine--peptide N-acetylglucosami | 2e-11 | |
| 1w3b_A | 388 | UDP-N-acetylglucosamine--peptide N-acetylglucosami | 4e-11 | |
| 1w3b_A | 388 | UDP-N-acetylglucosamine--peptide N-acetylglucosami | 1e-09 | |
| 1w3b_A | 388 | UDP-N-acetylglucosamine--peptide N-acetylglucosami | 4e-07 | |
| 3urz_A | 208 | Uncharacterized protein; tetratricopeptide repeats | 6e-12 | |
| 3u4t_A | 272 | TPR repeat-containing protein; structural genomics | 1e-11 | |
| 3u4t_A | 272 | TPR repeat-containing protein; structural genomics | 7e-11 | |
| 3u4t_A | 272 | TPR repeat-containing protein; structural genomics | 3e-09 | |
| 2ho1_A | 252 | Type 4 fimbrial biogenesis protein PILF; type IV p | 2e-11 | |
| 2ho1_A | 252 | Type 4 fimbrial biogenesis protein PILF; type IV p | 1e-06 | |
| 2ho1_A | 252 | Type 4 fimbrial biogenesis protein PILF; type IV p | 2e-06 | |
| 4g1t_A | 472 | Interferon-induced protein with tetratricopeptide | 4e-11 | |
| 4g1t_A | 472 | Interferon-induced protein with tetratricopeptide | 7e-08 | |
| 4g1t_A | 472 | Interferon-induced protein with tetratricopeptide | 1e-07 | |
| 4g1t_A | 472 | Interferon-induced protein with tetratricopeptide | 3e-05 | |
| 4g1t_A | 472 | Interferon-induced protein with tetratricopeptide | 3e-04 | |
| 2gw1_A | 514 | Mitochondrial precursor proteins import receptor; | 6e-11 | |
| 2gw1_A | 514 | Mitochondrial precursor proteins import receptor; | 1e-09 | |
| 2gw1_A | 514 | Mitochondrial precursor proteins import receptor; | 4e-09 | |
| 2gw1_A | 514 | Mitochondrial precursor proteins import receptor; | 5e-08 | |
| 2gw1_A | 514 | Mitochondrial precursor proteins import receptor; | 7e-07 | |
| 2gw1_A | 514 | Mitochondrial precursor proteins import receptor; | 6e-04 | |
| 3fp2_A | 537 | TPR repeat-containing protein YHR117W; TOM71, mito | 7e-11 | |
| 3fp2_A | 537 | TPR repeat-containing protein YHR117W; TOM71, mito | 9e-11 | |
| 3fp2_A | 537 | TPR repeat-containing protein YHR117W; TOM71, mito | 4e-09 | |
| 3fp2_A | 537 | TPR repeat-containing protein YHR117W; TOM71, mito | 6e-09 | |
| 3fp2_A | 537 | TPR repeat-containing protein YHR117W; TOM71, mito | 5e-07 | |
| 3fp2_A | 537 | TPR repeat-containing protein YHR117W; TOM71, mito | 3e-06 | |
| 2vq2_A | 225 | PILW, putative fimbrial biogenesis and twitching m | 8e-11 | |
| 3n71_A | 490 | Histone lysine methyltransferase SMYD1; heart deve | 9e-11 | |
| 3n71_A | 490 | Histone lysine methyltransferase SMYD1; heart deve | 1e-09 | |
| 3n71_A | 490 | Histone lysine methyltransferase SMYD1; heart deve | 4e-05 | |
| 3qww_A | 433 | SET and MYND domain-containing protein 2; methyltr | 3e-10 | |
| 3qww_A | 433 | SET and MYND domain-containing protein 2; methyltr | 1e-09 | |
| 3qww_A | 433 | SET and MYND domain-containing protein 2; methyltr | 9e-06 | |
| 3qww_A | 433 | SET and MYND domain-containing protein 2; methyltr | 3e-04 | |
| 2vsy_A | 568 | XCC0866; transferase, glycosyl transferase, GT-B, | 9e-10 | |
| 2vsy_A | 568 | XCC0866; transferase, glycosyl transferase, GT-B, | 6e-08 | |
| 2vsy_A | 568 | XCC0866; transferase, glycosyl transferase, GT-B, | 2e-06 | |
| 2xcb_A | 142 | PCRH, regulatory protein PCRH; protein transport, | 1e-09 | |
| 2xcb_A | 142 | PCRH, regulatory protein PCRH; protein transport, | 3e-04 | |
| 3qwp_A | 429 | SET and MYND domain-containing protein 3; SMYD3,SE | 2e-09 | |
| 3qwp_A | 429 | SET and MYND domain-containing protein 3; SMYD3,SE | 2e-09 | |
| 3qwp_A | 429 | SET and MYND domain-containing protein 3; SMYD3,SE | 2e-04 | |
| 4eqf_A | 365 | PEX5-related protein; accessory protein, tetratric | 2e-09 | |
| 4eqf_A | 365 | PEX5-related protein; accessory protein, tetratric | 2e-07 | |
| 4eqf_A | 365 | PEX5-related protein; accessory protein, tetratric | 6e-05 | |
| 3ieg_A | 359 | DNAJ homolog subfamily C member 3; TPR motif, chap | 3e-09 | |
| 3ieg_A | 359 | DNAJ homolog subfamily C member 3; TPR motif, chap | 2e-08 | |
| 3ieg_A | 359 | DNAJ homolog subfamily C member 3; TPR motif, chap | 4e-05 | |
| 3ieg_A | 359 | DNAJ homolog subfamily C member 3; TPR motif, chap | 1e-04 | |
| 2y4t_A | 450 | DNAJ homolog subfamily C member 3; chaperone, endo | 5e-09 | |
| 2y4t_A | 450 | DNAJ homolog subfamily C member 3; chaperone, endo | 8e-08 | |
| 2y4t_A | 450 | DNAJ homolog subfamily C member 3; chaperone, endo | 1e-07 | |
| 2y4t_A | 450 | DNAJ homolog subfamily C member 3; chaperone, endo | 2e-04 | |
| 2q7f_A | 243 | YRRB protein; TPR, protein binding; 2.49A {Bacillu | 6e-09 | |
| 2q7f_A | 243 | YRRB protein; TPR, protein binding; 2.49A {Bacillu | 1e-07 | |
| 2q7f_A | 243 | YRRB protein; TPR, protein binding; 2.49A {Bacillu | 6e-04 | |
| 1fch_A | 368 | Peroxisomal targeting signal 1 receptor; protein-p | 1e-08 | |
| 1fch_A | 368 | Peroxisomal targeting signal 1 receptor; protein-p | 8e-08 | |
| 1fch_A | 368 | Peroxisomal targeting signal 1 receptor; protein-p | 1e-04 | |
| 3cv0_A | 327 | Peroxisome targeting signal 1 receptor PEX5; TPR m | 1e-08 | |
| 3cv0_A | 327 | Peroxisome targeting signal 1 receptor PEX5; TPR m | 2e-06 | |
| 3cv0_A | 327 | Peroxisome targeting signal 1 receptor PEX5; TPR m | 2e-04 | |
| 2e2e_A | 177 | Formate-dependent nitrite reductase complex NRFG; | 3e-08 | |
| 3uq3_A | 258 | Heat shock protein STI1; HSP90, peptide binding, c | 3e-08 | |
| 3uq3_A | 258 | Heat shock protein STI1; HSP90, peptide binding, c | 5e-08 | |
| 3k9i_A | 117 | BH0479 protein; putative protein binding protein, | 8e-08 | |
| 3k9i_A | 117 | BH0479 protein; putative protein binding protein, | 3e-07 | |
| 2vgx_A | 148 | Chaperone SYCD; alternative dimer assembly, tetrat | 9e-08 | |
| 2vgx_A | 148 | Chaperone SYCD; alternative dimer assembly, tetrat | 2e-04 | |
| 2vgx_A | 148 | Chaperone SYCD; alternative dimer assembly, tetrat | 7e-04 | |
| 2fo7_A | 136 | Synthetic consensus TPR protein; tetratricopeptide | 1e-07 | |
| 2fo7_A | 136 | Synthetic consensus TPR protein; tetratricopeptide | 5e-07 | |
| 2fo7_A | 136 | Synthetic consensus TPR protein; tetratricopeptide | 5e-05 | |
| 3v6t_A | 499 | DHAX3; tandem repeats, DNA specific binding protei | 1e-07 | |
| 3v6t_A | 499 | DHAX3; tandem repeats, DNA specific binding protei | 5e-06 | |
| 3v6t_A | 499 | DHAX3; tandem repeats, DNA specific binding protei | 2e-05 | |
| 3v6t_A | 499 | DHAX3; tandem repeats, DNA specific binding protei | 7e-05 | |
| 3v6t_A | 499 | DHAX3; tandem repeats, DNA specific binding protei | 8e-05 | |
| 3v6t_A | 499 | DHAX3; tandem repeats, DNA specific binding protei | 8e-05 | |
| 3gyz_A | 151 | Chaperone protein IPGC; asymmetric homodimer, tetr | 1e-07 | |
| 3as5_A | 186 | MAMA; tetratricopeptide repeats (TPR) containing p | 2e-07 | |
| 3as5_A | 186 | MAMA; tetratricopeptide repeats (TPR) containing p | 2e-07 | |
| 3as5_A | 186 | MAMA; tetratricopeptide repeats (TPR) containing p | 5e-06 | |
| 2qfc_A | 293 | PLCR protein; TPR, HTH, transcription regulation; | 2e-07 | |
| 1hh8_A | 213 | P67PHOX, NCF-2, neutrophil cytosol factor 2; cell | 7e-07 | |
| 4gcn_A | 127 | Protein STI-1; structural genomics, PSI-biology, m | 2e-06 | |
| 1qqe_A | 292 | Vesicular transport protein SEC17; helix-turn-heli | 2e-06 | |
| 1elr_A | 131 | TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp | 2e-06 | |
| 1xnf_A | 275 | Lipoprotein NLPI; TPR, tetratricopeptide, structur | 2e-06 | |
| 1xnf_A | 275 | Lipoprotein NLPI; TPR, tetratricopeptide, structur | 1e-05 | |
| 1xnf_A | 275 | Lipoprotein NLPI; TPR, tetratricopeptide, structur | 8e-05 | |
| 1hxi_A | 121 | PEX5, peroxisome targeting signal 1 receptor PEX5; | 5e-06 | |
| 2pl2_A | 217 | Hypothetical conserved protein TTC0263; TPR, prote | 6e-06 | |
| 2pl2_A | 217 | Hypothetical conserved protein TTC0263; TPR, prote | 2e-04 | |
| 2pl2_A | 217 | Hypothetical conserved protein TTC0263; TPR, prote | 3e-04 | |
| 1na0_A | 125 | Designed protein CTPR3; de novo protein; HET: IPT; | 8e-06 | |
| 1na0_A | 125 | Designed protein CTPR3; de novo protein; HET: IPT; | 3e-05 | |
| 3ugm_A | 1047 | TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan | 2e-05 | |
| 3lvg_D | 190 | LCB, clathrin light chain B; SELF assembly, coated | 3e-05 | |
| 1i84_S | 1184 | Smooth muscle myosin heavy chain; muscle protein, | 8e-05 | |
| 4abn_A | 474 | Tetratricopeptide repeat protein 5; P53 cofactor, | 3e-04 | |
| 3pgw_B | 231 | SM B; protein-RNA complex, U1 snRNA, SM fold, SM c | 5e-04 | |
| 3pgw_B | 231 | SM B; protein-RNA complex, U1 snRNA, SM fold, SM c | 8e-04 | |
| 3ly7_A | 372 | Transcriptional activator CADC; alpha/beta domain, | 6e-04 |
| >3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} Length = 311 | Back alignment and structure |
|---|
Score = 145 bits (368), Expect = 2e-38
Identities = 56/220 (25%), Positives = 88/220 (40%), Gaps = 3/220 (1%)
Query: 366 DKGKLEDAVTYGTKALAKLVAVCGPYHRMTAGAYSLLAVVLYHTGDFNQATIYQQKALDI 425
+G+ E AV +AL L G H A ++LA+V + A AL I
Sbjct: 39 SQGRYEVAVPLCKQALEDLEKTSGHDHPDVATMLNILALVYRDQNKYKDAANLLNDALAI 98
Query: 426 NERELGLDHPDTMKSYGDLAVFYYRL-QHTELALKYVKRALYLLHLTCGPSHPNTAATYI 484
E+ LG DHP + +LAV Y + ++ E A KRAL + G HP+ A
Sbjct: 99 REKTLGKDHPAVAATLNNLAVLYGKRGKYKE-AEPLCKRALEIREKVLGKDHPDVAKQLN 157
Query: 485 NVAMMEEGLGNVHVALRYLHKALKCNQRLLGPDHIQTAASYHAIAIALSLMEAYPLSVQH 544
N+A++ + G Y +AL+ Q LGPD A + + +A + +
Sbjct: 158 NLALLCQNQGKYEEVEYYYQRALEIYQTKLGPDDPNVAKTKNNLASCYLKQGKFKQAETL 217
Query: 545 EQTTLQILRAK-LGPDDLRTQDAAAWLEYFESKAFEQQEA 583
+ L + G D + E E +Q++
Sbjct: 218 YKEILTRAHEREFGSVDDENKPIWMHAEEREECKGKQKDG 257
|
| >3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} Length = 311 | Back alignment and structure |
|---|
| >3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} Length = 311 | Back alignment and structure |
|---|
| >3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} Length = 311 | Back alignment and structure |
|---|
| >3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} Length = 311 | Back alignment and structure |
|---|
| >3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} Length = 311 | Back alignment and structure |
|---|
| >3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} Length = 311 | Back alignment and structure |
|---|
| >3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A Length = 283 | Back alignment and structure |
|---|
| >3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A Length = 283 | Back alignment and structure |
|---|
| >3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A Length = 283 | Back alignment and structure |
|---|
| >3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A Length = 283 | Back alignment and structure |
|---|
| >3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A Length = 283 | Back alignment and structure |
|---|
| >3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} Length = 203 | Back alignment and structure |
|---|
| >3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} Length = 203 | Back alignment and structure |
|---|
| >3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Length = 406 | Back alignment and structure |
|---|
| >3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Length = 406 | Back alignment and structure |
|---|
| >3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Length = 406 | Back alignment and structure |
|---|
| >3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Length = 406 | Back alignment and structure |
|---|
| >3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Length = 406 | Back alignment and structure |
|---|
| >3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Length = 406 | Back alignment and structure |
|---|
| >3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Length = 406 | Back alignment and structure |
|---|
| >3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Length = 406 | Back alignment and structure |
|---|
| >3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Length = 406 | Back alignment and structure |
|---|
| >3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Length = 338 | Back alignment and structure |
|---|
| >3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Length = 338 | Back alignment and structure |
|---|
| >3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Length = 338 | Back alignment and structure |
|---|
| >4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Length = 411 | Back alignment and structure |
|---|
| >4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Length = 411 | Back alignment and structure |
|---|
| >4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Length = 411 | Back alignment and structure |
|---|
| >4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Length = 411 | Back alignment and structure |
|---|
| >4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Length = 411 | Back alignment and structure |
|---|
| >4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Length = 411 | Back alignment and structure |
|---|
| >4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Length = 411 | Back alignment and structure |
|---|
| >3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} Length = 164 | Back alignment and structure |
|---|
| >3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} Length = 164 | Back alignment and structure |
|---|
| >3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Length = 378 | Back alignment and structure |
|---|
| >3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Length = 378 | Back alignment and structure |
|---|
| >3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Length = 378 | Back alignment and structure |
|---|
| >3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Length = 378 | Back alignment and structure |
|---|
| >3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Length = 378 | Back alignment and structure |
|---|
| >3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Length = 383 | Back alignment and structure |
|---|
| >3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Length = 383 | Back alignment and structure |
|---|
| >3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Length = 383 | Back alignment and structure |
|---|
| >3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Length = 383 | Back alignment and structure |
|---|
| >3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Length = 383 | Back alignment and structure |
|---|
| >3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Length = 383 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} Length = 307 | Back alignment and structure |
|---|
| >2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} Length = 307 | Back alignment and structure |
|---|
| >2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} Length = 307 | Back alignment and structure |
|---|
| >3tax_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; thiocarbamate crosslink, covalent inhibitor, gylcosyltransfe inhibitor, O-GLCNAC transferase; HET: UDP; 1.88A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* Length = 723 | Back alignment and structure |
|---|
| >3tax_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; thiocarbamate crosslink, covalent inhibitor, gylcosyltransfe inhibitor, O-GLCNAC transferase; HET: UDP; 1.88A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* Length = 723 | Back alignment and structure |
|---|
| >3tax_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; thiocarbamate crosslink, covalent inhibitor, gylcosyltransfe inhibitor, O-GLCNAC transferase; HET: UDP; 1.88A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* Length = 723 | Back alignment and structure |
|---|
| >2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Length = 597 | Back alignment and structure |
|---|
| >2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Length = 597 | Back alignment and structure |
|---|
| >2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Length = 597 | Back alignment and structure |
|---|
| >2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Length = 597 | Back alignment and structure |
|---|
| >2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Length = 597 | Back alignment and structure |
|---|
| >3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Length = 330 | Back alignment and structure |
|---|
| >3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Length = 330 | Back alignment and structure |
|---|
| >3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Length = 330 | Back alignment and structure |
|---|
| >3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Length = 330 | Back alignment and structure |
|---|
| >1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2 Length = 373 | Back alignment and structure |
|---|
| >1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2 Length = 373 | Back alignment and structure |
|---|
| >1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2 Length = 373 | Back alignment and structure |
|---|
| >1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2 Length = 373 | Back alignment and structure |
|---|
| >1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 | Back alignment and structure |
|---|
| >1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 | Back alignment and structure |
|---|
| >1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 | Back alignment and structure |
|---|
| >1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 | Back alignment and structure |
|---|
| >1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 | Back alignment and structure |
|---|
| >3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Length = 208 | Back alignment and structure |
|---|
| >3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Length = 272 | Back alignment and structure |
|---|
| >3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Length = 272 | Back alignment and structure |
|---|
| >3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Length = 272 | Back alignment and structure |
|---|
| >2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Length = 252 | Back alignment and structure |
|---|
| >2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Length = 252 | Back alignment and structure |
|---|
| >2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Length = 252 | Back alignment and structure |
|---|
| >4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Length = 472 | Back alignment and structure |
|---|
| >4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Length = 472 | Back alignment and structure |
|---|
| >4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Length = 472 | Back alignment and structure |
|---|
| >4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Length = 472 | Back alignment and structure |
|---|
| >4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Length = 472 | Back alignment and structure |
|---|
| >2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Length = 514 | Back alignment and structure |
|---|
| >2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Length = 514 | Back alignment and structure |
|---|
| >2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Length = 514 | Back alignment and structure |
|---|
| >2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Length = 514 | Back alignment and structure |
|---|
| >2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Length = 514 | Back alignment and structure |
|---|
| >2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Length = 514 | Back alignment and structure |
|---|
| >3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Length = 537 | Back alignment and structure |
|---|
| >3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Length = 537 | Back alignment and structure |
|---|
| >3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Length = 537 | Back alignment and structure |
|---|
| >3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Length = 537 | Back alignment and structure |
|---|
| >3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Length = 537 | Back alignment and structure |
|---|
| >3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Length = 537 | Back alignment and structure |
|---|
| >2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Length = 225 | Back alignment and structure |
|---|
| >3n71_A Histone lysine methyltransferase SMYD1; heart development, transcription; HET: SFG MES; 2.30A {Mus musculus} Length = 490 | Back alignment and structure |
|---|
| >3n71_A Histone lysine methyltransferase SMYD1; heart development, transcription; HET: SFG MES; 2.30A {Mus musculus} Length = 490 | Back alignment and structure |
|---|
| >3n71_A Histone lysine methyltransferase SMYD1; heart development, transcription; HET: SFG MES; 2.30A {Mus musculus} Length = 490 | Back alignment and structure |
|---|
| >3qww_A SET and MYND domain-containing protein 2; methyltransferase, HSP90, transferase-transferase inhibitor; HET: SFG; 1.80A {Mus musculus} PDB: 3qwv_A* 3s7d_A* 3s7b_A* 3s7f_A* 3s7j_A* 3tg4_A* 3tg5_A* 3rib_A* Length = 433 | Back alignment and structure |
|---|
| >3qww_A SET and MYND domain-containing protein 2; methyltransferase, HSP90, transferase-transferase inhibitor; HET: SFG; 1.80A {Mus musculus} PDB: 3qwv_A* 3s7d_A* 3s7b_A* 3s7f_A* 3s7j_A* 3tg4_A* 3tg5_A* 3rib_A* Length = 433 | Back alignment and structure |
|---|
| >3qww_A SET and MYND domain-containing protein 2; methyltransferase, HSP90, transferase-transferase inhibitor; HET: SFG; 1.80A {Mus musculus} PDB: 3qwv_A* 3s7d_A* 3s7b_A* 3s7f_A* 3s7j_A* 3tg4_A* 3tg5_A* 3rib_A* Length = 433 | Back alignment and structure |
|---|
| >3qww_A SET and MYND domain-containing protein 2; methyltransferase, HSP90, transferase-transferase inhibitor; HET: SFG; 1.80A {Mus musculus} PDB: 3qwv_A* 3s7d_A* 3s7b_A* 3s7f_A* 3s7j_A* 3tg4_A* 3tg5_A* 3rib_A* Length = 433 | Back alignment and structure |
|---|
| >2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Length = 568 | Back alignment and structure |
|---|
| >2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Length = 568 | Back alignment and structure |
|---|
| >2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Length = 568 | Back alignment and structure |
|---|
| >2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Length = 142 | Back alignment and structure |
|---|
| >2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Length = 142 | Back alignment and structure |
|---|
| >3qwp_A SET and MYND domain-containing protein 3; SMYD3,SET and MYND domain, zinc finger MYND domain-containin 1, structural genomics; HET: SAM; 1.53A {Homo sapiens} PDB: 3mek_A* 3oxg_A* 3oxf_A* 3pdn_A* 3oxl_A* 3ru0_A* Length = 429 | Back alignment and structure |
|---|
| >3qwp_A SET and MYND domain-containing protein 3; SMYD3,SET and MYND domain, zinc finger MYND domain-containin 1, structural genomics; HET: SAM; 1.53A {Homo sapiens} PDB: 3mek_A* 3oxg_A* 3oxf_A* 3pdn_A* 3oxl_A* 3ru0_A* Length = 429 | Back alignment and structure |
|---|
| >3qwp_A SET and MYND domain-containing protein 3; SMYD3,SET and MYND domain, zinc finger MYND domain-containin 1, structural genomics; HET: SAM; 1.53A {Homo sapiens} PDB: 3mek_A* 3oxg_A* 3oxf_A* 3pdn_A* 3oxl_A* 3ru0_A* Length = 429 | Back alignment and structure |
|---|
| >4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Length = 365 | Back alignment and structure |
|---|
| >4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Length = 365 | Back alignment and structure |
|---|
| >4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Length = 365 | Back alignment and structure |
|---|
| >3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Length = 359 | Back alignment and structure |
|---|
| >3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Length = 359 | Back alignment and structure |
|---|
| >3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Length = 359 | Back alignment and structure |
|---|
| >3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Length = 359 | Back alignment and structure |
|---|
| >2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Length = 450 | Back alignment and structure |
|---|
| >2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Length = 450 | Back alignment and structure |
|---|
| >2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Length = 450 | Back alignment and structure |
|---|
| >2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Length = 450 | Back alignment and structure |
|---|
| >2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Length = 243 | Back alignment and structure |
|---|
| >2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Length = 243 | Back alignment and structure |
|---|
| >2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Length = 243 | Back alignment and structure |
|---|
| >1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Length = 368 | Back alignment and structure |
|---|
| >1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Length = 368 | Back alignment and structure |
|---|
| >1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Length = 368 | Back alignment and structure |
|---|
| >3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Length = 327 | Back alignment and structure |
|---|
| >3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Length = 327 | Back alignment and structure |
|---|
| >3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Length = 327 | Back alignment and structure |
|---|
| >2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} Length = 177 | Back alignment and structure |
|---|
| >3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Length = 258 | Back alignment and structure |
|---|
| >3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Length = 258 | Back alignment and structure |
|---|
| >3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Length = 117 | Back alignment and structure |
|---|
| >3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Length = 117 | Back alignment and structure |
|---|
| >2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Length = 148 | Back alignment and structure |
|---|
| >2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Length = 148 | Back alignment and structure |
|---|
| >2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Length = 148 | Back alignment and structure |
|---|
| >2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Length = 136 | Back alignment and structure |
|---|
| >2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Length = 136 | Back alignment and structure |
|---|
| >2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Length = 136 | Back alignment and structure |
|---|
| >3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 | Back alignment and structure |
|---|
| >3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 | Back alignment and structure |
|---|
| >3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 | Back alignment and structure |
|---|
| >3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 | Back alignment and structure |
|---|
| >3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 | Back alignment and structure |
|---|
| >3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 | Back alignment and structure |
|---|
| >3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Length = 151 | Back alignment and structure |
|---|
| >3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Length = 186 | Back alignment and structure |
|---|
| >3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Length = 186 | Back alignment and structure |
|---|
| >3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Length = 186 | Back alignment and structure |
|---|
| >2qfc_A PLCR protein; TPR, HTH, transcription regulation; 2.60A {Bacillus thuringiensis serovar ISRAELE35646} Length = 293 | Back alignment and structure |
|---|
| >1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Length = 213 | Back alignment and structure |
|---|
| >4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} Length = 127 | Back alignment and structure |
|---|
| >1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1 Length = 292 | Back alignment and structure |
|---|
| >1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A Length = 131 | Back alignment and structure |
|---|
| >1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Length = 275 | Back alignment and structure |
|---|
| >1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Length = 275 | Back alignment and structure |
|---|
| >1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Length = 275 | Back alignment and structure |
|---|
| >1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Length = 121 | Back alignment and structure |
|---|
| >2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Length = 217 | Back alignment and structure |
|---|
| >2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Length = 217 | Back alignment and structure |
|---|
| >2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Length = 217 | Back alignment and structure |
|---|
| >1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Length = 125 | Back alignment and structure |
|---|
| >1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Length = 125 | Back alignment and structure |
|---|
| >3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 | Back alignment and structure |
|---|
| >3lvg_D LCB, clathrin light chain B; SELF assembly, coated PIT, cytoplasmic vesicle, membrane, Ca structural protein; 7.94A {Bos taurus} Length = 190 | Back alignment and structure |
|---|
| >1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 | Back alignment and structure |
|---|
| >4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Length = 474 | Back alignment and structure |
|---|
| >3pgw_B SM B; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 3cw1_A Length = 231 | Back alignment and structure |
|---|
| >3pgw_B SM B; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 3cw1_A Length = 231 | Back alignment and structure |
|---|
| >3ly7_A Transcriptional activator CADC; alpha/beta domain, alpha domain, DNA-binding, transcription regulation, transmembrane; 1.80A {Escherichia coli} PDB: 3lya_A 3ly8_A 3ly9_A Length = 372 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
No hit with probability above 80.00
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 1349 | ||||
| d1w3ba_ | 388 | a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, | 1e-12 | |
| d1w3ba_ | 388 | a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, | 4e-09 | |
| d1w3ba_ | 388 | a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, | 2e-06 | |
| d1w3ba_ | 388 | a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, | 9e-06 | |
| d1w3ba_ | 388 | a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, | 2e-05 | |
| d1w3ba_ | 388 | a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, | 5e-04 | |
| d1hz4a_ | 366 | a.118.8.2 (A:) Transcription factor MalT domain II | 2e-10 | |
| d1hz4a_ | 366 | a.118.8.2 (A:) Transcription factor MalT domain II | 7e-10 | |
| d1hz4a_ | 366 | a.118.8.2 (A:) Transcription factor MalT domain II | 2e-09 | |
| d1hh8a_ | 192 | a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF- | 2e-06 | |
| d1fcha_ | 323 | a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting | 3e-06 | |
| d1fcha_ | 323 | a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting | 1e-04 | |
| d1fcha_ | 323 | a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting | 2e-04 | |
| d1zbpa1 | 264 | e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {V | 5e-06 | |
| d1qqea_ | 290 | a.118.8.1 (A:) Vesicular transport protein sec17 { | 5e-06 | |
| d1ya0a1 | 497 | a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [T | 2e-04 | |
| d1tjca_ | 95 | a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subuni | 7e-04 | |
| d2c2la1 | 201 | a.118.8.1 (A:24-224) STIP1 homology and U box-cont | 0.003 |
| >d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Length = 388 | Back information, alignment and structure |
|---|
class: All alpha proteins fold: alpha-alpha superhelix superfamily: TPR-like family: Tetratricopeptide repeat (TPR) domain: O-GlcNAc transferase p110 subunit, OGT species: Human (Homo sapiens) [TaxId: 9606]
Score = 68.5 bits (166), Expect = 1e-12
Identities = 34/172 (19%), Positives = 62/172 (36%), Gaps = 32/172 (18%)
Query: 365 LDKGKLEDAVTYGTKALAKLVAVCGPYHRMTAGAYSLLAVVLYHTGDFNQATIYQQKALD 424
++G ++ A+ +A+ AY LA L G +A AL
Sbjct: 248 YEQGLIDLAIDTYRRAIE--------LQPHFPDAYCNLANALKEKGSVAEAEDCYNTALR 299
Query: 425 INERELGLDHPDTMKSYGDLAVFYYRLQHTELALKYVKRALYLLHLTCGPSHPNTAATYI 484
P S +LA + E A++ ++AL + P AA +
Sbjct: 300 --------LCPTHADSLNNLANIKREQGNIEEAVRLYRKALEV--------FPEFAAAHS 343
Query: 485 NVAMMEEGLGNVHVALRYLHKALKCNQRLLGPDHIQTAASYHAIAIALSLME 536
N+A + + G + AL + +A++ + P A +Y + L M+
Sbjct: 344 NLASVLQQQGKLQEALMHYKEAIRIS-----PTF---ADAYSNMGNTLKEMQ 387
|
| >d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Length = 388 | Back information, alignment and structure |
|---|
| >d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Length = 388 | Back information, alignment and structure |
|---|
| >d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Length = 388 | Back information, alignment and structure |
|---|
| >d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Length = 388 | Back information, alignment and structure |
|---|
| >d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Length = 388 | Back information, alignment and structure |
|---|
| >d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} Length = 366 | Back information, alignment and structure |
|---|
| >d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} Length = 366 | Back information, alignment and structure |
|---|
| >d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} Length = 366 | Back information, alignment and structure |
|---|
| >d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} Length = 192 | Back information, alignment and structure |
|---|
| >d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Length = 323 | Back information, alignment and structure |
|---|
| >d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Length = 323 | Back information, alignment and structure |
|---|
| >d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Length = 323 | Back information, alignment and structure |
|---|
| >d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} Length = 264 | Back information, alignment and structure |
|---|
| >d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 290 | Back information, alignment and structure |
|---|
| >d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} Length = 497 | Back information, alignment and structure |
|---|
| >d1tjca_ a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]} Length = 95 | Back information, alignment and structure |
|---|
| >d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 201 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 1349 | |||
| d1w3ba_ | 388 | O-GlcNAc transferase p110 subunit, OGT {Human (Hom | 99.68 | |
| d1fcha_ | 323 | Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 | 99.68 | |
| d1hz4a_ | 366 | Transcription factor MalT domain III {Escherichia | 99.66 | |
| d1hz4a_ | 366 | Transcription factor MalT domain III {Escherichia | 99.64 | |
| d1w3ba_ | 388 | O-GlcNAc transferase p110 subunit, OGT {Human (Hom | 99.53 | |
| d1qqea_ | 290 | Vesicular transport protein sec17 {Baker's yeast ( | 99.5 | |
| d1qqea_ | 290 | Vesicular transport protein sec17 {Baker's yeast ( | 99.49 | |
| d2h6fa1 | 315 | Protein farnesyltransferase alpha-subunit {Human ( | 99.49 | |
| d1xnfa_ | 259 | Lipoprotein NlpI {Escherichia coli [TaxId: 562]} | 99.48 | |
| d1fcha_ | 323 | Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 | 99.46 | |
| d1xnfa_ | 259 | Lipoprotein NlpI {Escherichia coli [TaxId: 562]} | 99.36 | |
| d2h6fa1 | 315 | Protein farnesyltransferase alpha-subunit {Human ( | 99.23 | |
| d1dcea1 | 334 | Rab geranylgeranyltransferase alpha-subunit, N-ter | 99.13 | |
| d1hh8a_ | 192 | Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {H | 99.08 | |
| d1hh8a_ | 192 | Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {H | 98.95 | |
| d1a17a_ | 159 | Protein phosphatase 5 {Human (Homo sapiens) [TaxId | 98.9 | |
| d2hr2a1 | 156 | Hypothetical protein CT2138 {Chlorobium tepidum [T | 98.84 | |
| d2hr2a1 | 156 | Hypothetical protein CT2138 {Chlorobium tepidum [T | 98.83 | |
| d1a17a_ | 159 | Protein phosphatase 5 {Human (Homo sapiens) [TaxId | 98.83 | |
| d2c2la1 | 201 | STIP1 homology and U box-containing protein 1, STU | 98.8 | |
| d1p5qa1 | 170 | FKBP52 (FKBP4), C-terminal domain {Human (Homo sap | 98.78 | |
| d1dcea1 | 334 | Rab geranylgeranyltransferase alpha-subunit, N-ter | 98.72 | |
| d1ya0a1 | 497 | SMG-7 {Human (Homo sapiens) [TaxId: 9606]} | 98.72 | |
| d1p5qa1 | 170 | FKBP52 (FKBP4), C-terminal domain {Human (Homo sap | 98.72 | |
| d1elra_ | 128 | Hop {Human (Homo sapiens) [TaxId: 9606]} | 98.71 | |
| d1kt1a1 | 168 | FKBP51, C-terminal domain {Monkey (Saimiri bolivie | 98.7 | |
| d1elwa_ | 117 | Hop {Human (Homo sapiens) [TaxId: 9606]} | 98.7 | |
| d1elra_ | 128 | Hop {Human (Homo sapiens) [TaxId: 9606]} | 98.69 | |
| d1ya0a1 | 497 | SMG-7 {Human (Homo sapiens) [TaxId: 9606]} | 98.68 | |
| d2c2la1 | 201 | STIP1 homology and U box-containing protein 1, STU | 98.67 | |
| d2fbna1 | 153 | Putative 70 kda peptidylprolyl isomerase PFL2275c | 98.67 | |
| d1ihga1 | 169 | Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} | 98.65 | |
| d1kt1a1 | 168 | FKBP51, C-terminal domain {Monkey (Saimiri bolivie | 98.64 | |
| d1elwa_ | 117 | Hop {Human (Homo sapiens) [TaxId: 9606]} | 98.58 | |
| d1ihga1 | 169 | Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} | 98.57 | |
| d1ouva_ | 265 | Cysteine rich protein C (HcpC) {Helicobacter pylor | 98.54 | |
| d2fbna1 | 153 | Putative 70 kda peptidylprolyl isomerase PFL2275c | 98.51 | |
| d2onda1 | 308 | Cleavage stimulation factor 77 kDa subunit CSTF3 { | 98.47 | |
| d1hxia_ | 112 | Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 | 98.39 | |
| d1hxia_ | 112 | Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 | 98.32 | |
| d2onda1 | 308 | Cleavage stimulation factor 77 kDa subunit CSTF3 { | 98.18 | |
| d1nzna_ | 122 | Mitochondria fission protein Fis1 {Human (Homo sap | 98.17 | |
| d1nzna_ | 122 | Mitochondria fission protein Fis1 {Human (Homo sap | 98.09 | |
| d1tjca_ | 95 | Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human | 97.99 | |
| d1zu2a1 | 145 | Mitochondrial import receptor subunit tom20-3 {Tha | 97.92 | |
| d2ff4a2 | 179 | Probable regulatory protein EmbR, middle domain {M | 97.91 | |
| d2ff4a2 | 179 | Probable regulatory protein EmbR, middle domain {M | 97.87 | |
| d1tjca_ | 95 | Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human | 97.86 | |
| d1zu2a1 | 145 | Mitochondrial import receptor subunit tom20-3 {Tha | 97.81 | |
| d1ouva_ | 265 | Cysteine rich protein C (HcpC) {Helicobacter pylor | 97.78 | |
| d1zbpa1 | 264 | Hypothetical protein VPA1032 {Vibrio parahaemolyti | 97.75 | |
| d1zbpa1 | 264 | Hypothetical protein VPA1032 {Vibrio parahaemolyti | 97.53 | |
| d1klxa_ | 133 | Cysteine rich protein B (HcpB) {Helicobacter pylor | 96.6 | |
| d1klxa_ | 133 | Cysteine rich protein B (HcpB) {Helicobacter pylor | 96.49 | |
| d2pqrb1 | 124 | Mitochondria fission protein Fis1 {Baker's yeast ( | 89.16 | |
| d2pqrb1 | 124 | Mitochondria fission protein Fis1 {Baker's yeast ( | 87.87 |
| >d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
class: All alpha proteins fold: alpha-alpha superhelix superfamily: TPR-like family: Tetratricopeptide repeat (TPR) domain: O-GlcNAc transferase p110 subunit, OGT species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.68 E-value=4.8e-14 Score=135.94 Aligned_cols=203 Identities=20% Similarity=0.194 Sum_probs=114.6
Q ss_pred HHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHCCCC
Q ss_conf 99999999999992996899999999999998840999810699999999999832999999999999999999950999
Q 000695 354 GRQLLESSKTALDKGKLEDAVTYGTKALAKLVAVCGPYHRMTAGAYSLLAVVLYHTGDFNQATIYQQKALDINERELGLD 433 (1349)
Q Consensus 354 Ar~LlelA~~yl~qGdyeEAlellekALel~eqilG~dhpe~A~al~~LA~vy~~lGdyeeAiel~qKALeI~Ek~lG~D 433 (1349)
+..+..+|..+...|++++|..++.+++.+ +|....++..+|.++...|++++|+..+++++.+
T Consensus 169 ~~~~~~l~~~~~~~~~~~~A~~~~~~al~~--------~p~~~~~~~~l~~~~~~~~~~~~A~~~~~~~~~~-------- 232 (388)
T d1w3ba_ 169 AVAWSNLGCVFNAQGEIWLAIHHFEKAVTL--------DPNFLDAYINLGNVLKEARIFDRAVAAYLRALSL-------- 232 (388)
T ss_dssp HHHHHHHHHHHHTTTCHHHHHHHHHHHHHH--------CTTCHHHHHHHHHHHHTTTCTTHHHHHHHHHHHH--------
T ss_pred HHHHHHHCCCCCCCCCHHHHHHHHHHHHHH--------CCCCHHHHHHHHHHHHCCCCHHHHHHHHHHHHHH--------
T ss_conf 689986363010247199999999999984--------9464999999715522005299999999985777--------
Q ss_pred CCHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHH
Q ss_conf 91169999999999999199799999999999999982599993289999999999999899799999999999999883
Q 000695 434 HPDTMKSYGDLAVFYYRLQHTELALKYVKRALYLLHLTCGPSHPNTAATYINVAMMEEGLGNVHVALRYLHKALKCNQRL 513 (1349)
Q Consensus 434 hpdta~ay~nLA~iy~~lGdyeeALellekALel~e~i~G~dhP~~A~al~NLA~iy~~lGdyeeAle~LekALei~ekl 513 (1349)
.+.....+..+|.++...|++++|+.+|++++.+ +|....++.++|.++..+|++.+|+.++++++...
T Consensus 233 ~~~~~~~~~~l~~~~~~~~~~~~A~~~~~~al~~--------~p~~~~~~~~l~~~~~~~~~~~~A~~~~~~~~~~~--- 301 (388)
T d1w3ba_ 233 SPNHAVVHGNLACVYYEQGLIDLAIDTYRRAIEL--------QPHFPDAYCNLANALKEKGSVAEAEDCYNTALRLC--- 301 (388)
T ss_dssp CTTCHHHHHHHHHHHHHTTCHHHHHHHHHHHHHT--------CSSCHHHHHHHHHHHHHHSCHHHHHHHHHHHHHHC---
T ss_pred HHHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHH--------CCCCHHHHHHHHHHHHHCCCHHHHHHHHHHHHCCC---
T ss_conf 5547999999999999878999999999999984--------99989999999999997487999999998654048---
Q ss_pred CCCCCHHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCH
Q ss_conf 19994889999999999999648915999999999999999609999999999999999999859999999942699961
Q 000695 514 LGPDHIQTAASYHAIAIALSLMEAYPLSVQHEQTTLQILRAKLGPDDLRTQDAAAWLEYFESKAFEQQEAARNGTRKPDA 593 (1349)
Q Consensus 514 lG~dhp~tA~al~nLA~iy~~lGdyeEAle~lekALeI~kk~LGpdhp~ta~al~~La~L~qk~~eqAEAl~~~a~ald~ 593 (1349)
+.....+..++.++..+|++++|+.++++++++ .|+
T Consensus 302 -----~~~~~~~~~l~~~~~~~~~~~~A~~~~~~al~~-----~p~---------------------------------- 337 (388)
T d1w3ba_ 302 -----PTHADSLNNLANIKREQGNIEEAVRLYRKALEV-----FPE---------------------------------- 337 (388)
T ss_dssp -----TTCHHHHHHHHHHHHTTTCHHHHHHHHHHHTTS-----CTT----------------------------------
T ss_pred -----CCCCHHHHHHHHHHHHCCCHHHHHHHHHHHHHH-----CCC----------------------------------
T ss_conf -----730010157999999878999999999999986-----889----------------------------------
Q ss_pred HHHHCCCCCHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHCC
Q ss_conf 2330399739999999999999889969999999999987421
Q 000695 594 SIASKGHLSVSDLLDYINPSHDTKGRNVSTLKRKTYVAKVKGN 636 (1349)
Q Consensus 594 ~~a~k~h~svaelL~~LA~iy~aqGdyeEAle~yeKALkL~~k 636 (1349)
...++..+|.+|..+|++++|+.+|++|+++.+.
T Consensus 338 ---------~~~~~~~la~~~~~~g~~~~A~~~~~~al~l~P~ 371 (388)
T d1w3ba_ 338 ---------FAAAHSNLASVLQQQGKLQEALMHYKEAIRISPT 371 (388)
T ss_dssp ---------CHHHHHHHHHHHHTTTCCHHHHHHHHHHHTTCTT
T ss_pred ---------CHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHCCC
T ss_conf ---------8999999999999859999999999999970999
|
| >d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1dcea1 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2hr2a1 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {Chlorobium tepidum [TaxId: 1097]} | Back information, alignment and structure |
|---|
| >d2hr2a1 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {Chlorobium tepidum [TaxId: 1097]} | Back information, alignment and structure |
|---|
| >d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1dcea1 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} | Back information, alignment and structure |
|---|
| >d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} | Back information, alignment and structure |
|---|
| >d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} | Back information, alignment and structure |
|---|
| >d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1ouva_ a.118.18.1 (A:) Cysteine rich protein C (HcpC) {Helicobacter pylori [TaxId: 210]} | Back information, alignment and structure |
|---|
| >d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} | Back information, alignment and structure |
|---|
| >d2onda1 a.118.8.7 (A:242-549) Cleavage stimulation factor 77 kDa subunit CSTF3 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1hxia_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Trypanosoma brucei [TaxId: 5691]} | Back information, alignment and structure |
|---|
| >d1hxia_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Trypanosoma brucei [TaxId: 5691]} | Back information, alignment and structure |
|---|
| >d2onda1 a.118.8.7 (A:242-549) Cleavage stimulation factor 77 kDa subunit CSTF3 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1tjca_ a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1zu2a1 a.118.8.1 (A:1-145) Mitochondrial import receptor subunit tom20-3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d2ff4a2 a.118.8.3 (A:105-283) Probable regulatory protein EmbR, middle domain {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d2ff4a2 a.118.8.3 (A:105-283) Probable regulatory protein EmbR, middle domain {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1tjca_ a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1zu2a1 a.118.8.1 (A:1-145) Mitochondrial import receptor subunit tom20-3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1ouva_ a.118.18.1 (A:) Cysteine rich protein C (HcpC) {Helicobacter pylori [TaxId: 210]} | Back information, alignment and structure |
|---|
| >d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} | Back information, alignment and structure |
|---|
| >d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} | Back information, alignment and structure |
|---|
| >d1klxa_ a.118.18.1 (A:) Cysteine rich protein B (HcpB) {Helicobacter pylori [TaxId: 210]} | Back information, alignment and structure |
|---|
| >d1klxa_ a.118.18.1 (A:) Cysteine rich protein B (HcpB) {Helicobacter pylori [TaxId: 210]} | Back information, alignment and structure |
|---|
| >d2pqrb1 a.118.8.1 (B:5-128) Mitochondria fission protein Fis1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2pqrb1 a.118.8.1 (B:5-128) Mitochondria fission protein Fis1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|