Citrus Sinensis ID: 000746

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820-------830-------840-------850-------860-------870-------880-------890-------900-------910-------920-------930-------940-------950-------960-------970-------980-------990------1000------1010------1020------1030------1040------1050------1060------1070------1080------1090------1100------1110------1120------1130------1140------1150------1160------1170------1180------1190------1200------1210------1220------1230------1240------1250------1260------1270------1280------1290------1300---
MCVSVLFLLKTEAISREQRLNFEAIKMASGPLDWYCRPVANGTWAKTVDSTFGAYTTCAVDSLVISISHSVLLGLCIFRIWLMNKNSKARRYRLSSNCYNYMLGLLACYCTAEPLLRLVMGISIFNLDGETSFAPFEMVSLIIEALAWCSMLIMICLETKFYIREFRWYVRFGVIYVLVGDAVILNLIIPMRDYYSRITLYLYISMVFCQALFGILILVYIPNLDPYPGYTIMQPEFVDNAEYEALPGGEHVCPERNASILSRTSFGWMTPLLQLGYKKPITEKDVWKLDTWDQTEILIEKFHRCWIEESQRSKPWLLRALNNSFGGRFWLGGLFKIGNDLSQFVGPVLLNHLLQSMQRGDPAWIGYIYAFLIFVGVSFGVLTEAQYFQNVWRVGFRLRSTLVAAIFRKTLRLTHEARKGFPSGKVTNMITTDANALQQISQQLHGLWSAPFRITLSMVLLYQQLGVASLLGSLMLVLMVPLQTFIISKMRKLTKEGLQWTDRRVSLTNEILAAMDTVKCYAWEKSFQSRVQSIRDDELSWFRKAQFLSAFNSFILNSIPVVVTVVSFGTFTLLGGDLTPARAFTSLSLFAVLRFPLNMLPNLLSQVVNANVSLQRLEELLLAEERILMPNPPLEPELPAVSIKNGNFSWDSKSPTLSNINLDIPVGSLVAIVGGTGEGKTSLVSAMLGELPPLKDASVVIRGTVAYVPQISWIFNATLRKNILFGSEFDPAKYWKTVDVSALQHDLDLLPDRDLTEIGERGVNISGGQKQRVSMARAVFNSCIKEELRGKTRILVTNQLHFLPHVDRIILVSEGMIKEEGSFEELSKHGRLFQKLMENAGKMEEMEEREEKDDSINSNQEVSKPVANRAVQVNEFPKNESYTKKGKRGRSVLVKQEERETGIVSGSVLTRYKNALGGPWVIMILFACYLSTEVLRISSSTWLSFWTDQSTSKNYNPGFYIAIYTILAFGQVTVTLLNSYWLIISSLRAAKRLHDSMLNSILRAPMLFFHTNPIGRVINRFSRDLGDIDRNVASFVNMFMNQLWQLLSTFVLIGIVSTISLWAIMPLLILFYAAYLYYQSTAREVKRLDSITRSPVYAQFGEALNGLSTIRAFKAYDRMAKINGKSMDNNIRFTLANTSSNRWLTIRLETLGGIMIWLIATFAVMQNGRAENQVAFASTMGLLLSYTLNITNLLSGVLRQASRAENSLNAVERVGTYIDLPSEAPGMVESNRPPPAWPSSGSIKFEDVVLRYRPELPPVLHGLSFTVSPSEKVGIVGRTGAGKSSMLNALFRIVELERGENIH
ccEEEEEcccHHHHHHHHccccHHHcccccHHHHccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHcEEEEcccHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccHHHccccccccccccccccHHHHHHHHHHHHHHHHHccccccccccccccccccHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccEEcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccEEEEEEEEEEccccccccccEEEEccccEEEEEccccccHHHHHHHHHcccccccccEEEEccEEEEEccccccccccccccccccccccHHHHHHHHHHHccHHHHcccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHccccEEEEcccccccccccEEEEEEccEEEEEccHHHHHHcccHHHHHHHHHcHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccHHccccccHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccEEHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHcHHHHHHccHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHccccccccccccccccccccccccEEEEEEEEEEEcccccccccccEEEEccccEEEEEccccccHHHHHHHHHHccccccccccc
ccEHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHcccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccHcccccccccccHHcccHHHHHHHHHHHHHHHHcccccccHHHcccccccccHHHHHHHHHHHHHHHccccccHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccEEEEEEEEEEEccccccEcEEEEEEccccEEEEEEcccccHHHHHHHHHHHHHHHcccEEEEEEEEEEEccccEEEcccHHHcccccccccHHHHHHHHHHHHHHHHHHHccccccEEEcccHHHccHHHHHHHHHHHHHHHHHHHHHHcccEEEEEEEcccccccccEEEEEEccEEEEcccHHHHHHcccHHHHHHHHHccHHHccccccccccccccccccccccccccccccccccccccccccccccccccHHHHccccEEHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccEccccccccccccccEEEEEEEEEEEcccccEEEEEEEEEEccccEEEEEEcccccHHHHHHHHHHHHcHccccEcc
MCVSVLFLLKTEAISREQRLNFEAIKMasgpldwycrpvangtwaktvdstfgayttCAVDSLVISISHSVLLGLCIFRIWLMNKNSKARRYRLSSNCYNYMLGLLACYCTAEPLLRLVMGISIfnldgetsfapFEMVSLIIEALAWCSMLIMICLETKFYIREFRWYVRFGVIYVLVGDAVILNLIIPMRDYYSRITLYLYISMVFCQALFGILILvyipnldpypgytimqpefvdnaeyealpggehvcpernasilsrtsfgwmtpllqlgykkpitekdvwkldtWDQTEILIEKFHRCwieesqrsKPWLLRALNNSFGGRFWLGGLFkigndlsqfVGPVLLNHLLQsmqrgdpaWIGYIYAFLIFVGVSFGVLTEAQYFQNVWRVGFRLRSTLVAAIFRKTLRLThearkgfpsgkvtnmiTTDANALQQISQQLhglwsapfRITLSMVLLYQQLGVASLLGSLMLVLMVPLQTFIISKMRKLTKEGLQWTDRRVSLTNEILAAMDTVKCYAWEKSFQSRVQSIRDDELSWFRKAQFLSAFNSFILNSIPVVVTVVSFGTftllggdltparaftSLSLFAVLRfplnmlpnLLSQVVNANVSLQRLEELLLAEErilmpnpplepelpavsikngnfswdsksptlsninldipvGSLVAIVGGTGEGKTSLVSAmlgelpplkdasvvIRGTVAYVPQISWIFNATLRKnilfgsefdpakywktvDVSALQhdldllpdrdlteigergvnisggQKQRVSMARAVFNSCIKEELRGKTRILVTNQlhflphvdRIILVSEgmikeegsFEELSKHGRLFQKLMENAGKMeemeereekddsinsnqevskpvanravqvnefpknesytkkgkrgrsvLVKQeeretgivSGSVLTRYKNALGGPWVIMILFACYLSTEVLRISSSTWLsfwtdqstsknynpgFYIAIYTILAFGQVTVTLLNSYWLIISSLRAAKRLHDSMLNSILRapmlffhtnpigrVINRFsrdlgdidRNVASFVNMFMNQLWQLLSTFVLIGIVSTISLWAIMPLLILFYAAYLYYQSTAREVKrldsitrspvyaqFGEALNGLSTIRAFKAYDRMAKINGKSMDNNIRFTlantssnrwLTIRLETLGGIMIWLIATFAVMQNGRAENQVAFASTMGLLLSYTLNITNLLSGVLRQASRAENSLNAVERVgtyidlpseapgmvesnrpppawpssgsikfedvvlryrpelppvlhglsftvspsekvgivgrtgagksSMLNALFRIVElergenih
MCVSVLFLLKTEAISREQRLNFEAIKMASGPLDWYCRPVANGTWAKTVDSTFGAYTTCAVDSLVISISHSVLLGLCIFRIWLMNKNSKARRYRLSSNCYNYMLGLLACYCTAEPLLRLVMGISIFNLDGETSFAPFEMVSLIIEALAWCSMLIMICLETKFYIREFRWYVRFGVIYVLVGDAVILNLIIPMRDYYSRITLYLYISMVFCQALFGILILVYIPNLDPYPGYTIMQPEFVDNAEYEALPGGEHVCPERNASILSRTSFGWMTPLLQLGYKKPITEKDVWKLDTWDQTEILIEKFHRCWIEESQRSKPWLLRALNNSFGGRFWLGGLFKIGNDLSQFVGPVLLNHLLQSMQRGDPAWIGYIYAFLIFVGVSFGVLTEAQYFQNVWRVGFRLRSTLVAAIFRktlrlthearkgfpsgkvTNMITTDANALQQISQQLHGLWSAPFRITLSMVLLYQQLGVASLLGSLMLVLMVPLQTFIISKMRKLTkeglqwtdrrVSLTNEILAAMDTVKCYAWEKSFQSRVQSIRDDELSWFRKAQFLSAFNSFILNSIPVVVTVVSFGTFTLLGGDLTPARAFTSLSLFAVLRFPLNMLPNLLSQVVNANVSLQRLEELLLAEERILMPNPPLEPELPAVSIKNGNFSWDSKSPTLSNINLDIPVGSLVAIVGGTGEGKTSLVSAMLGELPPLKDASVVIRGTVAYVPQISWIFNATLRKNILFGSEFDPAKYWKTVDVSALQHDLDLLPDRDLTEIGErgvnisggqkqrvSMARAVFNSCIKEELRGKTRILVtnqlhflphvDRIILVSEGMIKEEGSFEELSKHGRLFQKLMENAGKMEemeereekddsinsnqevskpvanravqvnefpknesytkkgkrgrsvlvkqeeretgivsgsvltRYKNALGGPWVIMILFACYLSTEVLRISSSTWLSFWTDQSTSKNYNPGFYIAIYTILAFGQVTVTLLNSYWLIISSLRAAKRLHDSMLNSILRAPMLFFHTNPIGRVINRFSRDLGDIDRNVASFVNMFMNQLWQLLSTFVLIGIVSTISLWAIMPLLILFYAAYLYYQSTAREVKRLDSITRSPVyaqfgealnglsTIRAFKAYDRMAKIngksmdnnirftlantssnrwLTIRLETLGGIMIWLIATFAVMQNGRAENQVAFASTMGLLLSYTLNITNLLSGVLRQASRAENSLNAVERVGTYIDLPSEAPGMVESNRPPPAWPSSGSIKFEDVVLRYRPELPPVLHglsftvspsekVGIVgrtgagkssmlnalfrivelergenih
MCVSVLFLLKTEAISREQRLNFEAIKMASGPLDWYCRPVANGTWAKTVDSTFGAYTTCAVDslvisishsvllglCIFRIWLMNKNSKARRYRLSSNCYNYMLGLLACYCTAEPLLRLVMGISIFNLDGETSFAPFEMVSLIIEALAWCSMLIMICLETKFYIREFRWYVRFGVIYVLVGDAVILNLIIPMRDYYSRITLYLYISMVFCQALFGILILVYIPNLDPYPGYTIMQPEFVDNAEYEALPGGEHVCPERNASILSRTSFGWMTPLLQLGYKKPITEKDVWKLDTWDQTEILIEKFHRCWIEESQRSKPWLLRALNNSFGGRFWLGGLFKIGNDLSQFVGPVLLNHLLQSMQRGDPAWIGYIYAFLIFVGVSFGVLTEAQYFQNVWRVGFRLRSTLVAAIFRKTLRLTHEARKGFPSGKVTNMITTDANALQQISQQLHGLWSAPFRITLSMVLLYQQlgvasllgslmlvlmvplQTFIISKMRKLTKEGLQWTDRRVSLTNEILAAMDTVKCYAWEKSFQSRVQSIRDDELSWFRKAQFLSAFNSFILNSIPvvvtvvSFGTFTLLGGDLTPARAFTSLSLFAVLRFPLNMLPNLLSQVVNANVSLQRleelllaeeRILMpnpplepelpAVSIKNGNFSWDSKSPTLSNINLDIPVGSLVAIVGGTGEGKTSLVSAMLGELPPLKDASVVIRGTVAYVPQISWIFNATLRKNILFGSEFDPAKYWKTVDVSALQHDLDLLPDRDLTEIGERGVNISGGQKQRVSMARAVFNSCIKEELRGKTRILVTNQLHFLPHVDRIILVSEGMIKEEGSFEELSKHGRLFQKLMENAGKmeemeereeKDDSINSNQEVSKPVANRAVQVNEFPKNESYTKKGKRGRSVLVKQEERETGIVSGSVLTRYKNALGGPWVIMILFACYLSTEVLRISSSTWLSFWTDQSTSKNYNPGFYIAIYTILAFGQVTVTLLNSYWLIISSLRAAKRLHDSMLNSILRAPMLFFHTNPIGRVINRFSRDLGDIDRNVASFVNMFMNQLWQLLSTFVLIGIVSTISLWAIMPllilfyaaylyyQSTAREVKRLDSITRSPVYAQFGEALNGLSTIRAFKAYDRMAKINGKSMDNNIRFTLANTSSNRWLTIRLETLGGIMIWLIATFAVMQNGRAENQVAFASTMGLLLSYTLNITNLLSGVLRQASRAENSLNAVERVGTYIDLPSEAPGMVESNRPPPAWPSSGSIKFEDVVLRYRPELPPVLHGLSFTVSPSEKVGIVGRTGAGKSSMLNALFRIVELERGENIH
*CVSVLFLLKTEAISREQRLNFEAIKMASGPLDWYCRPVANGTWAKTVDSTFGAYTTCAVDSLVISISHSVLLGLCIFRIWLMNKNSKARRYRLSSNCYNYMLGLLACYCTAEPLLRLVMGISIFNLDGETSFAPFEMVSLIIEALAWCSMLIMICLETKFYIREFRWYVRFGVIYVLVGDAVILNLIIPMRDYYSRITLYLYISMVFCQALFGILILVYIPNLDPYPGYTIMQPEFVDNAEYEALPGGEHVCPERNASILSRTSFGWMTPLLQLGYKKPITEKDVWKLDTWDQTEILIEKFHRCWIEESQRSKPWLLRALNNSFGGRFWLGGLFKIGNDLSQFVGPVLLNHLLQSMQRGDPAWIGYIYAFLIFVGVSFGVLTEAQYFQNVWRVGFRLRSTLVAAIFRKTLRLTHEARKGFPSGKVTNMITTDANALQQISQQLHGLWSAPFRITLSMVLLYQQLGVASLLGSLMLVLMVPLQTFIISKMRKLTKEGLQWTDRRVSLTNEILAAMDTVKCYAWEKSFQSRVQSIRDDELSWFRKAQFLSAFNSFILNSIPVVVTVVSFGTFTLLGGDLTPARAFTSLSLFAVLRFPLNMLPNLLSQVVNANVSLQRLEELLLAEERI*****************************LSNINLDIPVGSLVAIVGGTGEGKTSLVSAMLGELPPLKDASVVIRGTVAYVPQISWIFNATLRKNILFGSEFDPAKYWKTVDVSALQHDLDLLPDRDLTEIGERGVNISGGQKQRVSMARAVFNSCIKEELRGKTRILVTNQLHFLPHVDRIILVSEGMIK***********************************************************************************GIVSGSVLTRYKNALGGPWVIMILFACYLSTEVLRISSSTWLSFWTDQSTSKNYNPGFYIAIYTILAFGQVTVTLLNSYWLIISSLRAAKRLHDSMLNSILRAPMLFFHTNPIGRVINRFSRDLGDIDRNVASFVNMFMNQLWQLLSTFVLIGIVSTISLWAIMPLLILFYAAYLYYQSTAREVKRLDSITRSPVYAQFGEALNGLSTIRAFKAYDRMAKINGKSMDNNIRFTLANTSSNRWLTIRLETLGGIMIWLIATFAVMQNGRAENQVAFASTMGLLLSYTLNITNLLSGVLRQASRA**SLNAVERVGTYID***********************IKFEDVVLRYRPELPPVLHGLSFTVSPSEKVGIVGRTGAGKSSMLNALFRIVEL*******
*CVSVLFLLKT**************KMASGPLDWYCRPVANGTWAKTVDSTFGAYTTCAVDSLVISISHSVLLGLCIFRIWLMNKNS******LSSNCYNYMLGLLACYCTAEPLLRLVMGISIFNLDGETSFAPFEMVSLIIEALAWCSMLIMICLETKFYIREFRWYVRFGVIYVLVGDAVILNLIIPMRDYYSRITLYLYISMVFCQALFGILILVYIPNLDPYPGYTIMQ********************ERNASILSRTSFGWMTPLLQLGYKKPITEKDVWKLDTWDQTEILIEKFHRCWIEESQRSKPWLLRALNNSFGGRFWLGGLFKIGNDLSQFVGPVLLNHLLQSMQRGDPAWIGYIYAFLIFVGVSFGVLTEAQYFQNVWRVGFRLRSTLVAAIFRKT****************TNMITTDANALQQISQQLHGLWSAPFRITLSMVLLYQQLGVASLLGSLMLVLMVPLQTFIISKMRKLTKEGLQWTDRRVSLTNEILAAMDTVKCYAWEKSFQSRVQSIRDDELSWFRKAQFLSAFNSFILNSIPVVVTVVSFGTFTLLGGDLTPARAFTSLSLFAVLRFPLNMLPNLLSQVVNANVSLQRLEELLLAE****************VSIKNGNFSWDSKSPTLSNINLDIPVGSLVAIVGGTGEGKTSLVSAMLGELPPLKDASVVIRGTVAYVPQISWIFNATLRKNILFGSEFDPAKYWKTVDVSALQHDLDLLPDRDLTEIGERGVNISGGQKQRVSMARAVFNSCIKEELRGKTRILVTNQLHFLPHVDRIILVSEGMIKEEGSFEELSKHGRLFQK*******************************************************************IVSGSVLTRYKNALGGPWVIMILFACYLSTEVLRISSSTWLSFWTDQSTSKNYNPGFYIAIYTILAFGQVTVTLLNSYWLIISSLRAAKRLHDSMLNSILRAPMLFFHTNPIGRVINRFSRDLGDIDRNVASFVNMFMNQLWQLLSTFVLIGIVSTISLWAIMPLLILFYAAYLYYQSTAREVKRLDSITRSPVYAQFGEALNGLSTIRAFKAYDRMAKINGKSMDNNIRFTLANTSSNRWLTIRLETLGGIMIWLIATFAVMQNGRAENQVAFASTMGLLLSYTLNITNLLSGVLRQASRAENSLNAVERVGTYIDLP***************WPSSGSIKFEDVVLRYRPELPPVLHGLSFTVSPSEKVGIVGRTGAGKSSMLNALFRIVELERGENIH
MCVSVLFLLKTEAISREQRLNFEAIKMASGPLDWYCRPVANGTWAKTVDSTFGAYTTCAVDSLVISISHSVLLGLCIFRIWLMNKNSKARRYRLSSNCYNYMLGLLACYCTAEPLLRLVMGISIFNLDGETSFAPFEMVSLIIEALAWCSMLIMICLETKFYIREFRWYVRFGVIYVLVGDAVILNLIIPMRDYYSRITLYLYISMVFCQALFGILILVYIPNLDPYPGYTIMQPEFVDNAEYEALPGGEHVCPERNASILSRTSFGWMTPLLQLGYKKPITEKDVWKLDTWDQTEILIEKFHRCWIEESQRSKPWLLRALNNSFGGRFWLGGLFKIGNDLSQFVGPVLLNHLLQSMQRGDPAWIGYIYAFLIFVGVSFGVLTEAQYFQNVWRVGFRLRSTLVAAIFRKTLRLTHEARKGFPSGKVTNMITTDANALQQISQQLHGLWSAPFRITLSMVLLYQQLGVASLLGSLMLVLMVPLQTFIISKMRKLTKEGLQWTDRRVSLTNEILAAMDTVKCYAWEKSFQSRVQSIRDDELSWFRKAQFLSAFNSFILNSIPVVVTVVSFGTFTLLGGDLTPARAFTSLSLFAVLRFPLNMLPNLLSQVVNANVSLQRLEELLLAEERILMPNPPLEPELPAVSIKNGNFSWDSKSPTLSNINLDIPVGSLVAIVGGTGEGKTSLVSAMLGELPPLKDASVVIRGTVAYVPQISWIFNATLRKNILFGSEFDPAKYWKTVDVSALQHDLDLLPDRDLTEIGERGVNISGGQKQRVSMARAVFNSCIKEELRGKTRILVTNQLHFLPHVDRIILVSEGMIKEEGSFEELSKHGRLFQKLMENAGK*****************QEVSKPVANRAVQVNEFPKNESYTKKGKRGRSVLVKQEERETGIVSGSVLTRYKNALGGPWVIMILFACYLSTEVLRISSSTWLSFWTDQSTSKNYNPGFYIAIYTILAFGQVTVTLLNSYWLIISSLRAAKRLHDSMLNSILRAPMLFFHTNPIGRVINRFSRDLGDIDRNVASFVNMFMNQLWQLLSTFVLIGIVSTISLWAIMPLLILFYAAYLYYQSTAREVKRLDSITRSPVYAQFGEALNGLSTIRAFKAYDRMAKINGKSMDNNIRFTLANTSSNRWLTIRLETLGGIMIWLIATFAVMQNGRAENQVAFASTMGLLLSYTLNITNLLSGVLRQASRAENSLNAVERVGTYIDLPSEAPGMVESNRPPPAWPSSGSIKFEDVVLRYRPELPPVLHGLSFTVSPSEKVGIVGRTGAGKSSMLNALFRIVELERGENIH
MCVSVLFLLKTEAISREQRLNFEAIKMASGPLDWYCRPVANGTWAKTVDSTFGAYTTCAVDSLVISISHSVLLGLCIFRIWLMNKNSKARRYRLSSNCYNYMLGLLACYCTAEPLLRLVMGISIFNLDGETSFAPFEMVSLIIEALAWCSMLIMICLETKFYIREFRWYVRFGVIYVLVGDAVILNLIIPMRDYYSRITLYLYISMVFCQALFGILILVYIPNLDPYPGYTIM*******AE*****GGEHVCPERNASILSRTSFGWMTPLLQLGYKKPITEKDVWKLDTWDQTEILIEKFHRCWIEESQRSKPWLLRALNNSFGGRFWLGGLFKIGNDLSQFVGPVLLNHLLQSMQRGDPAWIGYIYAFLIFVGVSFGVLTEAQYFQNVWRVGFRLRSTLVAAIFRKTLRLTHEARKGFPSGKVTNMITTDANALQQISQQLHGLWSAPFRITLSMVLLYQQLGVASLLGSLMLVLMVPLQTFIISKMRKLTKEGLQWTDRRVSLTNEILAAMDTVKCYAWEKSFQSRVQSIRDDELSWFRKAQFLSAFNSFILNSIPVVVTVVSFGTFTLLGGDLTPARAFTSLSLFAVLRFPLNMLPNLLSQVVNANVSLQRLEELLLAEERILMPNPPLEPELPAVSIKNGNFSWDSKSPTLSNINLDIPVGSLVAIVGGTGEGKTSLVSAMLGELPPLKDASVVIRGTVAYVPQISWIFNATLRKNILFGSEFDPAKYWKTVDVSALQHDLDLLPDRDLTEIGERGVNISGGQKQRVSMARAVFNSCIKEELRGKTRILVTNQLHFLPHVDRIILVSEGMIKEEGSFEELSKHGRLFQKLMENAGK**********************************************************TGIVSGSVLTRYKNALGGPWVIMILFACYLSTEVLRISSSTWLSFWTDQSTSKNYNPGFYIAIYTILAFGQVTVTLLNSYWLIISSLRAAKRLHDSMLNSILRAPMLFFHTNPIGRVINRFSRDLGDIDRNVASFVNMFMNQLWQLLSTFVLIGIVSTISLWAIMPLLILFYAAYLYYQSTAREVKRLDSITRSPVYAQFGEALNGLSTIRAFKAYDRMAKINGKSMDNNIRFTLANTSSNRWLTIRLETLGGIMIWLIATFAVMQNGRAENQVAFASTMGLLLSYTLNITNLLSGVLRQASRAENSLNAVERVGTYIDLPSEAPGMVESNRPPPAWPSSGSIKFEDVVLRYRPELPPVLHGLSFTVSPSEKVGIVGRTGAGKSSMLNALFRIVELERG****
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHooooooooHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooHHHHHHHHHHHHHHHHHHHHHiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHoooooooooHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHHHHHoooooooooHHHHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSoooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHoooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHoooooooooooHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHoooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHoooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHoooooHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MCVSVLFLLKTEAISREQRLNFEAIKMASGPLDWYCRPVANGTWAKTVDSTFGAYTTCAVDSLVISISHSVLLGLCIFRIWLMNKNSKARRYRLSSNCYNYMLGLLACYCTAEPLLRLVMGISIFNLDGETSFAPFEMVSLIIEALAWCSMLIMICLETKFYIREFRWYVRFGVIYVLVGDAVILNLIIPMRDYYSRITLYLYISMVFCQALFGILILVYIPNLDPYPGYTIMQPEFVDNAEYEALPGGEHVCPERNASILSRTSFGWMTPLLQLGYKKPITEKDVWKLDTWDQTEILIEKFHRCWIEESQRSKPWLLRALNNSFGGRFWLGGLFKIGNDLSQFVGPVLLNHLLQSMQRGDPAWIGYIYAFLIFVGVSFGVLTEAQYFQNVWRVGFRLRSTLVAAIFRKTLRLTHEARKGFPSGKVTNMITTDANALQQISQQLHGLWSAPFRITLSMVLLYQQLGVASLLGSLMLVLMVPLQTFIISKMRKLTKEGLQWTDRRVSLTNEILAAMDTVKCYAWEKSFQSRVQSIRDDELSWFRKAQFLSAFNSFILNSIPVVVTVVSFGTFTLLGGDLTPARAFTSLSLFAVLRFPLNMLPNLLSQVVNANVSLQRLEELLLAEERILMPNPPLEPELPAVSIKNGNFSWDSKSPTLSNINLDIPVGSLVAIVGGTGEGKTSLVSAMLGELPPLKDASVVIRGTVAYVPQISWIFNATLRKNILFGSEFDPAKYWKTVDVSALQHDLDLLPDRDLTEIGERGVNISGGQKQRVSMARAVFNSCIKEELRGKTRILVTNQLHFLPHVDRIILVSEGMIKEEGSFEELSKHGRLFQKLMENAGKMEEMEEREEKDDSINSNQEVSKPVANRAVQVNEFPKNESYTKKGKRGRSVLVKQEERETGIVSGSVLTRYKNALGGPWVIMILFACYLSTEVLRISSSTWLSFWTDQSTSKNYNPGFYIAIYTILAFGQVTVTLLNSYWLIISSLRAAKRLHDSMLNSILRAPMLFFHTNPIGRVINRFSRDLGDIDRNVASFVNMFMNQLWQLLSTFVLIGIVSTISLWAIMPLLILFYAAYLYYQSTAREVKRLDSITRSPVYAQFGEALNGLSTIRAFKAYDRMAKINGKSMDNNIRFTLANTSSNRWLTIRLETLGGIMIWLIATFAVMQNGRAENQVAFASTMGLLLSYTLNITNLLSGVLRQASRAENSLNAVERVGTYIDLPSEAPGMVESNRPPPAWPSSGSIKFEDVVLRYRPELPPVLHGLSFTVSPSEKVGIVGRTGAGKSSMLNALFRIVELERGENIH
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query1303 2.2.26 [Sep-21-2011]
Q9C8H0 1495 ABC transporter C family yes no 0.970 0.845 0.756 0.0
Q9C8H1 1495 ABC transporter C family no no 0.970 0.845 0.717 0.0
Q9C8G9 1622 ABC transporter C family no no 0.972 0.781 0.673 0.0
Q42093 1623 ABC transporter C family no no 0.970 0.778 0.681 0.0
Q28689 1564 Canalicular multispecific no no 0.788 0.656 0.340 0.0
O35379 1528 Multidrug resistance-asso yes no 0.868 0.740 0.325 0.0
Q8CG09 1532 Multidrug resistance-asso no no 0.825 0.701 0.329 0.0
B2RX12 1523 Canalicular multispecific no no 0.821 0.703 0.328 0.0
O88563 1522 Canalicular multispecific yes no 0.818 0.701 0.328 0.0
Q92887 1545 Canalicular multispecific yes no 0.788 0.664 0.336 0.0
>sp|Q9C8H0|AB12C_ARATH ABC transporter C family member 12 OS=Arabidopsis thaliana GN=ABCC12 PE=2 SV=1 Back     alignment and function desciption
 Score = 2020 bits (5234), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 983/1300 (75%), Positives = 1123/1300 (86%), Gaps = 36/1300 (2%)

Query: 27   MASGPLDWYCRPVANGTWAKTVDSTFGAYTTCAVDSLVISISHSVLLGLCIFRIWLMNKN 86
            M    L+WYC+PVA+G W K VD  FGAYT CA+DSLV+ +SH VLLGLC +RIW++  N
Sbjct: 1    MGFEALNWYCKPVADGFWEKAVDGAFGAYTPCAIDSLVMLVSHFVLLGLCFYRIWIIFHN 60

Query: 87   SKARRYRLSSNCYNYMLGLLACYCTAEPLLRLVMGISIFNLDGETSFAPFEMVSLIIEAL 146
            +KA+ Y L    YN +LGLLACYC  EP+LRLVMGIS+F++D ET F PFE+ SL++EA 
Sbjct: 61   TKAQIYVLRKKYYNCVLGLLACYCVVEPVLRLVMGISLFDMDEETDFPPFEVASLMVEAF 120

Query: 147  AWCSMLIMICLETKFYIREFRWYVRFGVIYVLVGDAVILNLIIPMRDYYSRITLYLYISM 206
            AW SML++I LETK Y++EFRWYVRFGV+YVLV DAV+L+L++P+++  +R  LYL+IS 
Sbjct: 121  AWFSMLVLIGLETKQYVKEFRWYVRFGVLYVLVADAVLLDLVLPLKNSINRTALYLFISS 180

Query: 207  VFCQALFGILILVYIPNLDPYPGYTIMQPEFVDNAEYEALPGGEHVCPERNASILSRTSF 266
               QALFGIL+L+YIP LDPYPGY I+  E +DN EY+AL GGEH+CPER+ASI SR  F
Sbjct: 181  RCSQALFGILLLIYIPELDPYPGYHIVNNEPLDNVEYDALRGGEHICPERHASIFSRIYF 240

Query: 267  GWMTPLLQLGYKKPITEKDVWKLDTWDQTEILIEKFHRCWIEESQRSKPWLLRALNNSFG 326
            GW+TPL+QLGY+KPITEKDVW+LD WDQTE LI++F RCW EES+R KPWLLRALNNS G
Sbjct: 241  GWITPLMQLGYRKPITEKDVWQLDKWDQTETLIKRFQRCWTEESRRPKPWLLRALNNSLG 300

Query: 327  GRFWLGGLFKIGNDLSQFVGPVLLNHLLQSMQRGDPAWIGYIYAFLIFVGVSFGVLTEAQ 386
            GRFWL G+FKIGNDLSQFVGPV+L+HLL+SMQ GDPAW+GY+YAF+IFVGV+ GVL EAQ
Sbjct: 301  GRFWLAGIFKIGNDLSQFVGPVILSHLLRSMQEGDPAWVGYVYAFIIFVGVTLGVLCEAQ 360

Query: 387  YFQNVWRVGFRLRSTLVAAIFRKTLRLTHEARKGFPSGKVTNMITTDANALQQISQQLHG 446
            YFQNVWRVGFRLRSTLVAAIF K+LRLTHEARK F SGKVTNMITTDANALQQISQQLHG
Sbjct: 361  YFQNVWRVGFRLRSTLVAAIFHKSLRLTHEARKNFASGKVTNMITTDANALQQISQQLHG 420

Query: 447  LWSAPFRITLSMVLLYQQLGVASLLGSLMLVLMVPLQTFIISKMRKLTKEGLQWTDRRVS 506
            LWSAPFRI +SM+LLYQQLGVASL GSL+L L++PLQT IISKMRKLTKEGLQWTD+RV 
Sbjct: 421  LWSAPFRIIVSMILLYQQLGVASLFGSLILFLLIPLQTLIISKMRKLTKEGLQWTDKRVG 480

Query: 507  LTNEILAAMDTVKCYAWEKSFQSRVQSIRDDELSWFRKAQFLSAFNSFILNSIPVVVTVV 566
            +TNEIL++MDTVKCYAWEKSF+SR+Q IR++ELSWFRKAQ LSAFNSFILNSIPVVVTVV
Sbjct: 481  ITNEILSSMDTVKCYAWEKSFESRIQGIRNEELSWFRKAQLLSAFNSFILNSIPVVVTVV 540

Query: 567  SFGTFTLLGGDLTPARAFTSLSLFAVLRFPLNMLPNLLSQVVNANVSLQRLEELLLAEER 626
            SFG F LLGGDLTPARAFTSLSLFAVLRFPLNMLPNLLSQVVNANVSLQR+EELLL+EER
Sbjct: 541  SFGVFVLLGGDLTPARAFTSLSLFAVLRFPLNMLPNLLSQVVNANVSLQRIEELLLSEER 600

Query: 627  ILMPNPPLEPELPAVSIKNGNFSWDSKS--PTLSNINLDIPVGSLVAIVGGTGEGKTSLV 684
            IL  NPPL+P  PA+SIKNG FSWDSK+  PTLS+INL+IPVG+LVAIVGGTGEGKTSL+
Sbjct: 601  ILAQNPPLQPGTPAISIKNGYFSWDSKTTKPTLSDINLEIPVGTLVAIVGGTGEGKTSLI 660

Query: 685  SAMLGELPPLKDASVVIRGTVAYVPQISWIFNATLRKNILFGSEFDPAKYWKTVDVSALQ 744
            SAMLGEL   +  SVVIRG+VAYVPQ+SWIFNAT+R+NILFGS+F+  +YW+ +D +ALQ
Sbjct: 661  SAMLGELSHAETTSVVIRGSVAYVPQVSWIFNATVRENILFGSDFESERYWRAIDATALQ 720

Query: 745  HDLDLLPDRDLTEIGERGVNISGGQKQRVSMARA------------------------VF 780
            HDLDLLP RDLTEIGERGVNISGGQKQRVSMARA                        VF
Sbjct: 721  HDLDLLPGRDLTEIGERGVNISGGQKQRVSMARAVYSNSDVYIFDDPLSALDAHVAHQVF 780

Query: 781  NSCIKEELRGKTRILVTNQLHFLPHVDRIILVSEGMIKEEGSFEELSKHGRLFQKLMENA 840
            +SC+K+ELRGKTR+LVTNQLHFLP +D+IILVSEGMIKEEG+F ELSK G LF+KLMENA
Sbjct: 781  DSCMKDELRGKTRVLVTNQLHFLPLMDKIILVSEGMIKEEGTFVELSKSGILFKKLMENA 840

Query: 841  GKMEEMEEREEKDDSINSNQE-VSKPVANRAVQVNEFPKNESYTKKGKRGRSVLVKQEER 899
            GKM+  +E       +N+N E + K      V V+E  +N   TK+GKR RSVL+KQEER
Sbjct: 841  GKMDATQE-------VNTNDENILKLGPTVTVDVSE--RNLGSTKQGKRRRSVLIKQEER 891

Query: 900  ETGIVSGSVLTRYKNALGGPWVIMILFACYLSTEVLRISSSTWLSFWTDQSTSKNYNPGF 959
            ETGI+S +VL RYK A+GG WV+MIL ACYL+TEVLR+SSSTWLS WTDQSTSKNY+PGF
Sbjct: 892  ETGIISWNVLMRYKEAVGGLWVVMILLACYLATEVLRVSSSTWLSIWTDQSTSKNYSPGF 951

Query: 960  YIAIYTILAFGQVTVTLLNSYWLIISSLRAAKRLHDSMLNSILRAPMLFFHTNPIGRVIN 1019
            YI +Y +L FGQV VT  NS+WLI SSL AA+RLHD+ML+SILRAPMLFFHTNP GRVIN
Sbjct: 952  YIVVYALLGFGQVAVTFTNSFWLITSSLHAARRLHDAMLSSILRAPMLFFHTNPTGRVIN 1011

Query: 1020 RFSRDLGDIDRNVASFVNMFMNQLWQLLSTFVLIGIVSTISLWAIMPLLILFYAAYLYYQ 1079
            RFS+D+GDIDRNVA+ +NMFMNQLWQLLSTF LIG VSTISLWAIMPLLILFYAAYLYYQ
Sbjct: 1012 RFSKDIGDIDRNVANLMNMFMNQLWQLLSTFALIGTVSTISLWAIMPLLILFYAAYLYYQ 1071

Query: 1080 STAREVKRLDSITRSPVYAQFGEALNGLSTIRAFKAYDRMAKINGKSMDNNIRFTLANTS 1139
            ST+REV+RLDS+TRSP+YAQFGEALNGLS+IRA+KAYDRMAKINGKSMDNNIRFTLANTS
Sbjct: 1072 STSREVRRLDSVTRSPIYAQFGEALNGLSSIRAYKAYDRMAKINGKSMDNNIRFTLANTS 1131

Query: 1140 SNRWLTIRLETLGGIMIWLIATFAVMQNGRAENQVAFASTMGLLLSYTLNITNLLSGVLR 1199
            SNRWLTIRLETLGG+MIWL ATFAV+QNG   NQ  FASTMGLLLSYTLNIT+LLSGVLR
Sbjct: 1132 SNRWLTIRLETLGGVMIWLTATFAVLQNGNTNNQAGFASTMGLLLSYTLNITSLLSGVLR 1191

Query: 1200 QASRAENSLNAVERVGTYIDLPSEAPGMVESNRPPPAWPSSGSIKFEDVVLRYRPELPPV 1259
            QASRAENSLN+VERVG YIDLPSEA  ++E+NRP   WPS GSIKFEDV LRYRP LPPV
Sbjct: 1192 QASRAENSLNSVERVGNYIDLPSEATDIIENNRPVCGWPSGGSIKFEDVHLRYRPGLPPV 1251

Query: 1260 LHGLSFTVSPSEKVGIVGRTGAGKSSMLNALFRIVELERG 1299
            LHGL+F VSPSEKVG+VGRTGAGKSSMLNALFRIVE+E+G
Sbjct: 1252 LHGLTFFVSPSEKVGVVGRTGAGKSSMLNALFRIVEVEKG 1291
Pump for glutathione S-conjugates.
Arabidopsis thaliana (taxid: 3702)
EC: 3EC: .EC: 6EC: .EC: 3EC: .EC: 4EC: 4
>sp|Q9C8H1|AB11C_ARATH ABC transporter C family member 11 OS=Arabidopsis thaliana GN=ABCC11 PE=2 SV=2 Back     alignment and function description
>sp|Q9C8G9|AB1C_ARATH ABC transporter C family member 1 OS=Arabidopsis thaliana GN=ABCC1 PE=1 SV=1 Back     alignment and function description
>sp|Q42093|AB2C_ARATH ABC transporter C family member 2 OS=Arabidopsis thaliana GN=ABCC2 PE=1 SV=2 Back     alignment and function description
>sp|Q28689|MRP2_RABIT Canalicular multispecific organic anion transporter 1 OS=Oryctolagus cuniculus GN=ABCC2 PE=2 SV=1 Back     alignment and function description
>sp|O35379|MRP1_MOUSE Multidrug resistance-associated protein 1 OS=Mus musculus GN=Abcc1 PE=1 SV=1 Back     alignment and function description
>sp|Q8CG09|MRP1_RAT Multidrug resistance-associated protein 1 OS=Rattus norvegicus GN=Abcc1 PE=1 SV=2 Back     alignment and function description
>sp|B2RX12|MRP3_MOUSE Canalicular multispecific organic anion transporter 2 OS=Mus musculus GN=Abcc3 PE=1 SV=1 Back     alignment and function description
>sp|O88563|MRP3_RAT Canalicular multispecific organic anion transporter 2 OS=Rattus norvegicus GN=Abcc3 PE=2 SV=1 Back     alignment and function description
>sp|Q92887|MRP2_HUMAN Canalicular multispecific organic anion transporter 1 OS=Homo sapiens GN=ABCC2 PE=1 SV=3 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query1303
255571322 1626 mgatp-energized glutathione s-conjugate 0.976 0.782 0.800 0.0
224078860 1607 multidrug resistance protein ABC transpo 0.973 0.789 0.772 0.0
225443998 1624 PREDICTED: ABC transporter C family memb 0.973 0.781 0.775 0.0
75333513 1495 RecName: Full=ABC transporter C family m 0.970 0.845 0.756 0.0
297845974 1495 ATMRP13 [Arabidopsis lyrata subsp. lyrat 0.970 0.845 0.754 0.0
225443996 1623 PREDICTED: ABC transporter C family memb 0.973 0.781 0.752 0.0
359483925 1616 PREDICTED: ABC transporter C family memb 0.968 0.780 0.748 0.0
356555514 1620 PREDICTED: ABC transporter C family memb 0.973 0.782 0.736 0.0
356549118 1620 PREDICTED: ABC transporter C family memb 0.973 0.782 0.735 0.0
356517706 1615 PREDICTED: ABC transporter C family memb 0.975 0.786 0.726 0.0
>gi|255571322|ref|XP_002526610.1| mgatp-energized glutathione s-conjugate pump, putative [Ricinus communis] gi|223534050|gb|EEF35769.1| mgatp-energized glutathione s-conjugate pump, putative [Ricinus communis] Back     alignment and taxonomy information
 Score = 2156 bits (5587), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1043/1303 (80%), Positives = 1151/1303 (88%), Gaps = 31/1303 (2%)

Query: 27   MASGPLDWYCRPVANGTWAKTVDSTFGAYTTCAVDSLVISISHSVLLGLCIFRIWLMNKN 86
            MA  PLDWYCRPVANG WAK VDS FGAYT CA+DSLVI ISH VL+GLC +RIWL+ KN
Sbjct: 1    MALEPLDWYCRPVANGVWAKEVDSAFGAYTPCAIDSLVICISHLVLMGLCFYRIWLIKKN 60

Query: 87   SKARRYRLSSNCYNYMLGLLACYCTAEPLLRLVMGISIFNLDGETSFAPFEMVSLIIEAL 146
            SKA +Y L +  YNY+LGLL  YCTAEPL R+VM ISIFNLDG+T+ APFEMVSLIIEAL
Sbjct: 61   SKAVKYSLRTKYYNYLLGLLVGYCTAEPLFRMVMDISIFNLDGQTNLAPFEMVSLIIEAL 120

Query: 147  AWCSMLIMICLETKFYIREFRWYVRFGVIYVLVGDAVILNLIIPMRDYYSRITLYLYISM 206
             WCSMLIMI LETK YIR+FRWYVRFGVIYVLVG+A +LN I+ M  YY+R TLY YIS 
Sbjct: 121  TWCSMLIMIGLETKVYIRQFRWYVRFGVIYVLVGEAAMLNTILSMTAYYNRFTLYTYISA 180

Query: 207  VFCQALFGILILVYIPNLDPYPGYTIMQPEFVDNAEYEALPGGEHVCPERNASILSRTSF 266
            V CQ LFG+L+LVY+PNLDPYPGY+I+QPE  +N EYEALPGGEH CPER+ ++ SR  F
Sbjct: 181  VVCQVLFGLLLLVYVPNLDPYPGYSILQPESPENGEYEALPGGEH-CPERHVNLFSRIYF 239

Query: 267  GWMTPLLQLGYKKPITEKDVWKLDTWDQTEILIEKFHRCWIEESQRSKPWLLRALNNSFG 326
            GWMTPL+Q GYKKPITEKDVWKLDTWDQTE LI+KF RCWI+ESQ+ KPWLLRALNNS G
Sbjct: 240  GWMTPLMQQGYKKPITEKDVWKLDTWDQTETLIKKFQRCWIKESQKPKPWLLRALNNSLG 299

Query: 327  GRFWLGGLFKIGNDLSQFVGPVLLNHLLQSMQRGDPAWIGYIYAFLIFVGVSFGVLTEAQ 386
             RFWLGG FKIGNDLSQFVGPVLLNHLLQSMQ+GD  WIGY+YAF IFVGVS GVL E+Q
Sbjct: 300  RRFWLGGFFKIGNDLSQFVGPVLLNHLLQSMQQGDATWIGYVYAFSIFVGVSLGVLCESQ 359

Query: 387  YFQNVWRVGFRLRSTLVAAIFRKTLRLTHEARKGFPSGKVTNMITTDANALQQISQQLHG 446
            YFQNV R GFRLRSTLVAAIFRK+LRLTHE+RK FPSGK+TNMITTDAN+LQQI QQLHG
Sbjct: 360  YFQNVMRTGFRLRSTLVAAIFRKSLRLTHESRKNFPSGKITNMITTDANSLQQICQQLHG 419

Query: 447  LWSAPFRITLSMVLLYQQLGVASLLGSLMLVLMVPLQTFIISKMRKLTKEGLQWTDRRVS 506
            LWSAPFRIT+SMVLLYQQLGVASLLGSL+LVLMVP+QTF+IS+MRKLTKEGLQ TD+RVS
Sbjct: 420  LWSAPFRITMSMVLLYQQLGVASLLGSLILVLMVPIQTFVISRMRKLTKEGLQRTDKRVS 479

Query: 507  LTNEILAAMDTVKCYAWEKSFQSRVQSIRDDELSWFRKAQFLSAFNSFILNSIPVVVTVV 566
            L NEILAAMDTVKCYAWEKSFQS+VQ+IR+DELSWFR AQ LSAFNSFILNSIPVVVT+V
Sbjct: 480  LMNEILAAMDTVKCYAWEKSFQSKVQNIRNDELSWFRNAQLLSAFNSFILNSIPVVVTLV 539

Query: 567  SFGTFTLLGGDLTPARAFTSLSLFAVLRFPLNMLPNLLSQVVNANVSLQRLEELLLAEER 626
            SFGTFTLLGGDLTPARAFTSLSLF VLRFPLNMLPNLLSQVVNANVSLQRLEEL LAEER
Sbjct: 540  SFGTFTLLGGDLTPARAFTSLSLFQVLRFPLNMLPNLLSQVVNANVSLQRLEELFLAEER 599

Query: 627  ILMPNPPLEPELPAVSIKNGNFSWDSKSP--TLSNINLDIPVGSLVAIVGGTGEGKTSLV 684
            IL PNP L+PELPA+SIK+G FSWDSKS   TLSNINLDIP GSLVAIVGGTGEGKTSL+
Sbjct: 600  ILAPNPSLQPELPAISIKDGYFSWDSKSEKHTLSNINLDIPAGSLVAIVGGTGEGKTSLI 659

Query: 685  SAMLGELPPLKDASVVIRGTVAYVPQISWIFNATLRKNILFGSEFDPAKYWKTVDVSALQ 744
            SAMLGELPP+ +  +VIRGTVAYVPQ+SWIFNAT+R NILFGSEF+P++YW+T+DV+AL 
Sbjct: 660  SAMLGELPPVANTGIVIRGTVAYVPQVSWIFNATVRDNILFGSEFEPSRYWQTIDVTALH 719

Query: 745  HDLDLLPDRDLTEIGERGVNISGGQKQRVSMARAV------------------------F 780
            HDLDLLP RDLTEIGERGVNISGGQKQRVSMARAV                        F
Sbjct: 720  HDLDLLPGRDLTEIGERGVNISGGQKQRVSMARAVYSNSDVYIFDDPLSALDAHVGRQVF 779

Query: 781  NSCIKEELRGKTRILVTNQLHFLPHVDRIILVSEGMIKEEGSFEELSKHGRLFQKLMENA 840
            NSCIKE LRGKTR+LVTNQLHFLP VDRIILVSEGMIKEEG+FEELSK G+LFQKLMENA
Sbjct: 780  NSCIKEALRGKTRVLVTNQLHFLPQVDRIILVSEGMIKEEGTFEELSKSGKLFQKLMENA 839

Query: 841  GKMEEMEEREE-KDDSINSNQEVSKPVANRAVQVNEFPKNESYTKKGKRGRSVLVKQEER 899
            GKMEE++E+EE ++DS N + E SKP AN   ++NE  +N    KKGK  +SVLVKQEER
Sbjct: 840  GKMEEIKEQEEGQEDSKNLDNESSKPAAN---ELNELTQNVGQMKKGKGRKSVLVKQEER 896

Query: 900  ETGIVSGSVLTRYKNALGGPWVIMILFACYLSTEVLRISSSTWLSFWTDQSTSKNYNPGF 959
            ETG+VS  VL RYKNALGG +V+M+LFA Y+STEVLR+SSSTWLSFWT QSTS+ Y P +
Sbjct: 897  ETGVVSWKVLMRYKNALGGTFVVMVLFAFYISTEVLRVSSSTWLSFWTKQSTSEGYRPAY 956

Query: 960  YIAIYTILAFGQVTVTLLNSYWLIISSLRAAKRLHDSMLNSILRAPMLFFHTNPIGRVIN 1019
            YI IY +L+ GQVTVTL NSYWLI SSLRAA++LHD+MLNSIL+APMLFFHTNP GRVIN
Sbjct: 957  YIFIYALLSLGQVTVTLSNSYWLINSSLRAARKLHDAMLNSILQAPMLFFHTNPTGRVIN 1016

Query: 1020 RFSRDLGDIDRNVASFVNMFMNQLWQLLSTFVLIGIVSTISLWAIMPLLILFYAAYLYYQ 1079
            RF++DLG+IDRNVA+F NMF+NQ++QLLSTF LIGIVST+SLWAIMPLLILFYAAYLYYQ
Sbjct: 1017 RFAKDLGEIDRNVANFANMFLNQVFQLLSTFALIGIVSTVSLWAIMPLLILFYAAYLYYQ 1076

Query: 1080 STAREVKRLDSITRSPVYAQFGEALNGLSTIRAFKAYDRMAKINGKSMDNNIRFTLANTS 1139
            ST+REVKRLDSITRSPVYAQFGEALNGLS+IRA+KAYDRMA I+GKSMDNNIRFTL N S
Sbjct: 1077 STSREVKRLDSITRSPVYAQFGEALNGLSSIRAYKAYDRMANISGKSMDNNIRFTLVNIS 1136

Query: 1140 SNRWLTIRLETLGGIMIWLIATFAVMQNGRAENQVAFASTMGLLLSYTLNITNLLSGVLR 1199
            SNRWLTIRLETLGGIMIWL A+FAV+QN R EN+VAFASTMGLLLSYTLNITNLLS VLR
Sbjct: 1137 SNRWLTIRLETLGGIMIWLTASFAVLQNSRTENKVAFASTMGLLLSYTLNITNLLSNVLR 1196

Query: 1200 QASRAENSLNAVERVGTYIDLPSEAPGMVESNRPPPAWPSSGSIKFEDVVLRYRPELPPV 1259
            QASRAENS N+VER GTYID+PSEAP ++ESNRPPPAWPSSGSI F DVVLRYR ELPPV
Sbjct: 1197 QASRAENSFNSVERAGTYIDMPSEAPAVIESNRPPPAWPSSGSINFRDVVLRYRSELPPV 1256

Query: 1260 LHGLSFTVSPSEKVGIVGRTGAGKSSMLNALFRIVELERGENI 1302
            LHGLSF+VSPSEK+GI GRTGAGKSSMLNALFRIVELERGE I
Sbjct: 1257 LHGLSFSVSPSEKLGIAGRTGAGKSSMLNALFRIVELERGEVI 1299

Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|224078860|ref|XP_002305657.1| multidrug resistance protein ABC transporter family [Populus trichocarpa] gi|222848621|gb|EEE86168.1| multidrug resistance protein ABC transporter family [Populus trichocarpa] Back     alignment and taxonomy information
>gi|225443998|ref|XP_002281070.1| PREDICTED: ABC transporter C family member 2-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|75333513|sp|Q9C8H0.1|AB12C_ARATH RecName: Full=ABC transporter C family member 12; Short=ABC transporter ABCC.12; Short=AtABCC12; AltName: Full=ATP-energized glutathione S-conjugate pump 13; AltName: Full=Glutathione S-conjugate-transporting ATPase 13; AltName: Full=Multidrug resistance-associated protein 13 gi|12322126|gb|AAG51100.1|AC025295_8 ABC transporter, putative [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|297845974|ref|XP_002890868.1| ATMRP13 [Arabidopsis lyrata subsp. lyrata] gi|297336710|gb|EFH67127.1| ATMRP13 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|225443996|ref|XP_002280819.1| PREDICTED: ABC transporter C family member 2 isoform 1 [Vitis vinifera] gi|297740795|emb|CBI30977.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|359483925|ref|XP_003633036.1| PREDICTED: ABC transporter C family member 2 isoform 2 [Vitis vinifera] Back     alignment and taxonomy information
>gi|356555514|ref|XP_003546076.1| PREDICTED: ABC transporter C family member 2-like [Glycine max] Back     alignment and taxonomy information
>gi|356549118|ref|XP_003542944.1| PREDICTED: ABC transporter C family member 2-like [Glycine max] Back     alignment and taxonomy information
>gi|356517706|ref|XP_003527527.1| PREDICTED: ABC transporter C family member 12-like [Glycine max] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query1303
TAIR|locus:2028155 1495 ABCC11 "ATP-binding cassette C 0.576 0.502 0.665 0.0
TAIR|locus:2204202 1622 ABCC1 "ATP-binding cassette C1 0.583 0.468 0.627 0.0
TAIR|locus:2061559 1623 ABCC2 "ATP-binding cassette C2 0.575 0.462 0.622 0.0
ZFIN|ZDB-GENE-040426-1523 1567 abcc2 "ATP-binding cassette, s 0.387 0.322 0.378 9.9e-180
DICTYBASE|DDB_G0284867 1593 abcC8 "ABC transporter C famil 0.480 0.392 0.346 1e-174
UNIPROTKB|F1PHV0 1544 ABCC2 "Uncharacterized protein 0.360 0.304 0.363 5.6e-163
MGI|MGI:1352447 1543 Abcc2 "ATP-binding cassette, s 0.357 0.302 0.356 1.9e-160
UNIPROTKB|Q5F364 1525 ABCC1 "Multidrug resistance-as 0.373 0.319 0.361 1.3e-158
UNIPROTKB|E1C6S5 1552 ABCC2 "Uncharacterized protein 0.358 0.300 0.372 2.9e-158
UNIPROTKB|J9NY13 1523 ABCC3 "Uncharacterized protein 0.362 0.309 0.364 5.9e-158
TAIR|locus:2028155 ABCC11 "ATP-binding cassette C11" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 2637 (933.3 bits), Expect = 0., Sum P(2) = 0.
 Identities = 501/753 (66%), Positives = 594/753 (78%)

Query:    32 LDWYCRPVANGTWAKTVDSTFGAYTTCAVDXXXXXXXXXXXXXXCIFRIWLMNKNSKARR 91
             L+WYC+P+A G W KT D  FGAYT CA+D              C +RIW+   N+KA+ 
Sbjct:     6 LNWYCKPIAEGFWEKTPDGAFGAYTPCAIDSLVMIVSNSVLLGLCFYRIWITLYNAKAQI 65

Query:    92 YRLSSNCYNYMLGLLACYCTAEPLLRLVMGISIFNLDGETSFAPFEMVSLIIEALAWCSM 151
             Y L    Y+ +L +LAC C  EP+LRLVMGIS+F++  ET   PFE+ SL++EA AW +M
Sbjct:    66 YVLRKMYYHCVLWILACCCVVEPVLRLVMGISLFDMGDETDLPPFEVASLMVEAFAWFAM 125

Query:   152 LIMICLETKFYIREFRWYVRFGVIYVLVGDAVILNLIIPMRDYYSRITLYLYISMVFCQA 211
             L++I LETK Y++EFRWYVRFGV+YVLV DAV+L+L++P+++  +R  LYL IS   CQA
Sbjct:   126 LVLIGLETKQYVKEFRWYVRFGVVYVLVADAVLLDLVLPLKNSINRTALYLCISSRCCQA 185

Query:   212 LFGILILVYIPNLDPYPGYTIMQPEFVDNAEYEALPGGEHVCPERNASILSRTSFGWMTP 271
             LFGIL+LVYIP LD YP Y I+  E +DN EY+ALPGG ++CPER ASI S   F WMTP
Sbjct:   186 LFGILLLVYIPELDLYPDYHILNNESLDNVEYDALPGGVNICPERYASIFSGIYFSWMTP 245

Query:   272 LLQLGYKKPITEKDVWKLDTWDQTEILIEKFHRCWIEESQRSKPWLLRALNNSFGGRFWL 331
             L+QLGY+KPITE+DVW+LD WDQTE LI++F RCW EES+R KPWLLRALNNS G RFWL
Sbjct:   246 LMQLGYRKPITERDVWQLDQWDQTETLIKRFQRCWTEESRRPKPWLLRALNNSLGRRFWL 305

Query:   332 GGLFKIGNDLSQFVGPVLLNHLLQSMQRGDPAWIGYIYAFLIFVGVSFGVLTEAQYFQNV 391
             GG+FK+G+DLSQFVGPV+L+H+LQSM  GDPAW+GY+YAFLIF GV+FGVL ++QYFQ+V
Sbjct:   306 GGIFKVGHDLSQFVGPVILSHILQSMIEGDPAWVGYVYAFLIFFGVTFGVLCQSQYFQHV 365

Query:   392 WRVGFRLRSTLVAAIFRKTLRLTHEARKGFPSGKVTNMITTDANALQQISQQLHGLWSAP 451
              RVGFRLRSTLVAAIF K+LRLT++ARK F SGKVTNMITTDANALQ I++QLHGLWSAP
Sbjct:   366 GRVGFRLRSTLVAAIFHKSLRLTNKARKNFASGKVTNMITTDANALQLIAEQLHGLWSAP 425

Query:   452 FRITLSMVLLYQQXXXXXXXXXXXXXXXXXXQTFIISKMRKLTKEGLQWTDRRVSLTNEI 511
             FRI +SMVLLYQQ                  QT I+ KMRKLTKEGLQWTD+RV +  EI
Sbjct:   426 FRIIVSMVLLYQQLGVASIFGSLILFLLIPFQTLIVRKMRKLTKEGLQWTDKRVGIIYEI 485

Query:   512 LAAMDTVKCYAWEKSFQSRVQSIRDDELSWFRKAQFLSAFNSFILNSIPXXXXXXSFGTF 571
             LA+MD VKCYAWEKSF+SR+Q IR++ELSWFRKAQ LSAFNSFILNS P      SFG +
Sbjct:   486 LASMDIVKCYAWEKSFESRIQGIRNEELSWFRKAQLLSAFNSFILNSTPVVVTLVSFGVY 545

Query:   572 TLLGGDLTPARAFTSLSLFAVLRFPLNMLPNLLSQVVNANVSLQRXXXXXXXXXRILMXX 631
              LLGGDLTPARAFTSLSLFAVLR PL+ LPNL+SQ VNANVSLQR         RIL   
Sbjct:   546 VLLGGDLTPARAFTSLSLFAVLRSPLSTLPNLISQAVNANVSLQRIEELLLSEERILAQN 605

Query:   632 XXXXXXXXAVSIKNGNFSWDSKS--PTLSNINLDIPVGSLVAIVGGTGEGKTSLVSAMLG 689
                     A+SIKNG FSWDSK+  PTLS+INL+IPVGSLVAIVGGTGEGKTSL+SAMLG
Sbjct:   606 PPLQPGAPAISIKNGYFSWDSKTSKPTLSDINLEIPVGSLVAIVGGTGEGKTSLISAMLG 665

Query:   690 ELPPLKDASVVIRGTVAYVPQISWIFNATLRKNILFGSEFDPAKYWKTVDVSALQHDLDL 749
             EL   + +SV IRG+VAYVPQ+SWIFNATLR+NILFGS+F+  +YW+ +DV+ALQHDLDL
Sbjct:   666 ELSHAETSSVDIRGSVAYVPQVSWIFNATLRENILFGSDFESERYWRAIDVTALQHDLDL 725

Query:   750 LPDRDLTEIGERGVNISGGQKQRVSMARAVFNS 782
              P RD TEIGERGVNISGGQKQRVSMARAV+++
Sbjct:   726 FPGRDRTEIGERGVNISGGQKQRVSMARAVYSN 758
GO:0000166 "nucleotide binding" evidence=IEA
GO:0005524 "ATP binding" evidence=IEA
GO:0005737 "cytoplasm" evidence=ISM
GO:0006810 "transport" evidence=IEA
GO:0016021 "integral to membrane" evidence=IEA
GO:0016887 "ATPase activity" evidence=IEA
GO:0017111 "nucleoside-triphosphatase activity" evidence=IEA
GO:0042626 "ATPase activity, coupled to transmembrane movement of substances" evidence=IEA;ISS
GO:0055085 "transmembrane transport" evidence=IEA
TAIR|locus:2204202 ABCC1 "ATP-binding cassette C1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2061559 ABCC2 "ATP-binding cassette C2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-040426-1523 abcc2 "ATP-binding cassette, sub-family C (CFTR/MRP), member 2" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
DICTYBASE|DDB_G0284867 abcC8 "ABC transporter C family protein" [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms
UNIPROTKB|F1PHV0 ABCC2 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
MGI|MGI:1352447 Abcc2 "ATP-binding cassette, sub-family C (CFTR/MRP), member 2" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|Q5F364 ABCC1 "Multidrug resistance-associated protein 1" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|E1C6S5 ABCC2 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|J9NY13 ABCC3 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q9C8H0AB12C_ARATH3, ., 6, ., 3, ., 4, 40.75610.97000.8454yesno
Q9C8H1AB11C_ARATH3, ., 6, ., 3, ., 4, 40.71760.97000.8454nono

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer3.6.3.440.991

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
gw1.IV.2236.1
multidrug resistance protein ABC transporter family (1607 aa)
(Populus trichocarpa)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query1303
PLN03130 1622 PLN03130, PLN03130, ABC transporter C family membe 0.0
PLN03232 1495 PLN03232, PLN03232, ABC transporter C family membe 0.0
TIGR00957 1522 TIGR00957, MRP_assoc_pro, multi drug resistance-as 0.0
PTZ00243 1560 PTZ00243, PTZ00243, ABC transporter; Provisional 1e-109
cd03250204 cd03250, ABCC_MRP_domain1, ATP-binding cassette do 7e-80
TIGR01271 1490 TIGR01271, CFTR_protein, cystic fibrosis transmemb 3e-70
COG1132567 COG1132, MdlB, ABC-type multidrug transport system 3e-61
COG2274709 COG2274, SunT, ABC-type bacteriocin/lantibiotic ex 6e-46
cd03290218 cd03290, ABCC_SUR1_N, ATP-binding cassette domain 9e-45
COG4988559 COG4988, CydD, ABC-type transport system involved 2e-40
TIGR01271 1490 TIGR01271, CFTR_protein, cystic fibrosis transmemb 1e-39
COG1132 567 COG1132, MdlB, ABC-type multidrug transport system 2e-39
cd03291282 cd03291, ABCC_CFTR1, ATP-binding cassette domain o 2e-39
TIGR02857529 TIGR02857, CydD, thiol reductant ABC exporter, Cyd 4e-39
PTZ00243 1560 PTZ00243, PTZ00243, ABC transporter; Provisional 8e-38
COG4987573 COG4987, CydC, ABC-type transport system involved 2e-35
cd03254229 cd03254, ABCC_Glucan_exporter_like, ATP-binding ca 1e-33
pfam00664274 pfam00664, ABC_membrane, ABC transporter transmemb 6e-33
TIGR02204576 TIGR02204, MsbA_rel, ABC transporter, permease/ATP 2e-32
TIGR03375694 TIGR03375, type_I_sec_LssB, type I secretion syste 9e-32
TIGR01193708 TIGR01193, bacteriocin_ABC, ABC-type bacteriocin t 5e-30
TIGR01842544 TIGR01842, type_I_sec_PrtD, type I secretion syste 8e-30
cd03251234 cd03251, ABCC_MsbA, ATP-binding cassette domain of 3e-28
cd03228171 cd03228, ABCC_MRP_Like, ATP-binding cassette domai 5e-28
TIGR02203571 TIGR02203, MsbA_lipidA, lipid A export permease/AT 8e-28
COG4618580 COG4618, ArpD, ABC-type protease/lipase transport 1e-27
cd03244 221 cd03244, ABCC_MRP_domain2, ATP-binding cassette do 2e-27
cd03253236 cd03253, ABCC_ATM1_transporter, ATP-binding casset 1e-26
cd03245220 cd03245, ABCC_bacteriocin_exporters, ATP-binding c 2e-26
PRK11174588 PRK11174, PRK11174, cysteine/glutathione ABC trans 1e-25
TIGR02868530 TIGR02868, CydC, thiol reductant ABC exporter, Cyd 1e-25
pfam00664274 pfam00664, ABC_membrane, ABC transporter transmemb 2e-25
cd03249238 cd03249, ABC_MTABC3_MDL1_MDL2, ATP-binding cassett 3e-25
COG2274 709 COG2274, SunT, ABC-type bacteriocin/lantibiotic ex 1e-24
TIGR01846694 TIGR01846, type_I_sec_HlyB, type I secretion syste 2e-24
cd03369 207 cd03369, ABCC_NFT1, ATP-binding cassette domain 2 2e-24
cd03244221 cd03244, ABCC_MRP_domain2, ATP-binding cassette do 2e-23
PRK11160574 PRK11160, PRK11160, cysteine/glutathione ABC trans 3e-23
TIGR01192585 TIGR01192, chvA, glucan exporter ATP-binding prote 1e-21
TIGR03797686 TIGR03797, NHLM_micro_ABC2, NHLM bacteriocin syste 1e-21
cd03252237 cd03252, ABCC_Hemolysin, ATP-binding cassette doma 6e-21
COG5265497 COG5265, ATM1, ABC-type transport system involved 7e-20
PRK11176582 PRK11176, PRK11176, lipid transporter ATP-binding/ 2e-19
PRK10790592 PRK10790, PRK10790, putative multidrug transporter 6e-19
cd03225211 cd03225, ABC_cobalt_CbiO_domain1, First domain of 2e-18
TIGR00958 711 TIGR00958, 3a01208, Conjugate Transporter-2 (CT2) 2e-18
TIGR02203 571 TIGR02203, MsbA_lipidA, lipid A export permease/AT 3e-18
PRK13657588 PRK13657, PRK13657, cyclic beta-1,2-glucan ABC tra 6e-18
TIGR03796710 TIGR03796, NHLM_micro_ABC1, NHLM bacteriocin syste 1e-17
TIGR00958711 TIGR00958, 3a01208, Conjugate Transporter-2 (CT2) 2e-17
cd03246173 cd03246, ABCC_Protease_Secretion, ATP-binding cass 2e-17
COG1131293 COG1131, CcmA, ABC-type multidrug transport system 3e-17
COG1121254 COG1121, ZnuC, ABC-type Mn/Zn transport systems, A 4e-17
COG1122235 COG1122, CbiO, ABC-type cobalt transport system, A 8e-17
cd03247178 cd03247, ABCC_cytochrome_bd, ATP-binding cassette 4e-16
cd03235213 cd03235, ABC_Metallic_Cations, ATP-binding cassett 4e-16
TIGR03375 694 TIGR03375, type_I_sec_LssB, type I secretion syste 1e-15
cd03261235 cd03261, ABC_Org_Solvent_Resistant, ATP-binding ca 1e-15
TIGR00968237 TIGR00968, 3a0106s01, sulfate ABC transporter, ATP 1e-15
cd03228 171 cd03228, ABCC_MRP_Like, ATP-binding cassette domai 3e-15
TIGR02204 576 TIGR02204, MsbA_rel, ABC transporter, permease/ATP 4e-15
COG1120258 COG1120, FepC, ABC-type cobalamin/Fe3+-siderophore 4e-15
COG4988 559 COG4988, CydD, ABC-type transport system involved 9e-15
COG1127263 COG1127, Ttg2A, ABC-type transport system involved 1e-14
TIGR03410230 TIGR03410, urea_trans_UrtE, urea ABC transporter, 2e-14
TIGR01193 708 TIGR01193, bacteriocin_ABC, ABC-type bacteriocin t 5e-14
cd03248226 cd03248, ABCC_TAP, ATP-binding cassette domain of 5e-14
PRK10789569 PRK10789, PRK10789, putative multidrug transporter 5e-14
cd03224222 cd03224, ABC_TM1139_LivF_branched, ATP-binding cas 1e-13
TIGR02857 529 TIGR02857, CydD, thiol reductant ABC exporter, Cyd 2e-13
COG4987 573 COG4987, CydC, ABC-type transport system involved 3e-13
TIGR01846 694 TIGR01846, type_I_sec_HlyB, type I secretion syste 6e-13
cd03296239 cd03296, ABC_CysA_sulfate_importer, ATP-binding ca 8e-13
cd03226205 cd03226, ABC_cobalt_CbiO_domain2, Second domain of 1e-12
COG4615546 COG4615, PvdE, ABC-type siderophore export system, 2e-12
COG5265 497 COG5265, ATM1, ABC-type transport system involved 4e-12
cd03214180 cd03214, ABC_Iron-Siderophores_B12_Hemin, ATP-bind 4e-12
PRK10790 592 PRK10790, PRK10790, putative multidrug transporter 5e-12
COG1136226 COG1136, SalX, ABC-type antimicrobial peptide tran 5e-12
cd00267157 cd00267, ABC_ATPase, ATP-binding cassette transpor 6e-12
COG0410237 COG0410, LivF, ABC-type branched-chain amino acid 7e-12
PLN032321495 PLN03232, PLN03232, ABC transporter C family membe 8e-12
cd03259213 cd03259, ABC_Carb_Solutes_like, ATP-binding casset 1e-11
COG3842352 COG3842, PotA, ABC-type spermidine/putrescine tran 1e-11
TIGR009571522 TIGR00957, MRP_assoc_pro, multi drug resistance-as 2e-11
cd03254 229 cd03254, ABCC_Glucan_exporter_like, ATP-binding ca 2e-11
TIGR02868 530 TIGR02868, CydC, thiol reductant ABC exporter, Cyd 2e-11
PRK13632271 PRK13632, cbiO, cobalt transporter ATP-binding sub 2e-11
cd03369207 cd03369, ABCC_NFT1, ATP-binding cassette domain 2 4e-11
COG3839338 COG3839, MalK, ABC-type sugar transport systems, A 6e-11
TIGR03797 686 TIGR03797, NHLM_micro_ABC2, NHLM bacteriocin syste 1e-10
cd03293220 cd03293, ABC_NrtD_SsuB_transporters, ATP-binding c 1e-10
cd03258233 cd03258, ABC_MetN_methionine_transporter, ATP-bind 2e-10
COG0488530 COG0488, Uup, ATPase components of ABC transporter 3e-10
cd03301213 cd03301, ABC_MalK_N, The N-terminal ATPase domain 4e-10
cd03288 257 cd03288, ABCC_SUR2, ATP-binding cassette domain 2 5e-10
COG1126240 COG1126, GlnQ, ABC-type polar amino acid transport 6e-10
COG1116248 COG1116, TauB, ABC-type nitrate/sulfonate/bicarbon 6e-10
cd03251 234 cd03251, ABCC_MsbA, ATP-binding cassette domain of 1e-09
cd03245 220 cd03245, ABCC_bacteriocin_exporters, ATP-binding c 1e-09
cd03252 237 cd03252, ABCC_Hemolysin, ATP-binding cassette doma 1e-09
cd03255218 cd03255, ABC_MJ0796_LolCDE_FtsE, ATP-binding casse 1e-09
COG1118345 COG1118, CysA, ABC-type sulfate/molybdate transpor 1e-09
PLN031301622 PLN03130, PLN03130, ABC transporter C family membe 2e-09
cd03253 236 cd03253, ABCC_ATM1_transporter, ATP-binding casset 2e-09
cd03229178 cd03229, ABC_Class3, ATP-binding cassette domain o 2e-09
cd03230173 cd03230, ABC_DR_subfamily_A, ATP-binding cassette 2e-09
PRK10522547 PRK10522, PRK10522, multidrug transporter membrane 3e-09
PRK09536402 PRK09536, btuD, corrinoid ABC transporter ATPase; 3e-09
cd03289275 cd03289, ABCC_CFTR2, ATP-binding cassette domain 2 3e-09
TIGR02982220 TIGR02982, heterocyst_DevA, ABC exporter ATP-bindi 3e-09
TIGR03771223 TIGR03771, anch_rpt_ABC, anchored repeat-type ABC 4e-09
COG3638258 COG3638, COG3638, ABC-type phosphate/phosphonate t 5e-09
PRK13644274 PRK13644, cbiO, cobalt transporter ATP-binding sub 5e-09
PRK11160 574 PRK11160, PRK11160, cysteine/glutathione ABC trans 6e-09
cd00267157 cd00267, ABC_ATPase, ATP-binding cassette transpor 6e-09
cd03297214 cd03297, ABC_ModC_molybdenum_transporter, ATP-bind 7e-09
COG1123539 COG1123, COG1123, ATPase components of various ABC 8e-09
cd03257228 cd03257, ABC_NikE_OppD_transporters, ATP-binding c 8e-09
cd03221144 cd03221, ABCF_EF-3, ATP-binding cassette domain of 1e-08
COG1135339 COG1135, AbcC, ABC-type metal ion transport system 1e-08
cd03225 211 cd03225, ABC_cobalt_CbiO_domain1, First domain of 2e-08
cd03289 275 cd03289, ABCC_CFTR2, ATP-binding cassette domain 2 3e-08
COG4148352 COG4148, ModC, ABC-type molybdate transport system 3e-08
COG1124252 COG1124, DppF, ABC-type dipeptide/oligopeptide/nic 3e-08
cd03250 204 cd03250, ABCC_MRP_domain1, ATP-binding cassette do 4e-08
PRK09452375 PRK09452, potA, putrescine/spermidine ABC transpor 4e-08
COG2884 223 COG2884, FtsE, Predicted ATPase involved in cell d 4e-08
cd03260227 cd03260, ABC_PstB_phosphate_transporter, ATP-bindi 4e-08
PRK09493240 PRK09493, glnQ, glutamine ABC transporter ATP-bind 5e-08
cd03249 238 cd03249, ABC_MTABC3_MDL1_MDL2, ATP-binding cassett 8e-08
PRK10851353 PRK10851, PRK10851, sulfate/thiosulfate transporte 9e-08
COG4619223 COG4619, COG4619, ABC-type uncharacterized transpo 9e-08
PRK13657 588 PRK13657, PRK13657, cyclic beta-1,2-glucan ABC tra 1e-07
TIGR03796 710 TIGR03796, NHLM_micro_ABC1, NHLM bacteriocin syste 1e-07
cd03247 178 cd03247, ABCC_cytochrome_bd, ATP-binding cassette 1e-07
cd03234226 cd03234, ABCG_White, White pigment protein homolog 1e-07
cd03262213 cd03262, ABC_HisP_GlnQ, ATP-binding cassette domai 1e-07
cd03248 226 cd03248, ABCC_TAP, ATP-binding cassette domain of 2e-07
cd03214 180 cd03214, ABC_Iron-Siderophores_B12_Hemin, ATP-bind 2e-07
COG4161242 COG4161, ArtP, ABC-type arginine transport system, 2e-07
cd03246 173 cd03246, ABCC_Protease_Secretion, ATP-binding cass 3e-07
TIGR00954659 TIGR00954, 3a01203, Peroxysomal Fatty Acyl CoA Tra 3e-07
TIGR02142354 TIGR02142, modC_ABC, molybdenum ABC transporter, A 3e-07
PRK15056272 PRK15056, PRK15056, manganese/iron transporter ATP 3e-07
cd03224 222 cd03224, ABC_TM1139_LivF_branched, ATP-binding cas 4e-07
PRK13651305 PRK13651, PRK13651, cobalt transporter ATP-binding 4e-07
PRK11264250 PRK11264, PRK11264, putative amino-acid ABC transp 4e-07
COG1134249 COG1134, TagH, ABC-type polysaccharide/polyol phos 4e-07
cd03299235 cd03299, ABC_ModC_like, ATP-binding cassette domai 5e-07
COG1119257 COG1119, ModF, ABC-type molybdenum transport syste 5e-07
TIGR01194555 TIGR01194, cyc_pep_trnsptr, cyclic peptide transpo 5e-07
COG1117253 COG1117, PstB, ABC-type phosphate transport system 6e-07
cd03292 214 cd03292, ABC_FtsE_transporter, ATP-binding cassett 6e-07
TIGR03608206 TIGR03608, L_ocin_972_ABC, putative bacteriocin ex 7e-07
COG1121 254 COG1121, ZnuC, ABC-type Mn/Zn transport systems, A 8e-07
cd03256 241 cd03256, ABC_PhnC_transporter, ATP-binding cassett 9e-07
TIGR012711490 TIGR01271, CFTR_protein, cystic fibrosis transmemb 1e-06
COG1120 258 COG1120, FepC, ABC-type cobalamin/Fe3+-siderophore 1e-06
COG0410 237 COG0410, LivF, ABC-type branched-chain amino acid 1e-06
PRK13635279 PRK13635, cbiO, cobalt transporter ATP-binding sub 1e-06
COG0444316 COG0444, DppD, ABC-type dipeptide/oligopeptide/nic 1e-06
PRK13640282 PRK13640, cbiO, cobalt transporter ATP-binding sub 1e-06
cd03221144 cd03221, ABCF_EF-3, ATP-binding cassette domain of 2e-06
COG1134 249 COG1134, TagH, ABC-type polysaccharide/polyol phos 2e-06
PRK14259269 PRK14259, PRK14259, phosphate ABC transporter ATP- 2e-06
cd03295242 cd03295, ABC_OpuCA_Osmoprotection, ATP-binding cas 2e-06
PRK10535648 PRK10535, PRK10535, macrolide transporter ATP-bind 2e-06
COG4178604 COG4178, COG4178, ABC-type uncharacterized transpo 2e-06
COG0488 530 COG0488, Uup, ATPase components of ABC transporter 3e-06
COG1245591 COG1245, COG1245, Predicted ATPase, RNase L inhibi 3e-06
cd03237246 cd03237, ABC_RNaseL_inhibitor_domain2, The ATP-bin 3e-06
PRK14250241 PRK14250, PRK14250, phosphate ABC transporter ATP- 3e-06
cd03292214 cd03292, ABC_FtsE_transporter, ATP-binding cassett 4e-06
PRK11144352 PRK11144, modC, molybdate transporter ATP-binding 4e-06
TIGR00972247 TIGR00972, 3a0107s01c2, phosphate ABC transporter, 4e-06
PRK10744260 PRK10744, pstB, phosphate transporter ATP-binding 4e-06
COG4604252 COG4604, CeuD, ABC-type enterochelin transport sys 4e-06
PRK13634290 PRK13634, cbiO, cobalt transporter ATP-binding sub 4e-06
COG1123 539 COG1123, COG1123, ATPase components of various ABC 5e-06
TIGR03265353 TIGR03265, PhnT2, putative 2-aminoethylphosphonate 5e-06
TIGR02314343 TIGR02314, ABC_MetN, D-methionine ABC transporter, 6e-06
cd03255 218 cd03255, ABC_MJ0796_LolCDE_FtsE, ATP-binding casse 7e-06
TIGR00955617 TIGR00955, 3a01204, The Eye Pigment Precursor Tran 7e-06
PRK10619257 PRK10619, PRK10619, histidine/lysine/arginine/orni 7e-06
cd03235 213 cd03235, ABC_Metallic_Cations, ATP-binding cassett 8e-06
TIGR02673214 TIGR02673, FtsE, cell division ATP-binding protein 8e-06
PRK13637287 PRK13637, cbiO, cobalt transporter ATP-binding sub 9e-06
cd03213194 cd03213, ABCG_EPDR, Eye pigment and drug resistanc 9e-06
cd03223166 cd03223, ABCD_peroxisomal_ALDP, ATP-binding casset 9e-06
PRK11176 582 PRK11176, PRK11176, lipid transporter ATP-binding/ 1e-05
COG1122 235 COG1122, CbiO, ABC-type cobalt transport system, A 1e-05
cd03293 220 cd03293, ABC_NrtD_SsuB_transporters, ATP-binding c 1e-05
COG0488 530 COG0488, Uup, ATPase components of ABC transporter 1e-05
COG2884223 COG2884, FtsE, Predicted ATPase involved in cell d 1e-05
TIGR02673 214 TIGR02673, FtsE, cell division ATP-binding protein 1e-05
cd03300232 cd03300, ABC_PotA_N, ATP-binding cassette domain o 1e-05
cd03263220 cd03263, ABC_subfamily_A, ATP-binding cassette dom 1e-05
PRK11607377 PRK11607, potG, putrescine transporter ATP-binding 1e-05
COG1131 293 COG1131, CcmA, ABC-type multidrug transport system 2e-05
cd03257 228 cd03257, ABC_NikE_OppD_transporters, ATP-binding c 2e-05
COG1119 257 COG1119, ModF, ABC-type molybdenum transport syste 2e-05
cd03256241 cd03256, ABC_PhnC_transporter, ATP-binding cassett 2e-05
COG4178 604 COG4178, COG4178, ABC-type uncharacterized transpo 2e-05
pfam00005119 pfam00005, ABC_tran, ABC transporter 2e-05
COG1137243 COG1137, YhbG, ABC-type (unclassified) transport s 2e-05
cd03264211 cd03264, ABC_drug_resistance_like, ABC-type multid 2e-05
COG4555245 COG4555, NatA, ABC-type Na+ transport system, ATPa 2e-05
cd03213 194 cd03213, ABCG_EPDR, Eye pigment and drug resistanc 3e-05
COG3840231 COG3840, ThiQ, ABC-type thiamine transport system, 3e-05
PRK14244251 PRK14244, PRK14244, phosphate ABC transporter ATP- 3e-05
PRK14238271 PRK14238, PRK14238, phosphate transporter ATP-bind 3e-05
COG1125309 COG1125, OpuBA, ABC-type proline/glycine betaine t 3e-05
PTZ002651466 PTZ00265, PTZ00265, multidrug resistance protein ( 3e-05
COG4559259 COG4559, COG4559, ABC-type hemin transport system, 3e-05
PRK13648269 PRK13648, cbiO, cobalt transporter ATP-binding sub 3e-05
PRK13646286 PRK13646, cbiO, cobalt transporter ATP-binding sub 3e-05
PRK10789 569 PRK10789, PRK10789, putative multidrug transporter 4e-05
PRK13632 271 PRK13632, cbiO, cobalt transporter ATP-binding sub 4e-05
COG1116 248 COG1116, TauB, ABC-type nitrate/sulfonate/bicarbon 4e-05
COG3638 258 COG3638, COG3638, ABC-type phosphate/phosphonate t 4e-05
TIGR03005252 TIGR03005, ectoine_ehuA, ectoine/hydroxyectoine AB 4e-05
COG4136213 COG4136, COG4136, ABC-type uncharacterized transpo 4e-05
cd03230 173 cd03230, ABC_DR_subfamily_A, ATP-binding cassette 5e-05
COG1123539 COG1123, COG1123, ATPase components of various ABC 5e-05
COG3845501 COG3845, COG3845, ABC-type uncharacterized transpo 5e-05
PRK14249251 PRK14249, PRK14249, phosphate ABC transporter ATP- 5e-05
COG1129500 COG1129, MglA, ABC-type sugar transport system, AT 5e-05
PRK11248255 PRK11248, tauB, taurine transporter ATP-binding su 5e-05
cd03219236 cd03219, ABC_Mj1267_LivG_branched, ATP-binding cas 5e-05
PRK11124242 PRK11124, artP, arginine transporter ATP-binding s 6e-05
PRK11831269 PRK11831, PRK11831, putative ABC transporter ATP-b 6e-05
COG4525259 COG4525, TauB, ABC-type taurine transport system, 7e-05
cd03220 224 cd03220, ABC_KpsT_Wzt, ATP-binding cassette compon 7e-05
TIGR01277213 TIGR01277, thiQ, thiamine ABC transporter, ATP-bin 7e-05
COG1124 252 COG1124, DppF, ABC-type dipeptide/oligopeptide/nic 8e-05
PLN03073718 PLN03073, PLN03073, ABC transporter F family; Prov 8e-05
TIGR02315 243 TIGR02315, ABC_phnC, phosphonate ABC transporter, 8e-05
PRK13548258 PRK13548, hmuV, hemin importer ATP-binding subunit 8e-05
COG4618 580 COG4618, ArpD, ABC-type protease/lipase transport 9e-05
cd03220224 cd03220, ABC_KpsT_Wzt, ATP-binding cassette compon 9e-05
PRK11614237 PRK11614, livF, leucine/isoleucine/valine transpor 9e-05
COG4608268 COG4608, AppF, ABC-type oligopeptide transport sys 9e-05
PRK11174 588 PRK11174, PRK11174, cysteine/glutathione ABC trans 1e-04
cd03262 213 cd03262, ABC_HisP_GlnQ, ATP-binding cassette domai 1e-04
TIGR02324 224 TIGR02324, CP_lyasePhnL, phosphonate C-P lyase sys 1e-04
TIGR01186363 TIGR01186, proV, glycine betaine/L-proline transpo 1e-04
PRK14243264 PRK14243, PRK14243, phosphate transporter ATP-bind 1e-04
TIGR03410 230 TIGR03410, urea_trans_UrtE, urea ABC transporter, 2e-04
cd03258 233 cd03258, ABC_MetN_methionine_transporter, ATP-bind 2e-04
cd03288257 cd03288, ABCC_SUR2, ATP-binding cassette domain 2 2e-04
cd03229 178 cd03229, ABC_Class3, ATP-binding cassette domain o 2e-04
PRK13635 279 PRK13635, cbiO, cobalt transporter ATP-binding sub 2e-04
PTZ00265 1466 PTZ00265, PTZ00265, multidrug resistance protein ( 2e-04
TIGR03269520 TIGR03269, met_CoM_red_A2, methyl coenzyme M reduc 2e-04
PRK10247225 PRK10247, PRK10247, putative ABC transporter ATP-b 2e-04
cd03218232 cd03218, ABC_YhbG, ATP-binding cassette component 2e-04
PRK13409590 PRK13409, PRK13409, putative ATPase RIL; Provision 2e-04
COG1123 539 COG1123, COG1123, ATPase components of various ABC 3e-04
PRK13548 258 PRK13548, hmuV, hemin importer ATP-binding subunit 3e-04
PRK13652277 PRK13652, cbiO, cobalt transporter ATP-binding sub 3e-04
PRK13649280 PRK13649, cbiO, cobalt transporter ATP-binding sub 3e-04
PRK14258261 PRK14258, PRK14258, phosphate ABC transporter ATP- 3e-04
PRK15134 529 PRK15134, PRK15134, microcin C ABC transporter ATP 3e-04
PRK11247257 PRK11247, ssuB, aliphatic sulfonates transport ATP 3e-04
PRK14270251 PRK14270, PRK14270, phosphate ABC transporter ATP- 3e-04
PRK14262250 PRK14262, PRK14262, phosphate ABC transporter ATP- 3e-04
PRK11153 343 PRK11153, metN, DL-methionine transporter ATP-bind 3e-04
cd03259 213 cd03259, ABC_Carb_Solutes_like, ATP-binding casset 4e-04
COG1135 339 COG1135, AbcC, ABC-type metal ion transport system 4e-04
COG0444 316 COG0444, DppD, ABC-type dipeptide/oligopeptide/nic 4e-04
TIGR02211 221 TIGR02211, LolD_lipo_ex, lipoprotein releasing sys 4e-04
TIGR01166190 TIGR01166, cbiO, cobalt transport protein ATP-bind 4e-04
PRK13633280 PRK13633, PRK13633, cobalt transporter ATP-binding 4e-04
COG0411250 COG0411, LivG, ABC-type branched-chain amino acid 4e-04
TIGR03873256 TIGR03873, F420-0_ABC_ATP, proposed F420-0 ABC tra 4e-04
COG3839 338 COG3839, MalK, ABC-type sugar transport systems, A 5e-04
COG1126 240 COG1126, GlnQ, ABC-type polar amino acid transport 5e-04
PRK15064530 PRK15064, PRK15064, ABC transporter ATP-binding pr 5e-04
TIGR01189198 TIGR01189, ccmA, heme ABC exporter, ATP-binding pr 5e-04
TIGR01192 585 TIGR01192, chvA, glucan exporter ATP-binding prote 6e-04
COG1136 226 COG1136, SalX, ABC-type antimicrobial peptide tran 6e-04
TIGR03005 252 TIGR03005, ectoine_ehuA, ectoine/hydroxyectoine AB 6e-04
TIGR01188302 TIGR01188, drrA, daunorubicin resistance ABC trans 6e-04
PRK09544251 PRK09544, znuC, high-affinity zinc transporter ATP 6e-04
cd03261 235 cd03261, ABC_Org_Solvent_Resistant, ATP-binding ca 7e-04
COG4615 546 COG4615, PvdE, ABC-type siderophore export system, 7e-04
COG4598256 COG4598, HisP, ABC-type histidine transport system 7e-04
cd03269 210 cd03269, ABC_putative_ATPase, ATP-binding cassette 7e-04
TIGR01187325 TIGR01187, potA, spermidine/putrescine ABC transpo 7e-04
COG4559 259 COG4559, COG4559, ABC-type hemin transport system, 8e-04
PRK10938 490 PRK10938, PRK10938, putative molybdenum transport 9e-04
PTZ002431560 PTZ00243, PTZ00243, ABC transporter; Provisional 0.001
TIGR01842 544 TIGR01842, type_I_sec_PrtD, type I secretion syste 0.001
COG4619 223 COG4619, COG4619, ABC-type uncharacterized transpo 0.001
cd03295 242 cd03295, ABC_OpuCA_Osmoprotection, ATP-binding cas 0.001
COG3845501 COG3845, COG3845, ABC-type uncharacterized transpo 0.001
TIGR02315243 TIGR02315, ABC_phnC, phosphonate ABC transporter, 0.001
PRK13539207 PRK13539, PRK13539, cytochrome c biogenesis protei 0.001
TIGR03258362 TIGR03258, PhnT, 2-aminoethylphosphonate ABC trans 0.001
PRK14266250 PRK14266, PRK14266, phosphate ABC transporter ATP- 0.001
cd03266 218 cd03266, ABC_NatA_sodium_exporter, ATP-binding cas 0.001
COG4181 228 COG4181, COG4181, Predicted ABC-type transport sys 0.001
PRK14260259 PRK14260, PRK14260, phosphate ABC transporter ATP- 0.001
COG4133 209 COG4133, CcmA, ABC-type transport system involved 0.001
COG2401593 COG2401, COG2401, ABC-type ATPase fused to a predi 0.001
PRK13650279 PRK13650, cbiO, cobalt transporter ATP-binding sub 0.001
cd11383 140 cd11383, YfjP, YfjP GTPase 0.001
TIGR01257 2272 TIGR01257, rim_protein, retinal-specific rim ABC t 0.001
COG0488530 COG0488, Uup, ATPase components of ABC transporter 0.002
cd03260 227 cd03260, ABC_PstB_phosphate_transporter, ATP-bindi 0.002
cd03223 166 cd03223, ABCD_peroxisomal_ALDP, ATP-binding casset 0.002
PRK13643288 PRK13643, cbiO, cobalt transporter ATP-binding sub 0.002
PRK14261253 PRK14261, PRK14261, phosphate ABC transporter ATP- 0.002
pfam01926117 pfam01926, MMR_HSR1, 50S ribosome-binding GTPase 0.002
PRK11432351 PRK11432, fbpC, ferric transporter ATP-binding sub 0.002
PRK14239252 PRK14239, PRK14239, phosphate transporter ATP-bind 0.002
PRK11147 635 PRK11147, PRK11147, ABC transporter ATPase compone 0.002
cd03265220 cd03265, ABC_DrrA, Daunorubicin/doxorubicin resist 0.002
PRK13641287 PRK13641, cbiO, cobalt transporter ATP-binding sub 0.002
PRK13651 305 PRK13651, PRK13651, cobalt transporter ATP-binding 0.003
PTZ00265 1466 PTZ00265, PTZ00265, multidrug resistance protein ( 0.003
COG4181228 COG4181, COG4181, Predicted ABC-type transport sys 0.003
PRK14254285 PRK14254, PRK14254, phosphate ABC transporter ATP- 0.003
PRK14274259 PRK14274, PRK14274, phosphate ABC transporter ATP- 0.003
PRK14268258 PRK14268, PRK14268, phosphate ABC transporter ATP- 0.003
PRK11629233 PRK11629, lolD, lipoprotein transporter ATP-bindin 0.003
TIGR01184230 TIGR01184, ntrCD, nitrate transport ATP-binding su 0.003
PRK09984262 PRK09984, PRK09984, phosphonate/organophosphate es 0.003
cd03263 220 cd03263, ABC_subfamily_A, ATP-binding cassette dom 0.004
PRK14272252 PRK14272, PRK14272, phosphate ABC transporter ATP- 0.004
COG3596 296 COG3596, COG3596, Predicted GTPase [General functi 0.004
cd03268208 cd03268, ABC_BcrA_bacitracin_resist, ATP-binding c 0.004
>gnl|CDD|215595 PLN03130, PLN03130, ABC transporter C family member; Provisional Back     alignment and domain information 
 Score = 2483 bits (6438), Expect = 0.0
 Identities = 1008/1300 (77%), Positives = 1113/1300 (85%), Gaps = 31/1300 (2%)

Query: 27   MASGPLDWYCRPVANGTWAKTVDSTFGAYTTCAVDSLVISISHSVLLGLCIFRIWLMNKN 86
            M   PLDWYCRPV NG WAK VD+ FGAYT CA DSLVI+ISH VLLGLC++RIWL+ K+
Sbjct: 1    MGFEPLDWYCRPVPNGVWAKKVDNAFGAYTPCATDSLVINISHLVLLGLCLYRIWLIKKD 60

Query: 87   SKARRYRLSSNCYNYMLGLLACYCTAEPLLRLVMGISIFNLDGETSFAPFEMVSLIIEAL 146
             K +R+ L S  YNY L LLA YCTAEPL RLVMGIS+ NLDG+TS  PFE+VSLI+EAL
Sbjct: 61   HKVQRFCLRSKWYNYFLALLAAYCTAEPLFRLVMGISVLNLDGQTSLPPFEIVSLIVEAL 120

Query: 147  AWCSMLIMICLETKFYIREFRWYVRFGVIYVLVGDAVILNLIIPMRDYYSRITLYLYISM 206
             WCSML+MI +ETK YIREFRWYVRF VIYVLVGDAV+LNL++ +++YYS   LYLYIS 
Sbjct: 121  TWCSMLVMIGVETKIYIREFRWYVRFAVIYVLVGDAVMLNLVLSVKEYYSSFVLYLYISE 180

Query: 207  VFCQALFGILILVYIPNLDPYPGYTIMQPEFVDNAEYEALPGGEHVCPERNASILSRTSF 266
            V  Q LFGIL+LVY PNLDPYPGYT +  E VD+ EYE LPGGE +CPER+A+I SR  F
Sbjct: 181  VAAQVLFGILLLVYFPNLDPYPGYTPIGSESVDDYEYEELPGGEQICPERHANIFSRIFF 240

Query: 267  GWMTPLLQLGYKKPITEKDVWKLDTWDQTEILIEKFHRCWIEESQRSKPWLLRALNNSFG 326
            GWMTPL+QLGYK+P+TEKDVWKLDTWDQTE L   F +CW EE ++ KPWLLRALNNS G
Sbjct: 241  GWMTPLMQLGYKRPLTEKDVWKLDTWDQTETLYRSFQKCWDEELKKPKPWLLRALNNSLG 300

Query: 327  GRFWLGGLFKIGNDLSQFVGPVLLNHLLQSMQRGDPAWIGYIYAFLIFVGVSFGVLTEAQ 386
            GRFWLGG FKIGNDLSQFVGP+LLN LL+SMQ G+PAWIGYIYAF IFVGV  GVL EAQ
Sbjct: 301  GRFWLGGFFKIGNDLSQFVGPLLLNLLLESMQNGEPAWIGYIYAFSIFVGVVLGVLCEAQ 360

Query: 387  YFQNVWRVGFRLRSTLVAAIFRKTLRLTHEARKGFPSGKVTNMITTDANALQQISQQLHG 446
            YFQNV RVGFRLRSTLVAA+FRK+LRLTHE RK F SGK+TN++TTDA ALQQI QQLH 
Sbjct: 361  YFQNVMRVGFRLRSTLVAAVFRKSLRLTHEGRKKFTSGKITNLMTTDAEALQQICQQLHT 420

Query: 447  LWSAPFRITLSMVLLYQQLGVASLLGSLMLVLMVPLQTFIISKMRKLTKEGLQWTDRRVS 506
            LWSAPFRI ++MVLLYQQLGVASL+GSLMLVLM P+QTFIISKM+KLTKEGLQ TD+R+ 
Sbjct: 421  LWSAPFRIIIAMVLLYQQLGVASLIGSLMLVLMFPIQTFIISKMQKLTKEGLQRTDKRIG 480

Query: 507  LTNEILAAMDTVKCYAWEKSFQSRVQSIRDDELSWFRKAQFLSAFNSFILNSIPVVVTVV 566
            L NE+LAAMDTVKCYAWE SFQS+VQ++RDDELSWFRKAQ LSAFNSFILNSIPV+VTVV
Sbjct: 481  LMNEVLAAMDTVKCYAWENSFQSKVQTVRDDELSWFRKAQLLSAFNSFILNSIPVLVTVV 540

Query: 567  SFGTFTLLGGDLTPARAFTSLSLFAVLRFPLNMLPNLLSQVVNANVSLQRLEELLLAEER 626
            SFG FTLLGGDLTPARAFTSLSLFAVLRFPL MLPNL++Q VNANVSL+RLEELLLAEER
Sbjct: 541  SFGVFTLLGGDLTPARAFTSLSLFAVLRFPLFMLPNLITQAVNANVSLKRLEELLLAEER 600

Query: 627  ILMPNPPLEPELPAVSIKNGNFSWDSKS--PTLSNINLDIPVGSLVAIVGGTGEGKTSLV 684
            +L+PNPPLEP LPA+SIKNG FSWDSK+  PTLSNINLD+PVGSLVAIVG TGEGKTSL+
Sbjct: 601  VLLPNPPLEPGLPAISIKNGYFSWDSKAERPTLSNINLDVPVGSLVAIVGSTGEGKTSLI 660

Query: 685  SAMLGELPPLKDASVVIRGTVAYVPQISWIFNATLRKNILFGSEFDPAKYWKTVDVSALQ 744
            SAMLGELPP  DASVVIRGTVAYVPQ+SWIFNAT+R NILFGS FDP +Y + +DV+ALQ
Sbjct: 661  SAMLGELPPRSDASVVIRGTVAYVPQVSWIFNATVRDNILFGSPFDPERYERAIDVTALQ 720

Query: 745  HDLDLLPDRDLTEIGERGVNISGGQKQRVSMARA------------------------VF 780
            HDLDLLP  DLTEIGERGVNISGGQKQRVSMARA                        VF
Sbjct: 721  HDLDLLPGGDLTEIGERGVNISGGQKQRVSMARAVYSNSDVYIFDDPLSALDAHVGRQVF 780

Query: 781  NSCIKEELRGKTRILVTNQLHFLPHVDRIILVSEGMIKEEGSFEELSKHGRLFQKLMENA 840
            + CIK+ELRGKTR+LVTNQLHFL  VDRIILV EGMIKEEG++EELS +G LFQKLMENA
Sbjct: 781  DKCIKDELRGKTRVLVTNQLHFLSQVDRIILVHEGMIKEEGTYEELSNNGPLFQKLMENA 840

Query: 841  GKMEEMEEREEKDDSINSNQEVSKPVANRAVQVNEFPKNESYTKKGKRGRSVLVKQEERE 900
            GKMEE  E          +Q  SKPVAN     N   K+ S  KK K G+SVL+KQEERE
Sbjct: 841  GKMEEYVEEN---GEEEDDQTSSKPVANG--NANNLKKDSSSKKKSKEGKSVLIKQEERE 895

Query: 901  TGIVSGSVLTRYKNALGGPWVIMILFACYLSTEVLRISSSTWLSFWTDQSTSKNYNPGFY 960
            TG+VS  VL RYKNALGG WV+MILF CY+ TEV R+SSSTWLS WTDQ T K + P FY
Sbjct: 896  TGVVSWKVLERYKNALGGAWVVMILFLCYVLTEVFRVSSSTWLSEWTDQGTPKTHGPLFY 955

Query: 961  IAIYTILAFGQVTVTLLNSYWLIISSLRAAKRLHDSMLNSILRAPMLFFHTNPIGRVINR 1020
              IY +L+FGQV VTLLNSYWLI+SSL AAKRLHD+ML SILRAPM FFHTNP+GR+INR
Sbjct: 956  NLIYALLSFGQVLVTLLNSYWLIMSSLYAAKRLHDAMLGSILRAPMSFFHTNPLGRIINR 1015

Query: 1021 FSRDLGDIDRNVASFVNMFMNQLWQLLSTFVLIGIVSTISLWAIMPLLILFYAAYLYYQS 1080
            F++DLGDIDRNVA FVNMF+ Q++QLLSTFVLIGIVSTISLWAIMPLL+LFY AYLYYQS
Sbjct: 1016 FAKDLGDIDRNVAVFVNMFLGQIFQLLSTFVLIGIVSTISLWAIMPLLVLFYGAYLYYQS 1075

Query: 1081 TAREVKRLDSITRSPVYAQFGEALNGLSTIRAFKAYDRMAKINGKSMDNNIRFTLANTSS 1140
            TAREVKRLDSITRSPVYAQFGEALNGLSTIRA+KAYDRMA+ING+SMDNNIRFTL N SS
Sbjct: 1076 TAREVKRLDSITRSPVYAQFGEALNGLSTIRAYKAYDRMAEINGRSMDNNIRFTLVNMSS 1135

Query: 1141 NRWLTIRLETLGGIMIWLIATFAVMQNGRAENQVAFASTMGLLLSYTLNITNLLSGVLRQ 1200
            NRWL IRLETLGG+MIWL A+FAVMQNGRAENQ AFASTMGLLLSY LNIT+LL+ VLR 
Sbjct: 1136 NRWLAIRLETLGGLMIWLTASFAVMQNGRAENQAAFASTMGLLLSYALNITSLLTAVLRL 1195

Query: 1201 ASRAENSLNAVERVGTYIDLPSEAPGMVESNRPPPAWPSSGSIKFEDVVLRYRPELPPVL 1260
            AS AENSLNAVERVGTYIDLPSEAP ++E+NRPPP WPSSGSIKFEDVVLRYRPELPPVL
Sbjct: 1196 ASLAENSLNAVERVGTYIDLPSEAPLVIENNRPPPGWPSSGSIKFEDVVLRYRPELPPVL 1255

Query: 1261 HGLSFTVSPSEKVGIVGRTGAGKSSMLNALFRIVELERGE 1300
            HGLSF +SPSEKVGIVGRTGAGKSSMLNALFRIVELERG 
Sbjct: 1256 HGLSFEISPSEKVGIVGRTGAGKSSMLNALFRIVELERGR 1295

Length = 1622
>gnl|CDD|215640 PLN03232, PLN03232, ABC transporter C family member; Provisional Back     alignment and domain information
>gnl|CDD|188098 TIGR00957, MRP_assoc_pro, multi drug resistance-associated protein (MRP) Back     alignment and domain information
>gnl|CDD|240327 PTZ00243, PTZ00243, ABC transporter; Provisional Back     alignment and domain information
>gnl|CDD|213217 cd03250, ABCC_MRP_domain1, ATP-binding cassette domain 1 of multidrug resistance-associated protein, subfamily C Back     alignment and domain information
>gnl|CDD|233335 TIGR01271, CFTR_protein, cystic fibrosis transmembrane conductor regulator (CFTR) Back     alignment and domain information
>gnl|CDD|224055 COG1132, MdlB, ABC-type multidrug transport system, ATPase and permease components [Defense mechanisms] Back     alignment and domain information
>gnl|CDD|225183 COG2274, SunT, ABC-type bacteriocin/lantibiotic exporters, contain an N-terminal double-glycine peptidase domain [Defense mechanisms] Back     alignment and domain information
>gnl|CDD|213257 cd03290, ABCC_SUR1_N, ATP-binding cassette domain of the sulfonylurea receptor, subfamily C Back     alignment and domain information
>gnl|CDD|227321 COG4988, CydD, ABC-type transport system involved in cytochrome bd biosynthesis, ATPase and permease components [Energy production and conversion / Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|233335 TIGR01271, CFTR_protein, cystic fibrosis transmembrane conductor regulator (CFTR) Back     alignment and domain information
>gnl|CDD|224055 COG1132, MdlB, ABC-type multidrug transport system, ATPase and permease components [Defense mechanisms] Back     alignment and domain information
>gnl|CDD|213258 cd03291, ABCC_CFTR1, ATP-binding cassette domain of the cystic fibrosis transmembrane regulator, subfamily C Back     alignment and domain information
>gnl|CDD|234033 TIGR02857, CydD, thiol reductant ABC exporter, CydD subunit Back     alignment and domain information
>gnl|CDD|240327 PTZ00243, PTZ00243, ABC transporter; Provisional Back     alignment and domain information
>gnl|CDD|227320 COG4987, CydC, ABC-type transport system involved in cytochrome bd biosynthesis, fused ATPase and permease components [Energy production and conversion / Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|213221 cd03254, ABCC_Glucan_exporter_like, ATP-binding cassette domain of glucan transporter and related proteins, subfamily C Back     alignment and domain information
>gnl|CDD|216049 pfam00664, ABC_membrane, ABC transporter transmembrane region Back     alignment and domain information
>gnl|CDD|131259 TIGR02204, MsbA_rel, ABC transporter, permease/ATP-binding protein Back     alignment and domain information
>gnl|CDD|234189 TIGR03375, type_I_sec_LssB, type I secretion system ATPase, LssB family Back     alignment and domain information
>gnl|CDD|130261 TIGR01193, bacteriocin_ABC, ABC-type bacteriocin transporter Back     alignment and domain information
>gnl|CDD|200134 TIGR01842, type_I_sec_PrtD, type I secretion system ABC transporter, PrtD family Back     alignment and domain information
>gnl|CDD|213218 cd03251, ABCC_MsbA, ATP-binding cassette domain of the bacterial lipid flippase and related proteins, subfamily C Back     alignment and domain information
>gnl|CDD|213195 cd03228, ABCC_MRP_Like, ATP-binding cassette domain of multidrug resistance protein-like transporters Back     alignment and domain information
>gnl|CDD|131258 TIGR02203, MsbA_lipidA, lipid A export permease/ATP-binding protein MsbA Back     alignment and domain information
>gnl|CDD|226969 COG4618, ArpD, ABC-type protease/lipase transport system, ATPase and permease components [General function prediction only] Back     alignment and domain information
>gnl|CDD|213211 cd03244, ABCC_MRP_domain2, ATP-binding cassette domain 2 of multidrug resistance-associated protein Back     alignment and domain information
>gnl|CDD|213220 cd03253, ABCC_ATM1_transporter, ATP-binding cassette domain of iron-sulfur clusters transporter, subfamily C Back     alignment and domain information
>gnl|CDD|213212 cd03245, ABCC_bacteriocin_exporters, ATP-binding cassette domain of bacteriocin exporters, subfamily C Back     alignment and domain information
>gnl|CDD|236870 PRK11174, PRK11174, cysteine/glutathione ABC transporter membrane/ATP-binding component; Reviewed Back     alignment and domain information
>gnl|CDD|234041 TIGR02868, CydC, thiol reductant ABC exporter, CydC subunit Back     alignment and domain information
>gnl|CDD|216049 pfam00664, ABC_membrane, ABC transporter transmembrane region Back     alignment and domain information
>gnl|CDD|213216 cd03249, ABC_MTABC3_MDL1_MDL2, ATP-binding cassette domain of a mitochondrial protein MTABC3 and related proteins Back     alignment and domain information
>gnl|CDD|225183 COG2274, SunT, ABC-type bacteriocin/lantibiotic exporters, contain an N-terminal double-glycine peptidase domain [Defense mechanisms] Back     alignment and domain information
>gnl|CDD|233596 TIGR01846, type_I_sec_HlyB, type I secretion system ABC transporter, HlyB family Back     alignment and domain information
>gnl|CDD|213269 cd03369, ABCC_NFT1, ATP-binding cassette domain 2 of NFT1, subfamily C Back     alignment and domain information
>gnl|CDD|213211 cd03244, ABCC_MRP_domain2, ATP-binding cassette domain 2 of multidrug resistance-associated protein Back     alignment and domain information
>gnl|CDD|236865 PRK11160, PRK11160, cysteine/glutathione ABC transporter membrane/ATP-binding component; Reviewed Back     alignment and domain information
>gnl|CDD|130260 TIGR01192, chvA, glucan exporter ATP-binding protein Back     alignment and domain information
>gnl|CDD|234357 TIGR03797, NHLM_micro_ABC2, NHLM bacteriocin system ABC transporter, ATP-binding protein Back     alignment and domain information
>gnl|CDD|213219 cd03252, ABCC_Hemolysin, ATP-binding cassette domain of hemolysin B, subfamily C Back     alignment and domain information
>gnl|CDD|227590 COG5265, ATM1, ABC-type transport system involved in Fe-S cluster assembly, permease and ATPase components [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|183016 PRK11176, PRK11176, lipid transporter ATP-binding/permease protein; Provisional Back     alignment and domain information
>gnl|CDD|182733 PRK10790, PRK10790, putative multidrug transporter membrane\ATP-binding components; Provisional Back     alignment and domain information
>gnl|CDD|213192 cd03225, ABC_cobalt_CbiO_domain1, First domain of the ATP-binding cassette component of cobalt transport system Back     alignment and domain information
>gnl|CDD|233209 TIGR00958, 3a01208, Conjugate Transporter-2 (CT2) Family protein Back     alignment and domain information
>gnl|CDD|131258 TIGR02203, MsbA_lipidA, lipid A export permease/ATP-binding protein MsbA Back     alignment and domain information
>gnl|CDD|184214 PRK13657, PRK13657, cyclic beta-1,2-glucan ABC transporter; Provisional Back     alignment and domain information
>gnl|CDD|163508 TIGR03796, NHLM_micro_ABC1, NHLM bacteriocin system ABC transporter, peptidase/ATP-binding protein Back     alignment and domain information
>gnl|CDD|233209 TIGR00958, 3a01208, Conjugate Transporter-2 (CT2) Family protein Back     alignment and domain information
>gnl|CDD|213213 cd03246, ABCC_Protease_Secretion, ATP-binding cassette domain of PrtD, subfamily C Back     alignment and domain information
>gnl|CDD|224054 COG1131, CcmA, ABC-type multidrug transport system, ATPase component [Defense mechanisms] Back     alignment and domain information
>gnl|CDD|224046 COG1121, ZnuC, ABC-type Mn/Zn transport systems, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|224047 COG1122, CbiO, ABC-type cobalt transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|213214 cd03247, ABCC_cytochrome_bd, ATP-binding cassette domain of CydCD, subfamily C Back     alignment and domain information
>gnl|CDD|213202 cd03235, ABC_Metallic_Cations, ATP-binding cassette domain of the metal-type transporters Back     alignment and domain information
>gnl|CDD|234189 TIGR03375, type_I_sec_LssB, type I secretion system ATPase, LssB family Back     alignment and domain information
>gnl|CDD|213228 cd03261, ABC_Org_Solvent_Resistant, ATP-binding cassette transport system involved in resistant to organic solvents Back     alignment and domain information
>gnl|CDD|130041 TIGR00968, 3a0106s01, sulfate ABC transporter, ATP-binding protein Back     alignment and domain information
>gnl|CDD|213195 cd03228, ABCC_MRP_Like, ATP-binding cassette domain of multidrug resistance protein-like transporters Back     alignment and domain information
>gnl|CDD|131259 TIGR02204, MsbA_rel, ABC transporter, permease/ATP-binding protein Back     alignment and domain information
>gnl|CDD|224045 COG1120, FepC, ABC-type cobalamin/Fe3+-siderophores transport systems, ATPase components [Inorganic ion transport and metabolism / Coenzyme metabolism] Back     alignment and domain information
>gnl|CDD|227321 COG4988, CydD, ABC-type transport system involved in cytochrome bd biosynthesis, ATPase and permease components [Energy production and conversion / Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|224052 COG1127, Ttg2A, ABC-type transport system involved in resistance to organic solvents, ATPase component [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>gnl|CDD|234199 TIGR03410, urea_trans_UrtE, urea ABC transporter, ATP-binding protein UrtE Back     alignment and domain information
>gnl|CDD|130261 TIGR01193, bacteriocin_ABC, ABC-type bacteriocin transporter Back     alignment and domain information
>gnl|CDD|213215 cd03248, ABCC_TAP, ATP-binding cassette domain of the Transporter Associated with Antigen Processing, subfamily C Back     alignment and domain information
>gnl|CDD|182732 PRK10789, PRK10789, putative multidrug transporter membrane\ATP-binding components; Provisional Back     alignment and domain information
>gnl|CDD|213191 cd03224, ABC_TM1139_LivF_branched, ATP-binding cassette domain of branched-chain amino acid transporter Back     alignment and domain information
>gnl|CDD|234033 TIGR02857, CydD, thiol reductant ABC exporter, CydD subunit Back     alignment and domain information
>gnl|CDD|227320 COG4987, CydC, ABC-type transport system involved in cytochrome bd biosynthesis, fused ATPase and permease components [Energy production and conversion / Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|233596 TIGR01846, type_I_sec_HlyB, type I secretion system ABC transporter, HlyB family Back     alignment and domain information
>gnl|CDD|213263 cd03296, ABC_CysA_sulfate_importer, ATP-binding cassette domain of the sulfate transporter Back     alignment and domain information
>gnl|CDD|213193 cd03226, ABC_cobalt_CbiO_domain2, Second domain of the ATP-binding cassette component of cobalt transport system Back     alignment and domain information
>gnl|CDD|226968 COG4615, PvdE, ABC-type siderophore export system, fused ATPase and permease components [Secondary metabolites biosynthesis, transport, and catabolism / Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|227590 COG5265, ATM1, ABC-type transport system involved in Fe-S cluster assembly, permease and ATPase components [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|213181 cd03214, ABC_Iron-Siderophores_B12_Hemin, ATP-binding component of iron-siderophores, vitamin B12 and hemin transporters and related proteins Back     alignment and domain information
>gnl|CDD|182733 PRK10790, PRK10790, putative multidrug transporter membrane\ATP-binding components; Provisional Back     alignment and domain information
>gnl|CDD|224059 COG1136, SalX, ABC-type antimicrobial peptide transport system, ATPase component [Defense mechanisms] Back     alignment and domain information
>gnl|CDD|213179 cd00267, ABC_ATPase, ATP-binding cassette transporter nucleotide-binding domain Back     alignment and domain information
>gnl|CDD|223487 COG0410, LivF, ABC-type branched-chain amino acid transport systems, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|215640 PLN03232, PLN03232, ABC transporter C family member; Provisional Back     alignment and domain information
>gnl|CDD|213226 cd03259, ABC_Carb_Solutes_like, ATP-binding cassette domain of the carbohydrate and solute transporters-like Back     alignment and domain information
>gnl|CDD|226361 COG3842, PotA, ABC-type spermidine/putrescine transport systems, ATPase components [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|188098 TIGR00957, MRP_assoc_pro, multi drug resistance-associated protein (MRP) Back     alignment and domain information
>gnl|CDD|213221 cd03254, ABCC_Glucan_exporter_like, ATP-binding cassette domain of glucan transporter and related proteins, subfamily C Back     alignment and domain information
>gnl|CDD|234041 TIGR02868, CydC, thiol reductant ABC exporter, CydC subunit Back     alignment and domain information
>gnl|CDD|237452 PRK13632, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|213269 cd03369, ABCC_NFT1, ATP-binding cassette domain 2 of NFT1, subfamily C Back     alignment and domain information
>gnl|CDD|226359 COG3839, MalK, ABC-type sugar transport systems, ATPase components [Carbohydrate transport and metabolism] Back     alignment and domain information
>gnl|CDD|234357 TIGR03797, NHLM_micro_ABC2, NHLM bacteriocin system ABC transporter, ATP-binding protein Back     alignment and domain information
>gnl|CDD|213260 cd03293, ABC_NrtD_SsuB_transporters, ATP-binding cassette domain of the nitrate and sulfonate transporters Back     alignment and domain information
>gnl|CDD|213225 cd03258, ABC_MetN_methionine_transporter, ATP-binding cassette domain of methionine transporter Back     alignment and domain information
>gnl|CDD|223562 COG0488, Uup, ATPase components of ABC transporters with duplicated ATPase domains [General function prediction only] Back     alignment and domain information
>gnl|CDD|213268 cd03301, ABC_MalK_N, The N-terminal ATPase domain of the maltose transporter, MalK Back     alignment and domain information
>gnl|CDD|213255 cd03288, ABCC_SUR2, ATP-binding cassette domain 2 of the sulfonylurea receptor SUR Back     alignment and domain information
>gnl|CDD|224051 COG1126, GlnQ, ABC-type polar amino acid transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|224041 COG1116, TauB, ABC-type nitrate/sulfonate/bicarbonate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|213218 cd03251, ABCC_MsbA, ATP-binding cassette domain of the bacterial lipid flippase and related proteins, subfamily C Back     alignment and domain information
>gnl|CDD|213212 cd03245, ABCC_bacteriocin_exporters, ATP-binding cassette domain of bacteriocin exporters, subfamily C Back     alignment and domain information
>gnl|CDD|213219 cd03252, ABCC_Hemolysin, ATP-binding cassette domain of hemolysin B, subfamily C Back     alignment and domain information
>gnl|CDD|213222 cd03255, ABC_MJ0796_LolCDE_FtsE, ATP-binding cassette domain of the transporters involved in export of lipoprotein and macrolide, and cell division protein Back     alignment and domain information
>gnl|CDD|224043 COG1118, CysA, ABC-type sulfate/molybdate transport systems, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|215595 PLN03130, PLN03130, ABC transporter C family member; Provisional Back     alignment and domain information
>gnl|CDD|213220 cd03253, ABCC_ATM1_transporter, ATP-binding cassette domain of iron-sulfur clusters transporter, subfamily C Back     alignment and domain information
>gnl|CDD|213196 cd03229, ABC_Class3, ATP-binding cassette domain of the binding protein-dependent transport systems Back     alignment and domain information
>gnl|CDD|213197 cd03230, ABC_DR_subfamily_A, ATP-binding cassette domain of the drug resistance transporter and related proteins, subfamily A Back     alignment and domain information
>gnl|CDD|236707 PRK10522, PRK10522, multidrug transporter membrane component/ATP-binding component; Provisional Back     alignment and domain information
>gnl|CDD|236554 PRK09536, btuD, corrinoid ABC transporter ATPase; Reviewed Back     alignment and domain information
>gnl|CDD|213256 cd03289, ABCC_CFTR2, ATP-binding cassette domain 2 of CFTR,subfamily C Back     alignment and domain information
>gnl|CDD|132027 TIGR02982, heterocyst_DevA, ABC exporter ATP-binding subunit, DevA family Back     alignment and domain information
>gnl|CDD|163483 TIGR03771, anch_rpt_ABC, anchored repeat-type ABC transporter, ATP-binding subunit Back     alignment and domain information
>gnl|CDD|226164 COG3638, COG3638, ABC-type phosphate/phosphonate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|106587 PRK13644, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|236865 PRK11160, PRK11160, cysteine/glutathione ABC transporter membrane/ATP-binding component; Reviewed Back     alignment and domain information
>gnl|CDD|213179 cd00267, ABC_ATPase, ATP-binding cassette transporter nucleotide-binding domain Back     alignment and domain information
>gnl|CDD|213264 cd03297, ABC_ModC_molybdenum_transporter, ATP-binding cassette domain of the molybdenum transport system Back     alignment and domain information
>gnl|CDD|224048 COG1123, COG1123, ATPase components of various ABC-type transport systems, contain duplicated ATPase [General function prediction only] Back     alignment and domain information
>gnl|CDD|213224 cd03257, ABC_NikE_OppD_transporters, ATP-binding cassette domain of nickel/oligopeptides specific transporters Back     alignment and domain information
>gnl|CDD|213188 cd03221, ABCF_EF-3, ATP-binding cassette domain of elongation factor 3, subfamily F Back     alignment and domain information
>gnl|CDD|224058 COG1135, AbcC, ABC-type metal ion transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|213192 cd03225, ABC_cobalt_CbiO_domain1, First domain of the ATP-binding cassette component of cobalt transport system Back     alignment and domain information
>gnl|CDD|213256 cd03289, ABCC_CFTR2, ATP-binding cassette domain 2 of CFTR,subfamily C Back     alignment and domain information
>gnl|CDD|226628 COG4148, ModC, ABC-type molybdate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|224049 COG1124, DppF, ABC-type dipeptide/oligopeptide/nickel transport system, ATPase component [Amino acid transport and metabolism / Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|213217 cd03250, ABCC_MRP_domain1, ATP-binding cassette domain 1 of multidrug resistance-associated protein, subfamily C Back     alignment and domain information
>gnl|CDD|236523 PRK09452, potA, putrescine/spermidine ABC transporter ATPase protein; Reviewed Back     alignment and domain information
>gnl|CDD|225438 COG2884, FtsE, Predicted ATPase involved in cell division [Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|213227 cd03260, ABC_PstB_phosphate_transporter, ATP-binding cassette domain of the phosphate transport system Back     alignment and domain information
>gnl|CDD|181906 PRK09493, glnQ, glutamine ABC transporter ATP-binding protein; Reviewed Back     alignment and domain information
>gnl|CDD|213216 cd03249, ABC_MTABC3_MDL1_MDL2, ATP-binding cassette domain of a mitochondrial protein MTABC3 and related proteins Back     alignment and domain information
>gnl|CDD|182778 PRK10851, PRK10851, sulfate/thiosulfate transporter subunit; Provisional Back     alignment and domain information
>gnl|CDD|226970 COG4619, COG4619, ABC-type uncharacterized transport system, ATPase component [General function prediction only] Back     alignment and domain information
>gnl|CDD|184214 PRK13657, PRK13657, cyclic beta-1,2-glucan ABC transporter; Provisional Back     alignment and domain information
>gnl|CDD|163508 TIGR03796, NHLM_micro_ABC1, NHLM bacteriocin system ABC transporter, peptidase/ATP-binding protein Back     alignment and domain information
>gnl|CDD|213214 cd03247, ABCC_cytochrome_bd, ATP-binding cassette domain of CydCD, subfamily C Back     alignment and domain information
>gnl|CDD|213201 cd03234, ABCG_White, White pigment protein homolog of ABCG transporter subfamily Back     alignment and domain information
>gnl|CDD|213229 cd03262, ABC_HisP_GlnQ, ATP-binding cassette domain of the histidine and glutamine transporters Back     alignment and domain information
>gnl|CDD|213215 cd03248, ABCC_TAP, ATP-binding cassette domain of the Transporter Associated with Antigen Processing, subfamily C Back     alignment and domain information
>gnl|CDD|213181 cd03214, ABC_Iron-Siderophores_B12_Hemin, ATP-binding component of iron-siderophores, vitamin B12 and hemin transporters and related proteins Back     alignment and domain information
>gnl|CDD|226635 COG4161, ArtP, ABC-type arginine transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|213213 cd03246, ABCC_Protease_Secretion, ATP-binding cassette domain of PrtD, subfamily C Back     alignment and domain information
>gnl|CDD|233206 TIGR00954, 3a01203, Peroxysomal Fatty Acyl CoA Transporter (FAT) Family protei Back     alignment and domain information
>gnl|CDD|131197 TIGR02142, modC_ABC, molybdenum ABC transporter, ATP-binding protein Back     alignment and domain information
>gnl|CDD|185016 PRK15056, PRK15056, manganese/iron transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|213191 cd03224, ABC_TM1139_LivF_branched, ATP-binding cassette domain of branched-chain amino acid transporter Back     alignment and domain information
>gnl|CDD|184210 PRK13651, PRK13651, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|183063 PRK11264, PRK11264, putative amino-acid ABC transporter ATP-binding protein YecC; Provisional Back     alignment and domain information
>gnl|CDD|224057 COG1134, TagH, ABC-type polysaccharide/polyol phosphate transport system, ATPase component [Carbohydrate transport and metabolism / Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>gnl|CDD|213266 cd03299, ABC_ModC_like, ATP-binding cassette domain similar to the molybdate transporter Back     alignment and domain information
>gnl|CDD|224044 COG1119, ModF, ABC-type molybdenum transport system, ATPase component/photorepair protein PhrA [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|130262 TIGR01194, cyc_pep_trnsptr, cyclic peptide transporter Back     alignment and domain information
>gnl|CDD|224042 COG1117, PstB, ABC-type phosphate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|213259 cd03292, ABC_FtsE_transporter, ATP-binding cassette domain of the cell division transporter Back     alignment and domain information
>gnl|CDD|188353 TIGR03608, L_ocin_972_ABC, putative bacteriocin export ABC transporter, lactococcin 972 group Back     alignment and domain information
>gnl|CDD|224046 COG1121, ZnuC, ABC-type Mn/Zn transport systems, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|213223 cd03256, ABC_PhnC_transporter, ATP-binding cassette domain of the binding protein-dependent phosphonate transport system Back     alignment and domain information
>gnl|CDD|233335 TIGR01271, CFTR_protein, cystic fibrosis transmembrane conductor regulator (CFTR) Back     alignment and domain information
>gnl|CDD|224045 COG1120, FepC, ABC-type cobalamin/Fe3+-siderophores transport systems, ATPase components [Inorganic ion transport and metabolism / Coenzyme metabolism] Back     alignment and domain information
>gnl|CDD|223487 COG0410, LivF, ABC-type branched-chain amino acid transport systems, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|184195 PRK13635, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|223521 COG0444, DppD, ABC-type dipeptide/oligopeptide/nickel transport system, ATPase component [Amino acid transport and metabolism / Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|184200 PRK13640, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|213188 cd03221, ABCF_EF-3, ATP-binding cassette domain of elongation factor 3, subfamily F Back     alignment and domain information
>gnl|CDD|224057 COG1134, TagH, ABC-type polysaccharide/polyol phosphate transport system, ATPase component [Carbohydrate transport and metabolism / Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>gnl|CDD|172747 PRK14259, PRK14259, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|213262 cd03295, ABC_OpuCA_Osmoprotection, ATP-binding cassette domain of the osmoprotectant transporter Back     alignment and domain information
>gnl|CDD|182528 PRK10535, PRK10535, macrolide transporter ATP-binding /permease protein; Provisional Back     alignment and domain information
>gnl|CDD|226646 COG4178, COG4178, ABC-type uncharacterized transport system, permease and ATPase components [General function prediction only] Back     alignment and domain information
>gnl|CDD|223562 COG0488, Uup, ATPase components of ABC transporters with duplicated ATPase domains [General function prediction only] Back     alignment and domain information
>gnl|CDD|224166 COG1245, COG1245, Predicted ATPase, RNase L inhibitor (RLI) homolog [General function prediction only] Back     alignment and domain information
>gnl|CDD|213204 cd03237, ABC_RNaseL_inhibitor_domain2, The ATP-binding cassette domain 2 of RNase L inhibitor Back     alignment and domain information
>gnl|CDD|237648 PRK14250, PRK14250, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|213259 cd03292, ABC_FtsE_transporter, ATP-binding cassette domain of the cell division transporter Back     alignment and domain information
>gnl|CDD|182993 PRK11144, modC, molybdate transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|188099 TIGR00972, 3a0107s01c2, phosphate ABC transporter, ATP-binding protein Back     alignment and domain information
>gnl|CDD|182692 PRK10744, pstB, phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|226963 COG4604, CeuD, ABC-type enterochelin transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|237454 PRK13634, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|224048 COG1123, COG1123, ATPase components of various ABC-type transport systems, contain duplicated ATPase [General function prediction only] Back     alignment and domain information
>gnl|CDD|234152 TIGR03265, PhnT2, putative 2-aminoethylphosphonate ABC transporter, ATP-binding protein Back     alignment and domain information
>gnl|CDD|131367 TIGR02314, ABC_MetN, D-methionine ABC transporter, ATP-binding protein Back     alignment and domain information
>gnl|CDD|213222 cd03255, ABC_MJ0796_LolCDE_FtsE, ATP-binding cassette domain of the transporters involved in export of lipoprotein and macrolide, and cell division protein Back     alignment and domain information
>gnl|CDD|233207 TIGR00955, 3a01204, The Eye Pigment Precursor Transporter (EPP) Family protein Back     alignment and domain information
>gnl|CDD|182592 PRK10619, PRK10619, histidine/lysine/arginine/ornithine transporter subunit; Provisional Back     alignment and domain information
>gnl|CDD|213202 cd03235, ABC_Metallic_Cations, ATP-binding cassette domain of the metal-type transporters Back     alignment and domain information
>gnl|CDD|131721 TIGR02673, FtsE, cell division ATP-binding protein FtsE Back     alignment and domain information
>gnl|CDD|237455 PRK13637, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|213180 cd03213, ABCG_EPDR, Eye pigment and drug resistance transporter subfamily G of the ATP-binding cassette superfamily Back     alignment and domain information
>gnl|CDD|213190 cd03223, ABCD_peroxisomal_ALDP, ATP-binding cassette domain of peroxisomal transporter, subfamily D Back     alignment and domain information
>gnl|CDD|183016 PRK11176, PRK11176, lipid transporter ATP-binding/permease protein; Provisional Back     alignment and domain information
>gnl|CDD|224047 COG1122, CbiO, ABC-type cobalt transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|213260 cd03293, ABC_NrtD_SsuB_transporters, ATP-binding cassette domain of the nitrate and sulfonate transporters Back     alignment and domain information
>gnl|CDD|223562 COG0488, Uup, ATPase components of ABC transporters with duplicated ATPase domains [General function prediction only] Back     alignment and domain information
>gnl|CDD|225438 COG2884, FtsE, Predicted ATPase involved in cell division [Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|131721 TIGR02673, FtsE, cell division ATP-binding protein FtsE Back     alignment and domain information
>gnl|CDD|213267 cd03300, ABC_PotA_N, ATP-binding cassette domain of the polyamine transporter Back     alignment and domain information
>gnl|CDD|213230 cd03263, ABC_subfamily_A, ATP-binding cassette domain of the lipid transporters, subfamily A Back     alignment and domain information
>gnl|CDD|183226 PRK11607, potG, putrescine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|224054 COG1131, CcmA, ABC-type multidrug transport system, ATPase component [Defense mechanisms] Back     alignment and domain information
>gnl|CDD|213224 cd03257, ABC_NikE_OppD_transporters, ATP-binding cassette domain of nickel/oligopeptides specific transporters Back     alignment and domain information
>gnl|CDD|224044 COG1119, ModF, ABC-type molybdenum transport system, ATPase component/photorepair protein PhrA [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|213223 cd03256, ABC_PhnC_transporter, ATP-binding cassette domain of the binding protein-dependent phosphonate transport system Back     alignment and domain information
>gnl|CDD|226646 COG4178, COG4178, ABC-type uncharacterized transport system, permease and ATPase components [General function prediction only] Back     alignment and domain information
>gnl|CDD|215650 pfam00005, ABC_tran, ABC transporter Back     alignment and domain information
>gnl|CDD|224060 COG1137, YhbG, ABC-type (unclassified) transport system, ATPase component [General function prediction only] Back     alignment and domain information
>gnl|CDD|213231 cd03264, ABC_drug_resistance_like, ABC-type multidrug transport system, ATPase component Back     alignment and domain information
>gnl|CDD|226927 COG4555, NatA, ABC-type Na+ transport system, ATPase component [Energy production and conversion / Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|213180 cd03213, ABCG_EPDR, Eye pigment and drug resistance transporter subfamily G of the ATP-binding cassette superfamily Back     alignment and domain information
>gnl|CDD|226360 COG3840, ThiQ, ABC-type thiamine transport system, ATPase component [Coenzyme metabolism] Back     alignment and domain information
>gnl|CDD|172732 PRK14244, PRK14244, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|184584 PRK14238, PRK14238, phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|224050 COG1125, OpuBA, ABC-type proline/glycine betaine transport systems, ATPase components [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|240339 PTZ00265, PTZ00265, multidrug resistance protein (mdr1); Provisional Back     alignment and domain information
>gnl|CDD|226929 COG4559, COG4559, ABC-type hemin transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|184207 PRK13648, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|184205 PRK13646, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|182732 PRK10789, PRK10789, putative multidrug transporter membrane\ATP-binding components; Provisional Back     alignment and domain information
>gnl|CDD|237452 PRK13632, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|224041 COG1116, TauB, ABC-type nitrate/sulfonate/bicarbonate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|226164 COG3638, COG3638, ABC-type phosphate/phosphonate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|132050 TIGR03005, ectoine_ehuA, ectoine/hydroxyectoine ABC transporter, ATP-binding protein Back     alignment and domain information
>gnl|CDD|226620 COG4136, COG4136, ABC-type uncharacterized transport system, ATPase component [General function prediction only] Back     alignment and domain information
>gnl|CDD|213197 cd03230, ABC_DR_subfamily_A, ATP-binding cassette domain of the drug resistance transporter and related proteins, subfamily A Back     alignment and domain information
>gnl|CDD|224048 COG1123, COG1123, ATPase components of various ABC-type transport systems, contain duplicated ATPase [General function prediction only] Back     alignment and domain information
>gnl|CDD|226364 COG3845, COG3845, ABC-type uncharacterized transport systems, ATPase components [General function prediction only] Back     alignment and domain information
>gnl|CDD|184590 PRK14249, PRK14249, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|224053 COG1129, MglA, ABC-type sugar transport system, ATPase component [Carbohydrate transport and metabolism] Back     alignment and domain information
>gnl|CDD|183056 PRK11248, tauB, taurine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|213186 cd03219, ABC_Mj1267_LivG_branched, ATP-binding cassette component of branched chain amino acids transport system Back     alignment and domain information
>gnl|CDD|182980 PRK11124, artP, arginine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|236997 PRK11831, PRK11831, putative ABC transporter ATP-binding protein YrbF; Provisional Back     alignment and domain information
>gnl|CDD|226905 COG4525, TauB, ABC-type taurine transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|213187 cd03220, ABC_KpsT_Wzt, ATP-binding cassette component of polysaccharide transport system Back     alignment and domain information
>gnl|CDD|130344 TIGR01277, thiQ, thiamine ABC transporter, ATP-binding protein Back     alignment and domain information
>gnl|CDD|224049 COG1124, DppF, ABC-type dipeptide/oligopeptide/nickel transport system, ATPase component [Amino acid transport and metabolism / Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|215558 PLN03073, PLN03073, ABC transporter F family; Provisional Back     alignment and domain information
>gnl|CDD|131368 TIGR02315, ABC_phnC, phosphonate ABC transporter, ATP-binding protein Back     alignment and domain information
>gnl|CDD|237422 PRK13548, hmuV, hemin importer ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|226969 COG4618, ArpD, ABC-type protease/lipase transport system, ATPase and permease components [General function prediction only] Back     alignment and domain information
>gnl|CDD|213187 cd03220, ABC_KpsT_Wzt, ATP-binding cassette component of polysaccharide transport system Back     alignment and domain information
>gnl|CDD|183231 PRK11614, livF, leucine/isoleucine/valine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|226967 COG4608, AppF, ABC-type oligopeptide transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|236870 PRK11174, PRK11174, cysteine/glutathione ABC transporter membrane/ATP-binding component; Reviewed Back     alignment and domain information
>gnl|CDD|213229 cd03262, ABC_HisP_GlnQ, ATP-binding cassette domain of the histidine and glutamine transporters Back     alignment and domain information
>gnl|CDD|131377 TIGR02324, CP_lyasePhnL, phosphonate C-P lyase system protein PhnL Back     alignment and domain information
>gnl|CDD|130254 TIGR01186, proV, glycine betaine/L-proline transport ATP binding subunit Back     alignment and domain information
>gnl|CDD|184588 PRK14243, PRK14243, phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|234199 TIGR03410, urea_trans_UrtE, urea ABC transporter, ATP-binding protein UrtE Back     alignment and domain information
>gnl|CDD|213225 cd03258, ABC_MetN_methionine_transporter, ATP-binding cassette domain of methionine transporter Back     alignment and domain information
>gnl|CDD|213255 cd03288, ABCC_SUR2, ATP-binding cassette domain 2 of the sulfonylurea receptor SUR Back     alignment and domain information
>gnl|CDD|213196 cd03229, ABC_Class3, ATP-binding cassette domain of the binding protein-dependent transport systems Back     alignment and domain information
>gnl|CDD|184195 PRK13635, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|240339 PTZ00265, PTZ00265, multidrug resistance protein (mdr1); Provisional Back     alignment and domain information
>gnl|CDD|132313 TIGR03269, met_CoM_red_A2, methyl coenzyme M reductase system, component A2 Back     alignment and domain information
>gnl|CDD|182331 PRK10247, PRK10247, putative ABC transporter ATP-binding protein YbbL; Provisional Back     alignment and domain information
>gnl|CDD|213185 cd03218, ABC_YhbG, ATP-binding cassette component of YhbG transport system Back     alignment and domain information
>gnl|CDD|184037 PRK13409, PRK13409, putative ATPase RIL; Provisional Back     alignment and domain information
>gnl|CDD|224048 COG1123, COG1123, ATPase components of various ABC-type transport systems, contain duplicated ATPase [General function prediction only] Back     alignment and domain information
>gnl|CDD|237422 PRK13548, hmuV, hemin importer ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|172200 PRK13652, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|184208 PRK13649, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|184593 PRK14258, PRK14258, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|237917 PRK15134, PRK15134, microcin C ABC transporter ATP-binding protein YejF; Provisional Back     alignment and domain information
>gnl|CDD|183055 PRK11247, ssuB, aliphatic sulfonates transport ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|184597 PRK14270, PRK14270, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|172750 PRK14262, PRK14262, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|236863 PRK11153, metN, DL-methionine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|213226 cd03259, ABC_Carb_Solutes_like, ATP-binding cassette domain of the carbohydrate and solute transporters-like Back     alignment and domain information
>gnl|CDD|224058 COG1135, AbcC, ABC-type metal ion transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|223521 COG0444, DppD, ABC-type dipeptide/oligopeptide/nickel transport system, ATPase component [Amino acid transport and metabolism / Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|131266 TIGR02211, LolD_lipo_ex, lipoprotein releasing system, ATP-binding protein Back     alignment and domain information
>gnl|CDD|130234 TIGR01166, cbiO, cobalt transport protein ATP-binding subunit Back     alignment and domain information
>gnl|CDD|237453 PRK13633, PRK13633, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|223488 COG0411, LivG, ABC-type branched-chain amino acid transport systems, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|163585 TIGR03873, F420-0_ABC_ATP, proposed F420-0 ABC transporter, ATP-binding protein Back     alignment and domain information
>gnl|CDD|226359 COG3839, MalK, ABC-type sugar transport systems, ATPase components [Carbohydrate transport and metabolism] Back     alignment and domain information
>gnl|CDD|224051 COG1126, GlnQ, ABC-type polar amino acid transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|237894 PRK15064, PRK15064, ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|233305 TIGR01189, ccmA, heme ABC exporter, ATP-binding protein CcmA Back     alignment and domain information
>gnl|CDD|130260 TIGR01192, chvA, glucan exporter ATP-binding protein Back     alignment and domain information
>gnl|CDD|224059 COG1136, SalX, ABC-type antimicrobial peptide transport system, ATPase component [Defense mechanisms] Back     alignment and domain information
>gnl|CDD|132050 TIGR03005, ectoine_ehuA, ectoine/hydroxyectoine ABC transporter, ATP-binding protein Back     alignment and domain information
>gnl|CDD|130256 TIGR01188, drrA, daunorubicin resistance ABC transporter ATP-binding subunit Back     alignment and domain information
>gnl|CDD|181939 PRK09544, znuC, high-affinity zinc transporter ATPase; Reviewed Back     alignment and domain information
>gnl|CDD|213228 cd03261, ABC_Org_Solvent_Resistant, ATP-binding cassette transport system involved in resistant to organic solvents Back     alignment and domain information
>gnl|CDD|226968 COG4615, PvdE, ABC-type siderophore export system, fused ATPase and permease components [Secondary metabolites biosynthesis, transport, and catabolism / Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|226961 COG4598, HisP, ABC-type histidine transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|213236 cd03269, ABC_putative_ATPase, ATP-binding cassette domain of an uncharacterized transporter Back     alignment and domain information
>gnl|CDD|162242 TIGR01187, potA, spermidine/putrescine ABC transporter ATP-binding subunit Back     alignment and domain information
>gnl|CDD|226929 COG4559, COG4559, ABC-type hemin transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|182852 PRK10938, PRK10938, putative molybdenum transport ATP-binding protein ModF; Provisional Back     alignment and domain information
>gnl|CDD|240327 PTZ00243, PTZ00243, ABC transporter; Provisional Back     alignment and domain information
>gnl|CDD|200134 TIGR01842, type_I_sec_PrtD, type I secretion system ABC transporter, PrtD family Back     alignment and domain information
>gnl|CDD|226970 COG4619, COG4619, ABC-type uncharacterized transport system, ATPase component [General function prediction only] Back     alignment and domain information
>gnl|CDD|213262 cd03295, ABC_OpuCA_Osmoprotection, ATP-binding cassette domain of the osmoprotectant transporter Back     alignment and domain information
>gnl|CDD|226364 COG3845, COG3845, ABC-type uncharacterized transport systems, ATPase components [General function prediction only] Back     alignment and domain information
>gnl|CDD|131368 TIGR02315, ABC_phnC, phosphonate ABC transporter, ATP-binding protein Back     alignment and domain information
>gnl|CDD|237421 PRK13539, PRK13539, cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>gnl|CDD|132302 TIGR03258, PhnT, 2-aminoethylphosphonate ABC transport system, ATP-binding component PhnT Back     alignment and domain information
>gnl|CDD|237651 PRK14266, PRK14266, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|213233 cd03266, ABC_NatA_sodium_exporter, ATP-binding cassette domain of the Na+ transporter Back     alignment and domain information
>gnl|CDD|226647 COG4181, COG4181, Predicted ABC-type transport system involved in lysophospholipase L1 biosynthesis, ATPase component [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>gnl|CDD|172748 PRK14260, PRK14260, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|226617 COG4133, CcmA, ABC-type transport system involved in cytochrome c biogenesis, ATPase component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|225265 COG2401, COG2401, ABC-type ATPase fused to a predicted acetyltransferase domain [General function prediction only] Back     alignment and domain information
>gnl|CDD|184209 PRK13650, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|206743 cd11383, YfjP, YfjP GTPase Back     alignment and domain information
>gnl|CDD|130324 TIGR01257, rim_protein, retinal-specific rim ABC transporter Back     alignment and domain information
>gnl|CDD|223562 COG0488, Uup, ATPase components of ABC transporters with duplicated ATPase domains [General function prediction only] Back     alignment and domain information
>gnl|CDD|213227 cd03260, ABC_PstB_phosphate_transporter, ATP-binding cassette domain of the phosphate transport system Back     alignment and domain information
>gnl|CDD|213190 cd03223, ABCD_peroxisomal_ALDP, ATP-binding cassette domain of peroxisomal transporter, subfamily D Back     alignment and domain information
>gnl|CDD|184203 PRK13643, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|172749 PRK14261, PRK14261, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|216791 pfam01926, MMR_HSR1, 50S ribosome-binding GTPase Back     alignment and domain information
>gnl|CDD|183133 PRK11432, fbpC, ferric transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|184585 PRK14239, PRK14239, phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|236861 PRK11147, PRK11147, ABC transporter ATPase component; Reviewed Back     alignment and domain information
>gnl|CDD|213232 cd03265, ABC_DrrA, Daunorubicin/doxorubicin resistance ATP-binding protein Back     alignment and domain information
>gnl|CDD|237456 PRK13641, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|184210 PRK13651, PRK13651, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|240339 PTZ00265, PTZ00265, multidrug resistance protein (mdr1); Provisional Back     alignment and domain information
>gnl|CDD|226647 COG4181, COG4181, Predicted ABC-type transport system involved in lysophospholipase L1 biosynthesis, ATPase component [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>gnl|CDD|237649 PRK14254, PRK14254, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|172762 PRK14274, PRK14274, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|172756 PRK14268, PRK14268, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|183244 PRK11629, lolD, lipoprotein transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|130252 TIGR01184, ntrCD, nitrate transport ATP-binding subunits C and D Back     alignment and domain information
>gnl|CDD|182182 PRK09984, PRK09984, phosphonate/organophosphate ester transporter subunit; Provisional Back     alignment and domain information
>gnl|CDD|213230 cd03263, ABC_subfamily_A, ATP-binding cassette domain of the lipid transporters, subfamily A Back     alignment and domain information
>gnl|CDD|172760 PRK14272, PRK14272, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|226124 COG3596, COG3596, Predicted GTPase [General function prediction only] Back     alignment and domain information
>gnl|CDD|213235 cd03268, ABC_BcrA_bacitracin_resist, ATP-binding cassette domain of the bacitracin-resistance transporter Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 1303
KOG0054 1381 consensus Multidrug resistance-associated protein/ 100.0
PLN03130 1622 ABC transporter C family member; Provisional 100.0
PLN03232 1495 ABC transporter C family member; Provisional 100.0
TIGR00957 1522 MRP_assoc_pro multi drug resistance-associated pro 100.0
TIGR01271 1490 CFTR_protein cystic fibrosis transmembrane conduct 100.0
PTZ00243 1560 ABC transporter; Provisional 100.0
KOG0055 1228 consensus Multidrug/pheromone exporter, ABC superf 100.0
PTZ00265 1466 multidrug resistance protein (mdr1); Provisional 100.0
KOG0058716 consensus Peptide exporter, ABC superfamily [Intra 100.0
COG2274709 SunT ABC-type bacteriocin/lantibiotic exporters, c 100.0
PRK11174588 cysteine/glutathione ABC transporter membrane/ATP- 100.0
TIGR03797686 NHPM_micro_ABC2 NHPM bacteriocin system ABC transp 100.0
TIGR00958711 3a01208 Conjugate Transporter-2 (CT2) Family prote 100.0
TIGR03796710 NHPM_micro_ABC1 NHPM bacteriocin system ABC transp 100.0
TIGR01193708 bacteriocin_ABC ABC-type bacteriocin transporter. 100.0
KOG00551228 consensus Multidrug/pheromone exporter, ABC superf 100.0
TIGR03375694 type_I_sec_LssB type I secretion system ATPase, Ls 100.0
PRK11176582 lipid transporter ATP-binding/permease protein; Pr 100.0
COG4988559 CydD ABC-type transport system involved in cytochr 100.0
COG1132567 MdlB ABC-type multidrug transport system, ATPase a 100.0
TIGR02203571 MsbA_lipidA lipid A export permease/ATP-binding pr 100.0
PRK10790592 putative multidrug transporter membrane\ATP-bindin 100.0
PRK11160574 cysteine/glutathione ABC transporter membrane/ATP- 100.0
PRK13657588 cyclic beta-1,2-glucan ABC transporter; Provisiona 100.0
TIGR01846694 type_I_sec_HlyB type I secretion system ABC transp 100.0
TIGR02204576 MsbA_rel ABC transporter, permease/ATP-binding pro 100.0
TIGR02868529 CydC thiol reductant ABC exporter, CydC subunit. T 100.0
PRK10789569 putative multidrug transporter membrane\ATP-bindin 100.0
TIGR009571522 MRP_assoc_pro multi drug resistance-associated pro 100.0
COG4987573 CydC ABC-type transport system involved in cytochr 100.0
TIGR01192585 chvA glucan exporter ATP-binding protein. This mod 100.0
PTZ002651466 multidrug resistance protein (mdr1); Provisional 100.0
PLN031301622 ABC transporter C family member; Provisional 100.0
TIGR01842544 type_I_sec_PrtD type I secretion system ABC transp 100.0
TIGR02857529 CydD thiol reductant ABC exporter, CydD subunit. U 100.0
KOG0057591 consensus Mitochondrial Fe/S cluster exporter, ABC 100.0
PTZ002431560 ABC transporter; Provisional 100.0
PLN032321495 ABC transporter C family member; Provisional 100.0
KOG0056790 consensus Heavy metal exporter HMT1, ABC superfami 100.0
KOG00541381 consensus Multidrug resistance-associated protein/ 100.0
COG4618580 ArpD ABC-type protease/lipase transport system, AT 100.0
TIGR012711490 CFTR_protein cystic fibrosis transmembrane conduct 100.0
TIGR01194555 cyc_pep_trnsptr cyclic peptide transporter. This m 100.0
COG5265497 ATM1 ABC-type transport system involved in Fe-S cl 100.0
PRK10522547 multidrug transporter membrane component/ATP-bindi 100.0
TIGR00954659 3a01203 Peroxysomal Fatty Acyl CoA Transporter (FA 100.0
KOG0058 716 consensus Peptide exporter, ABC superfamily [Intra 100.0
COG2274 709 SunT ABC-type bacteriocin/lantibiotic exporters, c 100.0
TIGR02868 529 CydC thiol reductant ABC exporter, CydC subunit. T 100.0
TIGR00958 711 3a01208 Conjugate Transporter-2 (CT2) Family prote 100.0
TIGR01193 708 bacteriocin_ABC ABC-type bacteriocin transporter. 100.0
PRK11160 574 cysteine/glutathione ABC transporter membrane/ATP- 100.0
TIGR03797 686 NHPM_micro_ABC2 NHPM bacteriocin system ABC transp 100.0
TIGR03796 710 NHPM_micro_ABC1 NHPM bacteriocin system ABC transp 100.0
TIGR02857 529 CydD thiol reductant ABC exporter, CydD subunit. U 100.0
COG1132 567 MdlB ABC-type multidrug transport system, ATPase a 100.0
PRK11174 588 cysteine/glutathione ABC transporter membrane/ATP- 100.0
TIGR03375 694 type_I_sec_LssB type I secretion system ATPase, Ls 100.0
PRK10790 592 putative multidrug transporter membrane\ATP-bindin 100.0
TIGR01846 694 type_I_sec_HlyB type I secretion system ABC transp 100.0
PRK11176 582 lipid transporter ATP-binding/permease protein; Pr 100.0
PRK14257329 phosphate ABC transporter ATP-binding protein; Pro 100.0
TIGR01194 555 cyc_pep_trnsptr cyclic peptide transporter. This m 100.0
TIGR02203 571 MsbA_lipidA lipid A export permease/ATP-binding pr 100.0
TIGR01192 585 chvA glucan exporter ATP-binding protein. This mod 100.0
COG4615546 PvdE ABC-type siderophore export system, fused ATP 100.0
PRK10789 569 putative multidrug transporter membrane\ATP-bindin 100.0
TIGR02204 576 MsbA_rel ABC transporter, permease/ATP-binding pro 100.0
cd03289275 ABCC_CFTR2 The CFTR subfamily domain 2. The cystic 100.0
PRK13657 588 cyclic beta-1,2-glucan ABC transporter; Provisiona 100.0
KOG0056 790 consensus Heavy metal exporter HMT1, ABC superfami 100.0
PRK10522 547 multidrug transporter membrane component/ATP-bindi 100.0
TIGR01842 544 type_I_sec_PrtD type I secretion system ABC transp 100.0
COG4987 573 CydC ABC-type transport system involved in cytochr 100.0
COG4178604 ABC-type uncharacterized transport system, permeas 100.0
TIGR00956 1394 3a01205 Pleiotropic Drug Resistance (PDR) Family p 100.0
COG1126240 GlnQ ABC-type polar amino acid transport system, A 100.0
COG4988 559 CydD ABC-type transport system involved in cytochr 100.0
TIGR00954 659 3a01203 Peroxysomal Fatty Acyl CoA Transporter (FA 100.0
COG1123539 ATPase components of various ABC-type transport sy 100.0
cd03291282 ABCC_CFTR1 The CFTR subfamily domain 1. The cystic 99.97
KOG0057 591 consensus Mitochondrial Fe/S cluster exporter, ABC 99.97
cd03252237 ABCC_Hemolysin The ABC-transporter hemolysin B is 99.97
cd03288257 ABCC_SUR2 The SUR domain 2. The sulfonylurea recep 99.97
COG1117253 PstB ABC-type phosphate transport system, ATPase c 99.97
cd03250204 ABCC_MRP_domain1 Domain 1 of the ABC subfamily C. 99.97
COG1135339 AbcC ABC-type metal ion transport system, ATPase c 99.97
TIGR03719552 ABC_ABC_ChvD ATP-binding cassette protein, ChvD fa 99.97
COG1125309 OpuBA ABC-type proline/glycine betaine transport s 99.97
COG3839338 MalK ABC-type sugar transport systems, ATPase comp 99.97
COG1116248 TauB ABC-type nitrate/sulfonate/bicarbonate transp 99.97
cd03254229 ABCC_Glucan_exporter_like Glucan exporter ATP-bind 99.97
COG3842352 PotA ABC-type spermidine/putrescine transport syst 99.97
PRK11819556 putative ABC transporter ATP-binding protein; Revi 99.97
cd03253236 ABCC_ATM1_transporter ATM1 is an ABC transporter t 99.97
TIGR03269520 met_CoM_red_A2 methyl coenzyme M reductase system, 99.97
PRK15064530 ABC transporter ATP-binding protein; Provisional 99.97
COG1120258 FepC ABC-type cobalamin/Fe3+-siderophores transpor 99.97
cd03251234 ABCC_MsbA MsbA is an essential ABC transporter, cl 99.97
cd03244221 ABCC_MRP_domain2 Domain 2 of the ABC subfamily C. 99.97
TIGR01257 2272 rim_protein retinal-specific rim ABC transporter. 99.97
COG1127263 Ttg2A ABC-type transport system involved in resist 99.97
PRK10261623 glutathione transporter ATP-binding protein; Provi 99.97
COG3840231 ThiQ ABC-type thiamine transport system, ATPase co 99.97
PRK13549506 xylose transporter ATP-binding subunit; Provisiona 99.97
COG1118345 CysA ABC-type sulfate/molybdate transport systems, 99.97
COG1121254 ZnuC ABC-type Mn/Zn transport systems, ATPase comp 99.97
PRK09700510 D-allose transporter ATP-binding protein; Provisio 99.97
cd03249238 ABC_MTABC3_MDL1_MDL2 MTABC3 (also known as ABCB6) 99.97
PRK10938490 putative molybdenum transport ATP-binding protein 99.96
PRK15134529 microcin C ABC transporter ATP-binding protein Yej 99.96
COG1136226 SalX ABC-type antimicrobial peptide transport syst 99.96
PRK11288501 araG L-arabinose transporter ATP-binding protein; 99.96
cd03245220 ABCC_bacteriocin_exporters ABC-type bacteriocin ex 99.96
COG2884223 FtsE Predicted ATPase involved in cell division [C 99.96
TIGR02633500 xylG D-xylose ABC transporter, ATP-binding protein 99.96
COG3638258 ABC-type phosphate/phosphonate transport system, A 99.96
PRK13631320 cbiO cobalt transporter ATP-binding subunit; Provi 99.96
PLN03140 1470 ABC transporter G family member; Provisional 99.96
COG1122235 CbiO ABC-type cobalt transport system, ATPase comp 99.96
PRK11650356 ugpC glycerol-3-phosphate transporter ATP-binding 99.96
cd03290218 ABCC_SUR1_N The SUR domain 1. The sulfonylurea rec 99.96
PRK10636638 putative ABC transporter ATP-binding protein; Prov 99.96
COG5265 497 ATM1 ABC-type transport system involved in Fe-S cl 99.96
KOG0060659 consensus Long-chain acyl-CoA transporter, ABC sup 99.96
COG1124252 DppF ABC-type dipeptide/oligopeptide/nickel transp 99.96
TIGR02314343 ABC_MetN D-methionine ABC transporter, ATP-binding 99.96
cd03369207 ABCC_NFT1 Domain 2 of NFT1 (New full-length MRP-ty 99.96
cd03261235 ABC_Org_Solvent_Resistant ABC (ATP-binding cassett 99.96
PRK11432351 fbpC ferric transporter ATP-binding subunit; Provi 99.95
PRK13650279 cbiO cobalt transporter ATP-binding subunit; Provi 99.95
PRK09452375 potA putrescine/spermidine ABC transporter ATPase 99.95
PRK13647274 cbiO cobalt transporter ATP-binding subunit; Provi 99.95
cd03248226 ABCC_TAP TAP, the Transporter Associated with Anti 99.95
PRK13637287 cbiO cobalt transporter ATP-binding subunit; Provi 99.95
COG0488530 Uup ATPase components of ABC transporters with dup 99.95
PRK13643288 cbiO cobalt transporter ATP-binding subunit; Provi 99.95
PRK11147635 ABC transporter ATPase component; Reviewed 99.95
cd03260227 ABC_PstB_phosphate_transporter Phosphate uptake is 99.95
PRK13651305 cobalt transporter ATP-binding subunit; Provisiona 99.95
TIGR03265353 PhnT2 putative 2-aminoethylphosphonate ABC transpo 99.95
PRK14269246 phosphate ABC transporter ATP-binding protein; Pro 99.95
PRK13634290 cbiO cobalt transporter ATP-binding subunit; Provi 99.95
PRK13635279 cbiO cobalt transporter ATP-binding subunit; Provi 99.95
PRK13640282 cbiO cobalt transporter ATP-binding subunit; Provi 99.95
PRK14250241 phosphate ABC transporter ATP-binding protein; Pro 99.95
cd03296239 ABC_CysA_sulfate_importer Part of the ABC transpor 99.95
COG0410237 LivF ABC-type branched-chain amino acid transport 99.95
PRK13646286 cbiO cobalt transporter ATP-binding subunit; Provi 99.95
TIGR03258362 PhnT 2-aminoethylphosphonate ABC transport system, 99.95
PRK14242253 phosphate transporter ATP-binding protein; Provisi 99.95
PRK10851353 sulfate/thiosulfate transporter subunit; Provision 99.95
TIGR02315243 ABC_phnC phosphonate ABC transporter, ATP-binding 99.95
PRK13636283 cbiO cobalt transporter ATP-binding subunit; Provi 99.95
PRK14273254 phosphate ABC transporter ATP-binding protein; Pro 99.95
PRK11000369 maltose/maltodextrin transporter ATP-binding prote 99.95
PRK13644274 cbiO cobalt transporter ATP-binding subunit; Provi 99.95
TIGR00972247 3a0107s01c2 phosphate ABC transporter, ATP-binding 99.95
cd03263220 ABC_subfamily_A The ABCA subfamily mediates the tr 99.95
TIGR01186363 proV glycine betaine/L-proline transport ATP bindi 99.95
cd03256241 ABC_PhnC_transporter ABC-type phosphate/phosphonat 99.95
PRK10744260 pstB phosphate transporter ATP-binding protein; Pr 99.95
cd03258233 ABC_MetN_methionine_transporter MetN (also known a 99.95
cd03219236 ABC_Mj1267_LivG_branched The Mj1267/LivG ABC trans 99.95
cd03226205 ABC_cobalt_CbiO_domain2 Domain II of the ABC compo 99.95
PRK14237267 phosphate transporter ATP-binding protein; Provisi 99.95
PRK11153343 metN DL-methionine transporter ATP-binding subunit 99.95
PRK13632271 cbiO cobalt transporter ATP-binding subunit; Provi 99.95
cd03259213 ABC_Carb_Solutes_like ABC Carbohydrate and Solute 99.95
PRK13633280 cobalt transporter ATP-binding subunit; Provisiona 99.95
cd03293220 ABC_NrtD_SsuB_transporters NrtD and SsuB are the A 99.95
PRK14235267 phosphate transporter ATP-binding protein; Provisi 99.95
cd03255218 ABC_MJ0796_Lo1CDE_FtsE This family is comprised of 99.95
PLN03073718 ABC transporter F family; Provisional 99.95
PRK13652277 cbiO cobalt transporter ATP-binding subunit; Provi 99.95
PRK11247257 ssuB aliphatic sulfonates transport ATP-binding su 99.95
TIGR03864236 PQQ_ABC_ATP ABC transporter, ATP-binding subunit, 99.95
PRK14248268 phosphate ABC transporter ATP-binding protein; Pro 99.95
PRK11607377 potG putrescine transporter ATP-binding subunit; P 99.95
PRK14249251 phosphate ABC transporter ATP-binding protein; Pro 99.95
cd03265220 ABC_DrrA DrrA is the ATP-binding protein component 99.94
PRK14239252 phosphate transporter ATP-binding protein; Provisi 99.94
PRK14274259 phosphate ABC transporter ATP-binding protein; Pro 99.94
PRK14236272 phosphate transporter ATP-binding protein; Provisi 99.94
PRK09536402 btuD corrinoid ABC transporter ATPase; Reviewed 99.94
cd03294269 ABC_Pro_Gly_Bertaine This family comprises the gly 99.94
PRK14245250 phosphate ABC transporter ATP-binding protein; Pro 99.94
TIGR00960216 3a0501s02 Type II (General) Secretory Pathway (IIS 99.94
cd03247178 ABCC_cytochrome_bd The CYD subfamily implicated in 99.94
PRK14244251 phosphate ABC transporter ATP-binding protein; Pro 99.94
cd03295242 ABC_OpuCA_Osmoprotection OpuCA is a the ATP bindin 99.94
PRK13642277 cbiO cobalt transporter ATP-binding subunit; Provi 99.94
cd03224222 ABC_TM1139_LivF_branched LivF (TM1139) is part of 99.94
PRK14252265 phosphate ABC transporter ATP-binding protein; Pro 99.94
PRK13639275 cbiO cobalt transporter ATP-binding subunit; Provi 99.94
PRK14251251 phosphate ABC transporter ATP-binding protein; Pro 99.94
PRK14268258 phosphate ABC transporter ATP-binding protein; Pro 99.94
PRK14240250 phosphate transporter ATP-binding protein; Provisi 99.94
PRK11629233 lolD lipoprotein transporter ATP-binding subunit; 99.94
PRK13648269 cbiO cobalt transporter ATP-binding subunit; Provi 99.94
PRK14259269 phosphate ABC transporter ATP-binding protein; Pro 99.94
PRK13645289 cbiO cobalt transporter ATP-binding subunit; Provi 99.94
PRK14270251 phosphate ABC transporter ATP-binding protein; Pro 99.94
PRK13641287 cbiO cobalt transporter ATP-binding subunit; Provi 99.94
cd03301213 ABC_MalK_N The N-terminal ATPase domain of the mal 99.94
PRK14254285 phosphate ABC transporter ATP-binding protein; Pro 99.94
PRK14238271 phosphate transporter ATP-binding protein; Provisi 99.94
cd03268208 ABC_BcrA_bacitracin_resist The BcrA subfamily repr 99.94
cd03266218 ABC_NatA_sodium_exporter NatA is the ATPase compon 99.94
PRK10771232 thiQ thiamine transporter ATP-binding subunit; Pro 99.94
PRK10575265 iron-hydroxamate transporter ATP-binding subunit; 99.94
PRK13537306 nodulation ABC transporter NodI; Provisional 99.94
cd03223166 ABCD_peroxisomal_ALDP Peroxisomal ATP-binding cass 99.94
PRK10619257 histidine/lysine/arginine/ornithine transporter su 99.94
PRK13649280 cbiO cobalt transporter ATP-binding subunit; Provi 99.94
PRK14247250 phosphate ABC transporter ATP-binding protein; Pro 99.94
TIGR03005252 ectoine_ehuA ectoine/hydroxyectoine ABC transporte 99.94
PRK14253249 phosphate ABC transporter ATP-binding protein; Pro 99.94
cd03218232 ABC_YhbG The ABC transporters belonging to the Yhb 99.94
PRK09493240 glnQ glutamine ABC transporter ATP-binding protein 99.94
PRK14271276 phosphate ABC transporter ATP-binding protein; Pro 99.94
PRK14267253 phosphate ABC transporter ATP-binding protein; Pro 99.94
PRK14262250 phosphate ABC transporter ATP-binding protein; Pro 99.94
cd03264211 ABC_drug_resistance_like ABC-type multidrug transp 99.94
PRK14261253 phosphate ABC transporter ATP-binding protein; Pro 99.94
PRK14243264 phosphate transporter ATP-binding protein; Provisi 99.94
cd03298211 ABC_ThiQ_thiamine_transporter ABC-type thiamine tr 99.94
PRK15079331 oligopeptide ABC transporter ATP-binding protein O 99.94
cd03235213 ABC_Metallic_Cations ABC component of the metal-ty 99.94
TIGR03411242 urea_trans_UrtD urea ABC transporter, ATP-binding 99.94
PRK09984262 phosphonate/organophosphate ester transporter subu 99.94
PRK13548258 hmuV hemin importer ATP-binding subunit; Provision 99.94
PRK10584228 putative ABC transporter ATP-binding protein YbbA; 99.94
PRK11831269 putative ABC transporter ATP-binding protein YrbF; 99.94
PRK10247225 putative ABC transporter ATP-binding protein YbbL; 99.94
PRK11124242 artP arginine transporter ATP-binding subunit; Pro 99.94
TIGR03415382 ABC_choXWV_ATP choline ABC transporter, ATP-bindin 99.94
PRK10070400 glycine betaine transporter ATP-binding subunit; P 99.94
TIGR03410230 urea_trans_UrtE urea ABC transporter, ATP-binding 99.94
PRK11264250 putative amino-acid ABC transporter ATP-binding pr 99.94
PRK10895241 lipopolysaccharide ABC transporter ATP-binding pro 99.94
TIGR02211221 LolD_lipo_ex lipoprotein releasing system, ATP-bin 99.94
PRK14275286 phosphate ABC transporter ATP-binding protein; Pro 99.94
TIGR02769265 nickel_nikE nickel import ATP-binding protein NikE 99.94
cd03257228 ABC_NikE_OppD_transporters The ABC transporter sub 99.94
TIGR02673214 FtsE cell division ATP-binding protein FtsE. This 99.94
PRK14256252 phosphate ABC transporter ATP-binding protein; Pro 99.94
cd03300232 ABC_PotA_N PotA is an ABC-type transporter and the 99.94
TIGR00968237 3a0106s01 sulfate ABC transporter, ATP-binding pro 99.94
PRK14264305 phosphate ABC transporter ATP-binding protein; Pro 99.94
PRK11231255 fecE iron-dicitrate transporter ATP-binding subuni 99.94
TIGR03873256 F420-0_ABC_ATP proposed F420-0 ABC transporter, AT 99.94
cd03292214 ABC_FtsE_transporter FtsE is a hydrophilic nucleot 99.94
PRK14266250 phosphate ABC transporter ATP-binding protein; Pro 99.94
cd03299235 ABC_ModC_like Archeal protein closely related to M 99.94
TIGR01288303 nodI ATP-binding ABC transporter family nodulation 99.94
cd03269210 ABC_putative_ATPase This subfamily is involved in 99.94
PRK13638271 cbiO cobalt transporter ATP-binding subunit; Provi 99.94
PRK11614237 livF leucine/isoleucine/valine transporter ATP-bin 99.94
PRK11144352 modC molybdate transporter ATP-binding protein; Pr 99.94
PRK14263261 phosphate ABC transporter ATP-binding protein; Pro 99.94
PRK14265274 phosphate ABC transporter ATP-binding protein; Pro 99.94
PRK10253265 iron-enterobactin transporter ATP-binding protein; 99.93
PRK11300255 livG leucine/isoleucine/valine transporter ATP-bin 99.93
TIGR01277213 thiQ thiamine ABC transporter, ATP-binding protein 99.93
PRK10908222 cell division protein FtsE; Provisional 99.93
PRK13536340 nodulation factor exporter subunit NodI; Provision 99.93
PRK11308327 dppF dipeptide transporter ATP-binding subunit; Pr 99.93
TIGR03522301 GldA_ABC_ATP gliding motility-associated ABC trans 99.93
PRK14260259 phosphate ABC transporter ATP-binding protein; Pro 99.93
TIGR03740223 galliderm_ABC gallidermin-class lantibiotic protec 99.93
PRK09544251 znuC high-affinity zinc transporter ATPase; Review 99.93
PRK14246257 phosphate ABC transporter ATP-binding protein; Pro 99.93
PRK11248255 tauB taurine transporter ATP-binding subunit; Prov 99.93
PRK14272252 phosphate ABC transporter ATP-binding protein; Pro 99.93
cd03225211 ABC_cobalt_CbiO_domain1 Domain I of the ABC compon 99.93
PRK14255252 phosphate ABC transporter ATP-binding protein; Pro 99.93
cd03246173 ABCC_Protease_Secretion This family represents the 99.93
PRK10418254 nikD nickel transporter ATP-binding protein NikD; 99.93
PRK13547272 hmuV hemin importer ATP-binding subunit; Provision 99.93
cd03262213 ABC_HisP_GlnQ_permeases HisP and GlnQ are the ATP- 99.93
PRK15112267 antimicrobial peptide ABC system ATP-binding prote 99.93
PRK14258261 phosphate ABC transporter ATP-binding protein; Pro 99.93
PRK11701258 phnK phosphonate C-P lyase system protein PhnK; Pr 99.93
TIGR01978243 sufC FeS assembly ATPase SufC. SufC is part of the 99.93
PRK11022326 dppD dipeptide transporter ATP-binding subunit; Pr 99.93
PRK14241258 phosphate transporter ATP-binding protein; Provisi 99.93
cd03234226 ABCG_White The White subfamily represents ABC tran 99.93
PRK15056272 manganese/iron transporter ATP-binding protein; Pr 99.93
PRK09473330 oppD oligopeptide transporter ATP-binding componen 99.93
TIGR02982220 heterocyst_DevA ABC exporter ATP-binding subunit, 99.93
cd03213194 ABCG_EPDR ABCG transporters are involved in eye pi 99.93
TIGR02142354 modC_ABC molybdenum ABC transporter, ATP-binding p 99.93
COG4181228 Predicted ABC-type transport system involved in ly 99.93
TIGR01188302 drrA daunorubicin resistance ABC transporter ATP-b 99.93
PRK10419268 nikE nickel transporter ATP-binding protein NikE; 99.92
COG4175386 ProV ABC-type proline/glycine betaine transport sy 99.92
COG4619223 ABC-type uncharacterized transport system, ATPase 99.92
PRK15093330 antimicrobial peptide ABC transporter ATP-binding 99.92
cd03232192 ABC_PDR_domain2 The pleiotropic drug resistance-li 99.92
COG4559259 ABC-type hemin transport system, ATPase component 99.92
COG4615 546 PvdE ABC-type siderophore export system, fused ATP 99.92
cd03228171 ABCC_MRP_Like The MRP (Mutidrug Resistance Protein 99.92
COG1131293 CcmA ABC-type multidrug transport system, ATPase c 99.92
TIGR02323253 CP_lyasePhnK phosphonate C-P lyase system protein 99.92
COG1137243 YhbG ABC-type (unclassified) transport system, ATP 99.92
cd03230173 ABC_DR_subfamily_A This family of ATP-binding prot 99.92
cd03233202 ABC_PDR_domain1 The pleiotropic drug resistance (P 99.92
PRK13546264 teichoic acids export protein ATP-binding subunit; 99.92
cd03297214 ABC_ModC_molybdenum_transporter ModC is an ABC-typ 99.92
COG1123539 ATPase components of various ABC-type transport sy 99.92
PRK15439510 autoinducer 2 ABC transporter ATP-binding protein 99.91
cd03229178 ABC_Class3 This class is comprised of all BPD (Bin 99.91
PRK13545549 tagH teichoic acids export protein ATP-binding sub 99.91
COG4555245 NatA ABC-type Na+ transport system, ATPase compone 99.91
PRK10261623 glutathione transporter ATP-binding protein; Provi 99.91
cd03215182 ABC_Carb_Monos_II This family represents domain II 99.91
CHL00131252 ycf16 sulfate ABC transporter protein; Validated 99.91
COG0411250 LivG ABC-type branched-chain amino acid transport 99.91
TIGR03608206 L_ocin_972_ABC putative bacteriocin export ABC tra 99.91
COG4604252 CeuD ABC-type enterochelin transport system, ATPas 99.91
PRK03695248 vitamin B12-transporter ATPase; Provisional 99.91
cd03217200 ABC_FeS_Assembly ABC-type transport system involve 99.91
COG4525259 TauB ABC-type taurine transport system, ATPase com 99.91
COG4148352 ModC ABC-type molybdate transport system, ATPase c 99.91
PRK10762501 D-ribose transporter ATP binding protein; Provisio 99.91
PRK09580248 sufC cysteine desulfurase ATPase component; Review 99.91
TIGR00955617 3a01204 The Eye Pigment Precursor Transporter (EPP 99.91
TIGR01184230 ntrCD nitrate transport ATP-binding subunits C and 99.91
COG0444316 DppD ABC-type dipeptide/oligopeptide/nickel transp 99.91
TIGR02770230 nickel_nikD nickel import ATP-binding protein NikD 99.9
PRK13543214 cytochrome c biogenesis protein CcmA; Provisional 99.9
PRK15177213 Vi polysaccharide export ATP-binding protein VexC; 99.9
PRK13540200 cytochrome c biogenesis protein CcmA; Provisional 99.9
TIGR03269520 met_CoM_red_A2 methyl coenzyme M reductase system, 99.9
cd03231201 ABC_CcmA_heme_exporter CcmA, the ATP-binding compo 99.9
PLN03211659 ABC transporter G-25; Provisional 99.9
cd03267236 ABC_NatA_like Similar in sequence to NatA, this is 99.9
PRK10982491 galactose/methyl galaxtoside transporter ATP-bindi 99.9
COG4608268 AppF ABC-type oligopeptide transport system, ATPas 99.9
PRK15134529 microcin C ABC transporter ATP-binding protein Yej 99.9
cd03214180 ABC_Iron-Siderophores_B12_Hemin ABC transporters, 99.9
cd03220224 ABC_KpsT_Wzt ABC_KpsT_Wzt The KpsT/Wzt ABC transpo 99.9
COG4161242 ArtP ABC-type arginine transport system, ATPase co 99.9
PRK13539207 cytochrome c biogenesis protein CcmA; Provisional 99.89
cd03237246 ABC_RNaseL_inhibitor_domain2 The ATPase domain 2 o 99.89
TIGR02324224 CP_lyasePhnL phosphonate C-P lyase system protein 99.89
PRK15064530 ABC transporter ATP-binding protein; Provisional 99.89
COG4172534 ABC-type uncharacterized transport system, duplica 99.89
PRK13538204 cytochrome c biogenesis protein CcmA; Provisional 99.89
KOG0064728 consensus Peroxisomal long-chain acyl-CoA transpor 99.89
PRK13541195 cytochrome c biogenesis protein CcmA; Provisional 99.89
COG4598256 HisP ABC-type histidine transport system, ATPase c 99.89
cd03216163 ABC_Carb_Monos_I This family represents the domain 99.89
PRK13549506 xylose transporter ATP-binding subunit; Provisiona 99.89
TIGR01189198 ccmA heme ABC exporter, ATP-binding protein CcmA. 99.89
TIGR03771223 anch_rpt_ABC anchored repeat-type ABC transporter, 99.89
PRK10535648 macrolide transporter ATP-binding /permease protei 99.89
TIGR012572272 rim_protein retinal-specific rim ABC transporter. 99.88
TIGR01166190 cbiO cobalt transport protein ATP-binding subunit. 99.88
PLN03073718 ABC transporter F family; Provisional 99.88
COG4618 580 ArpD ABC-type protease/lipase transport system, AT 99.88
TIGR009561394 3a01205 Pleiotropic Drug Resistance (PDR) Family p 99.88
PRK09700510 D-allose transporter ATP-binding protein; Provisio 99.88
PRK10636638 putative ABC transporter ATP-binding protein; Prov 99.87
cd03221144 ABCF_EF-3 ABCF_EF-3 Elongation factor 3 (EF-3) is 99.87
PRK11819556 putative ABC transporter ATP-binding protein; Revi 99.87
COG1129500 MglA ABC-type sugar transport system, ATPase compo 99.87
PRK11288501 araG L-arabinose transporter ATP-binding protein; 99.87
TIGR03719552 ABC_ABC_ChvD ATP-binding cassette protein, ChvD fa 99.87
TIGR02633500 xylG D-xylose ABC transporter, ATP-binding protein 99.87
PRK11147635 ABC transporter ATPase component; Reviewed 99.87
COG4167267 SapF ABC-type antimicrobial peptide transport syst 99.87
PRK13409590 putative ATPase RIL; Provisional 99.87
PRK10762501 D-ribose transporter ATP binding protein; Provisio 99.87
COG1134249 TagH ABC-type polysaccharide/polyol phosphate tran 99.87
TIGR01187325 potA spermidine/putrescine ABC transporter ATP-bin 99.86
PRK15439510 autoinducer 2 ABC transporter ATP-binding protein 99.86
cd03236255 ABC_RNaseL_inhibitor_domain1 The ATPase domain 1 o 99.86
COG4136213 ABC-type uncharacterized transport system, ATPase 99.85
PRK10938490 putative molybdenum transport ATP-binding protein 99.85
cd03222177 ABC_RNaseL_inhibitor The ABC ATPase RNase L inhibi 99.85
COG1119257 ModF ABC-type molybdenum transport system, ATPase 99.84
PRK10982491 galactose/methyl galaxtoside transporter ATP-bindi 99.84
COG3845501 ABC-type uncharacterized transport systems, ATPase 99.84
COG1101263 PhnK ABC-type uncharacterized transport system, AT 99.84
PLN031401470 ABC transporter G family member; Provisional 99.83
cd03238176 ABC_UvrA The excision repair protein UvrA; Nucleot 99.83
cd00267157 ABC_ATPase ABC (ATP-binding cassette) transporter 99.81
COG4152300 ABC-type uncharacterized transport system, ATPase 99.81
COG4674249 Uncharacterized ABC-type transport system, ATPase 99.81
PF00664275 ABC_membrane: ABC transporter transmembrane region 99.8
PRK13409590 putative ATPase RIL; Provisional 99.8
COG0488530 Uup ATPase components of ABC transporters with dup 99.8
COG4172534 ABC-type uncharacterized transport system, duplica 99.8
PF00664275 ABC_membrane: ABC transporter transmembrane region 99.79
PF00005137 ABC_tran: ABC transporter This structure is on hol 99.79
COG0396251 sufC Cysteine desulfurase activator ATPase [Posttr 99.78
COG4107258 PhnK ABC-type phosphonate transport system, ATPase 99.77
KOG0061613 consensus Transporter, ABC superfamily (Breast can 99.75
COG4133209 CcmA ABC-type transport system involved in cytochr 99.74
cd03270226 ABC_UvrA_I The excision repair protein UvrA domain 99.74
COG4178 604 ABC-type uncharacterized transport system, permeas 99.73
cd03271261 ABC_UvrA_II The excision repair protein UvrA domai 99.72
KOG0065 1391 consensus Pleiotropic drug resistance proteins (PD 99.72
COG4586325 ABC-type uncharacterized transport system, ATPase 99.71
cd03278197 ABC_SMC_barmotin Barmotin is a tight junction-asso 99.67
KOG0927614 consensus Predicted transporter (ABC superfamily) 99.62
COG4778235 PhnL ABC-type phosphonate transport system, ATPase 99.61
KOG0059885 consensus Lipid exporter ABCA1 and related protein 99.6
cd03279213 ABC_sbcCD SbcCD and other Mre11/Rad50 (MR) complex 99.58
cd03272243 ABC_SMC3_euk Eukaryotic SMC3 proteins; SMC protein 99.57
KOG0060 659 consensus Long-chain acyl-CoA transporter, ABC sup 99.56
PRK00349943 uvrA excinuclease ABC subunit A; Reviewed 99.56
PRK00635 1809 excinuclease ABC subunit A; Provisional 99.52
cd03273251 ABC_SMC2_euk Eukaryotic SMC2 proteins; SMC protein 99.51
cd03240204 ABC_Rad50 The catalytic domains of Rad50 are simil 99.51
PRK14257 329 phosphate ABC transporter ATP-binding protein; Pro 99.51
COG4138248 BtuD ABC-type cobalamin transport system, ATPase c 99.5
cd03275247 ABC_SMC1_euk Eukaryotic SMC1 proteins; SMC protein 99.47
TIGR00630924 uvra excinuclease ABC, A subunit. This family is b 99.46
KOG0927614 consensus Predicted transporter (ABC superfamily) 99.46
KOG0066807 consensus eIF2-interacting protein ABC50 (ABC supe 99.45
COG3845501 ABC-type uncharacterized transport systems, ATPase 99.44
COG1245591 Predicted ATPase, RNase L inhibitor (RLI) homolog 99.44
cd03274212 ABC_SMC4_euk Eukaryotic SMC4 proteins; SMC protein 99.43
COG3638 258 ABC-type phosphate/phosphonate transport system, A 99.43
COG1129500 MglA ABC-type sugar transport system, ATPase compo 99.43
KOG2355291 consensus Predicted ABC-type transport, ATPase com 99.42
KOG0062582 consensus ATPase component of ABC transporters wit 99.41
COG2884 223 FtsE Predicted ATPase involved in cell division [C 99.4
COG0178935 UvrA Excinuclease ATPase subunit [DNA replication, 99.39
COG1126 240 GlnQ ABC-type polar amino acid transport system, A 99.38
cd03289 275 ABCC_CFTR2 The CFTR subfamily domain 2. The cystic 99.35
cd03369 207 ABCC_NFT1 Domain 2 of NFT1 (New full-length MRP-ty 99.35
KOG00651391 consensus Pleiotropic drug resistance proteins (PD 99.35
COG1125 309 OpuBA ABC-type proline/glycine betaine transport s 99.33
cd01128249 rho_factor Transcription termination factor rho is 99.33
COG1116 248 TauB ABC-type nitrate/sulfonate/bicarbonate transp 99.32
COG1121 254 ZnuC ABC-type Mn/Zn transport systems, ATPase comp 99.31
cd03239178 ABC_SMC_head The structural maintenance of chromos 99.31
cd03276198 ABC_SMC6_euk Eukaryotic SMC6 proteins; SMC protein 99.29
KOG0062582 consensus ATPase component of ABC transporters wit 99.28
COG1120 258 FepC ABC-type cobalamin/Fe3+-siderophores transpor 99.27
COG1136 226 SalX ABC-type antimicrobial peptide transport syst 99.27
TIGR00960 216 3a0501s02 Type II (General) Secretory Pathway (IIS 99.26
COG1124 252 DppF ABC-type dipeptide/oligopeptide/nickel transp 99.26
PRK13631 320 cbiO cobalt transporter ATP-binding subunit; Provi 99.26
cd03263 220 ABC_subfamily_A The ABCA subfamily mediates the tr 99.26
cd03244 221 ABCC_MRP_domain2 Domain 2 of the ABC subfamily C. 99.25
cd03247 178 ABCC_cytochrome_bd The CYD subfamily implicated in 99.25
COG1135 339 AbcC ABC-type metal ion transport system, ATPase c 99.25
cd03216 163 ABC_Carb_Monos_I This family represents the domain 99.24
cd03223 166 ABCD_peroxisomal_ALDP Peroxisomal ATP-binding cass 99.24
COG1127 263 Ttg2A ABC-type transport system involved in resist 99.23
cd03255 218 ABC_MJ0796_Lo1CDE_FtsE This family is comprised of 99.23
PRK13646 286 cbiO cobalt transporter ATP-binding subunit; Provi 99.22
cd03288 257 ABCC_SUR2 The SUR domain 2. The sulfonylurea recep 99.22
cd03246 173 ABCC_Protease_Secretion This family represents the 99.22
cd03292 214 ABC_FtsE_transporter FtsE is a hydrophilic nucleot 99.21
PRK13643 288 cbiO cobalt transporter ATP-binding subunit; Provi 99.21
PRK11629 233 lolD lipoprotein transporter ATP-binding subunit; 99.21
cd03250 204 ABCC_MRP_domain1 Domain 1 of the ABC subfamily C. 99.21
TIGR02673 214 FtsE cell division ATP-binding protein FtsE. This 99.21
cd03221144 ABCF_EF-3 ABCF_EF-3 Elongation factor 3 (EF-3) is 99.2
cd03257 228 ABC_NikE_OppD_transporters The ABC transporter sub 99.2
cd03266 218 ABC_NatA_sodium_exporter NatA is the ATPase compon 99.2
COG1122 235 CbiO ABC-type cobalt transport system, ATPase comp 99.2
cd03233 202 ABC_PDR_domain1 The pleiotropic drug resistance (P 99.2
PRK13650 279 cbiO cobalt transporter ATP-binding subunit; Provi 99.19
PRK13637 287 cbiO cobalt transporter ATP-binding subunit; Provi 99.19
cd03245 220 ABCC_bacteriocin_exporters ABC-type bacteriocin ex 99.19
cd03252 237 ABCC_Hemolysin The ABC-transporter hemolysin B is 99.19
PRK13540 200 cytochrome c biogenesis protein CcmA; Provisional 99.19
PRK13647 274 cbiO cobalt transporter ATP-binding subunit; Provi 99.19
TIGR02314 343 ABC_MetN D-methionine ABC transporter, ATP-binding 99.19
TIGR02211 221 LolD_lipo_ex lipoprotein releasing system, ATP-bin 99.18
cd03293 220 ABC_NrtD_SsuB_transporters NrtD and SsuB are the A 99.18
PRK13651 305 cobalt transporter ATP-binding subunit; Provisiona 99.18
PRK10584 228 putative ABC transporter ATP-binding protein YbbA; 99.18
PRK10908 222 cell division protein FtsE; Provisional 99.18
PRK13645 289 cbiO cobalt transporter ATP-binding subunit; Provi 99.18
PRK006351809 excinuclease ABC subunit A; Provisional 99.18
PRK13539 207 cytochrome c biogenesis protein CcmA; Provisional 99.18
PRK13632 271 cbiO cobalt transporter ATP-binding subunit; Provi 99.18
COG3839 338 MalK ABC-type sugar transport systems, ATPase comp 99.18
COG1134 249 TagH ABC-type polysaccharide/polyol phosphate tran 99.18
COG1245591 Predicted ATPase, RNase L inhibitor (RLI) homolog 99.18
cd00820107 PEPCK_HprK Phosphoenolpyruvate carboxykinase (PEPC 99.18
TIGR02769 265 nickel_nikE nickel import ATP-binding protein NikE 99.18
TIGR02315 243 ABC_phnC phosphonate ABC transporter, ATP-binding 99.18
cd03225 211 ABC_cobalt_CbiO_domain1 Domain I of the ABC compon 99.18
COG4181 228 Predicted ABC-type transport system involved in ly 99.18
PRK11247 257 ssuB aliphatic sulfonates transport ATP-binding su 99.17
cd03258 233 ABC_MetN_methionine_transporter MetN (also known a 99.17
cd03230 173 ABC_DR_subfamily_A This family of ATP-binding prot 99.17
PRK13648 269 cbiO cobalt transporter ATP-binding subunit; Provi 99.17
cd03213 194 ABCG_EPDR ABCG transporters are involved in eye pi 99.17
cd03254 229 ABCC_Glucan_exporter_like Glucan exporter ATP-bind 99.17
PRK11248 255 tauB taurine transporter ATP-binding subunit; Prov 99.17
>KOG0054 consensus Multidrug resistance-associated protein/mitoxantrone resistance protein, ABC superfamily [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information 
Probab=100.00  E-value=1e-184  Score=1741.36  Aligned_cols=1040  Identities=48%  Similarity=0.795  Sum_probs=940.7

Q ss_pred             CCCCccCCh--hhHHHHHchHHHHHhhhcCCCCCCCCCCCCccCcHHHHHHHHHHHHHHhhccC--CchHHHHHHHHHhH
Q 000746          252 VCPERNASI--LSRTSFGWMTPLLQLGYKKPITEKDVWKLDTWDQTEILIEKFHRCWIEESQRS--KPWLLRALNNSFGG  327 (1303)
Q Consensus       252 ~~pe~~a~~--~s~~~f~Wl~~l~~~g~~~~L~~~dl~~l~~~~~s~~l~~~~~~~w~~~~~~~--~~~l~~~l~~~~~~  327 (1303)
                      ++|.+.++.  +|+++|||++|++++|||++|+.+|+|+++++|+++.+.++|++.|+++.+++  +|+++++++++|++
T Consensus       122 ~~~~~~~~~~~~S~~~f~W~~~l~~~g~k~~L~~~Dl~~l~~~d~s~~l~~~~~~~w~~~~~~~~~~psl~~al~~~f~~  201 (1381)
T KOG0054|consen  122 PNPLPEASAGFLSRLTFSWMTPLLRKGYKKPLELKDLWSLSPEDSSETLVKRLESLWEKELGRSGKKPSLLRALLRTFGR  201 (1381)
T ss_pred             CCcccccchhHHHHHHHHHHHHHHHhhccCCCChhhcccCChhhhhhHHHHHHHHHHHHHhccccCCcHHHHHHHHHHHH
Confidence            445555555  99999999999999999999999999999999999999999999999986544  78999999999999


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHhccC-CcchHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q 000746          328 RFWLGGLFKIGNDLSQFVGPVLLNHLLQSMQRG-DPAWIGYIYAFLIFVGVSFGVLTEAQYFQNVWRVGFRLRSTLVAAI  406 (1303)
Q Consensus       328 ~~~~~~~~~~~~~~~~~~~p~ll~~li~~~~~~-~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~lr~~L~~~i  406 (1303)
                      .++..+++.++.+...+++|.+++.++++++++ .+.+.||.++++++++.++.+++.++|++..++.++|+|.++..+|
T Consensus       202 ~~~~~~~~~~~~~~~~~~~P~lL~~li~~~~~~~~~~~~g~~~a~~lf~~~~l~~l~~~~~~~~~~~~g~r~R~al~~~I  281 (1381)
T KOG0054|consen  202 TFLLSGIFLFLRDLAGFVGPLLLKKLILFFSEKRLPLNNGYLLAVLLFLASLLQSLLLHQYFFVSFRVGMRLRSALISAI  281 (1381)
T ss_pred             HHHHHHHHHHHHHHHccccHHHHHHHHHHhcCCCcccchhHHHHHHHHHHHHHHHHHHhHHHHHHHhhhhhHHHHHHHHH
Confidence            999999999999999999999999999999876 4557789999999999999999999999999999999999999999


Q ss_pred             HHHHHcCCcccccCCChHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q 000746          407 FRKTLRLTHEARKGFPSGKVTNMITTDANALQQISQQLHGLWSAPFRITLSMVLLYQQLGVASLLGSLMLVLMVPLQTFI  486 (1303)
Q Consensus       407 ~~k~l~l~~~~~~~~~~g~i~nl~s~Dv~~i~~~~~~~~~~~~~~~~i~~~~~~l~~~lg~~~l~~~~~~~~~~~~~~~~  486 (1303)
                      |+|.|+++...+.+.+.|+++|+|++|+++++++..++|.+|.+|+|++++++++|..+|+++++|++++++++|++.++
T Consensus       282 Y~K~L~ls~~~~~~~t~G~ivNlms~D~~ri~~~~~~~h~~w~~Plqi~~~l~lLy~~LG~sa~~G~~~~il~~p~n~~~  361 (1381)
T KOG0054|consen  282 YRKALRLSNSARGETTVGEIVNLMSVDAQRLSDAACFLHLLWSAPLQIILALYLLYGLLGPSALAGVAVMVLLIPLNSFL  361 (1381)
T ss_pred             HHhhhcCchhhccCCCcchhhhhhhhhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhChHHHHHHHHHHHHHHHHHHH
Confidence            99999999999888999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHhhHHHHHHhccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhHHhHHh
Q 000746          487 ISKMRKLTKEGLQWTDRRVSLTNEILAAMDTVKCYAWEKSFQSRVQSIRDDELSWFRKAQFLSAFNSFILNSIPVVVTVV  566 (1303)
Q Consensus       487 ~~~~~~~~~~~~~~~~~r~~~~~e~l~gi~~IK~~~~e~~~~~~i~~~r~~e~~~~~~~~~~~~~~~~~~~~~~~~~~~~  566 (1303)
                      +++++++|++.|+.+|+|++.++|+|+|||+||+|+||+.|.+++++.|++|++..++..+..++..+.+...|.+++++
T Consensus       362 a~~~~~~q~~~m~~~D~Rik~~nEiL~~IkviK~yaWE~~F~~~I~~~R~~El~~lrk~~~~~~~~~~~~~~~p~lv~~~  441 (1381)
T KOG0054|consen  362 AKKIAKFQKRLMKRKDERIKLMNEILNGIKVIKLYAWEKPFLKKIEDLRQKELKLLRKSAYLSALNSFLNFFSPVLVSVV  441 (1381)
T ss_pred             HHHHHHHHHHHhhhhhHHHHHHHHHHhhhHhhhhHhhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             hhhhhh-hhCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhhcCCCC--CCCCCCCcEEE
Q 000746          567 SFGTFT-LLGGDLTPARAFTSLSLFAVLRFPLNMLPNLLSQVVNANVSLQRLEELLLAEERILMPNP--PLEPELPAVSI  643 (1303)
Q Consensus       567 ~f~~~~-~~~~~l~~~~~f~~l~l~~~l~~pl~~l~~~~~~~~~a~~s~~Ri~~~l~~~~~~~~~~~--~~~~~~~~i~~  643 (1303)
                      +|++|+ ..++.+++..+|+++++|+.++.|+..+|..+..+.++.+|++|+++|+..+|.......  +..+....+++
T Consensus       442 tF~~~v~~~~~~lt~~~aF~slalfniLr~pl~~~P~~i~~~vqa~VS~~Ri~~fl~~~e~~~~~~~~~~~~~~~~~i~i  521 (1381)
T KOG0054|consen  442 TFVVFVLLLGNLLTASTAFTSLALFNILRFPLFMLPSVISQLVQAKVSLKRLKEFLLSEELDPDSVERSPDEAGENAIEI  521 (1381)
T ss_pred             HHHHHhhccCccccHhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhcCcccCccccccCCCCCCCceEEE
Confidence            999999 667889999999999999999999999999999999999999999999998875433222  33345567999


Q ss_pred             EeeEEEeCCC--CCccceeeeEecCCcEEEEEcCCCCChHHHHHHHhcCCCCCCCceEEEcCeEEEEccCcccccccHHH
Q 000746          644 KNGNFSWDSK--SPTLSNINLDIPVGSLVAIVGGTGEGKTSLVSAMLGELPPLKDASVVIRGTVAYVPQISWIFNATLRK  721 (1303)
Q Consensus       644 ~~~~f~~~~~--~~~L~~i~l~i~~G~~~~ivG~sGsGKSTLl~~llg~~~~~~g~~~~~~~~iayv~Q~p~l~~~Tire  721 (1303)
                      +|++|+|+++  .+.|+||||+|++|+++||||++||||||||++|+||+++.+| .+.+++.+|||||+||||||||||
T Consensus       522 ~~~sfsW~~~~~~~tL~dIn~~i~~G~lvaVvG~vGsGKSSLL~AiLGEm~~~sG-~v~v~gsiaYv~Q~pWI~ngTvre  600 (1381)
T KOG0054|consen  522 KNGSFSWDSESPEPTLKDINFEIKKGQLVAVVGPVGSGKSSLLSAILGEMPKLSG-SVAVNGSVAYVPQQPWIQNGTVRE  600 (1381)
T ss_pred             eeeeEecCCCCCcccccceeEEecCCCEEEEECCCCCCHHHHHHHHhcCcccccc-eEEEcCeEEEeccccHhhCCcHHH
Confidence            9999999863  3699999999999999999999999999999999999999997 788999999999999999999999


Q ss_pred             HHccCCCCChhhHHHHHHHHhhHHHhhcCCCCCCccccCCCCCCchHHHHHHHHHHH-----------------------
Q 000746          722 NILFGSEFDPAKYWKTVDVSALQHDLDLLPDRDLTEIGERGVNISGGQKQRVSMARA-----------------------  778 (1303)
Q Consensus       722 NI~~g~~~~~~~~~~vl~~~~l~~~i~~lp~g~~T~ige~G~~LSGGQkQRiaLARA-----------------------  778 (1303)
                      ||+||+|||+++|++|+++|+|++|++.||+||+|+|||+|.||||||||||+||||                       
T Consensus       601 NILFG~~~d~~rY~~Vi~aC~L~~Dle~Lp~GD~TeIGErGinLSGGQKqRIsLARAVY~~adIYLLDDplSAVDahvg~  680 (1381)
T KOG0054|consen  601 NILFGSPYDEERYDKVIKACALKKDLEILPFGDLTEIGERGINLSGGQKQRISLARAVYQDADIYLLDDPLSAVDAHVGK  680 (1381)
T ss_pred             hhhcCccccHHHHHHHHHHccCHhHHhhcCCCCcceecCCccCCcHhHHHHHHHHHHHhccCCEEEEcCcchhhhHhhhH
Confidence            999999999999999999999999999999999999999999999999999999999                       


Q ss_pred             -HHHHHHhHhcCCCEEEEEecCCCcccccCEEEEEeCCEEEEecCHHHHHhcchHHHHHHHHhccchhhhhhhhcccccc
Q 000746          779 -VFNSCIKEELRGKTRILVTNQLHFLPHVDRIILVSEGMIKEEGSFEELSKHGRLFQKLMENAGKMEEMEEREEKDDSIN  857 (1303)
Q Consensus       779 -l~~~~i~~~~~~~TvilvtH~~~~l~~aD~ii~l~~G~i~~~g~~~~l~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~  857 (1303)
                       +|++|+++.+++||+|+|||++++++.||+|++|+||+|.++|+|+|+++.++.+.++..+.....+.+ .+.+  ..+
T Consensus       681 ~if~~ci~~~L~~KT~ILVTHql~~L~~ad~Iivl~~G~I~~~Gty~el~~~~~~~~~l~~~~~~~~~~~-~~~~--~~~  757 (1381)
T KOG0054|consen  681 HIFEECIRGLLRGKTVILVTHQLQFLPHADQIIVLKDGKIVESGTYEELLKSGGDFAELAHEEESEQEEE-ASEK--DLE  757 (1381)
T ss_pred             HHHHHHHHhhhcCCEEEEEeCchhhhhhCCEEEEecCCeEecccCHHHHHhcchhHHHHhhccchhhccc-cccc--ccc
Confidence             567899899999999999999999999999999999999999999999999999888843322111110 0000  000


Q ss_pred             cccccCcccccccccccCCCCCccccccccCCCcccchhhhhhcCccchhHHHHHHHHcCchHHHHHHHHHHHHHHHHHh
Q 000746          858 SNQEVSKPVANRAVQVNEFPKNESYTKKGKRGRSVLVKQEERETGIVSGSVLTRYKNALGGPWVIMILFACYLSTEVLRI  937 (1303)
Q Consensus       858 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~e~~~~g~v~~~vy~~y~~~~g~~~~~~~~~~~~~~~~~~~~  937 (1303)
                      .. ........+.....+  ...+..+..++...++.++|+++.|.|+|++|+.|+++.++++.+.+.+++.+..+++.+
T Consensus       758 ~~-~~~~~~~~~~~~~~~--~~~~~~~~~~~~~~~~~~~ee~~~G~v~~~vY~~Y~~a~~g~~~~~~~~~~~v~~~~~~~  834 (1381)
T KOG0054|consen  758 SG-ESSRESESRSLESLS--SEEEKSKDEKEEEDKLVQEEERETGKVSWSVYKKYIKAAGGFLLVLLILLLFVLTQVLQI  834 (1381)
T ss_pred             cc-ccccchhhhhhhhhc--ccccccccccchhhHHHHHHHHhcCEeeHHHHHHHHHhcccHHHHHHHHHHHHHHHHHHH
Confidence            00 000000000000000  000000111111234566788899999999999999997777777777778888899999


Q ss_pred             hhhHHHhhhcccccCCC---CCchHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcCcccccccCCc
Q 000746          938 SSSTWLSFWTDQSTSKN---YNPGFYIAIYTILAFGQVTVTLLNSYWLIISSLRAAKRLHDSMLNSILRAPMLFFHTNPI 1014 (1303)
Q Consensus       938 ~~~~~l~~w~~~~~~~~---~~~~~~~~i~~~l~~~~~~~~~~~~~~~~~~~~~~~~~lr~~l~~~ll~~p~~fFd~~~~ 1014 (1303)
                      +.++|+++|+++.....   .+..+|+++|.+++++..++.+++++++..++.+++++||++|+++++|+||+|||+||+
T Consensus       835 ~~~~WLs~W~~~~~~~~~~~~~~~~~~~vY~~l~~~~~~~~~~rs~~~~~~~l~aS~~Lh~~ml~~Ilrapm~FFdtTP~  914 (1381)
T KOG0054|consen  835 ASNYWLSYWTDDGEDNGTTTVSTSFYLGVYALLGVASSLLTLLRSFLFAKGGLKASRKLHDKLLNSILRAPMSFFDTTPT  914 (1381)
T ss_pred             HHHHHHHHhcCCcccccccCCCcchHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhCcchhcCCCCc
Confidence            99999999998764333   467889999999999999999999999999999999999999999999999999999999


Q ss_pred             chhHHHhhccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhhccc
Q 000746         1015 GRVINRFSRDLGDIDRNVASFVNMFMNQLWQLLSTFVLIGIVSTISLWAIMPLLILFYAAYLYYQSTAREVKRLDSITRS 1094 (1303)
Q Consensus      1015 G~ilnR~s~D~~~vd~~l~~~~~~~~~~~~~~i~~~v~i~~~~~~~~~~~~pl~~~~~~i~~~~~~~~r~l~r~~~~~~s 1094 (1303)
                      |||+||||+|++.+|..+|..+..++..++.++++++++++++|+++++++|+.++++++++||.+++|+++|+++.++|
T Consensus       915 GRILNRFSkD~~~vD~~Lp~~~~~~~~~~~~~l~~~~vi~~~~P~fli~~~pl~v~~~~~~~~Y~~tsReLkRLesitRS  994 (1381)
T KOG0054|consen  915 GRILNRFSKDIDTVDVLLPFTLEFFLQSLLNVLGILVVISYVTPWFLIAIIPLGVIYYFVQRYYLATSRELKRLESITRS  994 (1381)
T ss_pred             cchhhhcccchHHHHHhhHHHHHHHHHHHHHHHHHHHHhhHHhHHHHHHHHHHHHHHHHHHHHHHHHhHHHHHhhhcccc
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             hHHHHHHHHhcChhhHhhcCcHHHHHHHHHHHHHhhhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccCcccccc
Q 000746         1095 PVYAQFGEALNGLSTIRAFKAYDRMAKINGKSMDNNIRFTLANTSSNRWLTIRLETLGGIMIWLIATFAVMQNGRAENQV 1174 (1303)
Q Consensus      1095 ~l~s~~~E~l~Gi~tIrAf~~e~~~~~~~~~~~d~~~~~~~~~~~~~~wl~~~l~~~~~~~~~~~~~~~v~~~~~~~~~~ 1174 (1303)
                      |+++||+|+++|+.|||||++|++|.+++.+++|.+.++.+....++||+++|+|++++++++.++.+++......    
T Consensus       995 Pi~sh~~Etl~GlsTIRAf~~~~rf~~~~~~~~D~~~~~~f~~~~a~RWla~Rle~ig~~~v~~~al~~vl~~~~~---- 1070 (1381)
T KOG0054|consen  995 PIYSHFSETLQGLSTIRAFGKEERFIQENDELIDENSRAFFLSISANRWLAVRLELLGNLVVLIAALFAVLLPSGL---- 1070 (1381)
T ss_pred             hHHHhHHHHhcCcceeeeccccHHHHHHHHHHhhhhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccCCC----
Confidence            9999999999999999999999999999999999999999999999999999999999999999988888765421    


Q ss_pred             cchhHHHHHHHHHHHHHHHHHHHHHHHHHHhhhhhHHHHHHHhhcCCCCCCCCCCCCCCCCCCCCcceEEEEEEEEEeCC
Q 000746         1175 AFASTMGLLLSYTLNITNLLSGVLRQASRAENSLNAVERVGTYIDLPSEAPGMVESNRPPPAWPSSGSIKFEDVVLRYRP 1254 (1303)
Q Consensus      1175 ~~~~~~gl~l~~~~~l~~~l~~~~~~~~~~e~~~~sveRi~~~~~~~~E~~~~~~~~~~~~~wp~~G~I~f~nVsf~Y~~ 1254 (1303)
                      ..+|.+|++++|++++++.+++++|+.+++|+.|+|+|||.||.++|+|.|...+...||+.||.+|+|+|+|+++||+|
T Consensus      1071 ~~~g~vGLslsyal~lt~~l~~~vR~~~elEn~m~SVERv~eY~~~~~E~p~~~~~~~pp~~WP~~G~I~f~~~~~RYrp 1150 (1381)
T KOG0054|consen 1071 ISPGLVGLSLSYALQLTGLLQWLVRQSSELENNMVSVERVLEYTDIPSEAPLEIEESRPPPSWPSKGEIEFEDLSLRYRP 1150 (1381)
T ss_pred             CCcchHHHHHHHHHHHHHHHHHHHHHHHHHHhcchhhhHHHHHhcCCCCCCCCCcCCCCCCCCCCCCeEEEEEeEEEeCC
Confidence            23799999999999999999999999999999999999999999999986665555558899999999999999999999


Q ss_pred             CCCCccccceeeecCCCEEEEECCCCCCHHHHHHHHhhcccCCCCeee
Q 000746         1255 ELPPVLHGLSFTVSPSEKVGIVGRTGAGKSSMLNALFRIVELERGENI 1302 (1303)
Q Consensus      1255 ~~~~VLk~Isl~I~~GekVaIVGrTGSGKSTLi~lL~R~yd~~~G~I~ 1302 (1303)
                      +.|+|||||||+|+||||||||||||||||||+++|+|+.||.+|+|.
T Consensus      1151 ~lp~VLk~is~~I~p~eKVGIVGRTGaGKSSL~~aLFRl~e~~~G~I~ 1198 (1381)
T KOG0054|consen 1151 NLPLVLKGISFTIKPGEKVGIVGRTGAGKSSLILALFRLVEPAEGEIL 1198 (1381)
T ss_pred             CCcchhcCceEEEcCCceEEEeCCCCCCHHHHHHHHHHhcCccCCeEE
Confidence            999999999999999999999999999999999999999999999985

>PLN03130 ABC transporter C family member; Provisional Back     alignment and domain information
>PLN03232 ABC transporter C family member; Provisional Back     alignment and domain information
>TIGR00957 MRP_assoc_pro multi drug resistance-associated protein (MRP) Back     alignment and domain information
>TIGR01271 CFTR_protein cystic fibrosis transmembrane conductor regulator (CFTR) Back     alignment and domain information
>PTZ00243 ABC transporter; Provisional Back     alignment and domain information
>KOG0055 consensus Multidrug/pheromone exporter, ABC superfamily [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PTZ00265 multidrug resistance protein (mdr1); Provisional Back     alignment and domain information
>KOG0058 consensus Peptide exporter, ABC superfamily [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>COG2274 SunT ABC-type bacteriocin/lantibiotic exporters, contain an N-terminal double-glycine peptidase domain [Defense mechanisms] Back     alignment and domain information
>PRK11174 cysteine/glutathione ABC transporter membrane/ATP-binding component; Reviewed Back     alignment and domain information
>TIGR03797 NHPM_micro_ABC2 NHPM bacteriocin system ABC transporter, ATP-binding protein Back     alignment and domain information
>TIGR00958 3a01208 Conjugate Transporter-2 (CT2) Family protein Back     alignment and domain information
>TIGR03796 NHPM_micro_ABC1 NHPM bacteriocin system ABC transporter, peptidase/ATP-binding protein Back     alignment and domain information
>TIGR01193 bacteriocin_ABC ABC-type bacteriocin transporter Back     alignment and domain information
>KOG0055 consensus Multidrug/pheromone exporter, ABC superfamily [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>TIGR03375 type_I_sec_LssB type I secretion system ATPase, LssB family Back     alignment and domain information
>PRK11176 lipid transporter ATP-binding/permease protein; Provisional Back     alignment and domain information
>COG4988 CydD ABC-type transport system involved in cytochrome bd biosynthesis, ATPase and permease components [Energy production and conversion / Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG1132 MdlB ABC-type multidrug transport system, ATPase and permease components [Defense mechanisms] Back     alignment and domain information
>TIGR02203 MsbA_lipidA lipid A export permease/ATP-binding protein MsbA Back     alignment and domain information
>PRK10790 putative multidrug transporter membrane\ATP-binding components; Provisional Back     alignment and domain information
>PRK11160 cysteine/glutathione ABC transporter membrane/ATP-binding component; Reviewed Back     alignment and domain information
>PRK13657 cyclic beta-1,2-glucan ABC transporter; Provisional Back     alignment and domain information
>TIGR01846 type_I_sec_HlyB type I secretion system ABC transporter, HlyB family Back     alignment and domain information
>TIGR02204 MsbA_rel ABC transporter, permease/ATP-binding protein Back     alignment and domain information
>TIGR02868 CydC thiol reductant ABC exporter, CydC subunit Back     alignment and domain information
>PRK10789 putative multidrug transporter membrane\ATP-binding components; Provisional Back     alignment and domain information
>TIGR00957 MRP_assoc_pro multi drug resistance-associated protein (MRP) Back     alignment and domain information
>COG4987 CydC ABC-type transport system involved in cytochrome bd biosynthesis, fused ATPase and permease components [Energy production and conversion / Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR01192 chvA glucan exporter ATP-binding protein Back     alignment and domain information
>PTZ00265 multidrug resistance protein (mdr1); Provisional Back     alignment and domain information
>PLN03130 ABC transporter C family member; Provisional Back     alignment and domain information
>TIGR01842 type_I_sec_PrtD type I secretion system ABC transporter, PrtD family Back     alignment and domain information
>TIGR02857 CydD thiol reductant ABC exporter, CydD subunit Back     alignment and domain information
>KOG0057 consensus Mitochondrial Fe/S cluster exporter, ABC superfamily [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PTZ00243 ABC transporter; Provisional Back     alignment and domain information
>PLN03232 ABC transporter C family member; Provisional Back     alignment and domain information
>KOG0056 consensus Heavy metal exporter HMT1, ABC superfamily [Inorganic ion transport and metabolism] Back     alignment and domain information
>KOG0054 consensus Multidrug resistance-associated protein/mitoxantrone resistance protein, ABC superfamily [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>COG4618 ArpD ABC-type protease/lipase transport system, ATPase and permease components [General function prediction only] Back     alignment and domain information
>TIGR01271 CFTR_protein cystic fibrosis transmembrane conductor regulator (CFTR) Back     alignment and domain information
>TIGR01194 cyc_pep_trnsptr cyclic peptide transporter Back     alignment and domain information
>COG5265 ATM1 ABC-type transport system involved in Fe-S cluster assembly, permease and ATPase components [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK10522 multidrug transporter membrane component/ATP-binding component; Provisional Back     alignment and domain information
>TIGR00954 3a01203 Peroxysomal Fatty Acyl CoA Transporter (FAT) Family protei Back     alignment and domain information
>KOG0058 consensus Peptide exporter, ABC superfamily [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>COG2274 SunT ABC-type bacteriocin/lantibiotic exporters, contain an N-terminal double-glycine peptidase domain [Defense mechanisms] Back     alignment and domain information
>TIGR02868 CydC thiol reductant ABC exporter, CydC subunit Back     alignment and domain information
>TIGR00958 3a01208 Conjugate Transporter-2 (CT2) Family protein Back     alignment and domain information
>TIGR01193 bacteriocin_ABC ABC-type bacteriocin transporter Back     alignment and domain information
>PRK11160 cysteine/glutathione ABC transporter membrane/ATP-binding component; Reviewed Back     alignment and domain information
>TIGR03797 NHPM_micro_ABC2 NHPM bacteriocin system ABC transporter, ATP-binding protein Back     alignment and domain information
>TIGR03796 NHPM_micro_ABC1 NHPM bacteriocin system ABC transporter, peptidase/ATP-binding protein Back     alignment and domain information
>TIGR02857 CydD thiol reductant ABC exporter, CydD subunit Back     alignment and domain information
>COG1132 MdlB ABC-type multidrug transport system, ATPase and permease components [Defense mechanisms] Back     alignment and domain information
>PRK11174 cysteine/glutathione ABC transporter membrane/ATP-binding component; Reviewed Back     alignment and domain information
>TIGR03375 type_I_sec_LssB type I secretion system ATPase, LssB family Back     alignment and domain information
>PRK10790 putative multidrug transporter membrane\ATP-binding components; Provisional Back     alignment and domain information
>TIGR01846 type_I_sec_HlyB type I secretion system ABC transporter, HlyB family Back     alignment and domain information
>PRK11176 lipid transporter ATP-binding/permease protein; Provisional Back     alignment and domain information
>PRK14257 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR01194 cyc_pep_trnsptr cyclic peptide transporter Back     alignment and domain information
>TIGR02203 MsbA_lipidA lipid A export permease/ATP-binding protein MsbA Back     alignment and domain information
>TIGR01192 chvA glucan exporter ATP-binding protein Back     alignment and domain information
>COG4615 PvdE ABC-type siderophore export system, fused ATPase and permease components [Secondary metabolites biosynthesis, transport, and catabolism / Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK10789 putative multidrug transporter membrane\ATP-binding components; Provisional Back     alignment and domain information
>TIGR02204 MsbA_rel ABC transporter, permease/ATP-binding protein Back     alignment and domain information
>cd03289 ABCC_CFTR2 The CFTR subfamily domain 2 Back     alignment and domain information
>PRK13657 cyclic beta-1,2-glucan ABC transporter; Provisional Back     alignment and domain information
>KOG0056 consensus Heavy metal exporter HMT1, ABC superfamily [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK10522 multidrug transporter membrane component/ATP-binding component; Provisional Back     alignment and domain information
>TIGR01842 type_I_sec_PrtD type I secretion system ABC transporter, PrtD family Back     alignment and domain information
>COG4987 CydC ABC-type transport system involved in cytochrome bd biosynthesis, fused ATPase and permease components [Energy production and conversion / Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG4178 ABC-type uncharacterized transport system, permease and ATPase components [General function prediction only] Back     alignment and domain information
>TIGR00956 3a01205 Pleiotropic Drug Resistance (PDR) Family protein Back     alignment and domain information
>COG1126 GlnQ ABC-type polar amino acid transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>COG4988 CydD ABC-type transport system involved in cytochrome bd biosynthesis, ATPase and permease components [Energy production and conversion / Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR00954 3a01203 Peroxysomal Fatty Acyl CoA Transporter (FAT) Family protei Back     alignment and domain information
>COG1123 ATPase components of various ABC-type transport systems, contain duplicated ATPase [General function prediction only] Back     alignment and domain information
>cd03291 ABCC_CFTR1 The CFTR subfamily domain 1 Back     alignment and domain information
>KOG0057 consensus Mitochondrial Fe/S cluster exporter, ABC superfamily [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>cd03252 ABCC_Hemolysin The ABC-transporter hemolysin B is a central component of the secretion machinery that translocates the toxin, hemolysin A, in a Sec-independent fashion across both membranes of E Back     alignment and domain information
>cd03288 ABCC_SUR2 The SUR domain 2 Back     alignment and domain information
>COG1117 PstB ABC-type phosphate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>cd03250 ABCC_MRP_domain1 Domain 1 of the ABC subfamily C Back     alignment and domain information
>COG1135 AbcC ABC-type metal ion transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>TIGR03719 ABC_ABC_ChvD ATP-binding cassette protein, ChvD family Back     alignment and domain information
>COG1125 OpuBA ABC-type proline/glycine betaine transport systems, ATPase components [Amino acid transport and metabolism] Back     alignment and domain information
>COG3839 MalK ABC-type sugar transport systems, ATPase components [Carbohydrate transport and metabolism] Back     alignment and domain information
>COG1116 TauB ABC-type nitrate/sulfonate/bicarbonate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>cd03254 ABCC_Glucan_exporter_like Glucan exporter ATP-binding protein Back     alignment and domain information
>COG3842 PotA ABC-type spermidine/putrescine transport systems, ATPase components [Amino acid transport and metabolism] Back     alignment and domain information
>PRK11819 putative ABC transporter ATP-binding protein; Reviewed Back     alignment and domain information
>cd03253 ABCC_ATM1_transporter ATM1 is an ABC transporter that is expressed in the mitochondria Back     alignment and domain information
>TIGR03269 met_CoM_red_A2 methyl coenzyme M reductase system, component A2 Back     alignment and domain information
>PRK15064 ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>COG1120 FepC ABC-type cobalamin/Fe3+-siderophores transport systems, ATPase components [Inorganic ion transport and metabolism / Coenzyme metabolism] Back     alignment and domain information
>cd03251 ABCC_MsbA MsbA is an essential ABC transporter, closely related to eukaryotic MDR proteins Back     alignment and domain information
>cd03244 ABCC_MRP_domain2 Domain 2 of the ABC subfamily C Back     alignment and domain information
>TIGR01257 rim_protein retinal-specific rim ABC transporter Back     alignment and domain information
>COG1127 Ttg2A ABC-type transport system involved in resistance to organic solvents, ATPase component [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>PRK10261 glutathione transporter ATP-binding protein; Provisional Back     alignment and domain information
>COG3840 ThiQ ABC-type thiamine transport system, ATPase component [Coenzyme metabolism] Back     alignment and domain information
>PRK13549 xylose transporter ATP-binding subunit; Provisional Back     alignment and domain information
>COG1118 CysA ABC-type sulfate/molybdate transport systems, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>COG1121 ZnuC ABC-type Mn/Zn transport systems, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK09700 D-allose transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03249 ABC_MTABC3_MDL1_MDL2 MTABC3 (also known as ABCB6) is a mitochondrial ATP-binding cassette protein involved in iron homeostasis and one of four ABC transporters expressed in the mitochondrial inner membrane, the other three being MDL1(ABC7), MDL2, and ATM1 Back     alignment and domain information
>PRK10938 putative molybdenum transport ATP-binding protein ModF; Provisional Back     alignment and domain information
>PRK15134 microcin C ABC transporter ATP-binding protein YejF; Provisional Back     alignment and domain information
>COG1136 SalX ABC-type antimicrobial peptide transport system, ATPase component [Defense mechanisms] Back     alignment and domain information
>PRK11288 araG L-arabinose transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03245 ABCC_bacteriocin_exporters ABC-type bacteriocin exporters Back     alignment and domain information
>COG2884 FtsE Predicted ATPase involved in cell division [Cell division and chromosome partitioning] Back     alignment and domain information
>TIGR02633 xylG D-xylose ABC transporter, ATP-binding protein Back     alignment and domain information
>COG3638 ABC-type phosphate/phosphonate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK13631 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PLN03140 ABC transporter G family member; Provisional Back     alignment and domain information
>COG1122 CbiO ABC-type cobalt transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK11650 ugpC glycerol-3-phosphate transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03290 ABCC_SUR1_N The SUR domain 1 Back     alignment and domain information
>PRK10636 putative ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>COG5265 ATM1 ABC-type transport system involved in Fe-S cluster assembly, permease and ATPase components [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0060 consensus Long-chain acyl-CoA transporter, ABC superfamily (involved in peroxisome organization and biogenesis) [Lipid transport and metabolism; General function prediction only] Back     alignment and domain information
>COG1124 DppF ABC-type dipeptide/oligopeptide/nickel transport system, ATPase component [Amino acid transport and metabolism / Inorganic ion transport and metabolism] Back     alignment and domain information
>TIGR02314 ABC_MetN D-methionine ABC transporter, ATP-binding protein Back     alignment and domain information
>cd03369 ABCC_NFT1 Domain 2 of NFT1 (New full-length MRP-type transporter 1) Back     alignment and domain information
>cd03261 ABC_Org_Solvent_Resistant ABC (ATP-binding cassette) transport system involved in resistant to organic solvents; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules Back     alignment and domain information
>PRK11432 fbpC ferric transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13650 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK09452 potA putrescine/spermidine ABC transporter ATPase protein; Reviewed Back     alignment and domain information
>PRK13647 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03248 ABCC_TAP TAP, the Transporter Associated with Antigen Processing; TAP is essential for peptide delivery from the cytosol into the lumen of the endoplasmic reticulum (ER), where these peptides are loaded on major histocompatibility complex (MHC) I molecules Back     alignment and domain information
>PRK13637 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>COG0488 Uup ATPase components of ABC transporters with duplicated ATPase domains [General function prediction only] Back     alignment and domain information
>PRK13643 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK11147 ABC transporter ATPase component; Reviewed Back     alignment and domain information
>cd03260 ABC_PstB_phosphate_transporter Phosphate uptake is of fundamental importance in the cell physiology of bacteria because phosphate is required as a nutrient Back     alignment and domain information
>PRK13651 cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR03265 PhnT2 putative 2-aminoethylphosphonate ABC transporter, ATP-binding protein Back     alignment and domain information
>PRK14269 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK13634 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13635 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13640 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK14250 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03296 ABC_CysA_sulfate_importer Part of the ABC transporter complex cysAWTP involved in sulfate import Back     alignment and domain information
>COG0410 LivF ABC-type branched-chain amino acid transport systems, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>PRK13646 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR03258 PhnT 2-aminoethylphosphonate ABC transport system, ATP-binding component PhnT Back     alignment and domain information
>PRK14242 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK10851 sulfate/thiosulfate transporter subunit; Provisional Back     alignment and domain information
>TIGR02315 ABC_phnC phosphonate ABC transporter, ATP-binding protein Back     alignment and domain information
>PRK13636 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK14273 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK11000 maltose/maltodextrin transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK13644 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR00972 3a0107s01c2 phosphate ABC transporter, ATP-binding protein Back     alignment and domain information
>cd03263 ABC_subfamily_A The ABCA subfamily mediates the transport of a variety of lipid compounds Back     alignment and domain information
>TIGR01186 proV glycine betaine/L-proline transport ATP binding subunit Back     alignment and domain information
>cd03256 ABC_PhnC_transporter ABC-type phosphate/phosphonate transport system Back     alignment and domain information
>PRK10744 pstB phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03258 ABC_MetN_methionine_transporter MetN (also known as YusC) is an ABC-type transporter encoded by metN of the metNPQ operon in Bacillus subtilis that is involved in methionine transport Back     alignment and domain information
>cd03219 ABC_Mj1267_LivG_branched The Mj1267/LivG ABC transporter subfamily is involved in the transport of the hydrophobic amino acids leucine, isoleucine and valine Back     alignment and domain information
>cd03226 ABC_cobalt_CbiO_domain2 Domain II of the ABC component of a cobalt transport family found in bacteria, archaea, and eukaryota Back     alignment and domain information
>PRK14237 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK11153 metN DL-methionine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13632 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03259 ABC_Carb_Solutes_like ABC Carbohydrate and Solute Transporters-like subgroup Back     alignment and domain information
>PRK13633 cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03293 ABC_NrtD_SsuB_transporters NrtD and SsuB are the ATP-binding subunits of the bacterial ABC-type nitrate and sulfonate transport systems, respectively Back     alignment and domain information
>PRK14235 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03255 ABC_MJ0796_Lo1CDE_FtsE This family is comprised of MJ0796 ATP-binding cassette, macrolide-specific ABC-type efflux carrier (MacAB), and proteins involved in cell division (FtsE), and release of liporoteins from the cytoplasmic membrane (LolCDE) Back     alignment and domain information
>PLN03073 ABC transporter F family; Provisional Back     alignment and domain information
>PRK13652 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK11247 ssuB aliphatic sulfonates transport ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR03864 PQQ_ABC_ATP ABC transporter, ATP-binding subunit, PQQ-dependent alcohol dehydrogenase system Back     alignment and domain information
>PRK14248 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK11607 potG putrescine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK14249 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03265 ABC_DrrA DrrA is the ATP-binding protein component of a bacterial exporter complex that confers resistance to the antibiotics daunorubicin and doxorubicin Back     alignment and domain information
>PRK14239 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14274 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14236 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK09536 btuD corrinoid ABC transporter ATPase; Reviewed Back     alignment and domain information
>cd03294 ABC_Pro_Gly_Bertaine This family comprises the glycine betaine/L-proline ATP binding subunit in bacteria and its equivalents in archaea Back     alignment and domain information
>PRK14245 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR00960 3a0501s02 Type II (General) Secretory Pathway (IISP) Family protein Back     alignment and domain information
>cd03247 ABCC_cytochrome_bd The CYD subfamily implicated in cytochrome bd biogenesis Back     alignment and domain information
>PRK14244 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03295 ABC_OpuCA_Osmoprotection OpuCA is a the ATP binding component of a bacterial solute transporter that serves a protective role to cells growing in a hyperosmolar environment Back     alignment and domain information
>PRK13642 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03224 ABC_TM1139_LivF_branched LivF (TM1139) is part of the LIV-I bacterial ABC-type two-component transport system that imports neutral, branched-chain amino acids Back     alignment and domain information
>PRK14252 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK13639 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK14251 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14268 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14240 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK11629 lolD lipoprotein transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13648 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK14259 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK13645 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK14270 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK13641 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03301 ABC_MalK_N The N-terminal ATPase domain of the maltose transporter, MalK Back     alignment and domain information
>PRK14254 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14238 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03268 ABC_BcrA_bacitracin_resist The BcrA subfamily represents ABC transporters involved in peptide antibiotic resistance Back     alignment and domain information
>cd03266 ABC_NatA_sodium_exporter NatA is the ATPase component of a bacterial ABC-type Na+ transport system called NatAB, which catalyzes ATP-dependent electrogenic Na+ extrusion without mechanically coupled proton or K+ uptake Back     alignment and domain information
>PRK10771 thiQ thiamine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK10575 iron-hydroxamate transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13537 nodulation ABC transporter NodI; Provisional Back     alignment and domain information
>cd03223 ABCD_peroxisomal_ALDP Peroxisomal ATP-binding cassette transporter (Pat) is involved in the import of very long-chain fatty acids (VLCFA) into the peroxisome Back     alignment and domain information
>PRK10619 histidine/lysine/arginine/ornithine transporter subunit; Provisional Back     alignment and domain information
>PRK13649 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK14247 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR03005 ectoine_ehuA ectoine/hydroxyectoine ABC transporter, ATP-binding protein Back     alignment and domain information
>PRK14253 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03218 ABC_YhbG The ABC transporters belonging to the YhbG family are similar to members of the Mj1267_LivG family, which is involved in the transport of branched-chain amino acids Back     alignment and domain information
>PRK09493 glnQ glutamine ABC transporter ATP-binding protein; Reviewed Back     alignment and domain information
>PRK14271 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14267 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14262 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03264 ABC_drug_resistance_like ABC-type multidrug transport system, ATPase component Back     alignment and domain information
>PRK14261 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14243 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03298 ABC_ThiQ_thiamine_transporter ABC-type thiamine tranport system; part of the binding-protein-dependent transport system tbpA-thiPQ for thiamine and TPP Back     alignment and domain information
>PRK15079 oligopeptide ABC transporter ATP-binding protein OppF; Provisional Back     alignment and domain information
>cd03235 ABC_Metallic_Cations ABC component of the metal-type transporters Back     alignment and domain information
>TIGR03411 urea_trans_UrtD urea ABC transporter, ATP-binding protein UrtD Back     alignment and domain information
>PRK09984 phosphonate/organophosphate ester transporter subunit; Provisional Back     alignment and domain information
>PRK13548 hmuV hemin importer ATP-binding subunit; Provisional Back     alignment and domain information
>PRK10584 putative ABC transporter ATP-binding protein YbbA; Provisional Back     alignment and domain information
>PRK11831 putative ABC transporter ATP-binding protein YrbF; Provisional Back     alignment and domain information
>PRK10247 putative ABC transporter ATP-binding protein YbbL; Provisional Back     alignment and domain information
>PRK11124 artP arginine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR03415 ABC_choXWV_ATP choline ABC transporter, ATP-binding protein Back     alignment and domain information
>PRK10070 glycine betaine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR03410 urea_trans_UrtE urea ABC transporter, ATP-binding protein UrtE Back     alignment and domain information
>PRK11264 putative amino-acid ABC transporter ATP-binding protein YecC; Provisional Back     alignment and domain information
>PRK10895 lipopolysaccharide ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR02211 LolD_lipo_ex lipoprotein releasing system, ATP-binding protein Back     alignment and domain information
>PRK14275 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR02769 nickel_nikE nickel import ATP-binding protein NikE Back     alignment and domain information
>cd03257 ABC_NikE_OppD_transporters The ABC transporter subfamily specific for the transport of dipeptides, oligopeptides (OppD), and nickel (NikDE) Back     alignment and domain information
>TIGR02673 FtsE cell division ATP-binding protein FtsE Back     alignment and domain information
>PRK14256 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03300 ABC_PotA_N PotA is an ABC-type transporter and the ATPase component of the spermidine/putrescine-preferential uptake system consisting of PotA, -B, -C, and -D Back     alignment and domain information
>TIGR00968 3a0106s01 sulfate ABC transporter, ATP-binding protein Back     alignment and domain information
>PRK14264 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK11231 fecE iron-dicitrate transporter ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR03873 F420-0_ABC_ATP proposed F420-0 ABC transporter, ATP-binding protein Back     alignment and domain information
>cd03292 ABC_FtsE_transporter FtsE is a hydrophilic nucleotide-binding protein that binds FtsX to form a heterodimeric ATP-binding cassette (ABC)-type transporter that associates with the bacterial inner membrane Back     alignment and domain information
>PRK14266 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03299 ABC_ModC_like Archeal protein closely related to ModC Back     alignment and domain information
>TIGR01288 nodI ATP-binding ABC transporter family nodulation protein NodI Back     alignment and domain information
>cd03269 ABC_putative_ATPase This subfamily is involved in drug resistance, nodulation, lipid transport, and bacteriocin and lantibiotic immunity Back     alignment and domain information
>PRK13638 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK11614 livF leucine/isoleucine/valine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK11144 modC molybdate transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14263 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14265 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK10253 iron-enterobactin transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK11300 livG leucine/isoleucine/valine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR01277 thiQ thiamine ABC transporter, ATP-binding protein Back     alignment and domain information
>PRK10908 cell division protein FtsE; Provisional Back     alignment and domain information
>PRK13536 nodulation factor exporter subunit NodI; Provisional Back     alignment and domain information
>PRK11308 dppF dipeptide transporter ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR03522 GldA_ABC_ATP gliding motility-associated ABC transporter ATP-binding subunit GldA Back     alignment and domain information
>PRK14260 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR03740 galliderm_ABC gallidermin-class lantibiotic protection ABC transporter, ATP-binding subunit Back     alignment and domain information
>PRK09544 znuC high-affinity zinc transporter ATPase; Reviewed Back     alignment and domain information
>PRK14246 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK11248 tauB taurine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK14272 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03225 ABC_cobalt_CbiO_domain1 Domain I of the ABC component of a cobalt transport family found in bacteria, archaea, and eukaryota Back     alignment and domain information
>PRK14255 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03246 ABCC_Protease_Secretion This family represents the ABC component of the protease secretion system PrtD, a 60-kDa integral membrane protein sharing 37% identity with HlyB, the ABC component of the alpha-hemolysin secretion pathway, in the C-terminal domain Back     alignment and domain information
>PRK10418 nikD nickel transporter ATP-binding protein NikD; Provisional Back     alignment and domain information
>PRK13547 hmuV hemin importer ATP-binding subunit; Provisional Back     alignment and domain information
>cd03262 ABC_HisP_GlnQ_permeases HisP and GlnQ are the ATP-binding components of the bacterial periplasmic histidine and glutamine permeases, repectively Back     alignment and domain information
>PRK15112 antimicrobial peptide ABC system ATP-binding protein SapF; Provisional Back     alignment and domain information
>PRK14258 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK11701 phnK phosphonate C-P lyase system protein PhnK; Provisional Back     alignment and domain information
>TIGR01978 sufC FeS assembly ATPase SufC Back     alignment and domain information
>PRK11022 dppD dipeptide transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK14241 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03234 ABCG_White The White subfamily represents ABC transporters homologous to the Drosophila white gene, which acts as a dimeric importer for eye pigment precursors Back     alignment and domain information
>PRK15056 manganese/iron transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK09473 oppD oligopeptide transporter ATP-binding component; Provisional Back     alignment and domain information
>TIGR02982 heterocyst_DevA ABC exporter ATP-binding subunit, DevA family Back     alignment and domain information
>cd03213 ABCG_EPDR ABCG transporters are involved in eye pigment (EP) precursor transport, regulation of lipid-trafficking mechanisms, and pleiotropic drug resistance (DR) Back     alignment and domain information
>TIGR02142 modC_ABC molybdenum ABC transporter, ATP-binding protein Back     alignment and domain information
>COG4181 Predicted ABC-type transport system involved in lysophospholipase L1 biosynthesis, ATPase component [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>TIGR01188 drrA daunorubicin resistance ABC transporter ATP-binding subunit Back     alignment and domain information
>PRK10419 nikE nickel transporter ATP-binding protein NikE; Provisional Back     alignment and domain information
>COG4175 ProV ABC-type proline/glycine betaine transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>COG4619 ABC-type uncharacterized transport system, ATPase component [General function prediction only] Back     alignment and domain information
>PRK15093 antimicrobial peptide ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03232 ABC_PDR_domain2 The pleiotropic drug resistance-like (PDR) family of ATP-binding cassette (ABC) transporters Back     alignment and domain information
>COG4559 ABC-type hemin transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>COG4615 PvdE ABC-type siderophore export system, fused ATPase and permease components [Secondary metabolites biosynthesis, transport, and catabolism / Inorganic ion transport and metabolism] Back     alignment and domain information
>cd03228 ABCC_MRP_Like The MRP (Mutidrug Resistance Protein)-like transporters are involved in drug, peptide, and lipid export Back     alignment and domain information
>COG1131 CcmA ABC-type multidrug transport system, ATPase component [Defense mechanisms] Back     alignment and domain information
>TIGR02323 CP_lyasePhnK phosphonate C-P lyase system protein PhnK Back     alignment and domain information
>COG1137 YhbG ABC-type (unclassified) transport system, ATPase component [General function prediction only] Back     alignment and domain information
>cd03230 ABC_DR_subfamily_A This family of ATP-binding proteins belongs to a multisubunit transporter involved in drug resistance (BcrA and DrrA), nodulation, lipid transport, and lantibiotic immunity Back     alignment and domain information
>cd03233 ABC_PDR_domain1 The pleiotropic drug resistance (PDR) family of ATP-binding cassette (ABC) transporters Back     alignment and domain information
>PRK13546 teichoic acids export protein ATP-binding subunit; Provisional Back     alignment and domain information
>cd03297 ABC_ModC_molybdenum_transporter ModC is an ABC-type transporter and the ATPase component of a molybdate transport system that also includes the periplasmic binding protein ModA and the membrane protein ModB Back     alignment and domain information
>COG1123 ATPase components of various ABC-type transport systems, contain duplicated ATPase [General function prediction only] Back     alignment and domain information
>PRK15439 autoinducer 2 ABC transporter ATP-binding protein LsrA; Provisional Back     alignment and domain information
>cd03229 ABC_Class3 This class is comprised of all BPD (Binding Protein Dependent) systems that are largely represented in archaea and eubacteria and are primarily involved in scavenging solutes from the environment Back     alignment and domain information
>PRK13545 tagH teichoic acids export protein ATP-binding subunit; Provisional Back     alignment and domain information
>COG4555 NatA ABC-type Na+ transport system, ATPase component [Energy production and conversion / Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK10261 glutathione transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03215 ABC_Carb_Monos_II This family represents domain II of the carbohydrate uptake proteins that transport only monosaccharides (Monos) Back     alignment and domain information
>CHL00131 ycf16 sulfate ABC transporter protein; Validated Back     alignment and domain information
>COG0411 LivG ABC-type branched-chain amino acid transport systems, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR03608 L_ocin_972_ABC putative bacteriocin export ABC transporter, lactococcin 972 group Back     alignment and domain information
>COG4604 CeuD ABC-type enterochelin transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK03695 vitamin B12-transporter ATPase; Provisional Back     alignment and domain information
>cd03217 ABC_FeS_Assembly ABC-type transport system involved in Fe-S cluster assembly, ATPase component Back     alignment and domain information
>COG4525 TauB ABC-type taurine transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>COG4148 ModC ABC-type molybdate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK10762 D-ribose transporter ATP binding protein; Provisional Back     alignment and domain information
>PRK09580 sufC cysteine desulfurase ATPase component; Reviewed Back     alignment and domain information
>TIGR00955 3a01204 The Eye Pigment Precursor Transporter (EPP) Family protein Back     alignment and domain information
>TIGR01184 ntrCD nitrate transport ATP-binding subunits C and D Back     alignment and domain information
>COG0444 DppD ABC-type dipeptide/oligopeptide/nickel transport system, ATPase component [Amino acid transport and metabolism / Inorganic ion transport and metabolism] Back     alignment and domain information
>TIGR02770 nickel_nikD nickel import ATP-binding protein NikD Back     alignment and domain information
>PRK13543 cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>PRK15177 Vi polysaccharide export ATP-binding protein VexC; Provisional Back     alignment and domain information
>PRK13540 cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>TIGR03269 met_CoM_red_A2 methyl coenzyme M reductase system, component A2 Back     alignment and domain information
>cd03231 ABC_CcmA_heme_exporter CcmA, the ATP-binding component of the bacterial CcmAB transporter Back     alignment and domain information
>PLN03211 ABC transporter G-25; Provisional Back     alignment and domain information
>cd03267 ABC_NatA_like Similar in sequence to NatA, this is the ATPase component of a bacterial ABC-type Na+ transport system called NatAB, which catalyzes ATP-dependent electrogenic Na+ extrusion without mechanically coupled to proton or K+ uptake Back     alignment and domain information
>PRK10982 galactose/methyl galaxtoside transporter ATP-binding protein; Provisional Back     alignment and domain information
>COG4608 AppF ABC-type oligopeptide transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>PRK15134 microcin C ABC transporter ATP-binding protein YejF; Provisional Back     alignment and domain information
>cd03214 ABC_Iron-Siderophores_B12_Hemin ABC transporters, involved in the uptake of siderophores, heme, and vitamin B12, are widely conserved in bacteria and archaea Back     alignment and domain information
>cd03220 ABC_KpsT_Wzt ABC_KpsT_Wzt The KpsT/Wzt ABC transporter subfamily is involved in extracellular polysaccharide export Back     alignment and domain information
>COG4161 ArtP ABC-type arginine transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>PRK13539 cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>cd03237 ABC_RNaseL_inhibitor_domain2 The ATPase domain 2 of RNase L inhibitor Back     alignment and domain information
>TIGR02324 CP_lyasePhnL phosphonate C-P lyase system protein PhnL Back     alignment and domain information
>PRK15064 ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>COG4172 ABC-type uncharacterized transport system, duplicated ATPase component [General function prediction only] Back     alignment and domain information
>PRK13538 cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>KOG0064 consensus Peroxisomal long-chain acyl-CoA transporter, ABC superfamily [Lipid transport and metabolism] Back     alignment and domain information
>PRK13541 cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>COG4598 HisP ABC-type histidine transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>cd03216 ABC_Carb_Monos_I This family represents the domain I of the carbohydrate uptake proteins that transport only monosaccharides (Monos) Back     alignment and domain information
>PRK13549 xylose transporter ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR01189 ccmA heme ABC exporter, ATP-binding protein CcmA Back     alignment and domain information
>TIGR03771 anch_rpt_ABC anchored repeat-type ABC transporter, ATP-binding subunit Back     alignment and domain information
>PRK10535 macrolide transporter ATP-binding /permease protein; Provisional Back     alignment and domain information
>TIGR01257 rim_protein retinal-specific rim ABC transporter Back     alignment and domain information
>TIGR01166 cbiO cobalt transport protein ATP-binding subunit Back     alignment and domain information
>PLN03073 ABC transporter F family; Provisional Back     alignment and domain information
>COG4618 ArpD ABC-type protease/lipase transport system, ATPase and permease components [General function prediction only] Back     alignment and domain information
>TIGR00956 3a01205 Pleiotropic Drug Resistance (PDR) Family protein Back     alignment and domain information
>PRK09700 D-allose transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK10636 putative ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03221 ABCF_EF-3 ABCF_EF-3 Elongation factor 3 (EF-3) is a cytosolic protein required by fungal ribosomes for in vitro protein synthesis and for in vivo growth Back     alignment and domain information
>PRK11819 putative ABC transporter ATP-binding protein; Reviewed Back     alignment and domain information
>COG1129 MglA ABC-type sugar transport system, ATPase component [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK11288 araG L-arabinose transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR03719 ABC_ABC_ChvD ATP-binding cassette protein, ChvD family Back     alignment and domain information
>TIGR02633 xylG D-xylose ABC transporter, ATP-binding protein Back     alignment and domain information
>PRK11147 ABC transporter ATPase component; Reviewed Back     alignment and domain information
>COG4167 SapF ABC-type antimicrobial peptide transport system, ATPase component [Defense mechanisms] Back     alignment and domain information
>PRK13409 putative ATPase RIL; Provisional Back     alignment and domain information
>PRK10762 D-ribose transporter ATP binding protein; Provisional Back     alignment and domain information
>COG1134 TagH ABC-type polysaccharide/polyol phosphate transport system, ATPase component [Carbohydrate transport and metabolism / Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>TIGR01187 potA spermidine/putrescine ABC transporter ATP-binding subunit Back     alignment and domain information
>PRK15439 autoinducer 2 ABC transporter ATP-binding protein LsrA; Provisional Back     alignment and domain information
>cd03236 ABC_RNaseL_inhibitor_domain1 The ATPase domain 1 of RNase L inhibitor Back     alignment and domain information
>COG4136 ABC-type uncharacterized transport system, ATPase component [General function prediction only] Back     alignment and domain information
>PRK10938 putative molybdenum transport ATP-binding protein ModF; Provisional Back     alignment and domain information
>cd03222 ABC_RNaseL_inhibitor The ABC ATPase RNase L inhibitor (RLI) is a key enzyme in ribosomal biogenesis, formation of translation preinitiation complexes, and assembly of HIV capsids Back     alignment and domain information
>COG1119 ModF ABC-type molybdenum transport system, ATPase component/photorepair protein PhrA [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK10982 galactose/methyl galaxtoside transporter ATP-binding protein; Provisional Back     alignment and domain information
>COG3845 ABC-type uncharacterized transport systems, ATPase components [General function prediction only] Back     alignment and domain information
>COG1101 PhnK ABC-type uncharacterized transport system, ATPase component [General function prediction only] Back     alignment and domain information
>PLN03140 ABC transporter G family member; Provisional Back     alignment and domain information
>cd03238 ABC_UvrA The excision repair protein UvrA; Nucleotide excision repair in eubacteria is a process that repairs DNA damage by the removal of a 12-13-mer oligonucleotide containing the lesion Back     alignment and domain information
>cd00267 ABC_ATPase ABC (ATP-binding cassette) transporter nucleotide-binding domain; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules Back     alignment and domain information
>COG4152 ABC-type uncharacterized transport system, ATPase component [General function prediction only] Back     alignment and domain information
>COG4674 Uncharacterized ABC-type transport system, ATPase component [General function prediction only] Back     alignment and domain information
>PF00664 ABC_membrane: ABC transporter transmembrane region; InterPro: IPR001140 ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energise diverse biological systems Back     alignment and domain information
>PRK13409 putative ATPase RIL; Provisional Back     alignment and domain information
>COG0488 Uup ATPase components of ABC transporters with duplicated ATPase domains [General function prediction only] Back     alignment and domain information
>COG4172 ABC-type uncharacterized transport system, duplicated ATPase component [General function prediction only] Back     alignment and domain information
>PF00664 ABC_membrane: ABC transporter transmembrane region; InterPro: IPR001140 ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energise diverse biological systems Back     alignment and domain information
>PF00005 ABC_tran: ABC transporter This structure is on hold until Dec 1999; InterPro: IPR003439 ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energise diverse biological systems Back     alignment and domain information
>COG0396 sufC Cysteine desulfurase activator ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG4107 PhnK ABC-type phosphonate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>KOG0061 consensus Transporter, ABC superfamily (Breast cancer resistance protein) [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>COG4133 CcmA ABC-type transport system involved in cytochrome c biogenesis, ATPase component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd03270 ABC_UvrA_I The excision repair protein UvrA domain I; Nucleotide excision repair in eubacteria is a process that repairs DNA damage by the removal of a 12-13-mer oligonucleotide containing the lesion Back     alignment and domain information
>COG4178 ABC-type uncharacterized transport system, permease and ATPase components [General function prediction only] Back     alignment and domain information
>cd03271 ABC_UvrA_II The excision repair protein UvrA domain II; Nucleotide excision repair in eubacteria is a process that repairs DNA damage by the removal of a 12-13-mer oligonucleotide containing the lesion Back     alignment and domain information
>KOG0065 consensus Pleiotropic drug resistance proteins (PDR1-15), ABC superfamily [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>COG4586 ABC-type uncharacterized transport system, ATPase component [General function prediction only] Back     alignment and domain information
>cd03278 ABC_SMC_barmotin Barmotin is a tight junction-associated protein expressed in rat epithelial cells which is thought to have an important regulatory role in tight junction barrier function Back     alignment and domain information
>KOG0927 consensus Predicted transporter (ABC superfamily) [General function prediction only] Back     alignment and domain information
>COG4778 PhnL ABC-type phosphonate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>KOG0059 consensus Lipid exporter ABCA1 and related proteins, ABC superfamily [Lipid transport and metabolism; General function prediction only] Back     alignment and domain information
>cd03279 ABC_sbcCD SbcCD and other Mre11/Rad50 (MR) complexes are implicated in the metabolism of DNA ends Back     alignment and domain information
>cd03272 ABC_SMC3_euk Eukaryotic SMC3 proteins; SMC proteins are large (approximately 110 to 170 kDa), and each is arranged into five recognizable domains Back     alignment and domain information
>KOG0060 consensus Long-chain acyl-CoA transporter, ABC superfamily (involved in peroxisome organization and biogenesis) [Lipid transport and metabolism; General function prediction only] Back     alignment and domain information
>PRK00349 uvrA excinuclease ABC subunit A; Reviewed Back     alignment and domain information
>PRK00635 excinuclease ABC subunit A; Provisional Back     alignment and domain information
>cd03273 ABC_SMC2_euk Eukaryotic SMC2 proteins; SMC proteins are large (approximately 110 to 170 kDa), and each is arranged into five recognizable domains Back     alignment and domain information
>cd03240 ABC_Rad50 The catalytic domains of Rad50 are similar to the ATP-binding cassette of ABC transporters, but are not associated with membrane-spanning domains Back     alignment and domain information
>PRK14257 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>COG4138 BtuD ABC-type cobalamin transport system, ATPase component [Coenzyme metabolism] Back     alignment and domain information
>cd03275 ABC_SMC1_euk Eukaryotic SMC1 proteins; SMC proteins are large (approximately 110 to 170 kDa), and each is arranged into five recognizable domains Back     alignment and domain information
>TIGR00630 uvra excinuclease ABC, A subunit Back     alignment and domain information
>KOG0927 consensus Predicted transporter (ABC superfamily) [General function prediction only] Back     alignment and domain information
>KOG0066 consensus eIF2-interacting protein ABC50 (ABC superfamily) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>COG3845 ABC-type uncharacterized transport systems, ATPase components [General function prediction only] Back     alignment and domain information
>COG1245 Predicted ATPase, RNase L inhibitor (RLI) homolog [General function prediction only] Back     alignment and domain information
>cd03274 ABC_SMC4_euk Eukaryotic SMC4 proteins; SMC proteins are large (approximately 110 to 170 kDa), and each is arranged into five recognizable domains Back     alignment and domain information
>COG3638 ABC-type phosphate/phosphonate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>COG1129 MglA ABC-type sugar transport system, ATPase component [Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG2355 consensus Predicted ABC-type transport, ATPase component/CCR4 associated factor [General function prediction only; Transcription] Back     alignment and domain information
>KOG0062 consensus ATPase component of ABC transporters with duplicated ATPase domains/Translation elongation factor EF-3b [Amino acid transport and metabolism; Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>COG2884 FtsE Predicted ATPase involved in cell division [Cell division and chromosome partitioning] Back     alignment and domain information
>COG0178 UvrA Excinuclease ATPase subunit [DNA replication, recombination, and repair] Back     alignment and domain information
>COG1126 GlnQ ABC-type polar amino acid transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>cd03289 ABCC_CFTR2 The CFTR subfamily domain 2 Back     alignment and domain information
>cd03369 ABCC_NFT1 Domain 2 of NFT1 (New full-length MRP-type transporter 1) Back     alignment and domain information
>KOG0065 consensus Pleiotropic drug resistance proteins (PDR1-15), ABC superfamily [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>COG1125 OpuBA ABC-type proline/glycine betaine transport systems, ATPase components [Amino acid transport and metabolism] Back     alignment and domain information
>cd01128 rho_factor Transcription termination factor rho is a bacterial ATP-dependent RNA/DNA helicase Back     alignment and domain information
>COG1116 TauB ABC-type nitrate/sulfonate/bicarbonate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>COG1121 ZnuC ABC-type Mn/Zn transport systems, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>cd03239 ABC_SMC_head The structural maintenance of chromosomes (SMC) proteins are essential for successful chromosome transmission during replication and segregation of the genome in all organisms Back     alignment and domain information
>cd03276 ABC_SMC6_euk Eukaryotic SMC6 proteins; SMC proteins are large (approximately 110 to 170 kDa), and each is arranged into five recognizable domains Back     alignment and domain information
>KOG0062 consensus ATPase component of ABC transporters with duplicated ATPase domains/Translation elongation factor EF-3b [Amino acid transport and metabolism; Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>COG1120 FepC ABC-type cobalamin/Fe3+-siderophores transport systems, ATPase components [Inorganic ion transport and metabolism / Coenzyme metabolism] Back     alignment and domain information
>COG1136 SalX ABC-type antimicrobial peptide transport system, ATPase component [Defense mechanisms] Back     alignment and domain information
>TIGR00960 3a0501s02 Type II (General) Secretory Pathway (IISP) Family protein Back     alignment and domain information
>COG1124 DppF ABC-type dipeptide/oligopeptide/nickel transport system, ATPase component [Amino acid transport and metabolism / Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK13631 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03263 ABC_subfamily_A The ABCA subfamily mediates the transport of a variety of lipid compounds Back     alignment and domain information
>cd03244 ABCC_MRP_domain2 Domain 2 of the ABC subfamily C Back     alignment and domain information
>cd03247 ABCC_cytochrome_bd The CYD subfamily implicated in cytochrome bd biogenesis Back     alignment and domain information
>COG1135 AbcC ABC-type metal ion transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>cd03216 ABC_Carb_Monos_I This family represents the domain I of the carbohydrate uptake proteins that transport only monosaccharides (Monos) Back     alignment and domain information
>cd03223 ABCD_peroxisomal_ALDP Peroxisomal ATP-binding cassette transporter (Pat) is involved in the import of very long-chain fatty acids (VLCFA) into the peroxisome Back     alignment and domain information
>COG1127 Ttg2A ABC-type transport system involved in resistance to organic solvents, ATPase component [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>cd03255 ABC_MJ0796_Lo1CDE_FtsE This family is comprised of MJ0796 ATP-binding cassette, macrolide-specific ABC-type efflux carrier (MacAB), and proteins involved in cell division (FtsE), and release of liporoteins from the cytoplasmic membrane (LolCDE) Back     alignment and domain information
>PRK13646 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03288 ABCC_SUR2 The SUR domain 2 Back     alignment and domain information
>cd03246 ABCC_Protease_Secretion This family represents the ABC component of the protease secretion system PrtD, a 60-kDa integral membrane protein sharing 37% identity with HlyB, the ABC component of the alpha-hemolysin secretion pathway, in the C-terminal domain Back     alignment and domain information
>cd03292 ABC_FtsE_transporter FtsE is a hydrophilic nucleotide-binding protein that binds FtsX to form a heterodimeric ATP-binding cassette (ABC)-type transporter that associates with the bacterial inner membrane Back     alignment and domain information
>PRK13643 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK11629 lolD lipoprotein transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03250 ABCC_MRP_domain1 Domain 1 of the ABC subfamily C Back     alignment and domain information
>TIGR02673 FtsE cell division ATP-binding protein FtsE Back     alignment and domain information
>cd03221 ABCF_EF-3 ABCF_EF-3 Elongation factor 3 (EF-3) is a cytosolic protein required by fungal ribosomes for in vitro protein synthesis and for in vivo growth Back     alignment and domain information
>cd03257 ABC_NikE_OppD_transporters The ABC transporter subfamily specific for the transport of dipeptides, oligopeptides (OppD), and nickel (NikDE) Back     alignment and domain information
>cd03266 ABC_NatA_sodium_exporter NatA is the ATPase component of a bacterial ABC-type Na+ transport system called NatAB, which catalyzes ATP-dependent electrogenic Na+ extrusion without mechanically coupled proton or K+ uptake Back     alignment and domain information
>COG1122 CbiO ABC-type cobalt transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>cd03233 ABC_PDR_domain1 The pleiotropic drug resistance (PDR) family of ATP-binding cassette (ABC) transporters Back     alignment and domain information
>PRK13650 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13637 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03245 ABCC_bacteriocin_exporters ABC-type bacteriocin exporters Back     alignment and domain information
>cd03252 ABCC_Hemolysin The ABC-transporter hemolysin B is a central component of the secretion machinery that translocates the toxin, hemolysin A, in a Sec-independent fashion across both membranes of E Back     alignment and domain information
>PRK13540 cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>PRK13647 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR02314 ABC_MetN D-methionine ABC transporter, ATP-binding protein Back     alignment and domain information
>TIGR02211 LolD_lipo_ex lipoprotein releasing system, ATP-binding protein Back     alignment and domain information
>cd03293 ABC_NrtD_SsuB_transporters NrtD and SsuB are the ATP-binding subunits of the bacterial ABC-type nitrate and sulfonate transport systems, respectively Back     alignment and domain information
>PRK13651 cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK10584 putative ABC transporter ATP-binding protein YbbA; Provisional Back     alignment and domain information
>PRK10908 cell division protein FtsE; Provisional Back     alignment and domain information
>PRK13645 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK00635 excinuclease ABC subunit A; Provisional Back     alignment and domain information
>PRK13539 cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>PRK13632 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>COG3839 MalK ABC-type sugar transport systems, ATPase components [Carbohydrate transport and metabolism] Back     alignment and domain information
>COG1134 TagH ABC-type polysaccharide/polyol phosphate transport system, ATPase component [Carbohydrate transport and metabolism / Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>COG1245 Predicted ATPase, RNase L inhibitor (RLI) homolog [General function prediction only] Back     alignment and domain information
>cd00820 PEPCK_HprK Phosphoenolpyruvate carboxykinase (PEPCK), a critical gluconeogenic enzyme, catalyzes the first committed step in the diversion of tricarboxylic acid cycle intermediates toward gluconeogenesis Back     alignment and domain information
>TIGR02769 nickel_nikE nickel import ATP-binding protein NikE Back     alignment and domain information
>TIGR02315 ABC_phnC phosphonate ABC transporter, ATP-binding protein Back     alignment and domain information
>cd03225 ABC_cobalt_CbiO_domain1 Domain I of the ABC component of a cobalt transport family found in bacteria, archaea, and eukaryota Back     alignment and domain information
>COG4181 Predicted ABC-type transport system involved in lysophospholipase L1 biosynthesis, ATPase component [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>PRK11247 ssuB aliphatic sulfonates transport ATP-binding subunit; Provisional Back     alignment and domain information
>cd03258 ABC_MetN_methionine_transporter MetN (also known as YusC) is an ABC-type transporter encoded by metN of the metNPQ operon in Bacillus subtilis that is involved in methionine transport Back     alignment and domain information
>cd03230 ABC_DR_subfamily_A This family of ATP-binding proteins belongs to a multisubunit transporter involved in drug resistance (BcrA and DrrA), nodulation, lipid transport, and lantibiotic immunity Back     alignment and domain information
>PRK13648 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03213 ABCG_EPDR ABCG transporters are involved in eye pigment (EP) precursor transport, regulation of lipid-trafficking mechanisms, and pleiotropic drug resistance (DR) Back     alignment and domain information
>cd03254 ABCC_Glucan_exporter_like Glucan exporter ATP-binding protein Back     alignment and domain information
>PRK11248 tauB taurine transporter ATP-binding subunit; Provisional Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query1303
2cbz_A237 Structure Of The Human Multidrug Resistance Protein 5e-44
1r0z_A286 Phosphorylated Cystic Fibrosis Transmembrane Conduc 2e-30
1q3h_A286 Mouse Cftr Nbd1 With Amp.Pnp Length = 286 2e-30
2pzg_A241 Minimal Human Cftr First Nucleotide Binding Domain 1e-29
2pze_A229 Minimal Human Cftr First Nucleotide Binding Domain 2e-29
1xf9_A283 Structure Of Nbd1 From Murine Cftr- F508s Mutant Le 2e-29
1xfa_A283 Structure Of Nbd1 From Murine Cftr- F508r Mutant Le 2e-29
1xmi_A291 Crystal Structure Of Human F508a Nbd1 Domain With A 2e-28
3si7_A285 The Crystal Structure Of The Nbd1 Domain Of The Mou 3e-28
2bbo_A291 Human Nbd1 With Phe508 Length = 291 8e-28
2pzf_A228 Minimal Human Cftr First Nucleotide Binding Domain 2e-27
2bbt_A290 Human Deltaf508 Nbd1 With Two Solublizing Mutations 6e-27
2bbs_A290 Human Deltaf508 Nbd1 With Three Solubilizing Mutati 6e-27
1xmj_A290 Crystal Structure Of Human Deltaf508 Human Nbd1 Dom 1e-25
2hyd_A578 Multidrug Abc Transporter Sav1866 Length = 578 2e-19
2hyd_A 578 Multidrug Abc Transporter Sav1866 Length = 578 2e-06
3qf4_A587 Crystal Structure Of A Heterodimeric Abc Transporte 6e-19
3qf4_A 587 Crystal Structure Of A Heterodimeric Abc Transporte 2e-10
1mv5_A243 Crystal Structure Of Lmra Atp-Binding Domain Length 2e-17
3b5w_A582 Crystal Structure Of Eschericia Coli Msba Length = 6e-17
3b5y_A582 Crystal Structure Of Msba From Salmonella Typhimuri 1e-16
4f4c_A 1321 The Crystal Structure Of The Multi-Drug Transporter 4e-16
4f4c_A 1321 The Crystal Structure Of The Multi-Drug Transporter 5e-07
3g60_A1284 Structure Of P-Glycoprotein Reveals A Molecular Bas 2e-15
3g60_A 1284 Structure Of P-Glycoprotein Reveals A Molecular Bas 2e-04
3g5u_A1284 Structure Of P-Glycoprotein Reveals A Molecular Bas 2e-15
3g5u_A 1284 Structure Of P-Glycoprotein Reveals A Molecular Bas 2e-04
4ayt_A595 Structure Of The Human Mitochondrial Abc Transporte 3e-15
4ayt_A 595 Structure Of The Human Mitochondrial Abc Transporte 1e-04
4ayw_A619 Structure Of The Human Mitochondrial Abc Transporte 3e-15
4ayw_A 619 Structure Of The Human Mitochondrial Abc Transporte 8e-05
2ghi_A260 Crystal Structure Of Plasmodium Yoelii Multidrug Re 4e-15
3b5x_A582 Crystal Structure Of Msba From Vibrio Cholerae Leng 7e-15
3b5x_A 582 Crystal Structure Of Msba From Vibrio Cholerae Leng 6e-06
3nh6_A306 Nucleotide Binding Domain Of Human Abcb6 (Apo Struc 2e-13
3nh6_A 306 Nucleotide Binding Domain Of Human Abcb6 (Apo Struc 8e-05
3qf4_B598 Crystal Structure Of A Heterodimeric Abc Transporte 4e-13
3qf4_B 598 Crystal Structure Of A Heterodimeric Abc Transporte 7e-12
2pmk_A243 Crystal Structures Of An Isolated Abc-Atpase In Com 2e-12
2pmk_A 243 Crystal Structures Of An Isolated Abc-Atpase In Com 4e-05
2ffb_A247 The Crystal Structure Of The Hlyb-Nbd E631q Mutant 2e-12
2ffb_A 247 The Crystal Structure Of The Hlyb-Nbd E631q Mutant 3e-05
1mt0_A241 Atp-Binding Domain Of Haemolysin B From Escherichia 2e-12
1mt0_A 241 Atp-Binding Domain Of Haemolysin B From Escherichia 4e-05
2ff7_A247 The Abc-Atpase Of The Abc-Transporter Hlyb In The A 2e-12
2ff7_A 247 The Abc-Atpase Of The Abc-Transporter Hlyb In The A 4e-05
3b5j_A243 Crystal Structures Of The S504a Mutant Of An Isolat 3e-12
3b5j_A 243 Crystal Structures Of The S504a Mutant Of An Isolat 5e-05
1xef_A241 Crystal Structure Of The AtpMG2+ BOUND COMPOSITE DI 5e-12
1xef_A 241 Crystal Structure Of The AtpMG2+ BOUND COMPOSITE DI 4e-05
2ffa_A247 Crystal Structure Of Abc-Atpase H662a Of The Abc-Tr 5e-12
2ffa_A 247 Crystal Structure Of Abc-Atpase H662a Of The Abc-Tr 4e-05
2ixf_A271 Crystal Structure Of The Atpase Domain Of Tap1 With 9e-10
2ixe_A271 Crystal Structure Of The Atpase Domain Of Tap1 With 1e-09
3gd7_A 390 Crystal Structure Of Human Nbd2 Complexed With N6- 1e-08
2ixg_A271 Crystal Structure Of The Atpase Domain Of Tap1 With 3e-08
2nq2_C253 An Inward-Facing Conformation Of A Putative Metal-C 6e-08
1jj7_A260 Crystal Structure Of The C-Terminal Atpase Domain O 8e-08
4hlu_D268 Structure Of The Ecfa-a' Heterodimer Bound To Adp L 2e-07
2it1_A362 Structure Of Ph0203 Protein From Pyrococcus Horikos 3e-07
3tuj_C366 Inward Facing Conformations Of The Metni Methionine 1e-05
3dhw_C343 Crystal Structure Of Methionine Importer Metni Leng 2e-05
3tui_C366 Inward Facing Conformations Of The Metni Methionine 2e-05
1ji0_A240 Crystal Structure Analysis Of The Abc Transporter F 6e-05
3d31_A348 Modbc From Methanosarcina Acetivorans Length = 348 2e-04
1b0u_A262 Atp-Binding Subunit Of The Histidine Permease From 2e-04
1z47_A355 Structure Of The Atpase Subunit Cysa Of The Putativ 3e-04
3c41_J242 Abc Protein Artp In Complex With Amp-PnpMG2+ Length 4e-04
2olj_A263 Abc Protein Artp In Complex With AdpMG2+ Length = 2 4e-04
2r6g_A381 The Crystal Structure Of The E. Coli Maltose Transp 6e-04
1q12_A381 Crystal Structure Of The Atp-bound E. Coli Malk Len 6e-04
1q1b_A381 Crystal Structure Of E. Coli Malk In The Nucleotide 7e-04
>pdb|2CBZ|A Chain A, Structure Of The Human Multidrug Resistance Protein 1 Nucleotide Binding Domain 1 Length = 237 Back     alignment and structure 
Iteration: 1

 Score =  177 bits (448), Expect = 5e-44,   Method: Compositional matrix adjust.
 Identities = 97/225 (43%), Positives = 138/225 (61%), Gaps = 28/225 (12%)
Query: 640 AVSIKNGNFSWD-SKSPTLSNINLDIPVGSLVAIVGGTGEGKTSLVSAMLGELPPLKDAS 698
           +++++N  F+W  S  PTL+ I   IP G+LVA+VG  G GK+SL+SA+L E+  + +  
Sbjct: 3   SITVRNATFTWARSDPPTLNGITFSIPEGALVAVVGQVGCGKSSLLSALLAEMDKV-EGH 61
Query: 699 VVIRGTVAYVPQISWIFNATLRKNILFGSEFDPAKYWKTVDVSALQHDLDLLPDRDLTEI 758
           V I+G+VAYVPQ +WI N +LR+NILFG + +   Y   +   AL  DL++LP  D TEI
Sbjct: 62  VAIKGSVAYVPQQAWIQNDSLRENILFGCQLEEPYYRSVIQACALLPDLEILPSGDRTEI 121
Query: 759 GERGVNISGGQKQRVSMARAVFNSC--------------------------IKEELRGKT 792
           GE+GVN+SGGQKQRVS+ARAV+++                            K  L+ KT
Sbjct: 122 GEKGVNLSGGQKQRVSLARAVYSNADIYLFDDPLSAVDAHVGKHIFENVIGPKGMLKNKT 181
Query: 793 RILVTNQLHFLPHVDRIILVSEGMIKEEGSFEELSKHGRLFQKLM 837
           RILVT+ + +LP VD II++S G I E GS++EL      F + +
Sbjct: 182 RILVTHSMSYLPQVDVIIVMSGGKISEMGSYQELLARDGAFAEFL 226
>pdb|1R0Z|A Chain A, Phosphorylated Cystic Fibrosis Transmembrane Conductance Regulator (Cftr) Nucleotide-Binding Domain One (Nbd1) With Atp Length = 286 Back     alignment and structure
>pdb|1Q3H|A Chain A, Mouse Cftr Nbd1 With Amp.Pnp Length = 286 Back     alignment and structure
>pdb|2PZG|A Chain A, Minimal Human Cftr First Nucleotide Binding Domain As A Monomer Length = 241 Back     alignment and structure
>pdb|2PZE|A Chain A, Minimal Human Cftr First Nucleotide Binding Domain As A Head-To-Tail Dimer Length = 229 Back     alignment and structure
>pdb|1XF9|A Chain A, Structure Of Nbd1 From Murine Cftr- F508s Mutant Length = 283 Back     alignment and structure
>pdb|1XFA|A Chain A, Structure Of Nbd1 From Murine Cftr- F508r Mutant Length = 283 Back     alignment and structure
>pdb|1XMI|A Chain A, Crystal Structure Of Human F508a Nbd1 Domain With Atp Length = 291 Back     alignment and structure
>pdb|3SI7|A Chain A, The Crystal Structure Of The Nbd1 Domain Of The Mouse Cftr Protein, Deltaf508 Mutant Length = 285 Back     alignment and structure
>pdb|2BBO|A Chain A, Human Nbd1 With Phe508 Length = 291 Back     alignment and structure
>pdb|2PZF|A Chain A, Minimal Human Cftr First Nucleotide Binding Domain As A Head-To-Tail Dimer With Delta F508 Length = 228 Back     alignment and structure
>pdb|2BBT|A Chain A, Human Deltaf508 Nbd1 With Two Solublizing Mutations. Length = 290 Back     alignment and structure
>pdb|2BBS|A Chain A, Human Deltaf508 Nbd1 With Three Solubilizing Mutations Length = 290 Back     alignment and structure
>pdb|1XMJ|A Chain A, Crystal Structure Of Human Deltaf508 Human Nbd1 Domain With Atp Length = 290 Back     alignment and structure
>pdb|2HYD|A Chain A, Multidrug Abc Transporter Sav1866 Length = 578 Back     alignment and structure
>pdb|2HYD|A Chain A, Multidrug Abc Transporter Sav1866 Length = 578 Back     alignment and structure
>pdb|3QF4|A Chain A, Crystal Structure Of A Heterodimeric Abc Transporter In Its Inward- Facing Conformation Length = 587 Back     alignment and structure
>pdb|3QF4|A Chain A, Crystal Structure Of A Heterodimeric Abc Transporter In Its Inward- Facing Conformation Length = 587 Back     alignment and structure
>pdb|1MV5|A Chain A, Crystal Structure Of Lmra Atp-Binding Domain Length = 243 Back     alignment and structure
>pdb|3B5W|A Chain A, Crystal Structure Of Eschericia Coli Msba Length = 582 Back     alignment and structure
>pdb|3B5Y|A Chain A, Crystal Structure Of Msba From Salmonella Typhimurium With Amppnp Length = 582 Back     alignment and structure
>pdb|4F4C|A Chain A, The Crystal Structure Of The Multi-Drug Transporter Length = 1321 Back     alignment and structure
>pdb|4F4C|A Chain A, The Crystal Structure Of The Multi-Drug Transporter Length = 1321 Back     alignment and structure
>pdb|3G60|A Chain A, Structure Of P-Glycoprotein Reveals A Molecular Basis For Poly-Specific Drug Binding Length = 1284 Back     alignment and structure
>pdb|3G60|A Chain A, Structure Of P-Glycoprotein Reveals A Molecular Basis For Poly-Specific Drug Binding Length = 1284 Back     alignment and structure
>pdb|3G5U|A Chain A, Structure Of P-Glycoprotein Reveals A Molecular Basis For Poly-Specific Drug Binding Length = 1284 Back     alignment and structure
>pdb|3G5U|A Chain A, Structure Of P-Glycoprotein Reveals A Molecular Basis For Poly-Specific Drug Binding Length = 1284 Back     alignment and structure
>pdb|4AYT|A Chain A, Structure Of The Human Mitochondrial Abc Transporter, Abcb10 Length = 595 Back     alignment and structure
>pdb|4AYT|A Chain A, Structure Of The Human Mitochondrial Abc Transporter, Abcb10 Length = 595 Back     alignment and structure
>pdb|4AYW|A Chain A, Structure Of The Human Mitochondrial Abc Transporter, Abcb10 (plate Form) Length = 619 Back     alignment and structure
>pdb|4AYW|A Chain A, Structure Of The Human Mitochondrial Abc Transporter, Abcb10 (plate Form) Length = 619 Back     alignment and structure
>pdb|2GHI|A Chain A, Crystal Structure Of Plasmodium Yoelii Multidrug Resistance Protein 2 Length = 260 Back     alignment and structure
>pdb|3B5X|A Chain A, Crystal Structure Of Msba From Vibrio Cholerae Length = 582 Back     alignment and structure
>pdb|3B5X|A Chain A, Crystal Structure Of Msba From Vibrio Cholerae Length = 582 Back     alignment and structure
>pdb|3NH6|A Chain A, Nucleotide Binding Domain Of Human Abcb6 (Apo Structure) Length = 306 Back     alignment and structure
>pdb|3NH6|A Chain A, Nucleotide Binding Domain Of Human Abcb6 (Apo Structure) Length = 306 Back     alignment and structure
>pdb|3QF4|B Chain B, Crystal Structure Of A Heterodimeric Abc Transporter In Its Inward- Facing Conformation Length = 598 Back     alignment and structure
>pdb|3QF4|B Chain B, Crystal Structure Of A Heterodimeric Abc Transporter In Its Inward- Facing Conformation Length = 598 Back     alignment and structure
>pdb|2PMK|A Chain A, Crystal Structures Of An Isolated Abc-Atpase In Complex With Tnp-Adp Length = 243 Back     alignment and structure
>pdb|2PMK|A Chain A, Crystal Structures Of An Isolated Abc-Atpase In Complex With Tnp-Adp Length = 243 Back     alignment and structure
>pdb|2FFB|A Chain A, The Crystal Structure Of The Hlyb-Nbd E631q Mutant In Complex With Adp Length = 247 Back     alignment and structure
>pdb|2FFB|A Chain A, The Crystal Structure Of The Hlyb-Nbd E631q Mutant In Complex With Adp Length = 247 Back     alignment and structure
>pdb|1MT0|A Chain A, Atp-Binding Domain Of Haemolysin B From Escherichia Coli Length = 241 Back     alignment and structure
>pdb|1MT0|A Chain A, Atp-Binding Domain Of Haemolysin B From Escherichia Coli Length = 241 Back     alignment and structure
>pdb|2FF7|A Chain A, The Abc-Atpase Of The Abc-Transporter Hlyb In The Adp Bound State Length = 247 Back     alignment and structure
>pdb|2FF7|A Chain A, The Abc-Atpase Of The Abc-Transporter Hlyb In The Adp Bound State Length = 247 Back     alignment and structure
>pdb|3B5J|A Chain A, Crystal Structures Of The S504a Mutant Of An Isolated Abc-atpase In Complex With Tnp-adp Length = 243 Back     alignment and structure
>pdb|3B5J|A Chain A, Crystal Structures Of The S504a Mutant Of An Isolated Abc-atpase In Complex With Tnp-adp Length = 243 Back     alignment and structure
>pdb|1XEF|A Chain A, Crystal Structure Of The AtpMG2+ BOUND COMPOSITE DIMER OF HLYB-Nbd Length = 241 Back     alignment and structure
>pdb|1XEF|A Chain A, Crystal Structure Of The AtpMG2+ BOUND COMPOSITE DIMER OF HLYB-Nbd Length = 241 Back     alignment and structure
>pdb|2FFA|A Chain A, Crystal Structure Of Abc-Atpase H662a Of The Abc-Transporter Hlyb In Complex With Adp Length = 247 Back     alignment and structure
>pdb|2FFA|A Chain A, Crystal Structure Of Abc-Atpase H662a Of The Abc-Transporter Hlyb In Complex With Adp Length = 247 Back     alignment and structure
>pdb|2IXF|A Chain A, Crystal Structure Of The Atpase Domain Of Tap1 With Atp (D645q, Q678h Mutant) Length = 271 Back     alignment and structure
>pdb|2IXE|A Chain A, Crystal Structure Of The Atpase Domain Of Tap1 With Atp (d645n Mutant) Length = 271 Back     alignment and structure
>pdb|3GD7|A Chain A, Crystal Structure Of Human Nbd2 Complexed With N6- Phenylethyl-Atp (P-Atp) Length = 390 Back     alignment and structure
>pdb|2IXG|A Chain A, Crystal Structure Of The Atpase Domain Of Tap1 With Atp (S621a, G622v, D645n Mutant) Length = 271 Back     alignment and structure
>pdb|2NQ2|C Chain C, An Inward-Facing Conformation Of A Putative Metal-Chelate Type Abc Transporter. Length = 253 Back     alignment and structure
>pdb|1JJ7|A Chain A, Crystal Structure Of The C-Terminal Atpase Domain Of Human Tap1 Length = 260 Back     alignment and structure
>pdb|4HLU|D Chain D, Structure Of The Ecfa-a' Heterodimer Bound To Adp Length = 268 Back     alignment and structure
>pdb|2IT1|A Chain A, Structure Of Ph0203 Protein From Pyrococcus Horikoshii Length = 362 Back     alignment and structure
>pdb|3TUJ|C Chain C, Inward Facing Conformations Of The Metni Methionine Abc Transporter: Dm Crystal Form Length = 366 Back     alignment and structure
>pdb|3DHW|C Chain C, Crystal Structure Of Methionine Importer Metni Length = 343 Back     alignment and structure
>pdb|3TUI|C Chain C, Inward Facing Conformations Of The Metni Methionine Abc Transporter: Cy5 Native Crystal Form Length = 366 Back     alignment and structure
>pdb|1JI0|A Chain A, Crystal Structure Analysis Of The Abc Transporter From Thermotoga Maritima Length = 240 Back     alignment and structure
>pdb|3D31|A Chain A, Modbc From Methanosarcina Acetivorans Length = 348 Back     alignment and structure
>pdb|1B0U|A Chain A, Atp-Binding Subunit Of The Histidine Permease From Salmonella Typhimurium Length = 262 Back     alignment and structure
>pdb|1Z47|A Chain A, Structure Of The Atpase Subunit Cysa Of The Putative Sulfate Atp-Binding Cassette (Abc) Transporter From Alicyclobacillus Acidocaldarius Length = 355 Back     alignment and structure
>pdb|3C41|J Chain J, Abc Protein Artp In Complex With Amp-PnpMG2+ Length = 242 Back     alignment and structure
>pdb|2OLJ|A Chain A, Abc Protein Artp In Complex With AdpMG2+ Length = 263 Back     alignment and structure
>pdb|2R6G|A Chain A, The Crystal Structure Of The E. Coli Maltose Transporter Length = 381 Back     alignment and structure
>pdb|1Q12|A Chain A, Crystal Structure Of The Atp-bound E. Coli Malk Length = 381 Back     alignment and structure
>pdb|1Q1B|A Chain A, Crystal Structure Of E. Coli Malk In The Nucleotide-Free Form Length = 381 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query1303
2cbz_A237 Multidrug resistance-associated protein 1; ABC pro 1e-104
2cbz_A 237 Multidrug resistance-associated protein 1; ABC pro 1e-12
2bbs_A290 Cystic fibrosis transmembrane conductance regulato 1e-103
2bbs_A 290 Cystic fibrosis transmembrane conductance regulato 5e-12
2pze_A229 Cystic fibrosis transmembrane conductance regulat; 1e-101
2pze_A 229 Cystic fibrosis transmembrane conductance regulat; 4e-14
3g5u_A 1284 MCG1178, multidrug resistance protein 1A; P-glycop 2e-68
3g5u_A1284 MCG1178, multidrug resistance protein 1A; P-glycop 2e-37
3g5u_A 1284 MCG1178, multidrug resistance protein 1A; P-glycop 2e-23
3b60_A582 Lipid A export ATP-binding/permease protein MSBA; 3e-53
3b60_A 582 Lipid A export ATP-binding/permease protein MSBA; 1e-31
3b5x_A582 Lipid A export ATP-binding/permease protein MSBA; 1e-52
3b5x_A 582 Lipid A export ATP-binding/permease protein MSBA; 5e-31
4a82_A578 Cystic fibrosis transmembrane conductance regulat; 1e-47
4a82_A 578 Cystic fibrosis transmembrane conductance regulat; 2e-30
2yl4_A595 ATP-binding cassette SUB-family B member 10, mitoc 3e-43
2yl4_A 595 ATP-binding cassette SUB-family B member 10, mitoc 3e-28
3qf4_A587 ABC transporter, ATP-binding protein; multidrug tr 3e-43
3qf4_A 587 ABC transporter, ATP-binding protein; multidrug tr 5e-19
3qf4_B598 Uncharacterized ABC transporter ATP-binding prote 1e-34
3qf4_B 598 Uncharacterized ABC transporter ATP-binding prote 7e-24
3nh6_A306 ATP-binding cassette SUB-family B member 6, mitoc; 3e-33
3nh6_A 306 ATP-binding cassette SUB-family B member 6, mitoc; 1e-14
3gd7_A 390 Fusion complex of cystic fibrosis transmembrane co 1e-32
3gd7_A390 Fusion complex of cystic fibrosis transmembrane co 2e-26
1mv5_A243 LMRA, multidrug resistance ABC transporter ATP-bin 2e-32
1mv5_A 243 LMRA, multidrug resistance ABC transporter ATP-bin 9e-11
2ghi_A260 Transport protein; multidrug resistance protein, M 2e-28
2ghi_A 260 Transport protein; multidrug resistance protein, M 3e-11
2ff7_A247 Alpha-hemolysin translocation ATP-binding protein 2e-27
2ff7_A 247 Alpha-hemolysin translocation ATP-binding protein 4e-14
2ixe_A271 Antigen peptide transporter 1; ABC ATPase, hydrola 8e-25
2ixe_A 271 Antigen peptide transporter 1; ABC ATPase, hydrola 4e-09
2nq2_C253 Hypothetical ABC transporter ATP-binding protein H 2e-22
2nq2_C 253 Hypothetical ABC transporter ATP-binding protein H 1e-07
3gfo_A275 Cobalt import ATP-binding protein CBIO 1; structur 2e-18
3gfo_A 275 Cobalt import ATP-binding protein CBIO 1; structur 2e-07
2ihy_A279 ABC transporter, ATP-binding protein; ATPase, ABC 9e-16
2ihy_A 279 ABC transporter, ATP-binding protein; ATPase, ABC 2e-06
2yz2_A266 Putative ABC transporter ATP-binding protein TM_0; 1e-14
2yz2_A 266 Putative ABC transporter ATP-binding protein TM_0; 5e-08
3j16_B608 RLI1P; ribosome recycling, translation, eukarya, r 5e-14
3j16_B608 RLI1P; ribosome recycling, translation, eukarya, r 1e-08
3j16_B 608 RLI1P; ribosome recycling, translation, eukarya, r 1e-04
3j16_B 608 RLI1P; ribosome recycling, translation, eukarya, r 2e-04
2pjz_A263 Hypothetical protein ST1066; ATP binding protein, 4e-13
3bk7_A607 ABC transporter ATP-binding protein; ABC ATPase, i 9e-13
3bk7_A607 ABC transporter ATP-binding protein; ABC ATPase, i 2e-07
3bk7_A 607 ABC transporter ATP-binding protein; ABC ATPase, i 7e-05
3bk7_A 607 ABC transporter ATP-binding protein; ABC ATPase, i 1e-04
1yqt_A538 RNAse L inhibitor; ATP-binding cassette, ribosome 9e-12
1yqt_A538 RNAse L inhibitor; ATP-binding cassette, ribosome 7e-06
1yqt_A 538 RNAse L inhibitor; ATP-binding cassette, ribosome 5e-04
1yqt_A 538 RNAse L inhibitor; ATP-binding cassette, ribosome 8e-04
2qi9_C249 Vitamin B12 import ATP-binding protein BTUD; inner 6e-11
2qi9_C 249 Vitamin B12 import ATP-binding protein BTUD; inner 6e-05
3ozx_A538 RNAse L inhibitor; ATP binding cassette protein, h 1e-10
3ozx_A538 RNAse L inhibitor; ATP binding cassette protein, h 8e-09
3ozx_A 538 RNAse L inhibitor; ATP binding cassette protein, h 6e-04
1sgw_A214 Putative ABC transporter; structural genomics, P p 1e-09
1vpl_A256 ABC transporter, ATP-binding protein; TM0544, stru 1e-08
3tif_A235 Uncharacterized ABC transporter ATP-binding prote; 2e-08
3tui_C366 Methionine import ATP-binding protein METN; ABC-tr 2e-08
3tui_C 366 Methionine import ATP-binding protein METN; ABC-tr 1e-04
2pcj_A224 ABC transporter, lipoprotein-releasing system ATP- 2e-08
2pcj_A 224 ABC transporter, lipoprotein-releasing system ATP- 1e-04
1vt4_I1221 APAF-1 related killer DARK; drosophila apoptosome, 8e-08
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-07
2iw3_A986 Elongation factor 3A; acetylation, ATP-binding, pr 4e-07
2iw3_A 986 Elongation factor 3A; acetylation, ATP-binding, pr 1e-05
2iw3_A986 Elongation factor 3A; acetylation, ATP-binding, pr 4e-05
1ji0_A240 ABC transporter; ATP binding protein, structural g 6e-07
1ji0_A 240 ABC transporter; ATP binding protein, structural g 9e-07
1z47_A355 CYSA, putative ABC-transporter ATP-binding protein 1e-06
3d31_A348 Sulfate/molybdate ABC transporter, ATP-binding pro 3e-05
2onk_A240 Molybdate/tungstate ABC transporter, ATP-binding p 4e-05
2olj_A263 Amino acid ABC transporter; ABC domain, ATPase, hy 2e-04
1oxx_K353 GLCV, glucose, ABC transporter, ATP binding protei 2e-04
1b0u_A262 Histidine permease; ABC transporter, transport pro 2e-04
2it1_A362 362AA long hypothetical maltose/maltodextrin trans 2e-04
3fvq_A359 Fe(3+) IONS import ATP-binding protein FBPC; nucle 3e-04
1v43_A372 Sugar-binding transport ATP-binding protein; ATPas 5e-04
1tq4_A 413 IIGP1, interferon-inducible GTPase; interferon gam 8e-04
>2cbz_A Multidrug resistance-associated protein 1; ABC proteins, MRP1/ABCC1, nucleotide-binding domain, ATP- binding, hydrolysis, transport; HET: ATP; 1.5A {Homo sapiens} Length = 237 Back     alignment and structure
 Score =  329 bits (845), Expect = e-104
 Identities = 99/235 (42%), Positives = 138/235 (58%), Gaps = 28/235 (11%)

Query: 640 AVSIKNGNFSWD-SKSPTLSNINLDIPVGSLVAIVGGTGEGKTSLVSAMLGELPPLKDAS 698
           +++++N  F+W  S  PTL+ I   IP G+LVA+VG  G GK+SL+SA+L E+  ++   
Sbjct: 3   SITVRNATFTWARSDPPTLNGITFSIPEGALVAVVGQVGCGKSSLLSALLAEMDKVE-GH 61

Query: 699 VVIRGTVAYVPQISWIFNATLRKNILFGSEFDPAKYWKTVDVSALQHDLDLLPDRDLTEI 758
           V I+G+VAYVPQ +WI N +LR+NILFG + +   Y   +   AL  DL++LP  D TEI
Sbjct: 62  VAIKGSVAYVPQQAWIQNDSLRENILFGCQLEEPYYRSVIQACALLPDLEILPSGDRTEI 121

Query: 759 GERGVNISGGQKQRVSMARAV------------------------FNSCI--KEELRGKT 792
           GE+GVN+SGGQKQRVS+ARAV                        F + I  K  L+ KT
Sbjct: 122 GEKGVNLSGGQKQRVSLARAVYSNADIYLFDDPLSAVDAHVGKHIFENVIGPKGMLKNKT 181

Query: 793 RILVTNQLHFLPHVDRIILVSEGMIKEEGSFEELSKHGRLFQKLMENAGKMEEME 847
           RILVT+ + +LP VD II++S G I E GS++EL      F + +          
Sbjct: 182 RILVTHSMSYLPQVDVIIVMSGGKISEMGSYQELLARDGAFAEFLRTYASHHHHH 236
>2cbz_A Multidrug resistance-associated protein 1; ABC proteins, MRP1/ABCC1, nucleotide-binding domain, ATP- binding, hydrolysis, transport; HET: ATP; 1.5A {Homo sapiens} Length = 237 Back     alignment and structure
>2bbs_A Cystic fibrosis transmembrane conductance regulator; ATP binding cassette, transport protein; HET: ATP; 2.05A {Homo sapiens} PDB: 2bbt_A* 1xmi_A* 1xmj_A* 2bbo_A* 3si7_A* 1r0w_A 1q3h_A 1r0x_A* 1r0y_A* 1r0z_A* 1r10_A* 1xf9_A* 1xfa_A* Length = 290 Back     alignment and structure
>2bbs_A Cystic fibrosis transmembrane conductance regulator; ATP binding cassette, transport protein; HET: ATP; 2.05A {Homo sapiens} PDB: 2bbt_A* 1xmi_A* 1xmj_A* 2bbo_A* 3si7_A* 1r0w_A 1q3h_A 1r0x_A* 1r0y_A* 1r0z_A* 1r10_A* 1xf9_A* 1xfa_A* Length = 290 Back     alignment and structure
>2pze_A Cystic fibrosis transmembrane conductance regulat; NBD, ABC transporter, CFTR, hydrolase; HET: ATP; 1.70A {Homo sapiens} PDB: 2pzg_A* 2pzf_A* 1ckx_A 1cky_A 1ckw_A 1ckz_A Length = 229 Back     alignment and structure
>2pze_A Cystic fibrosis transmembrane conductance regulat; NBD, ABC transporter, CFTR, hydrolase; HET: ATP; 1.70A {Homo sapiens} PDB: 2pzg_A* 2pzf_A* 1ckx_A 1cky_A 1ckw_A 1ckz_A Length = 229 Back     alignment and structure
>3g5u_A MCG1178, multidrug resistance protein 1A; P-glycoprotein, PGP, cyclic peptide, membrane protein; 3.80A {Mus musculus} PDB: 3g61_A* 3g60_A* Length = 1284 Back     alignment and structure
>3g5u_A MCG1178, multidrug resistance protein 1A; P-glycoprotein, PGP, cyclic peptide, membrane protein; 3.80A {Mus musculus} PDB: 3g61_A* 3g60_A* Length = 1284 Back     alignment and structure
>3g5u_A MCG1178, multidrug resistance protein 1A; P-glycoprotein, PGP, cyclic peptide, membrane protein; 3.80A {Mus musculus} PDB: 3g61_A* 3g60_A* Length = 1284 Back     alignment and structure
>3b60_A Lipid A export ATP-binding/permease protein MSBA; ABC transporter, lipid flippase, hydrolase, inner membrane, lipid transport, membrane; HET: ANP; 3.70A {Salmonella typhimurium} SCOP: c.37.1.12 f.37.1.1 PDB: 3b5y_A* 3b5z_A* 3b5w_A Length = 582 Back     alignment and structure
>3b60_A Lipid A export ATP-binding/permease protein MSBA; ABC transporter, lipid flippase, hydrolase, inner membrane, lipid transport, membrane; HET: ANP; 3.70A {Salmonella typhimurium} SCOP: c.37.1.12 f.37.1.1 PDB: 3b5y_A* 3b5z_A* 3b5w_A Length = 582 Back     alignment and structure
>3b5x_A Lipid A export ATP-binding/permease protein MSBA; ABC transporter, lipid flippase, hydrolase, inner membrane, lipid transport, membrane; 5.50A {Vibrio cholerae} Length = 582 Back     alignment and structure
>3b5x_A Lipid A export ATP-binding/permease protein MSBA; ABC transporter, lipid flippase, hydrolase, inner membrane, lipid transport, membrane; 5.50A {Vibrio cholerae} Length = 582 Back     alignment and structure
>4a82_A Cystic fibrosis transmembrane conductance regulat; CFTR, ION channel, transport protein, casse protein; 2.00A {Homo sapiens} PDB: 2onj_A* 2hyd_A Length = 578 Back     alignment and structure
>4a82_A Cystic fibrosis transmembrane conductance regulat; CFTR, ION channel, transport protein, casse protein; 2.00A {Homo sapiens} PDB: 2onj_A* 2hyd_A Length = 578 Back     alignment and structure
>3qf4_A ABC transporter, ATP-binding protein; multidrug transporter, transport protein; HET: ANP; 2.90A {Thermotoga maritima} Length = 587 Back     alignment and structure
>3qf4_A ABC transporter, ATP-binding protein; multidrug transporter, transport protein; HET: ANP; 2.90A {Thermotoga maritima} Length = 587 Back     alignment and structure
>3qf4_B Uncharacterized ABC transporter ATP-binding prote TM_0288; multidrug transporter, transport protein; HET: ANP; 2.90A {Thermotoga maritima} Length = 598 Back     alignment and structure
>3qf4_B Uncharacterized ABC transporter ATP-binding prote TM_0288; multidrug transporter, transport protein; HET: ANP; 2.90A {Thermotoga maritima} Length = 598 Back     alignment and structure
>3nh6_A ATP-binding cassette SUB-family B member 6, mitoc; ABC-transporter, ABCB6, nucleotide binding domain, heme BIOS transport protein; 2.00A {Homo sapiens} PDB: 3nh9_A* 3nha_A* 3nhb_A* Length = 306 Back     alignment and structure
>3nh6_A ATP-binding cassette SUB-family B member 6, mitoc; ABC-transporter, ABCB6, nucleotide binding domain, heme BIOS transport protein; 2.00A {Homo sapiens} PDB: 3nh9_A* 3nha_A* 3nhb_A* Length = 306 Back     alignment and structure
>3gd7_A Fusion complex of cystic fibrosis transmembrane conductance regulator, residues 1193-1427...; CFTR, ABC transporter, nucleotide binding domain, NBD; HET: B44; 2.70A {Homo sapiens} Length = 390 Back     alignment and structure
>3gd7_A Fusion complex of cystic fibrosis transmembrane conductance regulator, residues 1193-1427...; CFTR, ABC transporter, nucleotide binding domain, NBD; HET: B44; 2.70A {Homo sapiens} Length = 390 Back     alignment and structure
>1mv5_A LMRA, multidrug resistance ABC transporter ATP-binding and permease protein; asymmetric dimer, tetramer, P-glycoprotein; HET: ATP ADP; 3.10A {Lactococcus lactis} SCOP: c.37.1.12 Length = 243 Back     alignment and structure
>1mv5_A LMRA, multidrug resistance ABC transporter ATP-binding and permease protein; asymmetric dimer, tetramer, P-glycoprotein; HET: ATP ADP; 3.10A {Lactococcus lactis} SCOP: c.37.1.12 Length = 243 Back     alignment and structure
>2ghi_A Transport protein; multidrug resistance protein, MDR, structural genomics, structural genomics consortium, SGC; 2.20A {Plasmodium yoelii yoelii str} Length = 260 Back     alignment and structure
>2ghi_A Transport protein; multidrug resistance protein, MDR, structural genomics, structural genomics consortium, SGC; 2.20A {Plasmodium yoelii yoelii str} Length = 260 Back     alignment and structure
>2ff7_A Alpha-hemolysin translocation ATP-binding protein HLYB; ABC-transporter, transport protein; HET: ADP; 1.60A {Escherichia coli} SCOP: c.37.1.12 PDB: 2ffb_A* 2fgk_A* 2ffa_A* 2fgj_A* 2pmk_A* 3b5j_A* 1mt0_A 1xef_A* Length = 247 Back     alignment and structure
>2ff7_A Alpha-hemolysin translocation ATP-binding protein HLYB; ABC-transporter, transport protein; HET: ADP; 1.60A {Escherichia coli} SCOP: c.37.1.12 PDB: 2ffb_A* 2fgk_A* 2ffa_A* 2fgj_A* 2pmk_A* 3b5j_A* 1mt0_A 1xef_A* Length = 247 Back     alignment and structure
>2ixe_A Antigen peptide transporter 1; ABC ATPase, hydrolase; HET: ATP; 2.0A {Rattus norvegicus} PDB: 2ixg_A* 2ixf_A* 1jj7_A* Length = 271 Back     alignment and structure
>2ixe_A Antigen peptide transporter 1; ABC ATPase, hydrolase; HET: ATP; 2.0A {Rattus norvegicus} PDB: 2ixg_A* 2ixf_A* 1jj7_A* Length = 271 Back     alignment and structure
>2nq2_C Hypothetical ABC transporter ATP-binding protein HI1470; putative iron chelatin ABC transporter, nucleotide binding domain; 2.40A {Haemophilus influenzae} Length = 253 Back     alignment and structure
>2nq2_C Hypothetical ABC transporter ATP-binding protein HI1470; putative iron chelatin ABC transporter, nucleotide binding domain; 2.40A {Haemophilus influenzae} Length = 253 Back     alignment and structure
>3gfo_A Cobalt import ATP-binding protein CBIO 1; structural genomics, cell membrane, cobalt transport, hydrolase, ION transport; 2.30A {Clostridium perfringens atcc 13124} Length = 275 Back     alignment and structure
>3gfo_A Cobalt import ATP-binding protein CBIO 1; structural genomics, cell membrane, cobalt transport, hydrolase, ION transport; 2.30A {Clostridium perfringens atcc 13124} Length = 275 Back     alignment and structure
>2ihy_A ABC transporter, ATP-binding protein; ATPase, ABC cassette, hydrolase; HET: MSE; 1.90A {Staphylococcus aureus} Length = 279 Back     alignment and structure
>2ihy_A ABC transporter, ATP-binding protein; ATPase, ABC cassette, hydrolase; HET: MSE; 1.90A {Staphylococcus aureus} Length = 279 Back     alignment and structure
>2yz2_A Putative ABC transporter ATP-binding protein TM_0; cobalt transport, TM02 hydrolase, inner membrane, membrane, nucleotide-binding; 2.30A {Thermotoga maritima} Length = 266 Back     alignment and structure
>2yz2_A Putative ABC transporter ATP-binding protein TM_0; cobalt transport, TM02 hydrolase, inner membrane, membrane, nucleotide-binding; 2.30A {Thermotoga maritima} Length = 266 Back     alignment and structure
>3j16_B RLI1P; ribosome recycling, translation, eukarya, ribosome; HET: ATP; NMR {Saccharomyces cerevisiae} Length = 608 Back     alignment and structure
>3j16_B RLI1P; ribosome recycling, translation, eukarya, ribosome; HET: ATP; NMR {Saccharomyces cerevisiae} Length = 608 Back     alignment and structure
>3j16_B RLI1P; ribosome recycling, translation, eukarya, ribosome; HET: ATP; NMR {Saccharomyces cerevisiae} Length = 608 Back     alignment and structure
>3j16_B RLI1P; ribosome recycling, translation, eukarya, ribosome; HET: ATP; NMR {Saccharomyces cerevisiae} Length = 608 Back     alignment and structure
>2pjz_A Hypothetical protein ST1066; ATP binding protein, structural genomics, NPPSFA; 1.90A {Sulfolobus tokodaii} Length = 263 Back     alignment and structure
>3bk7_A ABC transporter ATP-binding protein; ABC ATPase, iron-sulfur cluster, adenosine diphosphate, nucleotide-binding; HET: ADP; 2.80A {Pyrococcus abyssi} PDB: 3j15_B* Length = 607 Back     alignment and structure
>3bk7_A ABC transporter ATP-binding protein; ABC ATPase, iron-sulfur cluster, adenosine diphosphate, nucleotide-binding; HET: ADP; 2.80A {Pyrococcus abyssi} PDB: 3j15_B* Length = 607 Back     alignment and structure
>3bk7_A ABC transporter ATP-binding protein; ABC ATPase, iron-sulfur cluster, adenosine diphosphate, nucleotide-binding; HET: ADP; 2.80A {Pyrococcus abyssi} PDB: 3j15_B* Length = 607 Back     alignment and structure
>3bk7_A ABC transporter ATP-binding protein; ABC ATPase, iron-sulfur cluster, adenosine diphosphate, nucleotide-binding; HET: ADP; 2.80A {Pyrococcus abyssi} PDB: 3j15_B* Length = 607 Back     alignment and structure
>1yqt_A RNAse L inhibitor; ATP-binding cassette, ribosome biogenesis, hydrolyase/translation complex; HET: ADP; 1.90A {Pyrococcus furiosus} Length = 538 Back     alignment and structure
>1yqt_A RNAse L inhibitor; ATP-binding cassette, ribosome biogenesis, hydrolyase/translation complex; HET: ADP; 1.90A {Pyrococcus furiosus} Length = 538 Back     alignment and structure
>1yqt_A RNAse L inhibitor; ATP-binding cassette, ribosome biogenesis, hydrolyase/translation complex; HET: ADP; 1.90A {Pyrococcus furiosus} Length = 538 Back     alignment and structure
>1yqt_A RNAse L inhibitor; ATP-binding cassette, ribosome biogenesis, hydrolyase/translation complex; HET: ADP; 1.90A {Pyrococcus furiosus} Length = 538 Back     alignment and structure
>2qi9_C Vitamin B12 import ATP-binding protein BTUD; inner membrane, membrane, transmembrane, transport, ATP- binding, hydrolase, nucleotide-binding, periplasm; HET: 1PE; 2.60A {Escherichia coli} PDB: 1l7v_C* 4dbl_C Length = 249 Back     alignment and structure
>2qi9_C Vitamin B12 import ATP-binding protein BTUD; inner membrane, membrane, transmembrane, transport, ATP- binding, hydrolase, nucleotide-binding, periplasm; HET: 1PE; 2.60A {Escherichia coli} PDB: 1l7v_C* 4dbl_C Length = 249 Back     alignment and structure
>3ozx_A RNAse L inhibitor; ATP binding cassette protein, hydrolase, translation; HET: ADP; 2.05A {Sulfolobus solfataricus} Length = 538 Back     alignment and structure
>3ozx_A RNAse L inhibitor; ATP binding cassette protein, hydrolase, translation; HET: ADP; 2.05A {Sulfolobus solfataricus} Length = 538 Back     alignment and structure
>3ozx_A RNAse L inhibitor; ATP binding cassette protein, hydrolase, translation; HET: ADP; 2.05A {Sulfolobus solfataricus} Length = 538 Back     alignment and structure
>1sgw_A Putative ABC transporter; structural genomics, P protein structure initiative, southeast collaboratory for S genomics, secsg; 1.70A {Pyrococcus furiosus} SCOP: c.37.1.12 Length = 214 Back     alignment and structure
>1vpl_A ABC transporter, ATP-binding protein; TM0544, structural GENO joint center for structural genomics, JCSG, protein structu initiative, PSI; 2.10A {Thermotoga maritima} SCOP: c.37.1.12 Length = 256 Back     alignment and structure
>3tif_A Uncharacterized ABC transporter ATP-binding prote; nucleotide-binding domain, ABC transporter ATPase; HET: ADP; 1.80A {Methanocaldococcus jannaschii dsm 2661ORGANISM_TAXID} PDB: 1l2t_A* 1f3o_A* Length = 235 Back     alignment and structure
>3tui_C Methionine import ATP-binding protein METN; ABC-transporter, type I ABC type importer, methionine uptake transporter, membrane protein; HET: ADP; 2.90A {Escherichia coli} PDB: 3tuj_C 3tuz_C* 3dhw_C Length = 366 Back     alignment and structure
>3tui_C Methionine import ATP-binding protein METN; ABC-transporter, type I ABC type importer, methionine uptake transporter, membrane protein; HET: ADP; 2.90A {Escherichia coli} PDB: 3tuj_C 3tuz_C* 3dhw_C Length = 366 Back     alignment and structure
>2pcj_A ABC transporter, lipoprotein-releasing system ATP-binding protein; structural genomics; 1.70A {Aquifex aeolicus} PDB: 2pcl_A Length = 224 Back     alignment and structure
>2pcj_A ABC transporter, lipoprotein-releasing system ATP-binding protein; structural genomics; 1.70A {Aquifex aeolicus} PDB: 2pcl_A Length = 224 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>2iw3_A Elongation factor 3A; acetylation, ATP-binding, protein biosynthesis, nucleotide-binding, phosphorylation, RNA- binding, rRNA-binding; HET: ADP; 2.4A {Saccharomyces cerevisiae} PDB: 2iwh_A* 2ix3_A 2ix8_A Length = 986 Back     alignment and structure
>2iw3_A Elongation factor 3A; acetylation, ATP-binding, protein biosynthesis, nucleotide-binding, phosphorylation, RNA- binding, rRNA-binding; HET: ADP; 2.4A {Saccharomyces cerevisiae} PDB: 2iwh_A* 2ix3_A 2ix8_A Length = 986 Back     alignment and structure
>2iw3_A Elongation factor 3A; acetylation, ATP-binding, protein biosynthesis, nucleotide-binding, phosphorylation, RNA- binding, rRNA-binding; HET: ADP; 2.4A {Saccharomyces cerevisiae} PDB: 2iwh_A* 2ix3_A 2ix8_A Length = 986 Back     alignment and structure
>1ji0_A ABC transporter; ATP binding protein, structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; HET: ATP; 2.00A {Thermotoga maritima} SCOP: c.37.1.12 Length = 240 Back     alignment and structure
>1ji0_A ABC transporter; ATP binding protein, structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; HET: ATP; 2.00A {Thermotoga maritima} SCOP: c.37.1.12 Length = 240 Back     alignment and structure
>1z47_A CYSA, putative ABC-transporter ATP-binding protein; alpha/beta motif, beta sandwich, ligand binding protein; 1.90A {Alicyclobacillus acidocaldarius} Length = 355 Back     alignment and structure
>3d31_A Sulfate/molybdate ABC transporter, ATP-binding protein; ATP-binding, nucleotide-binding, membrane, transmembrane, transport protein; 3.00A {Methanosarcina acetivorans} SCOP: b.40.6.3 c.37.1.12 Length = 348 Back     alignment and structure
>2onk_A Molybdate/tungstate ABC transporter, ATP-binding protein; membrane protein; 3.10A {Archaeoglobus fulgidus} SCOP: c.37.1.12 Length = 240 Back     alignment and structure
>2olj_A Amino acid ABC transporter; ABC domain, ATPase, hydrolase; HET: ADP; 2.05A {Geobacillus stearothermophilus} PDB: 2olk_A* 2ouk_A 2q0h_A* 3c4j_A* 3c41_J* Length = 263 Back     alignment and structure
>1oxx_K GLCV, glucose, ABC transporter, ATP binding protein; ABC-ATPase, ATP-binding cassette, ATPase, transport protein; 1.45A {Sulfolobus solfataricus} SCOP: b.40.6.3 c.37.1.12 PDB: 1oxs_C 1oxt_A 1oxu_A* 1oxv_A* Length = 353 Back     alignment and structure
>1b0u_A Histidine permease; ABC transporter, transport protein; HET: ATP; 1.50A {Salmonella typhimurium} SCOP: c.37.1.12 Length = 262 Back     alignment and structure
>2it1_A 362AA long hypothetical maltose/maltodextrin transport ATP-binding protein; structural genomics, NPPSFA; 1.94A {Pyrococcus horikoshii} Length = 362 Back     alignment and structure
>3fvq_A Fe(3+) IONS import ATP-binding protein FBPC; nucleotide binding domain, ABC motor domain, ferric iron transport, cell inner membrane; HET: ATP; 1.90A {Neisseria gonorrhoeae} Length = 359 Back     alignment and structure
>1v43_A Sugar-binding transport ATP-binding protein; ATPase, active transport, sugar uptake and regulation, transport protein; 2.20A {Pyrococcus horikoshii} SCOP: b.40.6.3 b.40.6.3 c.37.1.12 PDB: 1vci_A* Length = 372 Back     alignment and structure
>1tq4_A IIGP1, interferon-inducible GTPase; interferon gamma, dimer, immunology, signaling protein; HET: GDP; 1.95A {Mus musculus} SCOP: c.37.1.8 PDB: 1tqd_A* 1tq6_A* 1tpz_A* 1tq2_A* Length = 413 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

No hit with probability above 80.00

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 1303
d1r0wa_281 c.37.1.12 (A:) Cystic fibrosis transmembrane condu 2e-48
d1r0wa_ 281 c.37.1.12 (A:) Cystic fibrosis transmembrane condu 3e-13
d2hyda1255 c.37.1.12 (A:324-578) Putative multidrug export AT 8e-48
d2hyda1 255 c.37.1.12 (A:324-578) Putative multidrug export AT 7e-17
d3b60a1253 c.37.1.12 (A:329-581) Multidrug resistance ABC tra 3e-42
d3b60a1 253 c.37.1.12 (A:329-581) Multidrug resistance ABC tra 1e-14
d1mv5a_242 c.37.1.12 (A:) Multidrug resistance ABC transporte 5e-42
d1mv5a_ 242 c.37.1.12 (A:) Multidrug resistance ABC transporte 2e-12
d1jj7a_251 c.37.1.12 (A:) Peptide transporter Tap1, C-termina 2e-40
d1jj7a_ 251 c.37.1.12 (A:) Peptide transporter Tap1, C-termina 2e-13
d2pmka1241 c.37.1.12 (A:467-707) Haemolysin B ATP-binding pro 2e-38
d2pmka1 241 c.37.1.12 (A:467-707) Haemolysin B ATP-binding pro 2e-15
d1v43a3239 c.37.1.12 (A:7-245) Hypothetical protein PH0022, N 2e-17
d1v43a3 239 c.37.1.12 (A:7-245) Hypothetical protein PH0022, N 7e-07
d1l2ta_230 c.37.1.12 (A:) MJ0796 {Archaeon Methanococcus jann 7e-17
d1l2ta_ 230 c.37.1.12 (A:) MJ0796 {Archaeon Methanococcus jann 9e-07
d1ji0a_240 c.37.1.12 (A:) Branched chain aminoacid ABC transp 1e-16
d1ji0a_ 240 c.37.1.12 (A:) Branched chain aminoacid ABC transp 3e-06
d1vpla_238 c.37.1.12 (A:) Putative ABC transporter TM0544 {Th 7e-16
d1vpla_ 238 c.37.1.12 (A:) Putative ABC transporter TM0544 {Th 4e-08
d1l7vc_231 c.37.1.12 (C:) ABC transporter involved in vitamin 1e-15
d1l7vc_ 231 c.37.1.12 (C:) ABC transporter involved in vitamin 2e-06
d2awna2232 c.37.1.12 (A:4-235) Maltose transport protein MalK 1e-15
d2awna2 232 c.37.1.12 (A:4-235) Maltose transport protein MalK 1e-06
d1g2912240 c.37.1.12 (1:1-240) Maltose transport protein MalK 2e-15
d1g2912 240 c.37.1.12 (1:1-240) Maltose transport protein MalK 1e-06
d3dhwc1240 c.37.1.12 (C:1-240) Methionine import ATP-binding 3e-15
d3dhwc1 240 c.37.1.12 (C:1-240) Methionine import ATP-binding 8e-07
d1b0ua_258 c.37.1.12 (A:) ATP-binding subunit of the histidin 6e-15
d1b0ua_ 258 c.37.1.12 (A:) ATP-binding subunit of the histidin 2e-07
d1g6ha_254 c.37.1.12 (A:) MJ1267 {Archaeon Methanococcus jann 1e-14
d1g6ha_ 254 c.37.1.12 (A:) MJ1267 {Archaeon Methanococcus jann 2e-07
d1sgwa_200 c.37.1.12 (A:) Putative ABC transporter PF0895 {Py 1e-14
d1sgwa_ 200 c.37.1.12 (A:) Putative ABC transporter PF0895 {Py 5e-08
d3d31a2229 c.37.1.12 (A:1-229) Sulfate/molybdate ABC transpor 6e-13
d3d31a2 229 c.37.1.12 (A:1-229) Sulfate/molybdate ABC transpor 4e-06
d1oxxk2242 c.37.1.12 (K:1-242) Glucose transport protein GlcV 7e-11
d1oxxk2 242 c.37.1.12 (K:1-242) Glucose transport protein GlcV 2e-07
d2onka1240 c.37.1.12 (A:1-240) Molybdate/tungstate import ATP 4e-10
d3b60a2319 f.37.1.1 (A:10-328) Multidrug resistance ABC trans 5e-08
d2hyda2323 f.37.1.1 (A:1-323) Putative multidrug export ATP-b 7e-07
d1ye8a1178 c.37.1.11 (A:1-178) Hypothetical kinase-like prote 6e-05
d2gj8a1 161 c.37.1.8 (A:216-376) Probable tRNA modification GT 0.004
>d1r0wa_ c.37.1.12 (A:) Cystic fibrosis transmembrane conductance regulator, CFTR, nucleotide-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 281 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: ABC transporter ATPase domain-like
domain: Cystic fibrosis transmembrane conductance regulator, CFTR, nucleotide-binding domain
species: Mouse (Mus musculus) [TaxId: 10090]

 Score =  172 bits (436), Expect = 2e-48
 Identities = 85/268 (31%), Positives = 127/268 (47%), Gaps = 29/268 (10%)

Query: 609 NANVSLQRLEELLLAEERILMPNPPLEPELPAVSIKNGNFSWDSKSPTLSNINLDIPVGS 668
           N     +     LL + +    +     +   VS  +         P L NINL+I  G 
Sbjct: 7   NVTAFWEEGFGELLEKVQQSNGDRKHSSDENNVSFSH--LCLVGN-PVLKNINLNIEKGE 63

Query: 669 LVAIVGGTGEGKTSLVSAMLGELPPLKDASVVIRGTVAYVPQISWIFNATLRKNILFGSE 728
           ++AI G TG GKTSL+  +LGEL    +  +   G V++  Q SWI   T+++NI+FG  
Sbjct: 64  MLAITGSTGSGKTSLLMLILGELEA-SEGIIKHSGRVSFCSQFSWIMPGTIKENIIFGVS 122

Query: 729 FDPAKYWKTVDVSALQHDLDLLPDRDLTEIGERGVNISGGQKQRVSMARA---------- 778
           +D  +Y   V    LQ D+    ++D T +GE GV +SGGQ+ R+S+ARA          
Sbjct: 123 YDEYRYKSVVKACQLQQDITKFAEQDNTVLGEGGVTLSGGQRARISLARAVYKDADLYLL 182

Query: 779 --------------VFNSCIKEELRGKTRILVTNQLHFLPHVDRIILVSEGMIKEEGSFE 824
                         VF SC+ + +  KTRILVT+++  L   D+I+++ +G     G+F 
Sbjct: 183 DSPFGYLDVFTEEQVFESCVCKLMANKTRILVTSKMEHLRKADKILILHQGSSYFYGTFS 242

Query: 825 EL-SKHGRLFQKLMENAGKMEEMEEREE 851
           EL S       KLM      +  EER  
Sbjct: 243 ELQSLRPDFSSKLMGYDTFDQFTEERRS 270
>d1r0wa_ c.37.1.12 (A:) Cystic fibrosis transmembrane conductance regulator, CFTR, nucleotide-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 281 Back     information, alignment and structure
>d2hyda1 c.37.1.12 (A:324-578) Putative multidrug export ATP-binding/permease protein SAV1866 {Staphylococcus aureus [TaxId: 1280]} Length = 255 Back     information, alignment and structure
>d2hyda1 c.37.1.12 (A:324-578) Putative multidrug export ATP-binding/permease protein SAV1866 {Staphylococcus aureus [TaxId: 1280]} Length = 255 Back     information, alignment and structure
>d3b60a1 c.37.1.12 (A:329-581) Multidrug resistance ABC transporter MsbA, C-terminal domain {Salmonella typhimurium [TaxId: 90371]} Length = 253 Back     information, alignment and structure
>d3b60a1 c.37.1.12 (A:329-581) Multidrug resistance ABC transporter MsbA, C-terminal domain {Salmonella typhimurium [TaxId: 90371]} Length = 253 Back     information, alignment and structure
>d1mv5a_ c.37.1.12 (A:) Multidrug resistance ABC transporter LmrA, C-terminal domain {Lactococcus lactis [TaxId: 1358]} Length = 242 Back     information, alignment and structure
>d1mv5a_ c.37.1.12 (A:) Multidrug resistance ABC transporter LmrA, C-terminal domain {Lactococcus lactis [TaxId: 1358]} Length = 242 Back     information, alignment and structure
>d1jj7a_ c.37.1.12 (A:) Peptide transporter Tap1, C-terminal ABC domain {Human (Homo sapiens) [TaxId: 9606]} Length = 251 Back     information, alignment and structure
>d1jj7a_ c.37.1.12 (A:) Peptide transporter Tap1, C-terminal ABC domain {Human (Homo sapiens) [TaxId: 9606]} Length = 251 Back     information, alignment and structure
>d2pmka1 c.37.1.12 (A:467-707) Haemolysin B ATP-binding protein {Escherichia coli [TaxId: 562]} Length = 241 Back     information, alignment and structure
>d2pmka1 c.37.1.12 (A:467-707) Haemolysin B ATP-binding protein {Escherichia coli [TaxId: 562]} Length = 241 Back     information, alignment and structure
>d1v43a3 c.37.1.12 (A:7-245) Hypothetical protein PH0022, N-terminal domain {Pyrococcus horikoshii [TaxId: 53953]} Length = 239 Back     information, alignment and structure
>d1v43a3 c.37.1.12 (A:7-245) Hypothetical protein PH0022, N-terminal domain {Pyrococcus horikoshii [TaxId: 53953]} Length = 239 Back     information, alignment and structure
>d1l2ta_ c.37.1.12 (A:) MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Length = 230 Back     information, alignment and structure
>d1l2ta_ c.37.1.12 (A:) MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Length = 230 Back     information, alignment and structure
>d1ji0a_ c.37.1.12 (A:) Branched chain aminoacid ABC transporter {Thermotoga maritima, TM1139 [TaxId: 2336]} Length = 240 Back     information, alignment and structure
>d1ji0a_ c.37.1.12 (A:) Branched chain aminoacid ABC transporter {Thermotoga maritima, TM1139 [TaxId: 2336]} Length = 240 Back     information, alignment and structure
>d1vpla_ c.37.1.12 (A:) Putative ABC transporter TM0544 {Thermotoga maritima [TaxId: 2336]} Length = 238 Back     information, alignment and structure
>d1vpla_ c.37.1.12 (A:) Putative ABC transporter TM0544 {Thermotoga maritima [TaxId: 2336]} Length = 238 Back     information, alignment and structure
>d1l7vc_ c.37.1.12 (C:) ABC transporter involved in vitamin B12 uptake, BtuD {Escherichia coli [TaxId: 562]} Length = 231 Back     information, alignment and structure
>d1l7vc_ c.37.1.12 (C:) ABC transporter involved in vitamin B12 uptake, BtuD {Escherichia coli [TaxId: 562]} Length = 231 Back     information, alignment and structure
>d2awna2 c.37.1.12 (A:4-235) Maltose transport protein MalK, N-terminal domain {Escherichia coli [TaxId: 562]} Length = 232 Back     information, alignment and structure
>d2awna2 c.37.1.12 (A:4-235) Maltose transport protein MalK, N-terminal domain {Escherichia coli [TaxId: 562]} Length = 232 Back     information, alignment and structure
>d1g2912 c.37.1.12 (1:1-240) Maltose transport protein MalK, N-terminal domain {Archaeon Thermococcus litoralis [TaxId: 2265]} Length = 240 Back     information, alignment and structure
>d1g2912 c.37.1.12 (1:1-240) Maltose transport protein MalK, N-terminal domain {Archaeon Thermococcus litoralis [TaxId: 2265]} Length = 240 Back     information, alignment and structure
>d3dhwc1 c.37.1.12 (C:1-240) Methionine import ATP-binding protein MetN {Escherichia coli [TaxId: 562]} Length = 240 Back     information, alignment and structure
>d3dhwc1 c.37.1.12 (C:1-240) Methionine import ATP-binding protein MetN {Escherichia coli [TaxId: 562]} Length = 240 Back     information, alignment and structure
>d1b0ua_ c.37.1.12 (A:) ATP-binding subunit of the histidine permease {Salmonella typhimurium [TaxId: 90371]} Length = 258 Back     information, alignment and structure
>d1b0ua_ c.37.1.12 (A:) ATP-binding subunit of the histidine permease {Salmonella typhimurium [TaxId: 90371]} Length = 258 Back     information, alignment and structure
>d1g6ha_ c.37.1.12 (A:) MJ1267 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Length = 254 Back     information, alignment and structure
>d1g6ha_ c.37.1.12 (A:) MJ1267 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Length = 254 Back     information, alignment and structure
>d1sgwa_ c.37.1.12 (A:) Putative ABC transporter PF0895 {Pyrococcus furiosus [TaxId: 2261]} Length = 200 Back     information, alignment and structure
>d1sgwa_ c.37.1.12 (A:) Putative ABC transporter PF0895 {Pyrococcus furiosus [TaxId: 2261]} Length = 200 Back     information, alignment and structure
>d3d31a2 c.37.1.12 (A:1-229) Sulfate/molybdate ABC transporter, ATP-binding protein {Methanosarcina acetivorans [TaxId: 2214]} Length = 229 Back     information, alignment and structure
>d3d31a2 c.37.1.12 (A:1-229) Sulfate/molybdate ABC transporter, ATP-binding protein {Methanosarcina acetivorans [TaxId: 2214]} Length = 229 Back     information, alignment and structure
>d1oxxk2 c.37.1.12 (K:1-242) Glucose transport protein GlcV, N-terminal domain {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Length = 242 Back     information, alignment and structure
>d1oxxk2 c.37.1.12 (K:1-242) Glucose transport protein GlcV, N-terminal domain {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Length = 242 Back     information, alignment and structure
>d2onka1 c.37.1.12 (A:1-240) Molybdate/tungstate import ATP-binding protein WtpC (ModC) {Archaeoglobus fulgidus [TaxId: 2234]} Length = 240 Back     information, alignment and structure
>d3b60a2 f.37.1.1 (A:10-328) Multidrug resistance ABC transporter MsbA, N-terminal domain {Salmonella typhimurium [TaxId: 90371]} Length = 319 Back     information, alignment and structure
>d2hyda2 f.37.1.1 (A:1-323) Putative multidrug export ATP-binding/permease protein SAV1866 {Staphylococcus aureus [TaxId: 1280]} Length = 323 Back     information, alignment and structure
>d1ye8a1 c.37.1.11 (A:1-178) Hypothetical kinase-like protein Aq_1292 {Aquifex aeolicus [TaxId: 63363]} Length = 178 Back     information, alignment and structure
>d2gj8a1 c.37.1.8 (A:216-376) Probable tRNA modification GTPase TrmE (MnmE), G domain {Escherichia coli [TaxId: 562]} Length = 161 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query1303
d2hyda1255 Putative multidrug export ATP-binding/permease pro 100.0
d2pmka1241 Haemolysin B ATP-binding protein {Escherichia coli 100.0
d3b60a1253 Multidrug resistance ABC transporter MsbA, C-termi 100.0
d1mv5a_242 Multidrug resistance ABC transporter LmrA, C-termi 100.0
d1jj7a_251 Peptide transporter Tap1, C-terminal ABC domain {H 100.0
d1r0wa_281 Cystic fibrosis transmembrane conductance regulato 100.0
d1oxxk2242 Glucose transport protein GlcV, N-terminal domain 99.98
d1g2912240 Maltose transport protein MalK, N-terminal domain 99.98
d2awna2232 Maltose transport protein MalK, N-terminal domain 99.97
d1v43a3239 Hypothetical protein PH0022, N-terminal domain {Py 99.97
d3d31a2229 Sulfate/molybdate ABC transporter, ATP-binding pro 99.97
d3dhwc1240 Methionine import ATP-binding protein MetN {Escher 99.97
d1l2ta_230 MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 99.97
d1b0ua_258 ATP-binding subunit of the histidine permease {Sal 99.97
d1g6ha_254 MJ1267 {Archaeon Methanococcus jannaschii [TaxId: 99.97
d1ji0a_240 Branched chain aminoacid ABC transporter {Thermoto 99.97
d1vpla_238 Putative ABC transporter TM0544 {Thermotoga mariti 99.96
d3b60a2319 Multidrug resistance ABC transporter MsbA, N-termi 99.96
d2onka1240 Molybdate/tungstate import ATP-binding protein Wtp 99.95
d3b60a2319 Multidrug resistance ABC transporter MsbA, N-termi 99.95
d2hyda2323 Putative multidrug export ATP-binding/permease pro 99.94
d2hyda2323 Putative multidrug export ATP-binding/permease pro 99.94
d1l7vc_231 ABC transporter involved in vitamin B12 uptake, Bt 99.92
d1sgwa_200 Putative ABC transporter PF0895 {Pyrococcus furios 99.9
d2hyda1 255 Putative multidrug export ATP-binding/permease pro 99.72
d2pmka1 241 Haemolysin B ATP-binding protein {Escherichia coli 99.71
d3b60a1 253 Multidrug resistance ABC transporter MsbA, C-termi 99.7
d1jj7a_ 251 Peptide transporter Tap1, C-terminal ABC domain {H 99.7
d1mv5a_ 242 Multidrug resistance ABC transporter LmrA, C-termi 99.65
d1l2ta_ 230 MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 99.43
d1b0ua_ 258 ATP-binding subunit of the histidine permease {Sal 99.42
d1oxxk2 242 Glucose transport protein GlcV, N-terminal domain 99.4
d1g2912 240 Maltose transport protein MalK, N-terminal domain 99.4
d3dhwc1 240 Methionine import ATP-binding protein MetN {Escher 99.4
d1v43a3 239 Hypothetical protein PH0022, N-terminal domain {Py 99.4
d1vpla_ 238 Putative ABC transporter TM0544 {Thermotoga mariti 99.39
d1sgwa_ 200 Putative ABC transporter PF0895 {Pyrococcus furios 99.38
d1r0wa_ 281 Cystic fibrosis transmembrane conductance regulato 99.37
d1ji0a_ 240 Branched chain aminoacid ABC transporter {Thermoto 99.34
d1g6ha_ 254 MJ1267 {Archaeon Methanococcus jannaschii [TaxId: 99.33
g1f2t.1292 Rad50 {Archaeon Pyrococcus furiosus [TaxId: 2261]} 99.0
d1ye8a1178 Hypothetical kinase-like protein Aq_1292 {Aquifex 98.71
d1e69a_308 Smc head domain {Thermotoga maritima [TaxId: 2336] 98.05
g1ii8.1369 Rad50 {Archaeon Pyrococcus furiosus [TaxId: 2261]} 96.68
d1tq4a_400 Interferon-inducible GTPase {Mouse (Mus musculus) 96.62
d1u0la2225 Probable GTPase EngC (YjeQ), C-terminal domain {Th 96.59
g1xew.1329 Smc head domain {Pyrococcus furiosus [TaxId: 2261] 96.53
g1ii8.1369 Rad50 {Archaeon Pyrococcus furiosus [TaxId: 2261]} 96.41
d1ewqa2224 DNA repair protein MutS, the C-terminal domain {Th 96.4
d1h65a_257 Chloroplast protein translocon GTPase Toc34 {Garde 96.35
d1g6oa_323 Hexameric traffic ATPase, HP0525 {Helicobacter pyl 96.27
d1w1wa_427 Smc head domain {Baker's yeast (Saccharomyces cere 96.2
d1wb9a2234 DNA repair protein MutS, the C-terminal domain {Es 96.15
d1u0la2225 Probable GTPase EngC (YjeQ), C-terminal domain {Th 96.04
d1znwa1182 Guanylate kinase {Mycobacterium tuberculosis [TaxI 95.97
d1g6oa_323 Hexameric traffic ATPase, HP0525 {Helicobacter pyl 95.97
d1t9ha2231 Probable GTPase EngC (YjeQ), C-terminal domain {Ba 95.62
d1zp6a1176 Hypothetical protein Atu3015 {Agrobacterium tumefa 95.59
d1p9ra_401 Extracellular secretion NTPase EpsE {Vibrio choler 95.58
d1s96a_205 Guanylate kinase {Escherichia coli [TaxId: 562]} 95.48
d1sq5a_308 Pantothenate kinase PanK {Escherichia coli [TaxId: 95.46
d1p9ra_401 Extracellular secretion NTPase EpsE {Vibrio choler 95.13
d2p67a1327 LAO/AO transport system kinase ArgK {Escherichia c 94.95
d1np6a_170 Molybdopterin-guanine dinucleotide biosynthesis pr 94.93
d1t9ha2231 Probable GTPase EngC (YjeQ), C-terminal domain {Ba 94.87
d1svia_195 Probable GTPase EngB {Bacillus subtilis [TaxId: 14 94.73
d1y63a_174 Probable kinase LmjF30.1890 {Leishmania major [Tax 94.71
d1m8pa3183 ATP sulfurylase C-terminal domain {Fungus (Penicil 94.7
d1xp8a1268 RecA protein, ATPase-domain {Deinococcus radiodura 94.61
d1rz3a_198 Hypothetical protein rbstp0775 {Bacillus stearothe 94.51
d1knqa_171 Gluconate kinase {Escherichia coli [TaxId: 562]} 94.5
d1qhxa_178 Chloramphenicol phosphotransferase {Streptomyces v 94.45
d1kgda_178 Guanylate kinase-like domain of Cask {Human (Homo 94.38
d1ly1a_152 Polynucleotide kinase, kinase domain {Bacteriophag 94.37
d1yrba1244 ATP(GTP)-binding protein PAB0955 {Pyrococcus abyss 94.33
d1lw7a2192 Transcriptional regulator NadR, ribosylnicotinamid 94.2
d1n0wa_242 DNA repair protein Rad51, catalytic domain {Human 94.18
d2bdta1176 Hypothetical protein BH3686 {Bacillus halodurans [ 94.17
d1uj2a_213 Uridine-cytidine kinase 2 {Human (Homo sapiens) [T 94.09
d1xjca_165 Molybdopterin-guanine dinucleotide biosynthesis pr 94.08
d1khta_190 Adenylate kinase {Archaeon Methanococcus voltae [T 93.94
d1qhla_222 Cell division protein MukB {Escherichia coli [TaxI 93.86
d1ak2a1190 Adenylate kinase {Cow (Bos taurus), mitochondrial 93.78
d2i3ba1189 Cancer-related NTPase, C1orf57 {Human (Homo sapien 93.69
d1yj5a2172 5' polynucleotide kinase-3' phosphatase, C-termina 93.56
d1gkya_186 Guanylate kinase {Baker's yeast (Saccharomyces cer 93.55
d1mkya2186 Probable GTPase Der, N-terminal and middle domains 93.53
d1gvnb_273 Plasmid maintenance system epsilon/zeta, toxin zet 93.48
d1mkya1171 Probable GTPase Der, N-terminal and middle domains 93.38
d1rkba_173 Adenylate kinase {Human (Homo sapiens), isoenzyme 93.19
d1nn5a_209 Thymidylate kinase {Human (Homo sapiens) [TaxId: 9 93.16
d1qf9a_194 UMP/CMP kinase {Dictyostelium discoideum [TaxId: 4 93.11
d1wf3a1178 GTPase Era, N-terminal domain {Thermus thermophilu 93.05
d1x6va3195 Adenosine-5'phosphosulfate kinase (APS kinase) {Hu 93.05
d1szpa2251 DNA repair protein Rad51, catalytic domain {Baker' 93.01
d2gj8a1161 Probable tRNA modification GTPase TrmE (MnmE), G d 93.0
d1odfa_286 Hypothetical protein Ygr205W {Baker's yeast (Sacch 93.0
d4tmka_210 Thymidylate kinase {Escherichia coli [TaxId: 562]} 92.97
d2cxxa1184 GTP-binding protein engB {Pyrococcus horikoshii [T 92.85
d3adka_194 Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} 92.84
d1lvga_190 Guanylate kinase {Mouse (Mus musculus) [TaxId: 100 92.81
d1p5zb_241 Deoxycytidine kinase {Human (Homo sapiens) [TaxId: 92.75
d1kaga_169 Shikimate kinase (AroK) {Escherichia coli [TaxId: 92.74
d1tf7a2242 Circadian clock protein KaiC {Synechococcus sp. st 92.7
d2vp4a1197 Deoxyribonucleoside kinase {Fruit fly (Drosophila 92.66
d1cr2a_277 Gene 4 protein (g4p, DNA primase), helicase domain 92.59
d1f6ba_186 SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: 92.5
d1pzna2254 DNA repair protein Rad51, catalytic domain {Archae 92.49
d1v5wa_258 Meiotic recombination protein DMC1/LIM15 homolog { 92.48
d1nrjb_209 Signal recognition particle receptor beta-subunit 92.46
d1xpua3289 Transcription termination factor Rho, ATPase domai 92.4
d1tmka_214 Thymidylate kinase {Baker's yeast (Saccharomyces c 92.33
d1wb1a4179 Elongation factor SelB, N-terminal domain {Methano 92.3
d1tf7a1242 Circadian clock protein KaiC {Synechococcus sp. st 92.3
d1ukza_196 Uridylate kinase {Baker's yeast (Saccharomyces cer 92.22
d1m7ga_208 Adenosine-5'phosphosulfate kinase (APS kinase) {Fu 92.22
d2p67a1327 LAO/AO transport system kinase ArgK {Escherichia c 92.01
d1sxja2253 Replication factor C1 {Baker's yeast (Saccharomyce 91.94
d2qm8a1323 Metallochaperone MeaB {Methylobacterium extorquens 91.94
d1w1wa_427 Smc head domain {Baker's yeast (Saccharomyces cere 91.93
d1r8sa_160 ADP-ribosylation factor {Human (Homo sapiens), ARF 91.83
d1lnza2185 Obg GTP-binding protein middle domain {Bacillus su 91.82
d1egaa1179 GTPase Era, N-terminal domain {Escherichia coli [T 91.81
d2i1qa2258 DNA repair protein Rad51, catalytic domain {Archae 91.73
d1upta_169 ADP-ribosylation factor {Human (Homo sapiens), ARL 91.63
d1jwyb_306 Dynamin G domain {Dictyostelium discoideum [TaxId: 91.6
d1jjva_205 Dephospho-CoA kinase {Haemophilus influenzae [TaxI 91.59
d1udxa2180 Obg GTP-binding protein middle domain {Thermus the 91.52
d1cr2a_277 Gene 4 protein (g4p, DNA primase), helicase domain 91.42
d1uf9a_191 Dephospho-CoA kinase {Thermus thermophilus [TaxId: 91.39
d1bifa1213 6-phosphofructo-2-kinase/fructose-2,6-bisphosphata 91.37
d1zaka1189 Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} 91.24
d1u94a1263 RecA protein, ATPase-domain {Escherichia coli [Tax 91.22
d1ofha_309 HslU {Haemophilus influenzae [TaxId: 727]} 91.2
d1ksha_165 ADP-ribosylation factor {Mouse (Mus musculus), ARL 91.06
d1f5na2277 Interferon-induced guanylate-binding protein 1 (GB 91.02
d2fnaa2283 Archaeal ATPase SSO1545 {Sulfolobus solfataricus [ 90.96
d2fh5b1207 Signal recognition particle receptor beta-subunit 90.77
d1a7ja_288 Phosphoribulokinase {Rhodobacter sphaeroides [TaxI 90.74
d1q3ta_223 CMP kinase {Streptococcus pneumoniae [TaxId: 1313] 90.71
d1teva_194 UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606] 90.69
d2akab1299 Dynamin G domain {Rat (Rattus norvegicus) [TaxId: 90.67
d2qtvb1166 SAR1 {Baker's yeast (Saccharomyces cerevisiae) [Ta 90.67
d1svma_362 Papillomavirus large T antigen helicase domain {Si 90.62
d1puia_188 Probable GTPase EngB {Escherichia coli [TaxId: 562 90.61
d1lv7a_256 AAA domain of cell division protein FtsH {Escheric 90.52
d1nksa_194 Adenylate kinase {Archaeon Sulfolobus acidocaldari 90.51
d1zina1182 Adenylate kinase {Bacillus stearothermophilus [Tax 90.46
d1htwa_158 Hypothetical protein HI0065 {Haemophilus influenza 90.45
d1e6ca_170 Shikimate kinase (AroK) {Erwinia chrysanthemi [Tax 90.41
d1r7ra3265 Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu 90.4
d1g7sa4227 Initiation factor IF2/eIF5b, N-terminal (G) domain 90.37
d1zj6a1177 ADP-ribosylation factor {Human (Homo sapiens), ARL 90.21
d1s3ga1182 Adenylate kinase {Bacillus globisporus [TaxId: 145 90.19
d1ixza_247 AAA domain of cell division protein FtsH {Thermus 90.11
d1nlfa_274 Hexameric replicative helicase repA {Escherichia c 90.06
d1viaa_161 Shikimate kinase (AroK) {Campylobacter jejuni [Tax 90.04
d1ckea_225 CMP kinase {Escherichia coli [TaxId: 562]} 90.02
d1vhta_208 Dephospho-CoA kinase {Escherichia coli [TaxId: 562 89.93
d1iqpa2231 Replication factor C {Archaeon Pyrococcus furiosus 89.81
d1gsia_208 Thymidylate kinase {Mycobacterium tuberculosis [Ta 89.79
d1in4a2238 Holliday junction helicase RuvB {Thermotoga mariti 89.64
d2iyva1165 Shikimate kinase (AroK) {Mycobacterium tuberculosi 89.46
d2jdid3276 Central domain of beta subunit of F1 ATP synthase 89.33
d1g41a_443 HslU {Haemophilus influenzae [TaxId: 727]} 89.29
d1okkd2207 GTPase domain of the signal recognition particle r 89.23
d1e4va1179 Adenylate kinase {Escherichia coli [TaxId: 562]} 89.21
d1puja_273 Probable GTPase YlqF {Bacillus subtilis [TaxId: 14 89.2
d1ky3a_175 Rab-related protein ypt7p {Baker's yeast (Saccharo 89.13
d1sxjd2237 Replication factor C2 {Baker's yeast (Saccharomyce 89.13
d1ixsb2239 Holliday junction helicase RuvB {Thermus thermophi 89.12
d1mo6a1269 RecA protein, ATPase-domain {Mycobacterium tubercu 89.1
d1fnna2276 CDC6, N-domain {Archaeon Pyrobaculum aerophilum [T 89.09
d3raba_169 Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} 89.09
d1kk1a3195 Initiation factor eIF2 gamma subunit, N-terminal ( 89.05
d2cdna1181 Adenylate kinase {Mycobacterium tuberculosis [TaxI 88.89
d1vmaa2213 GTPase domain of the signal recognition particle r 88.81
d2f9la1175 Rab11b {Human (Homo sapiens) [TaxId: 9606]} 88.73
d1fzqa_176 ADP-ribosylation factor {Mouse (Mus musculus), ARL 88.72
d1e32a2258 Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu 88.6
d2erxa1171 di-Ras2 {Human (Homo sapiens) [TaxId: 9606]} 88.48
d1vg8a_184 Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]} 88.37
d1akya1180 Adenylate kinase {Baker's yeast (Saccharomyces cer 88.37
d1d2na_246 Hexamerization domain of N-ethylmalemide-sensitive 88.21
d2f7sa1186 Rab27b {Human (Homo sapiens) [TaxId: 9606]} 88.12
d2a5ja1173 Rab2b {Human (Homo sapiens) [TaxId: 9606]} 88.08
d1g16a_166 Rab-related protein Sec4 {Baker's yeast (Saccharom 88.06
d2ocpa1241 Deoxyguanosine kinase {Human (Homo sapiens) [TaxId 87.96
d1kaoa_167 Rap2a {Human (Homo sapiens) [TaxId: 9606]} 87.93
d2ak3a1189 Adenylate kinase {Cow (Bos taurus), mitochondrial 87.91
d1g41a_443 HslU {Haemophilus influenzae [TaxId: 727]} 87.82
d1ctqa_166 cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9 87.72
d1nlfa_274 Hexameric replicative helicase repA {Escherichia c 87.72
d2g3ya1172 GTP-binding protein GEM {Human (Homo sapiens) [Tax 87.71
d1z2aa1164 Rab23 {Mouse (Mus musculus) [TaxId: 10090]} 87.61
d2gjsa1168 Rad {Human (Homo sapiens) [TaxId: 9606]} 87.55
d1deka_241 Deoxynucleoside monophosphate kinase {Bacteriophag 87.29
d1fx0a3276 Central domain of alpha subunit of F1 ATP synthase 87.22
d1xtqa1167 GTP-binding protein RheB {Human (Homo sapiens) [Ta 87.15
d1knxa2177 HPr kinase HprK C-terminal domain {Mycoplasma pneu 87.06
d2qy9a2211 GTPase domain of the signal recognition particle r 87.02
d1zd9a1164 ADP-ribosylation factor {Human (Homo sapiens), ARL 86.96
d1e9ra_433 Bacterial conjugative coupling protein TrwB {Esche 86.94
d2c78a3204 Elongation factor Tu (EF-Tu), N-terminal (G) domai 86.93
d1xzpa2160 TrmE GTPase domain {Thermotoga maritima [TaxId: 23 86.85
d1nija1222 Hypothetical protein YjiA, N-terminal domain {Esch 86.84
d1mh1a_183 Rac {Human (Homo sapiens) [TaxId: 9606]} 86.84
d2qn6a3205 Initiation factor eIF2 gamma subunit, N-terminal ( 86.83
d2erya1171 r-Ras2 {Human (Homo sapiens) [TaxId: 9606]} 86.81
d2ew1a1171 Rab30 {Human (Homo sapiens) [TaxId: 9606]} 86.67
d1r6bx3315 ClpA, an Hsp100 chaperone, AAA+ modules {Escherich 86.5
d1z0fa1166 Rab14 {Human (Homo sapiens) [TaxId: 9606]} 86.39
d1kmqa_177 RhoA {Human (Homo sapiens) [TaxId: 9606]} 86.3
d1l8qa2213 Chromosomal replication initiation factor DnaA {Aq 86.21
d1yzqa1164 Rab6 {Human (Homo sapiens) [TaxId: 9606]} 86.21
d1kkma_176 HPr kinase HprK C-terminal domain {Lactobacillus c 86.05
d1x3sa1177 Rab18 {Human (Homo sapiens) [TaxId: 9606]} 85.95
d2bcgy1194 GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisi 85.92
d1z06a1165 Rab-33b {Mouse (Mus musculus) [TaxId: 10090]} 85.85
d2atva1168 Ras-like estrogen-regulated growth inhibitor, RERG 85.79
d1wmsa_174 Rab9a {Human (Homo sapiens) [TaxId: 9606]} 85.79
d2bv3a2276 Elongation factor G (EF-G), N-terminal (G) domain 85.79
d1sxjb2224 Replication factor C4 {Baker's yeast (Saccharomyce 85.7
d1ek0a_170 Ypt51 {Baker's yeast (Saccharomyces cerevisiae) [T 85.62
d1z08a1167 Rab21 {Human (Homo sapiens) [TaxId: 9606]} 85.61
d1sxjc2227 Replication factor C3 {Baker's yeast (Saccharomyce 85.58
d1lv7a_256 AAA domain of cell division protein FtsH {Escheric 85.5
d2dy1a2267 Elongation factor G (EF-G), N-terminal (G) domain 85.41
d2fn4a1173 r-Ras {Human (Homo sapiens) [TaxId: 9606]} 85.4
d1ls1a2207 GTPase domain of the signal sequence recognition p 85.37
d1r2qa_170 Rab5a {Human (Homo sapiens) [TaxId: 9606]} 85.24
d1i2ma_170 Ran {Human (Homo sapiens) [TaxId: 9606]} 85.16
d1p6xa_333 Thymidine kinase {Equine herpesvirus type 4 [TaxId 85.06
d2bmea1174 Rab4a {Human (Homo sapiens) [TaxId: 9606]} 84.86
d1z0ja1167 Rab-22a {Mouse (Mus musculus) [TaxId: 10090]} 84.83
d1osna_331 Thymidine kinase {Varicella-zoster virus [TaxId: 1 84.79
d1x1ra1169 Ras-related protein M-Ras (XRas) {Mouse (Mus muscu 84.63
d2fu5c1173 Rab8a {Mouse (Mus musculus) [TaxId: 10090]} 84.56
d1sxje2252 Replication factor C5 {Baker's yeast (Saccharomyce 84.5
d1moza_182 ADP-ribosylation factor {Baker's yeast (Saccharomy 84.49
d2bmja1175 Centaurin gamma 1, G domain {Human (Homo sapiens) 84.48
d2jdia3285 Central domain of alpha subunit of F1 ATP synthase 84.4
d2a5yb3277 CED-4, NB-ARC domain {Caenorhabditis elegans [TaxI 84.35
d1sxja2253 Replication factor C1 {Baker's yeast (Saccharomyce 84.23
d1u8za_168 Ras-related protein RalA {Cotton-top tamarin (Sagu 83.92
d1j8yf2211 GTPase domain of the signal sequence recognition p 83.87
d1ko7a2169 HPr kinase HprK C-terminal domain {Staphylococcus 83.86
d1c1ya_167 Rap1A {Human (Homo sapiens) [TaxId: 9606]} 83.77
d1m7ba_179 RhoE (RND3) {Mouse (Mus musculus) [TaxId: 10090]} 83.69
d2g6ba1170 Rab26 {Human (Homo sapiens) [TaxId: 9606]} 83.61
d1e0sa_173 ADP-ribosylation factor {Human (Homo sapiens), ARF 83.4
d2atxa1185 RhoQ {Human (Homo sapiens) [TaxId: 9606]} 83.38
d2ngra_191 CDC42 {Human (Homo sapiens) [TaxId: 9606]} 83.36
d1d2ea3196 Elongation factor Tu (EF-Tu), N-terminal (G) domai 83.19
d1zunb3222 Sulfate adenylate transferase subunit cysN/C, EF-T 82.68
d1jnya3224 Elongation factor eEF-1alpha, N-terminal (G) domai 82.39
d2jdid3276 Central domain of beta subunit of F1 ATP synthase 82.07
d1ni3a1296 YchF GTP-binding protein N-terminal domain {Fissio 82.02
d1sxjc2227 Replication factor C3 {Baker's yeast (Saccharomyce 82.02
d1w5sa2287 CDC6-like protein APE0152, N-terminal domain {Aero 81.56
d1ixsb2239 Holliday junction helicase RuvB {Thermus thermophi 81.51
d1um8a_364 ClpX {Helicobacter pylori [TaxId: 210]} 81.37
d1wxqa1319 GTP-binding protein PH0525 {Pyrococcus horikoshii 81.18
d1svma_362 Papillomavirus large T antigen helicase domain {Si 80.74
d1e2ka_329 Thymidine kinase {Herpes simplex virus type 1, dif 80.31
>d2hyda1 c.37.1.12 (A:324-578) Putative multidrug export ATP-binding/permease protein SAV1866 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: ABC transporter ATPase domain-like
domain: Putative multidrug export ATP-binding/permease protein SAV1866
species: Staphylococcus aureus [TaxId: 1280]

Probab=100.00  E-value=0  Score=349.23  Aligned_cols=204  Identities=29%  Similarity=0.490  Sum_probs=183.1

Q ss_pred             CCCCCCEEEEEEEEEECCC-CCCCCEEEEEECCCCEEEEECCCCCCHHHHHHHHHCCCCCCCCCEEEEC-----------
Q ss_conf             9999928999338972899-9853005657249969999949999867899998469999999669994-----------
Q 000746          635 EPELPAVSIKNGNFSWDSK-SPTLSNINLDIPVGSLVAIVGGTGEGKTSLVSAMLGELPPLKDASVVIR-----------  702 (1303)
Q Consensus       635 ~~~~~~i~~~~~~f~~~~~-~~~L~~i~l~i~~G~~~~ivG~~GsGKSTLl~~llge~~~~~g~~~~~~-----------  702 (1303)
                      +.....|+++|++|+|+++ .++|+|+||+|++|++++|+|++|||||||+++|+|.++|.+| .+.++           
T Consensus        11 ~~~~g~I~~~nvsf~Y~~~~~~vL~~isl~i~~Ge~vaivG~sGsGKSTLl~ll~gl~~p~~G-~I~i~g~~i~~~~~~~   89 (255)
T d2hyda1          11 EIKQGRIDIDHVSFQYNDNEAPILKDINLSIEKGETVAFVGMSGGGKSTLINLIPRFYDVTSG-QILIDGHNIKDFLTGS   89 (255)
T ss_dssp             CCCSCCEEEEEEEECSCSSSCCSEEEEEEEECTTCEEEEECSTTSSHHHHHTTTTTSSCCSEE-EEEETTEEGGGSCHHH
T ss_pred             CCCCCEEEEEEEEEEECCCCCCCEECEEEEECCCCEEEEECCCCCCHHHHHHHHHHCCCCCCC-CCCCCCEECCCCCHHH
T ss_conf             777887999988999599997606443899839989999889998099999999712786300-0153998753078888


Q ss_pred             --CEEEEECCCCCCCCCCHHHHHCCCCC-CCHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHH
Q ss_conf             --91799816865666558899704999-995658999989823888510999997311489887766899999999999
Q 000746          703 --GTVAYVPQISWIFNATLRKNILFGSE-FDPAKYWKTVDVSALQHDLDLLPDRDLTEIGERGVNISGGQKQRVSMARAV  779 (1303)
Q Consensus       703 --~~iayv~Q~pwl~~~TireNI~~g~~-~d~~~y~~vi~ac~L~~di~~lp~gd~T~ige~G~~LSGGQkqRiaLARAi  779 (1303)
                        ..++||+|+|++|++||+|||.+|.+ .++++..++++.+++.+++..+|+|++|.+|++|.+|||||||||+||||+
T Consensus        90 lr~~i~~v~Q~~~lf~~Ti~eNi~~g~~~~~~~~~~~al~~~~l~~~i~~lp~gl~t~i~~~g~~LSgGq~QRi~iARal  169 (255)
T d2hyda1          90 LRNQIGLVQQDNILFSDTVKENILLGRPTATDEEVVEAAKMANAHDFIMNLPQGYDTEVGERGVKLSGGQKQRLSIARIF  169 (255)
T ss_dssp             HHHTEEEECSSCCCCSSBHHHHHGGGCSSCCHHHHHHHHHHTTCHHHHHTSTTGGGCBCCGGGTTSCHHHHHHHHHHHHH
T ss_pred             HHHEEEEEECCCCCCCCCHHHHHHCCCCCCCHHHHHHHHHHHCCHHHHHHCCCCCCCHHCCCCCCCCHHHHHHHHHHHHH
T ss_conf             63414565101568998799998515867999999999999697999973624201033388898499999999999998


Q ss_pred             HH-----------------------HHHHHHCCCCEEEEEECCCCCCCCCCEEEEEECCEEEEECCHHHHHHCCHHHHHH
Q ss_conf             98-----------------------9986750998799992499940014979999398799943978897334599999
Q 000746          780 FN-----------------------SCIKEELRGKTRILVTNQLHFLPHVDRIILVSEGMIKEEGSFEELSKHGRLFQKL  836 (1303)
Q Consensus       780 ~~-----------------------~~i~~~l~~~TvilvTH~~~~l~~aD~ii~l~~G~i~~~G~~~~l~~~~~~~~~~  836 (1303)
                      +.                       +.+....+++|+|+|||+++.++.||+|++|++|+|++.|+++|++++++.|+++
T Consensus       170 ~~~p~ililDEpts~LD~~t~~~i~~~l~~l~~~~TvI~itH~~~~~~~~D~ii~l~~G~iv~~G~~~eLl~~~~~y~~l  249 (255)
T d2hyda1         170 LNNPPILILDEATSALDLESESIIQEALDVLSKDRTTLIVAHRLSTITHADKIVVIENGHIVETGTHRELIAKQGAYEHL  249 (255)
T ss_dssp             HHCCSEEEEESTTTTCCHHHHHHHHHHHHHHTTTSEEEEECSSGGGTTTCSEEEEEETTEEEEEECHHHHHHTTSHHHHH
T ss_pred             HCCCCEEEEECCCCCCCHHHHHHHHHHHHHHHCCCEEEEEECCHHHHHHCCEEEEEECCEEEEECCHHHHHHCCCHHHHH
T ss_conf             55998999837654479779999999999875388899996899999859999999899999988999998688499999


Q ss_pred             HHH
Q ss_conf             997
Q 000746          837 MEN  839 (1303)
Q Consensus       837 ~~~  839 (1303)
                      ++.
T Consensus       250 ~~~  252 (255)
T d2hyda1         250 YSI  252 (255)
T ss_dssp             HTT
T ss_pred             HHH
T ss_conf             997
>d2pmka1 c.37.1.12 (A:467-707) Haemolysin B ATP-binding protein {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d3b60a1 c.37.1.12 (A:329-581) Multidrug resistance ABC transporter MsbA, C-terminal domain {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1mv5a_ c.37.1.12 (A:) Multidrug resistance ABC transporter LmrA, C-terminal domain {Lactococcus lactis [TaxId: 1358]} Back     information, alignment and structure
>d1jj7a_ c.37.1.12 (A:) Peptide transporter Tap1, C-terminal ABC domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1r0wa_ c.37.1.12 (A:) Cystic fibrosis transmembrane conductance regulator, CFTR, nucleotide-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1oxxk2 c.37.1.12 (K:1-242) Glucose transport protein GlcV, N-terminal domain {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1g2912 c.37.1.12 (1:1-240) Maltose transport protein MalK, N-terminal domain {Archaeon Thermococcus litoralis [TaxId: 2265]} Back     information, alignment and structure
>d2awna2 c.37.1.12 (A:4-235) Maltose transport protein MalK, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1v43a3 c.37.1.12 (A:7-245) Hypothetical protein PH0022, N-terminal domain {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d3d31a2 c.37.1.12 (A:1-229) Sulfate/molybdate ABC transporter, ATP-binding protein {Methanosarcina acetivorans [TaxId: 2214]} Back     information, alignment and structure
>d3dhwc1 c.37.1.12 (C:1-240) Methionine import ATP-binding protein MetN {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1l2ta_ c.37.1.12 (A:) MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1b0ua_ c.37.1.12 (A:) ATP-binding subunit of the histidine permease {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1g6ha_ c.37.1.12 (A:) MJ1267 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1ji0a_ c.37.1.12 (A:) Branched chain aminoacid ABC transporter {Thermotoga maritima, TM1139 [TaxId: 2336]} Back     information, alignment and structure
>d1vpla_ c.37.1.12 (A:) Putative ABC transporter TM0544 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d3b60a2 f.37.1.1 (A:10-328) Multidrug resistance ABC transporter MsbA, N-terminal domain {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d2onka1 c.37.1.12 (A:1-240) Molybdate/tungstate import ATP-binding protein WtpC (ModC) {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d3b60a2 f.37.1.1 (A:10-328) Multidrug resistance ABC transporter MsbA, N-terminal domain {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d2hyda2 f.37.1.1 (A:1-323) Putative multidrug export ATP-binding/permease protein SAV1866 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d2hyda2 f.37.1.1 (A:1-323) Putative multidrug export ATP-binding/permease protein SAV1866 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1l7vc_ c.37.1.12 (C:) ABC transporter involved in vitamin B12 uptake, BtuD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1sgwa_ c.37.1.12 (A:) Putative ABC transporter PF0895 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d2hyda1 c.37.1.12 (A:324-578) Putative multidrug export ATP-binding/permease protein SAV1866 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d2pmka1 c.37.1.12 (A:467-707) Haemolysin B ATP-binding protein {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d3b60a1 c.37.1.12 (A:329-581) Multidrug resistance ABC transporter MsbA, C-terminal domain {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1jj7a_ c.37.1.12 (A:) Peptide transporter Tap1, C-terminal ABC domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mv5a_ c.37.1.12 (A:) Multidrug resistance ABC transporter LmrA, C-terminal domain {Lactococcus lactis [TaxId: 1358]} Back     information, alignment and structure
>d1l2ta_ c.37.1.12 (A:) MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1b0ua_ c.37.1.12 (A:) ATP-binding subunit of the histidine permease {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1oxxk2 c.37.1.12 (K:1-242) Glucose transport protein GlcV, N-terminal domain {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1g2912 c.37.1.12 (1:1-240) Maltose transport protein MalK, N-terminal domain {Archaeon Thermococcus litoralis [TaxId: 2265]} Back     information, alignment and structure
>d3dhwc1 c.37.1.12 (C:1-240) Methionine import ATP-binding protein MetN {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1v43a3 c.37.1.12 (A:7-245) Hypothetical protein PH0022, N-terminal domain {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1vpla_ c.37.1.12 (A:) Putative ABC transporter TM0544 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1sgwa_ c.37.1.12 (A:) Putative ABC transporter PF0895 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1r0wa_ c.37.1.12 (A:) Cystic fibrosis transmembrane conductance regulator, CFTR, nucleotide-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ji0a_ c.37.1.12 (A:) Branched chain aminoacid ABC transporter {Thermotoga maritima, TM1139 [TaxId: 2336]} Back     information, alignment and structure
>d1g6ha_ c.37.1.12 (A:) MJ1267 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1ye8a1 c.37.1.11 (A:1-178) Hypothetical kinase-like protein Aq_1292 {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1e69a_ c.37.1.12 (A:) Smc head domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1tq4a_ c.37.1.8 (A:) Interferon-inducible GTPase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1u0la2 c.37.1.8 (A:69-293) Probable GTPase EngC (YjeQ), C-terminal domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1ewqa2 c.37.1.12 (A:542-765) DNA repair protein MutS, the C-terminal domain {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1h65a_ c.37.1.8 (A:) Chloroplast protein translocon GTPase Toc34 {Garden pea (Pisum sativum) [TaxId: 3888]} Back     information, alignment and structure
>d1g6oa_ c.37.1.11 (A:) Hexameric traffic ATPase, HP0525 {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1w1wa_ c.37.1.12 (A:) Smc head domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1wb9a2 c.37.1.12 (A:567-800) DNA repair protein MutS, the C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1u0la2 c.37.1.8 (A:69-293) Probable GTPase EngC (YjeQ), C-terminal domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1znwa1 c.37.1.1 (A:20-201) Guanylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1g6oa_ c.37.1.11 (A:) Hexameric traffic ATPase, HP0525 {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1t9ha2 c.37.1.8 (A:68-298) Probable GTPase EngC (YjeQ), C-terminal domain {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1zp6a1 c.37.1.25 (A:6-181) Hypothetical protein Atu3015 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1p9ra_ c.37.1.11 (A:) Extracellular secretion NTPase EpsE {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1s96a_ c.37.1.1 (A:) Guanylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1sq5a_ c.37.1.6 (A:) Pantothenate kinase PanK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1p9ra_ c.37.1.11 (A:) Extracellular secretion NTPase EpsE {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d2p67a1 c.37.1.10 (A:1-327) LAO/AO transport system kinase ArgK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1np6a_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1t9ha2 c.37.1.8 (A:68-298) Probable GTPase EngC (YjeQ), C-terminal domain {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1svia_ c.37.1.8 (A:) Probable GTPase EngB {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1y63a_ c.37.1.1 (A:) Probable kinase LmjF30.1890 {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d1m8pa3 c.37.1.15 (A:391-573) ATP sulfurylase C-terminal domain {Fungus (Penicillium chrysogenum) [TaxId: 5076]} Back     information, alignment and structure
>d1xp8a1 c.37.1.11 (A:15-282) RecA protein, ATPase-domain {Deinococcus radiodurans [TaxId: 1299]} Back     information, alignment and structure
>d1rz3a_ c.37.1.6 (A:) Hypothetical protein rbstp0775 {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1knqa_ c.37.1.17 (A:) Gluconate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1qhxa_ c.37.1.3 (A:) Chloramphenicol phosphotransferase {Streptomyces venezuelae [TaxId: 54571]} Back     information, alignment and structure
>d1kgda_ c.37.1.1 (A:) Guanylate kinase-like domain of Cask {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ly1a_ c.37.1.1 (A:) Polynucleotide kinase, kinase domain {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d1yrba1 c.37.1.10 (A:1-244) ATP(GTP)-binding protein PAB0955 {Pyrococcus abyssi [TaxId: 29292]} Back     information, alignment and structure
>d1lw7a2 c.37.1.1 (A:220-411) Transcriptional regulator NadR, ribosylnicotinamide kinase domain {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1n0wa_ c.37.1.11 (A:) DNA repair protein Rad51, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bdta1 c.37.1.25 (A:1-176) Hypothetical protein BH3686 {Bacillus halodurans [TaxId: 86665]} Back     information, alignment and structure
>d1uj2a_ c.37.1.6 (A:) Uridine-cytidine kinase 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xjca_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1khta_ c.37.1.1 (A:) Adenylate kinase {Archaeon Methanococcus voltae [TaxId: 2188]} Back     information, alignment and structure
>d1qhla_ c.37.1.12 (A:) Cell division protein MukB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ak2a1 c.37.1.1 (A:14-146,A:177-233) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-2 [TaxId: 9913]} Back     information, alignment and structure
>d2i3ba1 c.37.1.11 (A:1-189) Cancer-related NTPase, C1orf57 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yj5a2 c.37.1.1 (A:351-522) 5' polynucleotide kinase-3' phosphatase, C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1gkya_ c.37.1.1 (A:) Guanylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1mkya2 c.37.1.8 (A:173-358) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1gvnb_ c.37.1.21 (B:) Plasmid maintenance system epsilon/zeta, toxin zeta subunit {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1mkya1 c.37.1.8 (A:2-172) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1rkba_ c.37.1.1 (A:) Adenylate kinase {Human (Homo sapiens), isoenzyme 6 [TaxId: 9606]} Back     information, alignment and structure
>d1nn5a_ c.37.1.1 (A:) Thymidylate kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qf9a_ c.37.1.1 (A:) UMP/CMP kinase {Dictyostelium discoideum [TaxId: 44689]} Back     information, alignment and structure
>d1wf3a1 c.37.1.8 (A:3-180) GTPase Era, N-terminal domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1x6va3 c.37.1.4 (A:34-228) Adenosine-5'phosphosulfate kinase (APS kinase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1szpa2 c.37.1.11 (A:145-395) DNA repair protein Rad51, catalytic domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2gj8a1 c.37.1.8 (A:216-376) Probable tRNA modification GTPase TrmE (MnmE), G domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1odfa_ c.37.1.6 (A:) Hypothetical protein Ygr205W {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d4tmka_ c.37.1.1 (A:) Thymidylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2cxxa1 c.37.1.8 (A:2-185) GTP-binding protein engB {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d3adka_ c.37.1.1 (A:) Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1lvga_ c.37.1.1 (A:) Guanylate kinase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1p5zb_ c.37.1.1 (B:) Deoxycytidine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kaga_ c.37.1.2 (A:) Shikimate kinase (AroK) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1tf7a2 c.37.1.11 (A:256-497) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} Back     information, alignment and structure
>d2vp4a1 c.37.1.1 (A:12-208) Deoxyribonucleoside kinase {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1cr2a_ c.37.1.11 (A:) Gene 4 protein (g4p, DNA primase), helicase domain {Bacteriophage T7 [TaxId: 10760]} Back     information, alignment and structure
>d1f6ba_ c.37.1.8 (A:) SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d1pzna2 c.37.1.11 (A:96-349) DNA repair protein Rad51, catalytic domain {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1v5wa_ c.37.1.11 (A:) Meiotic recombination protein DMC1/LIM15 homolog {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nrjb_ c.37.1.8 (B:) Signal recognition particle receptor beta-subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1xpua3 c.37.1.11 (A:129-417) Transcription termination factor Rho, ATPase domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1tmka_ c.37.1.1 (A:) Thymidylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1wb1a4 c.37.1.8 (A:1-179) Elongation factor SelB, N-terminal domain {Methanococcus maripaludis [TaxId: 39152]} Back     information, alignment and structure
>d1tf7a1 c.37.1.11 (A:14-255) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} Back     information, alignment and structure
>d1ukza_ c.37.1.1 (A:) Uridylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1m7ga_ c.37.1.4 (A:) Adenosine-5'phosphosulfate kinase (APS kinase) {Fungus (Penicillium chrysogenum) [TaxId: 5076]} Back     information, alignment and structure
>d2p67a1 c.37.1.10 (A:1-327) LAO/AO transport system kinase ArgK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1sxja2 c.37.1.20 (A:295-547) Replication factor C1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2qm8a1 c.37.1.10 (A:5-327) Metallochaperone MeaB {Methylobacterium extorquens [TaxId: 408]} Back     information, alignment and structure
>d1w1wa_ c.37.1.12 (A:) Smc head domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1r8sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF1 [TaxId: 9606]} Back     information, alignment and structure
>d1lnza2 c.37.1.8 (A:158-342) Obg GTP-binding protein middle domain {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1egaa1 c.37.1.8 (A:4-182) GTPase Era, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2i1qa2 c.37.1.11 (A:65-322) DNA repair protein Rad51, catalytic domain {Archaeon Methanococcus voltae [TaxId: 2188]} Back     information, alignment and structure
>d1upta_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARL1 [TaxId: 9606]} Back     information, alignment and structure
>d1jwyb_ c.37.1.8 (B:) Dynamin G domain {Dictyostelium discoideum [TaxId: 44689]} Back     information, alignment and structure
>d1jjva_ c.37.1.1 (A:) Dephospho-CoA kinase {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1udxa2 c.37.1.8 (A:157-336) Obg GTP-binding protein middle domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1cr2a_ c.37.1.11 (A:) Gene 4 protein (g4p, DNA primase), helicase domain {Bacteriophage T7 [TaxId: 10760]} Back     information, alignment and structure
>d1uf9a_ c.37.1.1 (A:) Dephospho-CoA kinase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1bifa1 c.37.1.7 (A:37-249) 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase, kinase domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1zaka1 c.37.1.1 (A:3-127,A:159-222) Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} Back     information, alignment and structure
>d1u94a1 c.37.1.11 (A:6-268) RecA protein, ATPase-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ofha_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1ksha_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL2 [TaxId: 10090]} Back     information, alignment and structure
>d1f5na2 c.37.1.8 (A:7-283) Interferon-induced guanylate-binding protein 1 (GBP1), N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fnaa2 c.37.1.20 (A:1-283) Archaeal ATPase SSO1545 {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d2fh5b1 c.37.1.8 (B:63-269) Signal recognition particle receptor beta-subunit {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1a7ja_ c.37.1.6 (A:) Phosphoribulokinase {Rhodobacter sphaeroides [TaxId: 1063]} Back     information, alignment and structure
>d1q3ta_ c.37.1.1 (A:) CMP kinase {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d1teva_ c.37.1.1 (A:) UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2akab1 c.37.1.8 (B:6-304) Dynamin G domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2qtvb1 c.37.1.8 (B:24-189) SAR1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1svma_ c.37.1.20 (A:) Papillomavirus large T antigen helicase domain {Simian virus 40 [TaxId: 10633]} Back     information, alignment and structure
>d1puia_ c.37.1.8 (A:) Probable GTPase EngB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1lv7a_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1nksa_ c.37.1.1 (A:) Adenylate kinase {Archaeon Sulfolobus acidocaldarius [TaxId: 2285]} Back     information, alignment and structure
>d1zina1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1htwa_ c.37.1.18 (A:) Hypothetical protein HI0065 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1e6ca_ c.37.1.2 (A:) Shikimate kinase (AroK) {Erwinia chrysanthemi [TaxId: 556]} Back     information, alignment and structure
>d1r7ra3 c.37.1.20 (A:471-735) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1g7sa4 c.37.1.8 (A:1-227) Initiation factor IF2/eIF5b, N-terminal (G) domain {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1zj6a1 c.37.1.8 (A:2-178) ADP-ribosylation factor {Human (Homo sapiens), ARL5A [TaxId: 9606]} Back     information, alignment and structure
>d1s3ga1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus globisporus [TaxId: 1459]} Back     information, alignment and structure
>d1ixza_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1nlfa_ c.37.1.11 (A:) Hexameric replicative helicase repA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1viaa_ c.37.1.2 (A:) Shikimate kinase (AroK) {Campylobacter jejuni [TaxId: 197]} Back     information, alignment and structure
>d1ckea_ c.37.1.1 (A:) CMP kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1vhta_ c.37.1.1 (A:) Dephospho-CoA kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1iqpa2 c.37.1.20 (A:2-232) Replication factor C {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1gsia_ c.37.1.1 (A:) Thymidylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1in4a2 c.37.1.20 (A:17-254) Holliday junction helicase RuvB {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2iyva1 c.37.1.2 (A:2-166) Shikimate kinase (AroK) {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2jdid3 c.37.1.11 (D:82-357) Central domain of beta subunit of F1 ATP synthase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1g41a_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1okkd2 c.37.1.10 (D:97-303) GTPase domain of the signal recognition particle receptor FtsY {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1e4va1 c.37.1.1 (A:1-121,A:157-214) Adenylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1puja_ c.37.1.8 (A:) Probable GTPase YlqF {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1ky3a_ c.37.1.8 (A:) Rab-related protein ypt7p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1sxjd2 c.37.1.20 (D:26-262) Replication factor C2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ixsb2 c.37.1.20 (B:4-242) Holliday junction helicase RuvB {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1mo6a1 c.37.1.11 (A:1-269) RecA protein, ATPase-domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1fnna2 c.37.1.20 (A:1-276) CDC6, N-domain {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d3raba_ c.37.1.8 (A:) Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1kk1a3 c.37.1.8 (A:6-200) Initiation factor eIF2 gamma subunit, N-terminal (G) domain {Archaeon Pyrococcus abyssi [TaxId: 29292]} Back     information, alignment and structure
>d2cdna1 c.37.1.1 (A:1-181) Adenylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1vmaa2 c.37.1.10 (A:82-294) GTPase domain of the signal recognition particle receptor FtsY {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2f9la1 c.37.1.8 (A:8-182) Rab11b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fzqa_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL3 [TaxId: 10090]} Back     information, alignment and structure
>d1e32a2 c.37.1.20 (A:201-458) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2erxa1 c.37.1.8 (A:6-176) di-Ras2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vg8a_ c.37.1.8 (A:) Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1akya1 c.37.1.1 (A:3-130,A:169-220) Adenylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1d2na_ c.37.1.20 (A:) Hexamerization domain of N-ethylmalemide-sensitive fusion (NSF) protein {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d2f7sa1 c.37.1.8 (A:5-190) Rab27b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2a5ja1 c.37.1.8 (A:9-181) Rab2b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g16a_ c.37.1.8 (A:) Rab-related protein Sec4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2ocpa1 c.37.1.1 (A:37-277) Deoxyguanosine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kaoa_ c.37.1.8 (A:) Rap2a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ak3a1 c.37.1.1 (A:0-124,A:162-225) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-3 [TaxId: 9913]} Back     information, alignment and structure
>d1g41a_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1ctqa_ c.37.1.8 (A:) cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nlfa_ c.37.1.11 (A:) Hexameric replicative helicase repA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2g3ya1 c.37.1.8 (A:73-244) GTP-binding protein GEM {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z2aa1 c.37.1.8 (A:8-171) Rab23 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2gjsa1 c.37.1.8 (A:91-258) Rad {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1deka_ c.37.1.1 (A:) Deoxynucleoside monophosphate kinase {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d1fx0a3 c.37.1.11 (A:97-372) Central domain of alpha subunit of F1 ATP synthase {Spinach (Spinacia oleracea), chloroplast [TaxId: 3562]} Back     information, alignment and structure
>d1xtqa1 c.37.1.8 (A:3-169) GTP-binding protein RheB {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1knxa2 c.91.1.2 (A:133-309) HPr kinase HprK C-terminal domain {Mycoplasma pneumoniae [TaxId: 2104]} Back     information, alignment and structure
>d2qy9a2 c.37.1.10 (A:285-495) GTPase domain of the signal recognition particle receptor FtsY {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1zd9a1 c.37.1.8 (A:18-181) ADP-ribosylation factor {Human (Homo sapiens), ARL8A [TaxId: 9606]} Back     information, alignment and structure
>d1e9ra_ c.37.1.11 (A:) Bacterial conjugative coupling protein TrwB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2c78a3 c.37.1.8 (A:9-212) Elongation factor Tu (EF-Tu), N-terminal (G) domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1xzpa2 c.37.1.8 (A:212-371) TrmE GTPase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1nija1 c.37.1.10 (A:2-223) Hypothetical protein YjiA, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1mh1a_ c.37.1.8 (A:) Rac {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2qn6a3 c.37.1.8 (A:2-206) Initiation factor eIF2 gamma subunit, N-terminal (G) domain {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d2erya1 c.37.1.8 (A:10-180) r-Ras2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ew1a1 c.37.1.8 (A:4-174) Rab30 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1r6bx3 c.37.1.20 (X:437-751) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1z0fa1 c.37.1.8 (A:8-173) Rab14 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kmqa_ c.37.1.8 (A:) RhoA {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1l8qa2 c.37.1.20 (A:77-289) Chromosomal replication initiation factor DnaA {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1yzqa1 c.37.1.8 (A:14-177) Rab6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kkma_ c.91.1.2 (A:) HPr kinase HprK C-terminal domain {Lactobacillus casei [TaxId: 1582]} Back     information, alignment and structure
>d1x3sa1 c.37.1.8 (A:2-178) Rab18 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bcgy1 c.37.1.8 (Y:3-196) GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1z06a1 c.37.1.8 (A:32-196) Rab-33b {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2atva1 c.37.1.8 (A:5-172) Ras-like estrogen-regulated growth inhibitor, RERG {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wmsa_ c.37.1.8 (A:) Rab9a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bv3a2 c.37.1.8 (A:7-282) Elongation factor G (EF-G), N-terminal (G) domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1sxjb2 c.37.1.20 (B:7-230) Replication factor C4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ek0a_ c.37.1.8 (A:) Ypt51 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1z08a1 c.37.1.8 (A:17-183) Rab21 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sxjc2 c.37.1.20 (C:12-238) Replication factor C3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1lv7a_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2dy1a2 c.37.1.8 (A:8-274) Elongation factor G (EF-G), N-terminal (G) domain {Thermus thermophilus, EF-G-2 [TaxId: 274]} Back     information, alignment and structure
>d2fn4a1 c.37.1.8 (A:24-196) r-Ras {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ls1a2 c.37.1.10 (A:89-295) GTPase domain of the signal sequence recognition protein Ffh {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1r2qa_ c.37.1.8 (A:) Rab5a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1i2ma_ c.37.1.8 (A:) Ran {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p6xa_ c.37.1.1 (A:) Thymidine kinase {Equine herpesvirus type 4 [TaxId: 10331]} Back     information, alignment and structure
>d2bmea1 c.37.1.8 (A:6-179) Rab4a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z0ja1 c.37.1.8 (A:2-168) Rab-22a {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1osna_ c.37.1.1 (A:) Thymidine kinase {Varicella-zoster virus [TaxId: 10335]} Back     information, alignment and structure
>d1x1ra1 c.37.1.8 (A:10-178) Ras-related protein M-Ras (XRas) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2fu5c1 c.37.1.8 (C:3-175) Rab8a {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1sxje2 c.37.1.20 (E:4-255) Replication factor C5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1moza_ c.37.1.8 (A:) ADP-ribosylation factor {Baker's yeast (Saccharomyces cerevisiae), ARL1 [TaxId: 4932]} Back     information, alignment and structure
>d2bmja1 c.37.1.8 (A:66-240) Centaurin gamma 1, G domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2jdia3 c.37.1.11 (A:95-379) Central domain of alpha subunit of F1 ATP synthase {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2a5yb3 c.37.1.20 (B:109-385) CED-4, NB-ARC domain {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1sxja2 c.37.1.20 (A:295-547) Replication factor C1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1u8za_ c.37.1.8 (A:) Ras-related protein RalA {Cotton-top tamarin (Saguinus oedipus) [TaxId: 9490]} Back     information, alignment and structure
>d1j8yf2 c.37.1.10 (F:87-297) GTPase domain of the signal sequence recognition protein Ffh {Archaeon Acidianus ambivalens [TaxId: 2283]} Back     information, alignment and structure
>d1ko7a2 c.91.1.2 (A:130-298) HPr kinase HprK C-terminal domain {Staphylococcus xylosus [TaxId: 1288]} Back     information, alignment and structure
>d1c1ya_ c.37.1.8 (A:) Rap1A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m7ba_ c.37.1.8 (A:) RhoE (RND3) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2g6ba1 c.37.1.8 (A:58-227) Rab26 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1e0sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF6 [TaxId: 9606]} Back     information, alignment and structure
>d2atxa1 c.37.1.8 (A:9-193) RhoQ {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ngra_ c.37.1.8 (A:) CDC42 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1d2ea3 c.37.1.8 (A:55-250) Elongation factor Tu (EF-Tu), N-terminal (G) domain {Cow (Bos taurus), mitochondrial [TaxId: 9913]} Back     information, alignment and structure
>d1zunb3 c.37.1.8 (B:16-237) Sulfate adenylate transferase subunit cysN/C, EF-Tu domain G-like domain {Pseudomonas syringae pv. tomato [TaxId: 323]} Back     information, alignment and structure
>d1jnya3 c.37.1.8 (A:4-227) Elongation factor eEF-1alpha, N-terminal (G) domain {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d2jdid3 c.37.1.11 (D:82-357) Central domain of beta subunit of F1 ATP synthase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1ni3a1 c.37.1.8 (A:11-306) YchF GTP-binding protein N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1sxjc2 c.37.1.20 (C:12-238) Replication factor C3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1w5sa2 c.37.1.20 (A:7-293) CDC6-like protein APE0152, N-terminal domain {Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1ixsb2 c.37.1.20 (B:4-242) Holliday junction helicase RuvB {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1um8a_ c.37.1.20 (A:) ClpX {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1wxqa1 c.37.1.8 (A:1-319) GTP-binding protein PH0525 {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1svma_ c.37.1.20 (A:) Papillomavirus large T antigen helicase domain {Simian virus 40 [TaxId: 10633]} Back     information, alignment and structure
>d1e2ka_ c.37.1.1 (A:) Thymidine kinase {Herpes simplex virus type 1, different strains [TaxId: 10298]} Back     information, alignment and structure