Citrus Sinensis ID: 000780
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 1288 | ||||||
| 224127917 | 1470 | tir-nbs-lrr resistance protein [Populus | 0.861 | 0.754 | 0.376 | 0.0 | |
| 255563202 | 1158 | leucine-rich repeat containing protein, | 0.680 | 0.756 | 0.418 | 0.0 | |
| 255544956 | 1403 | leucine-rich repeat containing protein, | 0.917 | 0.842 | 0.355 | 0.0 | |
| 359486075 | 1291 | PREDICTED: TMV resistance protein N-like | 0.863 | 0.861 | 0.364 | 0.0 | |
| 451798990 | 1335 | TMV resistance protein N-like protein 7 | 0.892 | 0.861 | 0.362 | 0.0 | |
| 224145030 | 1435 | tir-nbs-lrr resistance protein [Populus | 0.868 | 0.779 | 0.378 | 0.0 | |
| 224145021 | 1561 | tir-nbs-lrr resistance protein [Populus | 0.872 | 0.720 | 0.373 | 0.0 | |
| 224145016 | 1254 | tir-nbs-lrr resistance protein [Populus | 0.846 | 0.869 | 0.374 | 0.0 | |
| 359486073 | 1296 | PREDICTED: TMV resistance protein N-like | 0.866 | 0.861 | 0.353 | 0.0 | |
| 359493483 | 1274 | PREDICTED: TMV resistance protein N-like | 0.868 | 0.877 | 0.363 | 0.0 |
| >gi|224127917|ref|XP_002329209.1| tir-nbs-lrr resistance protein [Populus trichocarpa] gi|222870990|gb|EEF08121.1| tir-nbs-lrr resistance protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
Score = 715 bits (1846), Expect = 0.0, Method: Compositional matrix adjust.
Identities = 481/1277 (37%), Positives = 692/1277 (54%), Gaps = 168/1277 (13%)
Query: 2 ASSSSSSGNYEVFLNFRGEDTRTSFTCHLYDNLYERKKIRTFIDDEGLRRGDEISPALLN 61
+S+ + Y+VFL+FRG+DTR +F HL D L RK+I+TFIDD+ L RG+EI+ ALL
Sbjct: 4 SSAVAQKWKYDVFLSFRGKDTRDNFVSHLRDALC-RKQIKTFIDDK-LERGEEITGALLR 61
Query: 62 AIQGSKISVVIFSKDYASSKWCLHELLKILECKKMKGQIIIPVFYGVSPSDVRHQNGTFG 121
I+ S+ISV+IFS++YASS WC+ EL+KILECKK GQI++PVFY V PSDV Q G+FG
Sbjct: 62 TIEESRISVIIFSRNYASSPWCVDELVKILECKKAYGQIVLPVFYHVDPSDVDQQTGSFG 121
Query: 122 DGFDELKKQFQDKPEMVLKWRDALTETSHLAGHESAKFRHDAQLVNKIVEDVLKKLEKIT 181
+ F EL++ F+ K + V +WR LT ++++G +S R ++ LV +IV +LKKL
Sbjct: 122 NAFAELERNFKQKMDKVPRWRADLTSAANISGWDSQVTRPESSLVEQIVHHILKKLN--Y 179
Query: 182 VSTDSSNGLVGLNSRIEQIKPFLCMDSSDTVQIVGIWGMGGIGKTTLAKAIFDQFSHEFE 241
S+ GLVG++SR+EQI+ LC + VGIWGMGG GKTT+A IF++ + E+E
Sbjct: 180 ASSSDLKGLVGMDSRMEQIEASLCTKLPEFC-FVGIWGMGGTGKTTIAGEIFNKIAREYE 238
Query: 242 GSCFVSDVRGNSETAGGLEHLQKQMLS-TTLSEKLEVAGPNIPH-FTKERVRRMKLLIVL 299
G F+++VR SE GGL ++ ++ S T E L + P I H F K+R+ R K+LIV
Sbjct: 239 GHYFLANVR-ESEKNGGLFRIRDELFSKITEEENLHIRTPRIGHPFIKDRICRKKILIVF 297
Query: 300 DDVNEVGQLKRLIGELDQFGQGSRIVVTTRDKRVLEKFRGEEKKIYRVNGLEFEEAFEHF 359
DDVN+V Q++ L+G + FG GSRI++T+RDK+VL+K+ KI+ V GL EA F
Sbjct: 298 DDVNDVDQIEMLLGGCESFGPGSRIILTSRDKQVLKKY---ADKIFEVEGLNHREALHLF 354
Query: 360 CNFAFKENHCPEDLNWHSRSVVSYTKGNPLVLEVLGSSLCLKRKSHWGKVLHDLNRICES 419
AFK+N P + S ++Y KGNPL L+VLGSSL + W L+ + ++
Sbjct: 355 SLHAFKDNQPPYNYMELSVRAINYAKGNPLALKVLGSSLFGRTTKEWESALNKVEKLTRQ 414
Query: 420 EIHDIYDILKISFNKLTPRVKSIFLDIACFFEGEDKDFVASILDDS--ESDV-LDILIDK 476
++H + L+IS+ L KSIFLDIACFF G DFV ILD ++D+ +LID+
Sbjct: 415 KVHSV---LRISYEALDSEEKSIFLDIACFFRGHRVDFVKRILDGCGFKTDIGFSVLIDR 471
Query: 477 SLVSISGNFLNMHDILQEMGRQIVRQESEKEPGKRSRLWDPKEISRVLKHNKGTDAIEGI 536
L+ IS + + MHD+LQEM +VR+ES E G +SRLW PK++ +VL +N GT +EGI
Sbjct: 472 CLIKISDDKVEMHDLLQEMAHDVVRKESLDELGGQSRLWSPKDVYQVLTNNLGTGKVEGI 531
Query: 537 FLDLSKIKGINLDPRAFTNMSNLRLFKFYVPKFYEIEKLPSMSTEEQLSYSKVQLPNGLD 596
FLD+SKI+ I L A M LRL K Y E +V LP+GL+
Sbjct: 532 FLDVSKIREIELSSTALGRMYKLRLLKIY--------------NSEAGVKCRVHLPHGLE 577
Query: 597 YLPKKLRYLHWDTYPLRTLPSNFKPKNLVELNLRCSKVEQPWEGEKACV----------- 645
L ++LRYLHWD YPL +LPSNF+P+NLVE+NL CSKV + W G++ V
Sbjct: 578 SLSEELRYLHWDGYPLTSLPSNFRPQNLVEINLSCSKVNRLWRGDQNLVNLKDVNLSNCE 637
Query: 646 ----------------------------PSSIQNFKYLSALSFKGCQSLRSFPSNLHFVC 677
PSSIQ+ L L +GC+ L + PS ++ C
Sbjct: 638 HITFLPDLSKARNLERLNLQFCTSLVKVPSSIQHLDRLVDLDLRGCERLVNLPSRINSSC 697
Query: 678 PVTINFSYCVNLIEFPQISGKVTRLYLGQSAIEEVPSSIECLTDLEVLDLRGCKRLKRIS 737
T+N S C NL + P+ + K+T L L ++A+EE+P SI L+ L L+L+ CK L +
Sbjct: 698 LETLNLSGCANLKKCPETARKLTYLNLNETAVEELPQSIGELSGLVALNLKNCKLLVNLP 757
Query: 738 TSFCKLRSLVTLILLGCLNLEHFPEILEKMEHLKRIYSDRTPITELPSSFENLPGLEVLF 797
+ L SL+ + + GC ++ P+ + +L Y + T I ELPSS +L L L
Sbjct: 758 ENMYLLTSLLLVDISGCSSISRLPDFSRNIRYL---YLNGTAIEELPSSIGDLRKLIYLN 814
Query: 798 VEDCSKLDNLPDNIGSLEYLYYILAAASAISQLPSSVALSNMLRSLDSSHCKGLESFPRT 857
+ CS + P +++ LY +AI ++PSS+ L L +CK E
Sbjct: 815 LSGCSSITEFPKVSNNIKELYL---DGTAIREIPSSIDCLFELVELHLRNCKQFEI---- 867
Query: 858 FLLGLSAMGLLHISDYAVREIPQEIAYLSSLEILYLSGN-NFESLPAIIKQMSQLRFIHL 916
+P I L LE L LSG F P +++ M LR+++L
Sbjct: 868 --------------------LPSSICTLRKLERLNLSGCLQFRDFPEVLEPMVCLRYLYL 907
Query: 917 EDFNMLQSLPELPL-------CL-----KYLHLIDC----KMLQSLPVLPFCLESLDLTG 960
E+ + LP P+ CL KYL+ I+C ++ + L + L L+L G
Sbjct: 908 EE-TRITKLPS-PIGNLKGLACLEVGNCKYLNDIECFVDLQLSERWVDLDY-LRKLNLDG 964
Query: 961 CNMLRSLPELPLCLQYLNLEDCNMLRSLPELPLC------LQLLTVRNCNRLQSLPEILL 1014
C+ + +P+ CL L + D + + +PL LQ L +RNC RL+SLPE+
Sbjct: 965 CH-ISVVPDSLGCLSSLEVLDLSG-NNFSTIPLSINKLSELQYLGLRNCKRLESLPELPP 1022
Query: 1015 CLQELDASVLEKLSKHSPDLQWAPESLKSAAICFEFTNCLKLNGKANNKILADSLLRIRH 1074
L +LDA E L+ + +K F FTNCL SL RI
Sbjct: 1023 RLSKLDADNCESLNYLGSS---SSTVVKGNIFEFIFTNCL-------------SLCRINQ 1066
Query: 1075 M---AIASLRLGYEMAINEKLSELRGSL-IVLPGSEIPDWFSNQSSGSSICIQLPPHSSC 1130
+ A+ RL Y +++ L G+ LPG P W S+QS GS++ QL H +
Sbjct: 1067 ILPYALKKFRL-YTKRLHQLTDVLEGACSFFLPGGVSPQWLSHQSWGSTVTCQLSSHWAN 1125
Query: 1131 RNLIGFAFCAVLDSKKVDSDCFRYFYVSFQFDLEIKTLSE--TKHVD-----LGYNSRYI 1183
+GF+ CAV+ + SF L++K +H D + Y
Sbjct: 1126 SKFLGFSLCAVIA------------FHSFGHSLQVKCTYHFSNEHGDSHDLYCYLHGWYD 1173
Query: 1184 EDLIDSDRVILGFKPCL 1200
E IDS+ +++GF PCL
Sbjct: 1174 EKRIDSEHILVGFDPCL 1190
|
Source: Populus trichocarpa Species: Populus trichocarpa Genus: Populus Family: Salicaceae Order: Malpighiales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|255563202|ref|XP_002522604.1| leucine-rich repeat containing protein, putative [Ricinus communis] gi|223538080|gb|EEF39691.1| leucine-rich repeat containing protein, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|255544956|ref|XP_002513539.1| leucine-rich repeat containing protein, putative [Ricinus communis] gi|223547447|gb|EEF48942.1| leucine-rich repeat containing protein, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|359486075|ref|XP_002273047.2| PREDICTED: TMV resistance protein N-like [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|451798990|gb|AGF69193.1| TMV resistance protein N-like protein 7 [Vitis labrusca] | Back alignment and taxonomy information |
|---|
| >gi|224145030|ref|XP_002325501.1| tir-nbs-lrr resistance protein [Populus trichocarpa] gi|222862376|gb|EEE99882.1| tir-nbs-lrr resistance protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|224145021|ref|XP_002325498.1| tir-nbs-lrr resistance protein [Populus trichocarpa] gi|222862373|gb|EEE99879.1| tir-nbs-lrr resistance protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|224145016|ref|XP_002325496.1| tir-nbs-lrr resistance protein [Populus trichocarpa] gi|222862371|gb|EEE99877.1| tir-nbs-lrr resistance protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|359486073|ref|XP_002272820.2| PREDICTED: TMV resistance protein N-like, partial [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|359493483|ref|XP_003634610.1| PREDICTED: TMV resistance protein N-like, partial [Vitis vinifera] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 1288 | ||||||
| TAIR|locus:2118106 | 1219 | AT4G12010 [Arabidopsis thalian | 0.708 | 0.748 | 0.354 | 1.7e-137 | |
| TAIR|locus:2175991 | 1294 | AT5G17680 [Arabidopsis thalian | 0.833 | 0.829 | 0.328 | 1.6e-134 | |
| UNIPROTKB|Q40392 | 1144 | N "TMV resistance protein N" [ | 0.601 | 0.677 | 0.372 | 3.4e-126 | |
| TAIR|locus:2053405 | 1215 | AT2G14080 [Arabidopsis thalian | 0.731 | 0.775 | 0.337 | 5.6e-126 | |
| TAIR|locus:2153072 | 1229 | AT5G51630 [Arabidopsis thalian | 0.424 | 0.445 | 0.391 | 1e-123 | |
| TAIR|locus:2155189 | 980 | AT5G49140 [Arabidopsis thalian | 0.600 | 0.788 | 0.378 | 3.5e-123 | |
| TAIR|locus:2162439 | 1008 | AT5G22690 [Arabidopsis thalian | 0.534 | 0.682 | 0.371 | 1.7e-120 | |
| TAIR|locus:2032602 | 1163 | AT1G72860 [Arabidopsis thalian | 0.549 | 0.608 | 0.352 | 3.1e-120 | |
| TAIR|locus:2167457 | 1191 | AT5G36930 [Arabidopsis thalian | 0.428 | 0.463 | 0.423 | 7.5e-120 | |
| TAIR|locus:2146228 | 1245 | AT5G18350 [Arabidopsis thalian | 0.724 | 0.749 | 0.325 | 1.7e-119 |
| TAIR|locus:2118106 AT4G12010 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 1346 (478.9 bits), Expect = 1.7e-137, P = 1.7e-137
Identities = 348/982 (35%), Positives = 543/982 (55%)
Query: 1 MASSSSSSGNYEVFLNFRGEDTRTSFTCHLYDNLYERKKIRTFIDDEGLRRGDEISPALL 60
M SSS SS ++VFL+FRG DTR +FT HL L R I +FIDD LRRGD ++ AL
Sbjct: 1 MESSSPSSAEFDVFLSFRGFDTRNNFTGHLQKALRLRG-IDSFIDDR-LRRGDNLT-ALF 57
Query: 61 NAIQGSKISVVIFSKDYASSKWCLHELLKILECKKMKGQIIIPVFYGVSPSDVRHQNGTF 120
+ I+ SKI++++FS +YA+S WCL EL+KILEC+ Q+++P+FY V SDV Q +F
Sbjct: 58 DRIEKSKIAIIVFSTNYANSAWCLRELVKILECRNSNQQLVVPIFYKVDKSDVEKQRNSF 117
Query: 121 GDGFDELKKQFQD-KPEMVLKWRDALTETSHLAGHESAKFR-HDAQLVNKIVEDVLKKLE 178
F + F PE + W+ AL S++ G+ + +A+LV++I D KKL
Sbjct: 118 AVPFKLPELTFPGVTPEEISSWKAALASASNILGYVVKEISTSEAKLVDEIAVDTFKKLN 177
Query: 179 KITVSTDSSNGLVGLNSRIEQIKPFLCMDSSDTVQIVGIWGMGGIGKTTLAKAIFDQFSH 238
+ S + GLVG+ SR++ ++ L + DTV I+GI GM GIGKTTLA ++ +
Sbjct: 178 DLAPS--GNEGLVGIESRLKNLEKLLSWEDLDTVHIIGIVGMVGIGKTTLADCLYGRMRG 235
Query: 239 EFEGSCFVSDVRGNSETAGGLEHLQKQMLSTTLSEK-LEVAGPNIPHFTKER-VRRMKLL 296
+F+GSCF++++R NS +G LE L +++ ST L+++ LE+ P H ER ++ +LL
Sbjct: 236 QFDGSCFLTNIRENSGRSG-LESLLQKLFSTVLNDRDLEIGAPGNAHERFERRLKSKRLL 294
Query: 297 IVLDDVNEVGQLKRLIGELDQFGQGSRIVVTTRDKRVLEKFRGEEKKIYRVNGLEFEEAF 356
IVLDDVN+ Q++ L+G + GSRI++TTRD +++E +G + + ++N EA
Sbjct: 295 IVLDDVNDEKQIRYLMGHCKWYQGGSRIIITTRDSKLIETIKGRKYVLPKLND---REAL 351
Query: 357 EHFCNFAFKENHCPEDLNWHSRSVVSYTKGNPLVLEVLGSSLCLKRKSHWGKVLHDLNRI 416
+ F AF + ++ + V+ Y KG+PL L+VLGS LC + +W L+R+
Sbjct: 352 KLFSLNAFSNSFPLKEFEGLTNMVLDYAKGHPLALKVLGSDLCERDDLYWEA---KLDRL 408
Query: 417 CESEIH-DIYDILKISFNKLTPRVKSIFLDIACFFEGEDKDFVASILDDSESDVLDI--- 472
+S H DIY++L+ S+ +LT K++FLDIACFF E+ D+V S+L+ DV +
Sbjct: 409 -KSRSHGDIYEVLETSYEELTTEQKNVFLDIACFFRSENVDYVTSLLNSHGVDVSGVVKD 467
Query: 473 LIDKSLVSISGNFLNMHDILQEMGRQI-VRQESE--------KEPGKRS----RLWDPKE 519
L+DK L+++S N + MHD+LQ M ++I ++ E+ G + RLWD ++
Sbjct: 468 LVDKCLITLSDNRIEMHDMLQTMAKEISLKVETIGIRDCRWLSRHGNQCQWHIRLWDSED 527
Query: 520 ISRVLKHNKGTDAIEGIFLDLSKIKGINLDPRAFTNMSNLRLFKFYVPKFYEIEKLPSMS 579
I +L GTD I GIFLD SK++ + L +AF M NL+ K Y + S
Sbjct: 528 ICDLLTEGLGTDKIRGIFLDTSKLRAMRLSAKAFQGMYNLKYLKIY-------DSHCSRG 580
Query: 580 TEEQLSYSKVQLPNGLDYLPKKLRYLHWDTYPLRTLPSNFKPKNLVELNLRCSKVEQPWE 639
E + K+ L GL +LP +L YLHW YPL+++P +F PKNLV+L L S++E+ W+
Sbjct: 581 CEAEF---KLHLRRGLSFLPNELTYLHWHGYPLQSIPLDFDPKNLVDLKLPHSQLEEIWD 637
Query: 640 GEKACVPSSIQNFKYLSALSFKGCQSLRSFPSNLHFVCPVTINFSYCVNLIEFPQISGKV 699
EK ++ +++ + C L +N H + +N C +L + P +
Sbjct: 638 DEKDV--GMLKWVDLSHSINLRQCLGL----ANAHNL--ERLNLEGCTSLKKLPSTINCL 689
Query: 700 TRL-YLGQ---SAIEEVPSSIECLTDLEVLDLRGCKRLKRISTSFCKLRSLVTLILLGCL 755
+L YL +++ +P I+ + L+ L L GC LK+ F + V ++LL
Sbjct: 690 EKLIYLNLRDCTSLRSLPKGIKTQS-LQTLILSGCSSLKK----FPLISENVEVLLLDGT 744
Query: 756 NLEHFPEILEKMEHLKRI-YSDRTPITELPSSFENLPGLEVLFVEDCSKLDNLPDNIGXX 814
++ PE ++ L + + + L S L L+ L + CS+L+ P+
Sbjct: 745 VIKSLPESIQTFRRLALLNLKNCKKLKHLSSDLYKLKCLQELILSGCSQLEVFPEIKEDM 804
Query: 815 XXXXXXXXXXXXXXXXXXXVALSNMLR-SL--DSSHCKGLESF-PRTFLLGLSAMGLLHI 870
+ LSN+ SL SSH F P T LG S + L++
Sbjct: 805 ESLEILLMDDTSITEMPKMMHLSNIKTFSLCGTSSHVSVSMFFMPPT--LGCSRLTDLYL 862
Query: 871 SDYAVREIPQEIAYLSSLEILYLSGNNFESLPAIIKQMSQLRFIHLEDFNMLQSLPELPL 930
S ++ ++P I LSSL+ L LSGNN E+LP Q++ L++ L+ ML+SLP LP
Sbjct: 863 SRCSLYKLPDNIGGLSSLQSLCLSGNNIENLPESFNQLNNLKWFDLKFCKMLKSLPVLPQ 922
Query: 931 CLKYLHLIDCKMLQSL--PVLP 950
L+YL +C+ L++L P+ P
Sbjct: 923 NLQYLDAHECESLETLANPLTP 944
|
|
| TAIR|locus:2175991 AT5G17680 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q40392 N "TMV resistance protein N" [Nicotiana glutinosa (taxid:35889)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2053405 AT2G14080 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2153072 AT5G51630 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2155189 AT5G49140 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2162439 AT5G22690 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2032602 AT1G72860 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2167457 AT5G36930 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2146228 AT5G18350 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
| eugene3.01250003 | tir-nbs-lrr resistance protein (1470 aa) | |||||||
(Populus trichocarpa) | ||||||||
| Sorry, there are no predicted associations at the current settings. |
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 1288 | |||
| PLN03210 | 1153 | PLN03210, PLN03210, Resistant to P | 1e-160 | |
| pfam00931 | 285 | pfam00931, NB-ARC, NB-ARC domain | 3e-44 | |
| pfam01582 | 135 | pfam01582, TIR, TIR domain | 8e-38 | |
| smart00255 | 140 | smart00255, TIR, Toll - interleukin 1 - resistance | 4e-32 | |
| PLN03194 | 187 | PLN03194, PLN03194, putative disease resistance pr | 1e-17 | |
| PRK15387 | 788 | PRK15387, PRK15387, E3 ubiquitin-protein ligase Ss | 3e-09 | |
| COG4886 | 394 | COG4886, COG4886, Leucine-rich repeat (LRR) protei | 8e-08 | |
| pfam13676 | 102 | pfam13676, TIR_2, TIR domain | 1e-07 | |
| COG4886 | 394 | COG4886, COG4886, Leucine-rich repeat (LRR) protei | 2e-07 | |
| PRK15370 | 754 | PRK15370, PRK15370, E3 ubiquitin-protein ligase Sl | 6e-07 | |
| PRK15387 | 788 | PRK15387, PRK15387, E3 ubiquitin-protein ligase Ss | 3e-06 | |
| COG4886 | 394 | COG4886, COG4886, Leucine-rich repeat (LRR) protei | 1e-05 | |
| PLN00113 | 968 | PLN00113, PLN00113, leucine-rich repeat receptor-l | 2e-05 | |
| PLN00113 | 968 | PLN00113, PLN00113, leucine-rich repeat receptor-l | 2e-05 | |
| PLN00113 | 968 | PLN00113, PLN00113, leucine-rich repeat receptor-l | 9e-04 | |
| pfam13191 | 154 | pfam13191, AAA_16, AAA ATPase domain | 0.001 | |
| pfam07725 | 20 | pfam07725, LRR_3, Leucine Rich Repeat | 0.004 |
| >gnl|CDD|215633 PLN03210, PLN03210, Resistant to P | Back alignment and domain information |
|---|
Score = 509 bits (1312), Expect = e-160
Identities = 389/1212 (32%), Positives = 581/1212 (47%), Gaps = 242/1212 (19%)
Query: 1 MASSSSSSGN--YEVFLNFRGEDTRTSFTCHLYDNLYERKKIRTFIDDEGLRRGDEISPA 58
MASSSSSS N Y+VF +F GED R +F H L +RK I F D+E + R + P
Sbjct: 1 MASSSSSSRNWVYDVFPSFSGEDVRITFLSHFLKEL-DRKLIIAFKDNE-IERSQSLDPE 58
Query: 59 LLNAIQGSKISVVIFSKDYASSKWCLHELLKILECKKMKGQIIIPVFYGVSPSDVRHQNG 118
L AI+ S+I+VV+FSK+YASS WCL+ELL+I+ CK+ GQ++IPVFYG+ PS VR Q G
Sbjct: 59 LKQAIRDSRIAVVVFSKNYASSSWCLNELLEIVRCKEELGQLVIPVFYGLDPSHVRKQTG 118
Query: 119 TFGDGFDELKKQFQDKPEMVLK-WRDALTETSHLAGHESAKFRHDAQLVNKIVEDVLKKL 177
FG+ F +K Q+K E W+ ALT+ +++ G+ S + ++A+++ +I DVL KL
Sbjct: 119 DFGEAF---EKTCQNKTEDEKIQWKQALTDVANILGYHSQNWPNEAKMIEEIANDVLGKL 175
Query: 178 EKITVSTDSSNGLVGLNSRIEQIKPFLCMDSSDTVQIVGIWGMGGIGKTTLAKAIFDQFS 237
+T S D + VG+ I ++ L ++S + V++VGIWG GIGKTT+A+A+F + S
Sbjct: 176 -NLTPSNDFED-FVGIEDHIAKMSSLLHLES-EEVRMVGIWGSSGIGKTTIARALFSRLS 232
Query: 238 HEFEGSCFVSDV----------RGNSETAGGLEHLQKQMLSTTLSEKLEVAGPNIPHF-- 285
+F+ S F+ N + HLQ+ LS L +K I H
Sbjct: 233 RQFQSSVFIDRAFISKSMEIYSSANPDDYNMKLHLQRAFLSEILDKK----DIKIYHLGA 288
Query: 286 TKERVRRMKLLIVLDDVNEVGQLKRLIGELDQFGQGSRIVVTTRDKRVLEKFRGEEKKIY 345
+ER++ K+LI +DD+++ L L G+ FG GSRI+V T+DK L + IY
Sbjct: 289 MEERLKHRKVLIFIDDLDDQDVLDALAGQTQWFGSGSRIIVITKDKHFLRAHGIDH--IY 346
Query: 346 RVNGLEFEEAFEHFCNFAFKENHCPEDLNWHSRSVVSYTKGN-PLVLEVLGSSLCLKRKS 404
V E A E FC AFK+N P+ + S V+ GN PL L VLGS L + K
Sbjct: 347 EVCLPSNELALEMFCRSAFKKNSPPDGFMELA-SEVALRAGNLPLGLNVLGSYLRGRDKE 405
Query: 405 HWGKVLHDLNRICESEIHDIYDILKISFNKLTPRV-KSIFLDIACFFEGEDKDFVASILD 463
W +L L + +I L++S++ L + K+IF IAC F GE + + +L
Sbjct: 406 DWMDMLPRLRNGLDGKIEKT---LRVSYDGLNNKKDKAIFRHIACLFNGEKVNDIKLLLA 462
Query: 464 DSESDV---LDILIDKSLVSISGNFLNMHDILQEMGRQIVRQESEKEPGKRSRLWDPKEI 520
+S+ DV L L+DKSL+ + + + MH +LQEMG++IVR +S EPG+R L D K+I
Sbjct: 463 NSDLDVNIGLKNLVDKSLIHVREDIVEMHSLLQEMGKEIVRAQSN-EPGEREFLVDAKDI 521
Query: 521 SRVLKHNKGTDAIEGIFLDLSKIKGINLDPRAFTNMSNLRLFKFYVPKFYEIEKLPSMST 580
VL+ N GT + GI LD+ +I +++ AF M NL KFY K+
Sbjct: 522 CDVLEDNTGTKKVLGITLDIDEIDELHIHENAFKGMRNLLFLKFYTKKW----------- 570
Query: 581 EEQLSYSKVQLPNGLDYLPKKLRYLHWDTYPLRTLPSNFKPKNLVELNLRCSKVEQPWEG 640
+Q + LP G DYLP KLR L WD YPLR +PSNF+P+NLV+L ++ SK+E+ W+G
Sbjct: 571 -DQKKEVRWHLPEGFDYLPPKLRLLRWDKYPLRCMPSNFRPENLVKLQMQGSKLEKLWDG 629
Query: 641 EKACVPSSIQNFKYLSALSFKGCQSLRSFP-----SNLHFVCPVTINFSYCVNLIEFPQI 695
+ + L + +G ++L+ P +NL T+ S C +L+E
Sbjct: 630 --------VHSLTGLRNIDLRGSKNLKEIPDLSMATNLE-----TLKLSDCSSLVE---- 672
Query: 696 SGKVTRLYLGQSAIEEVPSSIECLTDLEVLDLRGCKRLKRISTSFCKLRSLVTLILLGCL 755
+PSSI+ L LE LD+ C+ L+ + T L+SL L L GC
Sbjct: 673 ----------------LPSSIQYLNKLEDLDMSRCENLEILPTGI-NLKSLYRLNLSGCS 715
Query: 756 NLEHFPEILEKMEHLKRIYSDRTPITELPSSFENLPGLEVLFVEDCSKLDNLPDNIGSLE 815
L+ FP+I NI L
Sbjct: 716 RLKSFPDI--------------------------------------------STNISWL- 730
Query: 816 YLYYILAAASAISQLPSSVALSNMLRSLDSSHCKGLESFPRTFLLGLSAMGLLHISDYAV 875
L +AI + PS++ L N+ L L M + +
Sbjct: 731 DLD-----ETAIEEFPSNLRLENL------------------DELILCEMKSEKLWERVQ 767
Query: 876 REIPQEIAYLSSLEILYLSGN-NFESLPAIIKQMSQLRFIHLEDFNMLQSLPELPLCLKY 934
P SL L+LS + LP+ I+ + +L ++
Sbjct: 768 PLTPLMTMLSPSLTRLFLSDIPSLVELPSSIQNLHKL---------------------EH 806
Query: 935 LHLIDCKMLQSLPV---LPFCLESLDLTGCNMLRSLPELPLCLQYLNLEDCNMLRSLPEL 991
L + +C L++LP L LESLDL+GC+ LR+ P++ + LNL + E+
Sbjct: 807 LEIENCINLETLPTGINLES-LESLDLSGCSRLRTFPDISTNISDLNLSRT----GIEEV 861
Query: 992 PLC------LQLLTVRNCNRLQSL-PEI--LLCLQELDASVLEKLSKHS--------PDL 1034
P L L + CN LQ + I L L+ +D S L++ S
Sbjct: 862 PWWIEKFSNLSFLDMNGCNNLQRVSLNISKLKHLETVDFSDCGALTEASWNGSPSEVAMA 921
Query: 1035 QWAPESLKSAAICFEFTNCLKLNGKANNKILADSLLRIRHMAIASLRLGYEMAINEKLSE 1094
S + +C F NC L+ +A LL+ + +
Sbjct: 922 TDNIHSKLPSTVCINFINCFNLDQEA--------LLQQQSIFKQ---------------- 957
Query: 1095 LRGSLIVLPGSEIPDWFSNQSSGSS-ICIQLPPHSSCRNLIGFAFCAVLDSKKVDSDCFR 1153
++L G E+P +F+++++G+S I L S C+ F CAV VDS+ F
Sbjct: 958 -----LILSGEEVPSYFTHRTTGASLTNIPLLHISPCQPFFRFRACAV-----VDSESF- 1006
Query: 1154 YFYVSFQFDLEI 1165
F +S FD+++
Sbjct: 1007 -FIISVSFDIQV 1017
|
syringae 6; Provisional. Length = 1153 |
| >gnl|CDD|216202 pfam00931, NB-ARC, NB-ARC domain | Back alignment and domain information |
|---|
| >gnl|CDD|216585 pfam01582, TIR, TIR domain | Back alignment and domain information |
|---|
| >gnl|CDD|214587 smart00255, TIR, Toll - interleukin 1 - resistance | Back alignment and domain information |
|---|
| >gnl|CDD|215626 PLN03194, PLN03194, putative disease resistance protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|185285 PRK15387, PRK15387, E3 ubiquitin-protein ligase SspH2; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] | Back alignment and domain information |
|---|
| >gnl|CDD|222311 pfam13676, TIR_2, TIR domain | Back alignment and domain information |
|---|
| >gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] | Back alignment and domain information |
|---|
| >gnl|CDD|185268 PRK15370, PRK15370, E3 ubiquitin-protein ligase SlrP; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|185285 PRK15387, PRK15387, E3 ubiquitin-protein ligase SspH2; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] | Back alignment and domain information |
|---|
| >gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|221970 pfam13191, AAA_16, AAA ATPase domain | Back alignment and domain information |
|---|
| >gnl|CDD|191828 pfam07725, LRR_3, Leucine Rich Repeat | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 1288 | |||
| PLN03210 | 1153 | Resistant to P. syringae 6; Provisional | 100.0 | |
| KOG4658 | 889 | consensus Apoptotic ATPase [Signal transduction me | 100.0 | |
| PLN03194 | 187 | putative disease resistance protein; Provisional | 100.0 | |
| PLN00113 | 968 | leucine-rich repeat receptor-like protein kinase; | 100.0 | |
| PLN00113 | 968 | leucine-rich repeat receptor-like protein kinase; | 100.0 | |
| PF00931 | 287 | NB-ARC: NB-ARC domain; InterPro: IPR002182 This is | 100.0 | |
| KOG0472 | 565 | consensus Leucine-rich repeat protein [Function un | 99.93 | |
| KOG0444 | 1255 | consensus Cytoskeletal regulator Flightless-I (con | 99.93 | |
| KOG0444 | 1255 | consensus Cytoskeletal regulator Flightless-I (con | 99.93 | |
| KOG4194 | 873 | consensus Membrane glycoprotein LIG-1 [Signal tran | 99.92 | |
| KOG0472 | 565 | consensus Leucine-rich repeat protein [Function un | 99.92 | |
| KOG4194 | 873 | consensus Membrane glycoprotein LIG-1 [Signal tran | 99.92 | |
| PLN03210 | 1153 | Resistant to P. syringae 6; Provisional | 99.9 | |
| KOG0618 | 1081 | consensus Serine/threonine phosphatase 2C containi | 99.9 | |
| KOG0618 | 1081 | consensus Serine/threonine phosphatase 2C containi | 99.85 | |
| PF01582 | 141 | TIR: TIR domain; InterPro: IPR000157 In Drosophila | 99.8 | |
| PRK15387 | 788 | E3 ubiquitin-protein ligase SspH2; Provisional | 99.77 | |
| PRK15387 | 788 | E3 ubiquitin-protein ligase SspH2; Provisional | 99.76 | |
| smart00255 | 140 | TIR Toll - interleukin 1 - resistance. | 99.75 | |
| PRK15370 | 754 | E3 ubiquitin-protein ligase SlrP; Provisional | 99.69 | |
| PRK15370 | 754 | E3 ubiquitin-protein ligase SlrP; Provisional | 99.66 | |
| KOG4237 | 498 | consensus Extracellular matrix protein slit, conta | 99.65 | |
| KOG0617 | 264 | consensus Ras suppressor protein (contains leucine | 99.59 | |
| KOG4237 | 498 | consensus Extracellular matrix protein slit, conta | 99.55 | |
| KOG0617 | 264 | consensus Ras suppressor protein (contains leucine | 99.52 | |
| cd00116 | 319 | LRR_RI Leucine-rich repeats (LRRs), ribonuclease i | 99.41 | |
| PF13676 | 102 | TIR_2: TIR domain; PDB: 3H16_B 3UB4_A 2Y92_A 3UB3_ | 99.36 | |
| cd00116 | 319 | LRR_RI Leucine-rich repeats (LRRs), ribonuclease i | 99.36 | |
| PRK04841 | 903 | transcriptional regulator MalT; Provisional | 99.34 | |
| KOG4658 | 889 | consensus Apoptotic ATPase [Signal transduction me | 99.2 | |
| PRK00411 | 394 | cdc6 cell division control protein 6; Reviewed | 99.1 | |
| TIGR00635 | 305 | ruvB Holliday junction DNA helicase, RuvB subunit. | 99.07 | |
| KOG0532 | 722 | consensus Leucine-rich repeat (LRR) protein, conta | 99.07 | |
| PF01637 | 234 | Arch_ATPase: Archaeal ATPase; InterPro: IPR011579 | 99.03 | |
| PRK00080 | 328 | ruvB Holliday junction DNA helicase RuvB; Reviewed | 99.02 | |
| COG3899 | 849 | Predicted ATPase [General function prediction only | 99.01 | |
| KOG3207 | 505 | consensus Beta-tubulin folding cofactor E [Posttra | 98.97 | |
| TIGR02928 | 365 | orc1/cdc6 family replication initiation protein. M | 98.96 | |
| COG2909 | 894 | MalT ATP-dependent transcriptional regulator [Tran | 98.96 | |
| TIGR03015 | 269 | pepcterm_ATPase putative secretion ATPase, PEP-CTE | 98.95 | |
| PF05729 | 166 | NACHT: NACHT domain | 98.93 | |
| PRK15386 | 426 | type III secretion protein GogB; Provisional | 98.87 | |
| COG4886 | 394 | Leucine-rich repeat (LRR) protein [Function unknow | 98.86 | |
| COG4886 | 394 | Leucine-rich repeat (LRR) protein [Function unknow | 98.85 | |
| KOG0532 | 722 | consensus Leucine-rich repeat (LRR) protein, conta | 98.8 | |
| KOG1259 | 490 | consensus Nischarin, modulator of integrin alpha5 | 98.79 | |
| KOG3207 | 505 | consensus Beta-tubulin folding cofactor E [Posttra | 98.75 | |
| KOG1259 | 490 | consensus Nischarin, modulator of integrin alpha5 | 98.69 | |
| COG2256 | 436 | MGS1 ATPase related to the helicase subunit of the | 98.66 | |
| KOG1909 | 382 | consensus Ran GTPase-activating protein [RNA proce | 98.62 | |
| KOG1909 | 382 | consensus Ran GTPase-activating protein [RNA proce | 98.58 | |
| PRK13342 | 413 | recombination factor protein RarA; Reviewed | 98.56 | |
| PF14580 | 175 | LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ | 98.56 | |
| PF14580 | 175 | LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ | 98.55 | |
| PRK06893 | 229 | DNA replication initiation factor; Validated | 98.55 | |
| PRK15386 | 426 | type III secretion protein GogB; Provisional | 98.53 | |
| PTZ00202 | 550 | tuzin; Provisional | 98.45 | |
| COG3903 | 414 | Predicted ATPase [General function prediction only | 98.43 | |
| TIGR03420 | 226 | DnaA_homol_Hda DnaA regulatory inactivator Hda. Me | 98.39 | |
| KOG3678 | 832 | consensus SARM protein (with sterile alpha and arm | 98.38 | |
| PTZ00112 | 1164 | origin recognition complex 1 protein; Provisional | 98.38 | |
| PF13173 | 128 | AAA_14: AAA domain | 98.32 | |
| PRK07471 | 365 | DNA polymerase III subunit delta'; Validated | 98.28 | |
| PLN03150 | 623 | hypothetical protein; Provisional | 98.27 | |
| PF05496 | 233 | RuvB_N: Holliday junction DNA helicase ruvB N-term | 98.26 | |
| PRK12402 | 337 | replication factor C small subunit 2; Reviewed | 98.25 | |
| TIGR01242 | 364 | 26Sp45 26S proteasome subunit P45 family. Many pro | 98.25 | |
| PRK14961 | 363 | DNA polymerase III subunits gamma and tau; Provisi | 98.24 | |
| PRK07003 | 830 | DNA polymerase III subunits gamma and tau; Validat | 98.23 | |
| PRK14963 | 504 | DNA polymerase III subunits gamma and tau; Provisi | 98.23 | |
| PRK14949 | 944 | DNA polymerase III subunits gamma and tau; Provisi | 98.23 | |
| PRK14960 | 702 | DNA polymerase III subunits gamma and tau; Provisi | 98.22 | |
| PF13191 | 185 | AAA_16: AAA ATPase domain; PDB: 2V1U_A. | 98.21 | |
| KOG0531 | 414 | consensus Protein phosphatase 1, regulatory subuni | 98.18 | |
| PLN03150 | 623 | hypothetical protein; Provisional | 98.18 | |
| cd00009 | 151 | AAA The AAA+ (ATPases Associated with a wide varie | 98.17 | |
| PRK12323 | 700 | DNA polymerase III subunits gamma and tau; Provisi | 98.16 | |
| PLN03025 | 319 | replication factor C subunit; Provisional | 98.16 | |
| PRK05564 | 313 | DNA polymerase III subunit delta'; Validated | 98.16 | |
| KOG2120 | 419 | consensus SCF ubiquitin ligase, Skp2 component [Po | 98.15 | |
| PRK00440 | 319 | rfc replication factor C small subunit; Reviewed | 98.14 | |
| PRK13341 | 725 | recombination factor protein RarA/unknown domain f | 98.11 | |
| PRK09112 | 351 | DNA polymerase III subunit delta'; Validated | 98.09 | |
| PRK04195 | 482 | replication factor C large subunit; Provisional | 98.08 | |
| KOG0531 | 414 | consensus Protein phosphatase 1, regulatory subuni | 98.08 | |
| PF13401 | 131 | AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S | 98.07 | |
| COG1474 | 366 | CDC6 Cdc6-related protein, AAA superfamily ATPase | 98.07 | |
| PRK14957 | 546 | DNA polymerase III subunits gamma and tau; Provisi | 98.06 | |
| PF14516 | 331 | AAA_35: AAA-like domain | 98.05 | |
| PRK06645 | 507 | DNA polymerase III subunits gamma and tau; Validat | 98.05 | |
| PRK08691 | 709 | DNA polymerase III subunits gamma and tau; Validat | 98.05 | |
| PRK07940 | 394 | DNA polymerase III subunit delta'; Validated | 98.04 | |
| PF13855 | 61 | LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF | 98.03 | |
| PRK14962 | 472 | DNA polymerase III subunits gamma and tau; Provisi | 98.03 | |
| PRK08727 | 233 | hypothetical protein; Validated | 98.02 | |
| PF00308 | 219 | Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013 | 98.02 | |
| PRK08903 | 227 | DnaA regulatory inactivator Hda; Validated | 98.02 | |
| PRK14956 | 484 | DNA polymerase III subunits gamma and tau; Provisi | 98.01 | |
| PRK07994 | 647 | DNA polymerase III subunits gamma and tau; Validat | 98.0 | |
| PRK08084 | 235 | DNA replication initiation factor; Provisional | 98.0 | |
| TIGR00678 | 188 | holB DNA polymerase III, delta' subunit. At positi | 98.0 | |
| TIGR02397 | 355 | dnaX_nterm DNA polymerase III, subunit gamma and t | 97.99 | |
| PRK14087 | 450 | dnaA chromosomal replication initiation protein; P | 97.98 | |
| PRK14964 | 491 | DNA polymerase III subunits gamma and tau; Provisi | 97.96 | |
| PRK09087 | 226 | hypothetical protein; Validated | 97.96 | |
| PRK03992 | 389 | proteasome-activating nucleotidase; Provisional | 97.95 | |
| PRK05642 | 234 | DNA replication initiation factor; Validated | 97.93 | |
| KOG1859 | 1096 | consensus Leucine-rich repeat proteins [General fu | 97.91 | |
| PRK05896 | 605 | DNA polymerase III subunits gamma and tau; Validat | 97.91 | |
| PRK14951 | 618 | DNA polymerase III subunits gamma and tau; Provisi | 97.89 | |
| PRK14955 | 397 | DNA polymerase III subunits gamma and tau; Provisi | 97.87 | |
| TIGR02903 | 615 | spore_lon_C ATP-dependent protease, Lon family. Me | 97.85 | |
| KOG2120 | 419 | consensus SCF ubiquitin ligase, Skp2 component [Po | 97.83 | |
| PHA02544 | 316 | 44 clamp loader, small subunit; Provisional | 97.82 | |
| PF13855 | 61 | LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF | 97.81 | |
| PRK14958 | 509 | DNA polymerase III subunits gamma and tau; Provisi | 97.81 | |
| PRK14969 | 527 | DNA polymerase III subunits gamma and tau; Provisi | 97.78 | |
| COG2255 | 332 | RuvB Holliday junction resolvasome, helicase subun | 97.78 | |
| TIGR02639 | 731 | ClpA ATP-dependent Clp protease ATP-binding subuni | 97.77 | |
| PRK14970 | 367 | DNA polymerase III subunits gamma and tau; Provisi | 97.77 | |
| KOG1859 | 1096 | consensus Leucine-rich repeat proteins [General fu | 97.77 | |
| PRK00149 | 450 | dnaA chromosomal replication initiation protein; R | 97.75 | |
| PTZ00361 | 438 | 26 proteosome regulatory subunit 4-like protein; P | 97.73 | |
| KOG2982 | 418 | consensus Uncharacterized conserved protein [Funct | 97.71 | |
| PRK14959 | 624 | DNA polymerase III subunits gamma and tau; Provisi | 97.71 | |
| PRK07133 | 725 | DNA polymerase III subunits gamma and tau; Validat | 97.71 | |
| PRK14952 | 584 | DNA polymerase III subunits gamma and tau; Provisi | 97.71 | |
| PRK14954 | 620 | DNA polymerase III subunits gamma and tau; Provisi | 97.7 | |
| PRK07764 | 824 | DNA polymerase III subunits gamma and tau; Validat | 97.69 | |
| TIGR02881 | 261 | spore_V_K stage V sporulation protein K. Members o | 97.69 | |
| PRK14950 | 585 | DNA polymerase III subunits gamma and tau; Provisi | 97.68 | |
| TIGR00362 | 405 | DnaA chromosomal replication initiator protein Dna | 97.68 | |
| PRK09111 | 598 | DNA polymerase III subunits gamma and tau; Validat | 97.67 | |
| KOG2227 | 529 | consensus Pre-initiation complex, subunit CDC6, AA | 97.66 | |
| KOG2028 | 554 | consensus ATPase related to the helicase subunit o | 97.66 | |
| PRK09376 | 416 | rho transcription termination factor Rho; Provisio | 97.64 | |
| PRK14088 | 440 | dnaA chromosomal replication initiation protein; P | 97.64 | |
| TIGR02880 | 284 | cbbX_cfxQ probable Rubsico expression protein CbbX | 97.64 | |
| PRK06305 | 451 | DNA polymerase III subunits gamma and tau; Validat | 97.63 | |
| TIGR03345 | 852 | VI_ClpV1 type VI secretion ATPase, ClpV1 family. M | 97.61 | |
| PRK08451 | 535 | DNA polymerase III subunits gamma and tau; Validat | 97.6 | |
| TIGR03689 | 512 | pup_AAA proteasome ATPase. In the Actinobacteria, | 97.59 | |
| KOG4341 | 483 | consensus F-box protein containing LRR [General fu | 97.59 | |
| PTZ00454 | 398 | 26S protease regulatory subunit 6B-like protein; P | 97.58 | |
| PRK14953 | 486 | DNA polymerase III subunits gamma and tau; Provisi | 97.57 | |
| KOG2982 | 418 | consensus Uncharacterized conserved protein [Funct | 97.56 | |
| KOG2543 | 438 | consensus Origin recognition complex, subunit 5 [R | 97.55 | |
| PRK12422 | 445 | chromosomal replication initiation protein; Provis | 97.54 | |
| cd01128 | 249 | rho_factor Transcription termination factor rho is | 97.54 | |
| PF08937 | 130 | DUF1863: MTH538 TIR-like domain (DUF1863); InterPr | 97.53 | |
| PRK14948 | 620 | DNA polymerase III subunits gamma and tau; Provisi | 97.5 | |
| PRK05707 | 328 | DNA polymerase III subunit delta'; Validated | 97.5 | |
| CHL00095 | 821 | clpC Clp protease ATP binding subunit | 97.49 | |
| CHL00181 | 287 | cbbX CbbX; Provisional | 97.48 | |
| PRK07399 | 314 | DNA polymerase III subunit delta'; Validated | 97.48 | |
| PRK06647 | 563 | DNA polymerase III subunits gamma and tau; Validat | 97.47 | |
| PRK07952 | 244 | DNA replication protein DnaC; Validated | 97.47 | |
| PRK06620 | 214 | hypothetical protein; Validated | 97.46 | |
| PF12799 | 44 | LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ | 97.45 | |
| PRK14971 | 614 | DNA polymerase III subunits gamma and tau; Provisi | 97.43 | |
| KOG4579 | 177 | consensus Leucine-rich repeat (LRR) protein associ | 97.4 | |
| PRK14086 | 617 | dnaA chromosomal replication initiation protein; P | 97.39 | |
| PRK10865 | 857 | protein disaggregation chaperone; Provisional | 97.39 | |
| PRK11034 | 758 | clpA ATP-dependent Clp protease ATP-binding subuni | 97.37 | |
| PF05673 | 249 | DUF815: Protein of unknown function (DUF815); Inte | 97.37 | |
| TIGR00767 | 415 | rho transcription termination factor Rho. Members | 97.37 | |
| KOG4341 | 483 | consensus F-box protein containing LRR [General fu | 97.36 | |
| KOG0989 | 346 | consensus Replication factor C, subunit RFC4 [Repl | 97.36 | |
| PRK05563 | 559 | DNA polymerase III subunits gamma and tau; Validat | 97.35 | |
| PRK08116 | 268 | hypothetical protein; Validated | 97.35 | |
| COG0593 | 408 | DnaA ATPase involved in DNA replication initiation | 97.34 | |
| PF00004 | 132 | AAA: ATPase family associated with various cellula | 97.32 | |
| CHL00195 | 489 | ycf46 Ycf46; Provisional | 97.31 | |
| PRK12377 | 248 | putative replication protein; Provisional | 97.31 | |
| TIGR03346 | 852 | chaperone_ClpB ATP-dependent chaperone ClpB. Membe | 97.31 | |
| PRK14965 | 576 | DNA polymerase III subunits gamma and tau; Provisi | 97.31 | |
| CHL00176 | 638 | ftsH cell division protein; Validated | 97.3 | |
| KOG3665 | 699 | consensus ZYG-1-like serine/threonine protein kina | 97.24 | |
| COG3267 | 269 | ExeA Type II secretory pathway, component ExeA (pr | 97.23 | |
| COG1222 | 406 | RPT1 ATP-dependent 26S proteasome regulatory subun | 97.17 | |
| KOG0991 | 333 | consensus Replication factor C, subunit RFC2 [Repl | 97.17 | |
| TIGR01241 | 495 | FtsH_fam ATP-dependent metalloprotease FtsH. HflB( | 97.16 | |
| PRK08769 | 319 | DNA polymerase III subunit delta'; Validated | 97.15 | |
| PF05621 | 302 | TniB: Bacterial TniB protein; InterPro: IPR008868 | 97.13 | |
| PF12799 | 44 | LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ | 97.12 | |
| COG1373 | 398 | Predicted ATPase (AAA+ superfamily) [General funct | 97.12 | |
| PRK08181 | 269 | transposase; Validated | 97.06 | |
| PRK09183 | 259 | transposase/IS protein; Provisional | 97.01 | |
| smart00382 | 148 | AAA ATPases associated with a variety of cellular | 97.01 | |
| PRK06871 | 325 | DNA polymerase III subunit delta'; Validated | 97.0 | |
| TIGR01243 | 733 | CDC48 AAA family ATPase, CDC48 subfamily. This sub | 97.0 | |
| TIGR01243 | 733 | CDC48 AAA family ATPase, CDC48 subfamily. This sub | 96.99 | |
| COG5238 | 388 | RNA1 Ran GTPase-activating protein (RanGAP) involv | 96.99 | |
| PRK08058 | 329 | DNA polymerase III subunit delta'; Validated | 96.98 | |
| PRK06526 | 254 | transposase; Provisional | 96.98 | |
| KOG4579 | 177 | consensus Leucine-rich repeat (LRR) protein associ | 96.97 | |
| PRK10865 | 857 | protein disaggregation chaperone; Provisional | 96.95 | |
| KOG0744 | 423 | consensus AAA+-type ATPase [Posttranslational modi | 96.94 | |
| PRK10536 | 262 | hypothetical protein; Provisional | 96.94 | |
| COG0466 | 782 | Lon ATP-dependent Lon protease, bacterial type [Po | 96.92 | |
| PRK06090 | 319 | DNA polymerase III subunit delta'; Validated | 96.89 | |
| PF01695 | 178 | IstB_IS21: IstB-like ATP binding protein; InterPro | 96.89 | |
| PLN00020 | 413 | ribulose bisphosphate carboxylase/oxygenase activa | 96.89 | |
| KOG3665 | 699 | consensus ZYG-1-like serine/threonine protein kina | 96.88 | |
| TIGR00602 | 637 | rad24 checkpoint protein rad24. This family is bas | 96.88 | |
| KOG0741 | 744 | consensus AAA+-type ATPase [Posttranslational modi | 96.81 | |
| cd01133 | 274 | F1-ATPase_beta F1 ATP synthase beta subunit, nucle | 96.81 | |
| PRK11034 | 758 | clpA ATP-dependent Clp protease ATP-binding subuni | 96.8 | |
| TIGR02639 | 731 | ClpA ATP-dependent Clp protease ATP-binding subuni | 96.78 | |
| PRK00771 | 437 | signal recognition particle protein Srp54; Provisi | 96.76 | |
| PRK07993 | 334 | DNA polymerase III subunit delta'; Validated | 96.75 | |
| PRK11331 | 459 | 5-methylcytosine-specific restriction enzyme subun | 96.74 | |
| cd01131 | 198 | PilT Pilus retraction ATPase PilT. PilT is a nucle | 96.73 | |
| TIGR02640 | 262 | gas_vesic_GvpN gas vesicle protein GvpN. Members o | 96.71 | |
| TIGR03346 | 852 | chaperone_ClpB ATP-dependent chaperone ClpB. Membe | 96.71 | |
| KOG1644 | 233 | consensus U2-associated snRNP A' protein [RNA proc | 96.7 | |
| PRK10787 | 784 | DNA-binding ATP-dependent protease La; Provisional | 96.66 | |
| TIGR00763 | 775 | lon ATP-dependent protease La. This protein is ind | 96.65 | |
| KOG0733 | 802 | consensus Nuclear AAA ATPase (VCP subfamily) [Post | 96.64 | |
| PF10443 | 431 | RNA12: RNA12 protein; InterPro: IPR018850 Mitochon | 96.64 | |
| PRK13531 | 498 | regulatory ATPase RavA; Provisional | 96.62 | |
| PF13177 | 162 | DNA_pol3_delta2: DNA polymerase III, delta subunit | 96.6 | |
| KOG0735 | 952 | consensus AAA+-type ATPase [Posttranslational modi | 96.56 | |
| PF08357 | 150 | SEFIR: SEFIR domain; InterPro: IPR013568 This doma | 96.55 | |
| COG5238 | 388 | RNA1 Ran GTPase-activating protein (RanGAP) involv | 96.54 | |
| COG0542 | 786 | clpA ATP-binding subunits of Clp protease and DnaK | 96.53 | |
| PRK08118 | 167 | topology modulation protein; Reviewed | 96.49 | |
| PF07728 | 139 | AAA_5: AAA domain (dynein-related subfamily); Inte | 96.49 | |
| PRK06921 | 266 | hypothetical protein; Provisional | 96.47 | |
| PF02562 | 205 | PhoH: PhoH-like protein; InterPro: IPR003714 PhoH | 96.46 | |
| TIGR00959 | 428 | ffh signal recognition particle protein. This mode | 96.46 | |
| PRK11889 | 436 | flhF flagellar biosynthesis regulator FlhF; Provis | 96.44 | |
| COG1484 | 254 | DnaC DNA replication protein [DNA replication, rec | 96.44 | |
| PRK10867 | 433 | signal recognition particle protein; Provisional | 96.43 | |
| TIGR03345 | 852 | VI_ClpV1 type VI secretion ATPase, ClpV1 family. M | 96.4 | |
| PRK07261 | 171 | topology modulation protein; Provisional | 96.4 | |
| PF04665 | 241 | Pox_A32: Poxvirus A32 protein; InterPro: IPR006758 | 96.4 | |
| PRK06835 | 329 | DNA replication protein DnaC; Validated | 96.33 | |
| PHA00729 | 226 | NTP-binding motif containing protein | 96.32 | |
| PRK06964 | 342 | DNA polymerase III subunit delta'; Validated | 96.3 | |
| TIGR01425 | 429 | SRP54_euk signal recognition particle protein SRP5 | 96.29 | |
| PRK14974 | 336 | cell division protein FtsY; Provisional | 96.29 | |
| KOG1644 | 233 | consensus U2-associated snRNP A' protein [RNA proc | 96.27 | |
| CHL00095 | 821 | clpC Clp protease ATP binding subunit | 96.27 | |
| PRK12608 | 380 | transcription termination factor Rho; Provisional | 96.23 | |
| PRK10733 | 644 | hflB ATP-dependent metalloprotease; Reviewed | 96.2 | |
| KOG0730 | 693 | consensus AAA+-type ATPase [Posttranslational modi | 96.19 | |
| PF13207 | 121 | AAA_17: AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6 | 96.17 | |
| COG4608 | 268 | AppF ABC-type oligopeptide transport system, ATPas | 96.15 | |
| cd01120 | 165 | RecA-like_NTPases RecA-like NTPases. This family i | 96.11 | |
| cd00544 | 169 | CobU Adenosylcobinamide kinase / adenosylcobinamid | 96.07 | |
| COG1618 | 179 | Predicted nucleotide kinase [Nucleotide transport | 96.06 | |
| PRK06696 | 223 | uridine kinase; Validated | 96.05 | |
| TIGR02902 | 531 | spore_lonB ATP-dependent protease LonB. Members of | 96.02 | |
| PRK08939 | 306 | primosomal protein DnaI; Reviewed | 95.97 | |
| smart00763 | 361 | AAA_PrkA PrkA AAA domain. This is a family of PrkA | 95.96 | |
| PRK08699 | 325 | DNA polymerase III subunit delta'; Validated | 95.96 | |
| PRK04296 | 190 | thymidine kinase; Provisional | 95.94 | |
| COG0488 | 530 | Uup ATPase components of ABC transporters with dup | 95.92 | |
| COG0470 | 325 | HolB ATPase involved in DNA replication [DNA repli | 95.91 | |
| COG1223 | 368 | Predicted ATPase (AAA+ superfamily) [General funct | 95.84 | |
| KOG0728 | 404 | consensus 26S proteasome regulatory complex, ATPas | 95.82 | |
| PRK05541 | 176 | adenylylsulfate kinase; Provisional | 95.78 | |
| PRK04132 | 846 | replication factor C small subunit; Provisional | 95.77 | |
| TIGR00064 | 272 | ftsY signal recognition particle-docking protein F | 95.75 | |
| PRK09361 | 225 | radB DNA repair and recombination protein RadB; Pr | 95.71 | |
| KOG1514 | 767 | consensus Origin recognition complex, subunit 1, a | 95.71 | |
| COG2812 | 515 | DnaX DNA polymerase III, gamma/tau subunits [DNA r | 95.68 | |
| PF00448 | 196 | SRP54: SRP54-type protein, GTPase domain; InterPro | 95.66 | |
| KOG1947 | 482 | consensus Leucine rich repeat proteins, some prote | 95.66 | |
| cd01121 | 372 | Sms Sms (bacterial radA) DNA repair protein. This | 95.61 | |
| COG0542 | 786 | clpA ATP-binding subunits of Clp protease and DnaK | 95.59 | |
| cd01129 | 264 | PulE-GspE PulE/GspE The type II secretory pathway | 95.57 | |
| PRK05800 | 170 | cobU adenosylcobinamide kinase/adenosylcobinamide- | 95.54 | |
| KOG0731 | 774 | consensus AAA+-type ATPase containing the peptidas | 95.52 | |
| cd03221 | 144 | ABCF_EF-3 ABCF_EF-3 Elongation factor 3 (EF-3) is | 95.51 | |
| PRK15429 | 686 | formate hydrogenlyase transcriptional activator Fh | 95.5 | |
| PF14532 | 138 | Sigma54_activ_2: Sigma-54 interaction domain; PDB: | 95.48 | |
| TIGR02237 | 209 | recomb_radB DNA repair and recombination protein R | 95.48 | |
| PRK07667 | 193 | uridine kinase; Provisional | 95.48 | |
| KOG2228 | 408 | consensus Origin recognition complex, subunit 4 [R | 95.48 | |
| TIGR01420 | 343 | pilT_fam pilus retraction protein PilT. This model | 95.47 | |
| PRK06067 | 234 | flagellar accessory protein FlaH; Validated | 95.44 | |
| PRK05703 | 424 | flhF flagellar biosynthesis regulator FlhF; Valida | 95.4 | |
| PRK11608 | 326 | pspF phage shock protein operon transcriptional ac | 95.38 | |
| cd01394 | 218 | radB RadB. The archaeal protein radB shares simila | 95.27 | |
| KOG0734 | 752 | consensus AAA+-type ATPase containing the peptidas | 95.26 | |
| COG2884 | 223 | FtsE Predicted ATPase involved in cell division [C | 95.19 | |
| PRK12724 | 432 | flagellar biosynthesis regulator FlhF; Provisional | 95.19 | |
| KOG2739 | 260 | consensus Leucine-rich acidic nuclear protein [Cel | 95.19 | |
| cd03214 | 180 | ABC_Iron-Siderophores_B12_Hemin ABC transporters, | 95.17 | |
| cd01393 | 226 | recA_like RecA is a bacterial enzyme which has rol | 95.14 | |
| cd03222 | 177 | ABC_RNaseL_inhibitor The ABC ATPase RNase L inhibi | 95.14 | |
| COG1121 | 254 | ZnuC ABC-type Mn/Zn transport systems, ATPase comp | 95.13 | |
| TIGR01817 | 534 | nifA Nif-specific regulatory protein. This model r | 95.1 | |
| PRK12726 | 407 | flagellar biosynthesis regulator FlhF; Provisional | 95.1 | |
| KOG0743 | 457 | consensus AAA+-type ATPase [Posttranslational modi | 95.09 | |
| PRK05022 | 509 | anaerobic nitric oxide reductase transcription reg | 95.08 | |
| PRK14722 | 374 | flhF flagellar biosynthesis regulator FlhF; Provis | 95.08 | |
| PRK06762 | 166 | hypothetical protein; Provisional | 95.07 | |
| PF07726 | 131 | AAA_3: ATPase family associated with various cellu | 95.07 | |
| PF13604 | 196 | AAA_30: AAA domain; PDB: 1W36_G 3K70_G 3UPU_B 3GPL | 95.06 | |
| PF01583 | 156 | APS_kinase: Adenylylsulphate kinase; InterPro: IPR | 94.99 | |
| PF13671 | 143 | AAA_33: AAA domain; PDB: 1LTQ_A 2IA5_K 1RC8_A 1LY1 | 94.99 | |
| PRK10416 | 318 | signal recognition particle-docking protein FtsY; | 94.98 | |
| PF13238 | 129 | AAA_18: AAA domain; PDB: 3IIK_A 3IIJ_A 3IIL_A 1RKB | 94.95 | |
| cd03223 | 166 | ABCD_peroxisomal_ALDP Peroxisomal ATP-binding cass | 94.93 | |
| KOG0733 | 802 | consensus Nuclear AAA ATPase (VCP subfamily) [Post | 94.92 | |
| COG0464 | 494 | SpoVK ATPases of the AAA+ class [Posttranslational | 94.91 | |
| KOG1947 | 482 | consensus Leucine rich repeat proteins, some prote | 94.91 | |
| COG1066 | 456 | Sms Predicted ATP-dependent serine protease [Postt | 94.9 | |
| COG2607 | 287 | Predicted ATPase (AAA+ superfamily) [General funct | 94.89 | |
| KOG2123 | 388 | consensus Uncharacterized conserved protein [Funct | 94.85 | |
| TIGR02974 | 329 | phageshock_pspF psp operon transcriptional activat | 94.84 | |
| PF00485 | 194 | PRK: Phosphoribulokinase / Uridine kinase family; | 94.82 | |
| cd01858 | 157 | NGP_1 NGP-1. Autoantigen NGP-1 (Nucleolar G-protei | 94.82 | |
| TIGR01359 | 183 | UMP_CMP_kin_fam UMP-CMP kinase family. This subfam | 94.8 | |
| cd03216 | 163 | ABC_Carb_Monos_I This family represents the domain | 94.78 | |
| PF00406 | 151 | ADK: Adenylate kinase; InterPro: IPR000850 Adenyla | 94.77 | |
| KOG2123 | 388 | consensus Uncharacterized conserved protein [Funct | 94.76 | |
| PRK15455 | 644 | PrkA family serine protein kinase; Provisional | 94.7 | |
| cd03238 | 176 | ABC_UvrA The excision repair protein UvrA; Nucleot | 94.7 | |
| cd00561 | 159 | CobA_CobO_BtuR ATP:corrinoid adenosyltransferase B | 94.69 | |
| COG0572 | 218 | Udk Uridine kinase [Nucleotide transport and metab | 94.66 | |
| cd03229 | 178 | ABC_Class3 This class is comprised of all BPD (Bin | 94.63 | |
| KOG2739 | 260 | consensus Leucine-rich acidic nuclear protein [Cel | 94.63 | |
| TIGR00416 | 454 | sms DNA repair protein RadA. The gene protuct code | 94.63 | |
| KOG0651 | 388 | consensus 26S proteasome regulatory complex, ATPas | 94.6 | |
| PF07724 | 171 | AAA_2: AAA domain (Cdc48 subfamily); InterPro: IPR | 94.55 | |
| COG4088 | 261 | Predicted nucleotide kinase [Nucleotide transport | 94.53 | |
| PTZ00494 | 664 | tuzin-like protein; Provisional | 94.53 | |
| TIGR01650 | 327 | PD_CobS cobaltochelatase, CobS subunit. This model | 94.51 | |
| cd00267 | 157 | ABC_ATPase ABC (ATP-binding cassette) transporter | 94.49 | |
| COG1124 | 252 | DppF ABC-type dipeptide/oligopeptide/nickel transp | 94.49 | |
| PTZ00301 | 210 | uridine kinase; Provisional | 94.45 | |
| COG1120 | 258 | FepC ABC-type cobalamin/Fe3+-siderophores transpor | 94.44 | |
| COG1875 | 436 | NYN ribonuclease and ATPase of PhoH family domains | 94.43 | |
| PRK11823 | 446 | DNA repair protein RadA; Provisional | 94.41 | |
| PRK12727 | 559 | flagellar biosynthesis regulator FlhF; Provisional | 94.38 | |
| KOG2035 | 351 | consensus Replication factor C, subunit RFC3 [Cell | 94.35 | |
| cd01135 | 276 | V_A-ATPase_B V/A-type ATP synthase (non-catalytic) | 94.34 | |
| COG1136 | 226 | SalX ABC-type antimicrobial peptide transport syst | 94.34 | |
| KOG1969 | 877 | consensus DNA replication checkpoint protein CHL12 | 94.32 | |
| PRK10463 | 290 | hydrogenase nickel incorporation protein HypB; Pro | 94.31 | |
| cd03115 | 173 | SRP The signal recognition particle (SRP) mediates | 94.31 | |
| cd02019 | 69 | NK Nucleoside/nucleotide kinase (NK) is a protein | 94.26 | |
| TIGR02858 | 270 | spore_III_AA stage III sporulation protein AA. Mem | 94.2 | |
| cd03230 | 173 | ABC_DR_subfamily_A This family of ATP-binding prot | 94.2 | |
| PRK10820 | 520 | DNA-binding transcriptional regulator TyrR; Provis | 94.17 | |
| COG4618 | 580 | ArpD ABC-type protease/lipase transport system, AT | 94.13 | |
| PRK03839 | 180 | putative kinase; Provisional | 94.13 | |
| PF00910 | 107 | RNA_helicase: RNA helicase; InterPro: IPR000605 He | 94.11 | |
| PRK05480 | 209 | uridine/cytidine kinase; Provisional | 94.08 | |
| TIGR02012 | 321 | tigrfam_recA protein RecA. This model describes or | 94.06 | |
| PRK08233 | 182 | hypothetical protein; Provisional | 94.05 | |
| PF00437 | 270 | T2SE: Type II/IV secretion system protein; InterPr | 94.02 | |
| PRK04040 | 188 | adenylate kinase; Provisional | 94.02 | |
| KOG1970 | 634 | consensus Checkpoint RAD17-RFC complex, RAD17/RAD2 | 94.0 | |
| PRK12723 | 388 | flagellar biosynthesis regulator FlhF; Provisional | 93.99 | |
| KOG1051 | 898 | consensus Chaperone HSP104 and related ATP-depende | 93.99 | |
| cd00983 | 325 | recA RecA is a bacterial enzyme which has roles in | 93.97 | |
| PTZ00088 | 229 | adenylate kinase 1; Provisional | 93.95 | |
| TIGR00235 | 207 | udk uridine kinase. Model contains a number of lon | 93.94 | |
| PRK00625 | 173 | shikimate kinase; Provisional | 93.94 | |
| cd03283 | 199 | ABC_MutS-like MutS-like homolog in eukaryotes. The | 93.94 | |
| PRK06995 | 484 | flhF flagellar biosynthesis regulator FlhF; Valida | 93.92 | |
| COG0563 | 178 | Adk Adenylate kinase and related kinases [Nucleoti | 93.88 | |
| KOG0738 | 491 | consensus AAA+-type ATPase [Posttranslational modi | 93.82 | |
| PF00006 | 215 | ATP-synt_ab: ATP synthase alpha/beta family, nucle | 93.8 | |
| PRK14723 | 767 | flhF flagellar biosynthesis regulator FlhF; Provis | 93.73 | |
| PF03308 | 266 | ArgK: ArgK protein; InterPro: IPR005129 Bacterial | 93.73 | |
| cd01122 | 271 | GP4d_helicase GP4d_helicase is a homohexameric 5'- | 93.72 | |
| PF07725 | 20 | LRR_3: Leucine Rich Repeat; InterPro: IPR011713 Le | 93.69 | |
| PF08433 | 270 | KTI12: Chromatin associated protein KTI12 ; InterP | 93.68 | |
| PRK13543 | 214 | cytochrome c biogenesis protein CcmA; Provisional | 93.65 | |
| cd03237 | 246 | ABC_RNaseL_inhibitor_domain2 The ATPase domain 2 o | 93.62 | |
| cd01125 | 239 | repA Hexameric Replicative Helicase RepA. RepA is | 93.61 | |
| PRK12337 | 475 | 2-phosphoglycerate kinase; Provisional | 93.59 | |
| KOG0729 | 435 | consensus 26S proteasome regulatory complex, ATPas | 93.59 | |
| KOG0652 | 424 | consensus 26S proteasome regulatory complex, ATPas | 93.56 | |
| cd03246 | 173 | ABCC_Protease_Secretion This family represents the | 93.56 | |
| PF03969 | 362 | AFG1_ATPase: AFG1-like ATPase; InterPro: IPR005654 | 93.55 | |
| cd01130 | 186 | VirB11-like_ATPase Type IV secretory pathway compo | 93.55 | |
| PHA02244 | 383 | ATPase-like protein | 93.54 | |
| PRK00131 | 175 | aroK shikimate kinase; Reviewed | 93.52 | |
| cd03233 | 202 | ABC_PDR_domain1 The pleiotropic drug resistance (P | 93.5 | |
| PRK05973 | 237 | replicative DNA helicase; Provisional | 93.5 | |
| TIGR03499 | 282 | FlhF flagellar biosynthetic protein FlhF. | 93.48 | |
| PRK08356 | 195 | hypothetical protein; Provisional | 93.47 | |
| COG2274 | 709 | SunT ABC-type bacteriocin/lantibiotic exporters, c | 93.46 | |
| cd03247 | 178 | ABCC_cytochrome_bd The CYD subfamily implicated in | 93.46 | |
| KOG0062 | 582 | consensus ATPase component of ABC transporters wit | 93.43 | |
| TIGR02655 | 484 | circ_KaiC circadian clock protein KaiC. Members of | 93.43 | |
| PRK10923 | 469 | glnG nitrogen regulation protein NR(I); Provisiona | 93.41 | |
| TIGR02788 | 308 | VirB11 P-type DNA transfer ATPase VirB11. The VirB | 93.41 | |
| TIGR00150 | 133 | HI0065_YjeE ATPase, YjeE family. Members of this f | 93.39 | |
| COG1428 | 216 | Deoxynucleoside kinases [Nucleotide transport and | 93.37 | |
| TIGR03600 | 421 | phage_DnaB phage replicative helicase, DnaB family | 93.36 | |
| cd02027 | 149 | APSK Adenosine 5'-phosphosulfate kinase (APSK) cat | 93.34 | |
| cd03240 | 204 | ABC_Rad50 The catalytic domains of Rad50 are simil | 93.33 | |
| PRK06547 | 172 | hypothetical protein; Provisional | 93.32 | |
| PRK00889 | 175 | adenylylsulfate kinase; Provisional | 93.31 | |
| PRK07132 | 299 | DNA polymerase III subunit delta'; Validated | 93.31 | |
| TIGR02524 | 358 | dot_icm_DotB Dot/Icm secretion system ATPase DotB. | 93.3 | |
| PF03205 | 140 | MobB: Molybdopterin guanine dinucleotide synthesis | 93.26 | |
| PRK05439 | 311 | pantothenate kinase; Provisional | 93.26 | |
| PRK09280 | 463 | F0F1 ATP synthase subunit beta; Validated | 93.25 | |
| KOG2004 | 906 | consensus Mitochondrial ATP-dependent protease PIM | 93.24 | |
| PRK13947 | 171 | shikimate kinase; Provisional | 93.22 | |
| TIGR01360 | 188 | aden_kin_iso1 adenylate kinase, isozyme 1 subfamil | 93.19 | |
| TIGR00390 | 441 | hslU ATP-dependent protease HslVU, ATPase subunit. | 93.19 | |
| cd03228 | 171 | ABCC_MRP_Like The MRP (Mutidrug Resistance Protein | 93.17 | |
| TIGR03740 | 223 | galliderm_ABC gallidermin-class lantibiotic protec | 93.12 | |
| cd03281 | 213 | ABC_MSH5_euk MutS5 homolog in eukaryotes. The MutS | 93.12 | |
| COG0003 | 322 | ArsA Predicted ATPase involved in chromosome parti | 93.09 | |
| PRK12597 | 461 | F0F1 ATP synthase subunit beta; Provisional | 93.08 | |
| cd02028 | 179 | UMPK_like Uridine monophosphate kinase_like (UMPK_ | 93.05 | |
| COG0488 | 530 | Uup ATPase components of ABC transporters with dup | 93.03 | |
| cd03285 | 222 | ABC_MSH2_euk MutS2 homolog in eukaryotes. The MutS | 93.02 | |
| PRK03846 | 198 | adenylylsulfate kinase; Provisional | 93.0 | |
| TIGR03878 | 259 | thermo_KaiC_2 KaiC domain protein, AF_0795 family. | 92.99 | |
| TIGR00554 | 290 | panK_bact pantothenate kinase, bacterial type. Sho | 92.97 | |
| COG0468 | 279 | RecA RecA/RadA recombinase [DNA replication, recom | 92.96 | |
| TIGR02782 | 299 | TrbB_P P-type conjugative transfer ATPase TrbB. Th | 92.94 | |
| TIGR03574 | 249 | selen_PSTK L-seryl-tRNA(Sec) kinase, archaeal. Mem | 92.89 | |
| PF00560 | 22 | LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le | 92.87 | |
| TIGR01069 | 771 | mutS2 MutS2 family protein. Function of MutS2 is u | 92.85 | |
| cd00227 | 175 | CPT Chloramphenicol (Cm) phosphotransferase (CPT). | 92.84 | |
| PRK11388 | 638 | DNA-binding transcriptional regulator DhaR; Provis | 92.81 | |
| CHL00206 | 2281 | ycf2 Ycf2; Provisional | 92.8 | |
| TIGR01039 | 461 | atpD ATP synthase, F1 beta subunit. The sequences | 92.8 | |
| PF10236 | 309 | DAP3: Mitochondrial ribosomal death-associated pro | 92.8 | |
| PRK08972 | 444 | fliI flagellum-specific ATP synthase; Validated | 92.78 | |
| COG0465 | 596 | HflB ATP-dependent Zn proteases [Posttranslational | 92.77 | |
| PRK05201 | 443 | hslU ATP-dependent protease ATP-binding subunit Hs | 92.75 | |
| PRK14721 | 420 | flhF flagellar biosynthesis regulator FlhF; Provis | 92.69 | |
| PRK15115 | 444 | response regulator GlrR; Provisional | 92.68 | |
| COG3640 | 255 | CooC CO dehydrogenase maturation factor [Cell divi | 92.63 | |
| COG3910 | 233 | Predicted ATPase [General function prediction only | 92.62 | |
| COG0467 | 260 | RAD55 RecA-superfamily ATPases implicated in signa | 92.53 | |
| COG5635 | 824 | Predicted NTPase (NACHT family) [Signal transducti | 92.51 | |
| PRK09270 | 229 | nucleoside triphosphate hydrolase domain-containin | 92.51 | |
| cd02024 | 187 | NRK1 Nicotinamide riboside kinase (NRK) is an enzy | 92.51 | |
| cd03220 | 224 | ABC_KpsT_Wzt ABC_KpsT_Wzt The KpsT/Wzt ABC transpo | 92.5 | |
| cd00071 | 137 | GMPK Guanosine monophosphate kinase (GMPK, EC 2.7. | 92.47 | |
| COG4133 | 209 | CcmA ABC-type transport system involved in cytochr | 92.42 | |
| PRK13949 | 169 | shikimate kinase; Provisional | 92.4 | |
| PF00625 | 183 | Guanylate_kin: Guanylate kinase; InterPro: IPR0081 | 92.39 | |
| cd02025 | 220 | PanK Pantothenate kinase (PanK) catalyzes the phos | 92.39 | |
| COG0055 | 468 | AtpD F0F1-type ATP synthase, beta subunit [Energy | 92.38 | |
| PRK14528 | 186 | adenylate kinase; Provisional | 92.34 | |
| PF08423 | 256 | Rad51: Rad51; InterPro: IPR013632 This domain is f | 92.34 | |
| cd03284 | 216 | ABC_MutS1 MutS1 homolog in eukaryotes. The MutS pr | 92.34 | |
| cd01123 | 235 | Rad51_DMC1_radA Rad51_DMC1_radA,B. This group of r | 92.33 | |
| cd03217 | 200 | ABC_FeS_Assembly ABC-type transport system involve | 92.28 | |
| TIGR03877 | 237 | thermo_KaiC_1 KaiC domain protein, Ph0284 family. | 92.26 | |
| cd02023 | 198 | UMPK Uridine monophosphate kinase (UMPK, EC 2.7.1. | 92.25 | |
| PRK00279 | 215 | adk adenylate kinase; Reviewed | 92.24 | |
| cd01132 | 274 | F1_ATPase_alpha F1 ATP synthase alpha, central dom | 92.24 | |
| PF03266 | 168 | NTPase_1: NTPase; InterPro: IPR004948 This entry r | 92.22 | |
| PRK13948 | 182 | shikimate kinase; Provisional | 92.2 | |
| COG1102 | 179 | Cmk Cytidylate kinase [Nucleotide transport and me | 92.19 | |
| KOG3928 | 461 | consensus Mitochondrial ribosome small subunit com | 92.19 | |
| PRK06217 | 183 | hypothetical protein; Validated | 92.19 | |
| PRK08506 | 472 | replicative DNA helicase; Provisional | 92.19 | |
| PRK11174 | 588 | cysteine/glutathione ABC transporter membrane/ATP- | 92.14 | |
| cd03215 | 182 | ABC_Carb_Monos_II This family represents domain II | 92.11 | |
| PRK10751 | 173 | molybdopterin-guanine dinucleotide biosynthesis pr | 92.09 | |
| PRK13765 | 637 | ATP-dependent protease Lon; Provisional | 92.07 | |
| PF00158 | 168 | Sigma54_activat: Sigma-54 interaction domain; Inte | 92.03 | |
| cd02020 | 147 | CMPK Cytidine monophosphate kinase (CMPK) catalyze | 91.99 | |
| cd00464 | 154 | SK Shikimate kinase (SK) is the fifth enzyme in th | 91.98 | |
| cd03232 | 192 | ABC_PDR_domain2 The pleiotropic drug resistance-li | 91.96 | |
| TIGR02322 | 179 | phosphon_PhnN phosphonate metabolism protein/1,5-b | 91.96 | |
| cd03287 | 222 | ABC_MSH3_euk MutS3 homolog in eukaryotes. The MutS | 91.95 | |
| cd01857 | 141 | HSR1_MMR1 HSR1/MMR1. Human HSR1, is localized to t | 91.92 | |
| PF02374 | 305 | ArsA_ATPase: Anion-transporting ATPase; PDB: 2WOO_ | 91.89 | |
| PRK13946 | 184 | shikimate kinase; Provisional | 91.89 | |
| KOG1532 | 366 | consensus GTPase XAB1, interacts with DNA repair p | 91.89 | |
| COG2842 | 297 | Uncharacterized ATPase, putative transposase [Gene | 91.89 | |
| COG1703 | 323 | ArgK Putative periplasmic protein kinase ArgK and | 91.86 | |
| smart00534 | 185 | MUTSac ATPase domain of DNA mismatch repair MUTS f | 91.83 | |
| PRK14529 | 223 | adenylate kinase; Provisional | 91.82 | |
| KOG4308 | 478 | consensus LRR-containing protein [Function unknown | 91.75 | |
| KOG0736 | 953 | consensus Peroxisome assembly factor 2 containing | 91.72 | |
| cd02021 | 150 | GntK Gluconate kinase (GntK) catalyzes the phospho | 91.71 | |
| CHL00059 | 485 | atpA ATP synthase CF1 alpha subunit | 91.71 | |
| TIGR02915 | 445 | PEP_resp_reg putative PEP-CTERM system response re | 91.7 | |
| PRK14526 | 211 | adenylate kinase; Provisional | 91.7 | |
| TIGR02533 | 486 | type_II_gspE general secretory pathway protein E. | 91.7 | |
| cd04121 | 189 | Rab40 Rab40 subfamily. This subfamily contains Rab | 91.67 | |
| PRK08927 | 442 | fliI flagellum-specific ATP synthase; Validated | 91.65 | |
| PRK12339 | 197 | 2-phosphoglycerate kinase; Provisional | 91.62 | |
| COG3854 | 308 | SpoIIIAA ncharacterized protein conserved in bacte | 91.61 | |
| PF12775 | 272 | AAA_7: P-loop containing dynein motor region D3; P | 91.61 | |
| PF06068 | 398 | TIP49: TIP49 C-terminus; InterPro: IPR010339 This | 91.61 | |
| COG1936 | 180 | Predicted nucleotide kinase (related to CMP and AM | 91.59 | |
| PRK05057 | 172 | aroK shikimate kinase I; Reviewed | 91.59 | |
| COG0194 | 191 | Gmk Guanylate kinase [Nucleotide transport and met | 91.59 | |
| PRK14493 | 274 | putative bifunctional molybdopterin-guanine dinucl | 91.56 |
| >PLN03210 Resistant to P | Back alignment and domain information |
|---|
Probab=100.00 E-value=1.4e-143 Score=1419.94 Aligned_cols=1054 Identities=34% Similarity=0.574 Sum_probs=867.8
Q ss_pred CCCCCC--CCCcccEEEccccccCCCchHHHHHHHHhhcCCcceEecCCCCCCCCCchHHHHHHhhccceEEEEeccCcc
Q 000780 1 MASSSS--SSGNYEVFLNFRGEDTRTSFTCHLYDNLYERKKIRTFIDDEGLRRGDEISPALLNAIQGSKISVVIFSKDYA 78 (1288)
Q Consensus 1 m~~s~~--~~~~~dvfis~~~~d~r~~~~~~l~~~l~~~~g~~~~~d~~~~~~g~~~~~~l~~ai~~s~~~i~v~S~~y~ 78 (1288)
||+||| +.|+||||+||||+|||++|++|||++| +++||++|+|++ +++|+.|++++.+||++||++|||||++||
T Consensus 1 ~~~~~~~~~~~~~~vf~sfrg~d~r~~f~~hl~~~l-~~~~i~~f~d~~-~~~g~~~~~~l~~~i~~s~~~ivv~s~~ya 78 (1153)
T PLN03210 1 MASSSSSSRNWVYDVFPSFSGEDVRITFLSHFLKEL-DRKLIIAFKDNE-IERSQSLDPELKQAIRDSRIAVVVFSKNYA 78 (1153)
T ss_pred CCCCCCCCCCCCCcEEeeCCCcccccCHHHHHHHHH-HHCCCeEEccCC-ccCCCcccHHHHHHHHhCeEEEEEecCCcc
Confidence 676654 7899999999999999999999999999 999999999985 999999999999999999999999999999
Q ss_pred cchhhHHHHHHHHHHhhcCCcEEEEEEeecCCccccccccchHHHHHHHHHHhCCChHHHHHHHHHHHhccccCCCCCcc
Q 000780 79 SSKWCLHELLKILECKKMKGQIIIPVFYGVSPSDVRHQNGTFGDGFDELKKQFQDKPEMVLKWRDALTETSHLAGHESAK 158 (1288)
Q Consensus 79 ~s~wcl~El~~i~~~~~~~~~~v~Pvfy~v~p~~vr~~~~~~~~~~~~~~~~~~~~~~~~~~w~~al~~~~~~~g~~~~~ 158 (1288)
+|+|||+||++|++|++.++++|+||||+|||+|||+|+|+||+||++++++ ...+++++||+||++||+++|| +..
T Consensus 79 ~s~wcl~el~~i~~~~~~~~~~v~pvfy~v~p~~v~~~~g~f~~~f~~~~~~--~~~~~~~~w~~al~~~~~~~g~-~~~ 155 (1153)
T PLN03210 79 SSSWCLNELLEIVRCKEELGQLVIPVFYGLDPSHVRKQTGDFGEAFEKTCQN--KTEDEKIQWKQALTDVANILGY-HSQ 155 (1153)
T ss_pred cchHHHHHHHHHHHhhhhcCceEEEEEecccHHHHhhccchHHHHHHHHhcc--cchhHHHHHHHHHHHHhCcCce-ecC
Confidence 9999999999999999999999999999999999999999999999998875 4678999999999999999999 665
Q ss_pred C-CChHHHHHHHHHHHHHhccccccccCCCCCcccchhhHHHHHHhhccCCCCCceEEEEEecCCchHHHHHHHHHHHhh
Q 000780 159 F-RHDAQLVNKIVEDVLKKLEKITVSTDSSNGLVGLNSRIEQIKPFLCMDSSDTVQIVGIWGMGGIGKTTLAKAIFDQFS 237 (1288)
Q Consensus 159 ~-~~e~~~i~~i~~~v~~~l~~~~~~~~~~~~~vGr~~~~~~l~~~L~~~~~~~~~vv~I~G~gGiGKTtLA~~~~~~~~ 237 (1288)
. ++|+++|++||++|+++++. +++.+.+++|||+.+++++.++|..+. +++++|+|||||||||||||+++|+++.
T Consensus 156 ~~~~E~~~i~~Iv~~v~~~l~~--~~~~~~~~~vG~~~~l~~l~~lL~l~~-~~~~vvgI~G~gGiGKTTLA~~l~~~l~ 232 (1153)
T PLN03210 156 NWPNEAKMIEEIANDVLGKLNL--TPSNDFEDFVGIEDHIAKMSSLLHLES-EEVRMVGIWGSSGIGKTTIARALFSRLS 232 (1153)
T ss_pred CCCCHHHHHHHHHHHHHHhhcc--ccCcccccccchHHHHHHHHHHHcccc-CceEEEEEEcCCCCchHHHHHHHHHHHh
Confidence 4 89999999999999999988 788888999999999999999998766 7899999999999999999999999999
Q ss_pred cccceeEEeeec--cccc---c-----cCCChHHHHHHHHhhhcCc-cccccCCCchhHHHHHHhcceEEEEeccCCChH
Q 000780 238 HEFEGSCFVSDV--RGNS---E-----TAGGLEHLQKQMLSTTLSE-KLEVAGPNIPHFTKERVRRMKLLIVLDDVNEVG 306 (1288)
Q Consensus 238 ~~F~~~~~~~~~--~~~~---~-----~~~~l~~l~~~ll~~l~~~-~~~~~~~~~~~~l~~~l~~k~~LlVLDdv~~~~ 306 (1288)
.+|++.+|+.+. +... . .......++++++.++... ..... ....++++++++|+||||||||+.+
T Consensus 233 ~~F~g~vfv~~~~v~~~~~~~~~~~~~~~~~~~~l~~~~l~~il~~~~~~~~---~~~~~~~~L~~krvLLVLDdv~~~~ 309 (1153)
T PLN03210 233 RQFQSSVFIDRAFISKSMEIYSSANPDDYNMKLHLQRAFLSEILDKKDIKIY---HLGAMEERLKHRKVLIFIDDLDDQD 309 (1153)
T ss_pred hcCCeEEEeeccccccchhhcccccccccchhHHHHHHHHHHHhCCCCcccC---CHHHHHHHHhCCeEEEEEeCCCCHH
Confidence 999999998642 1110 0 0011235666666663322 11111 1256889999999999999999999
Q ss_pred HHHHHHhccCCCCCCcEEEEEcCChhHHhhhCCccceEEEcCCCCHHHHHHHHhhhhcCCCCCCchHHHHHHHHHhhhcC
Q 000780 307 QLKRLIGELDQFGQGSRIVVTTRDKRVLEKFRGEEKKIYRVNGLEFEEAFEHFCNFAFKENHCPEDLNWHSRSVVSYTKG 386 (1288)
Q Consensus 307 ~~~~l~~~l~~~~~gsrIivTTR~~~v~~~~~~~~~~~~~l~~L~~~ea~~Lf~~~af~~~~~~~~~~~l~~~i~~~~~G 386 (1288)
+|+.+.+...|+++||+||||||+++++..++ ..++|+|+.|+++||++||+++||++..+++++.+++++|+++|+|
T Consensus 310 ~l~~L~~~~~~~~~GsrIIiTTrd~~vl~~~~--~~~~~~v~~l~~~ea~~LF~~~Af~~~~~~~~~~~l~~~iv~~c~G 387 (1153)
T PLN03210 310 VLDALAGQTQWFGSGSRIIVITKDKHFLRAHG--IDHIYEVCLPSNELALEMFCRSAFKKNSPPDGFMELASEVALRAGN 387 (1153)
T ss_pred HHHHHHhhCccCCCCcEEEEEeCcHHHHHhcC--CCeEEEecCCCHHHHHHHHHHHhcCCCCCcHHHHHHHHHHHHHhCC
Confidence 99999998899999999999999999998776 6789999999999999999999999888888899999999999999
Q ss_pred CchhHHHHhhhcCCCCHHHHHHHhhhhhhcCccchhhHHHHHHhhhcCCCh-hhHHHhhhcccccCCCChhHHHHHhhhh
Q 000780 387 NPLVLEVLGSSLCLKRKSHWGKVLHDLNRICESEIHDIYDILKISFNKLTP-RVKSIFLDIACFFEGEDKDFVASILDDS 465 (1288)
Q Consensus 387 lPLal~~lg~~L~~~~~~~w~~~l~~l~~~~~~~~~~i~~~l~~sy~~L~~-~~k~~fl~~a~f~~~~~~~~~~~~l~~~ 465 (1288)
+||||+++|+.|++++..+|+.+++++++.++.++ .++|++||++|++ .+|.||++|||||.+.+.+.+..+++++
T Consensus 388 LPLAl~vlgs~L~~k~~~~W~~~l~~L~~~~~~~I---~~~L~~SYd~L~~~~~k~~Fl~ia~ff~~~~~~~v~~~l~~~ 464 (1153)
T PLN03210 388 LPLGLNVLGSYLRGRDKEDWMDMLPRLRNGLDGKI---EKTLRVSYDGLNNKKDKAIFRHIACLFNGEKVNDIKLLLANS 464 (1153)
T ss_pred CcHHHHHHHHHHcCCCHHHHHHHHHHHHhCccHHH---HHHHHHhhhccCccchhhhhheehhhcCCCCHHHHHHHHHhc
Confidence 99999999999999999999999999988766555 9999999999976 5999999999999999999999988876
Q ss_pred ---hhhhhHHhhcCcCeeEeCCEEEecHHHHHHHHHHhhccccCCCCCcccccChhhhhhhhccCCcccccccccccccc
Q 000780 466 ---ESDVLDILIDKSLVSISGNFLNMHDILQEMGRQIVRQESEKEPGKRSRLWDPKEISRVLKHNKGTDAIEGIFLDLSK 542 (1288)
Q Consensus 466 ---~~~~l~~L~~~sLi~~~~~~~~mHdll~~~~~~i~~~e~~~~~~~~~rl~~~~di~~~l~~~~~~~~v~~i~ldls~ 542 (1288)
+..+++.|+++|||+...++++|||++|+||++++++++ .+|++|+|+|+++|++.++..++|+..+++|++|+++
T Consensus 465 ~~~~~~~l~~L~~ksLi~~~~~~~~MHdLl~~~~r~i~~~~~-~~~~~r~~l~~~~di~~vl~~~~g~~~v~~i~l~~~~ 543 (1153)
T PLN03210 465 DLDVNIGLKNLVDKSLIHVREDIVEMHSLLQEMGKEIVRAQS-NEPGEREFLVDAKDICDVLEDNTGTKKVLGITLDIDE 543 (1153)
T ss_pred CCCchhChHHHHhcCCEEEcCCeEEhhhHHHHHHHHHHHhhc-CCCCcceeEeCHHHHHHHHHhCcccceeeEEEeccCc
Confidence 667899999999999999999999999999999999997 7899999999999999999999999999999999999
Q ss_pred ccccccCchhhcCCCCCcEEEEeCCcccccccCCCCchhhhccccccccCCCCCCCCCCcceEEeCCCCCCCCCCCCCCC
Q 000780 543 IKGINLDPRAFTNMSNLRLFKFYVPKFYEIEKLPSMSTEEQLSYSKVQLPNGLDYLPKKLRYLHWDTYPLRTLPSNFKPK 622 (1288)
Q Consensus 543 ~~~~~~~~~~f~~l~~Lr~L~l~~n~~~~i~~l~~l~~l~~~~~~~~~l~~~~~~l~~~Lr~L~l~~~~l~~lp~~~~l~ 622 (1288)
.....+...+|.+|++|++|+++.+.+.. ......++|.++..+|.+||+|+|.+|+++++|..|.+.
T Consensus 544 ~~~~~i~~~aF~~m~~L~~L~~~~~~~~~------------~~~~~~~lp~~~~~lp~~Lr~L~~~~~~l~~lP~~f~~~ 611 (1153)
T PLN03210 544 IDELHIHENAFKGMRNLLFLKFYTKKWDQ------------KKEVRWHLPEGFDYLPPKLRLLRWDKYPLRCMPSNFRPE 611 (1153)
T ss_pred cceeeecHHHHhcCccccEEEEecccccc------------cccceeecCcchhhcCcccEEEEecCCCCCCCCCcCCcc
Confidence 99899999999999999999998764211 112345789999999999999999999999999999999
Q ss_pred CceEEecCCCccccCCCCCccccCcccccccccceecccCccCccccCCCCCcCCCcEEEecCCcCCcccCCcccCceee
Q 000780 623 NLVELNLRCSKVEQPWEGEKACVPSSIQNFKYLSALSFKGCQSLRSFPSNLHFVCPVTINFSYCVNLIEFPQISGKVTRL 702 (1288)
Q Consensus 623 ~L~~L~L~~n~i~~lw~~~~~~~p~~l~~l~~L~~L~L~~~~~l~~lp~~~~~~~L~~L~L~~~~~l~~~p~~~~~L~~L 702 (1288)
+|++|+|++|+++.+|.+ +..+++|+.|+|++|..++.+|....+++|+.|++++|..+
T Consensus 612 ~L~~L~L~~s~l~~L~~~--------~~~l~~Lk~L~Ls~~~~l~~ip~ls~l~~Le~L~L~~c~~L------------- 670 (1153)
T PLN03210 612 NLVKLQMQGSKLEKLWDG--------VHSLTGLRNIDLRGSKNLKEIPDLSMATNLETLKLSDCSSL------------- 670 (1153)
T ss_pred CCcEEECcCccccccccc--------cccCCCCCEEECCCCCCcCcCCccccCCcccEEEecCCCCc-------------
Confidence 999999999999998655 45799999999999988998887667778888888887554
Q ss_pred cCCCccccccCccccccCcccEEEcccCcCccccccccccccccceeeecCccCCCCcchhhhhccccceeecccccCcc
Q 000780 703 YLGQSAIEEVPSSIECLTDLEVLDLRGCKRLKRISTSFCKLRSLVTLILLGCLNLEHFPEILEKMEHLKRIYSDRTPITE 782 (1288)
Q Consensus 703 ~L~~~~l~~lp~~i~~l~~L~~L~Ls~~~~l~~lp~~l~~l~~L~~L~L~~~~~~~~~p~~l~~l~~L~~L~l~~~~i~~ 782 (1288)
..+|.+++++++|+.|++++|..++.+|..+ ++++|+.|++++|..++.+|.. ..+|+.|++++|.+..
T Consensus 671 -------~~lp~si~~L~~L~~L~L~~c~~L~~Lp~~i-~l~sL~~L~Lsgc~~L~~~p~~---~~nL~~L~L~~n~i~~ 739 (1153)
T PLN03210 671 -------VELPSSIQYLNKLEDLDMSRCENLEILPTGI-NLKSLYRLNLSGCSRLKSFPDI---STNISWLDLDETAIEE 739 (1153)
T ss_pred -------cccchhhhccCCCCEEeCCCCCCcCccCCcC-CCCCCCEEeCCCCCCccccccc---cCCcCeeecCCCcccc
Confidence 4566778889999999999999999999876 8999999999999988888865 4678999999999999
Q ss_pred cCcccCCCCCCcEEEeccCCCCC-------CCCCcCCCCchHHHHhhcccC-CccCCcccccCCCCcEEEcCCCCCCCcc
Q 000780 783 LPSSFENLPGLEVLFVEDCSKLD-------NLPDNIGSLEYLYYILAAASA-ISQLPSSVALSNMLRSLDSSHCKGLESF 854 (1288)
Q Consensus 783 lp~~l~~l~~L~~L~L~~~~~~~-------~lp~~l~~l~~L~~L~l~~~~-l~~lp~~l~~l~~L~~L~L~~~~~~~~~ 854 (1288)
+|..+ .+++|+.|.+.++.... ..+......++|+.|++++|. +..+|.+++.+++|+.|++++|..++.+
T Consensus 740 lP~~~-~l~~L~~L~l~~~~~~~l~~~~~~l~~~~~~~~~sL~~L~Ls~n~~l~~lP~si~~L~~L~~L~Ls~C~~L~~L 818 (1153)
T PLN03210 740 FPSNL-RLENLDELILCEMKSEKLWERVQPLTPLMTMLSPSLTRLFLSDIPSLVELPSSIQNLHKLEHLEIENCINLETL 818 (1153)
T ss_pred ccccc-cccccccccccccchhhccccccccchhhhhccccchheeCCCCCCccccChhhhCCCCCCEEECCCCCCcCee
Confidence 99876 68889999888754321 111122335789999999984 5689999999999999999999888888
Q ss_pred ccccccCCCCCcEEEecCCCCC-CCchhhcCCCCCcEEEccCCCCccCchhhhcCCCCCEEEecCCCCCCccCCcC---c
Q 000780 855 PRTFLLGLSAMGLLHISDYAVR-EIPQEIAYLSSLEILYLSGNNFESLPAIIKQMSQLRFIHLEDFNMLQSLPELP---L 930 (1288)
Q Consensus 855 ~~~~~~~~~~L~~L~L~~~~l~-~lp~~l~~l~~L~~L~Ls~n~l~~lp~~l~~l~~L~~L~L~~~~~l~~lp~~~---~ 930 (1288)
|... .+++|+.|++++|... .+|.. .++|+.|+|++|.++.+|.++..+++|+.|+|++|+.+..+|..+ +
T Consensus 819 P~~~--~L~sL~~L~Ls~c~~L~~~p~~---~~nL~~L~Ls~n~i~~iP~si~~l~~L~~L~L~~C~~L~~l~~~~~~L~ 893 (1153)
T PLN03210 819 PTGI--NLESLESLDLSGCSRLRTFPDI---STNISDLNLSRTGIEEVPWWIEKFSNLSFLDMNGCNNLQRVSLNISKLK 893 (1153)
T ss_pred CCCC--CccccCEEECCCCCcccccccc---ccccCEeECCCCCCccChHHHhcCCCCCEEECCCCCCcCccCccccccc
Confidence 7653 6899999999998543 46542 478999999999999999999999999999999999988887533 3
Q ss_pred cccEEEeeCCCCCCccCCCCCCcceeeccCCCCcCCCCCCCCCCcEEeccCCCCccCCCCCCCcccEEecccccCcCccc
Q 000780 931 CLKYLHLIDCKMLQSLPVLPFCLESLDLTGCNMLRSLPELPLCLQYLNLEDCNMLRSLPELPLCLQLLTVRNCNRLQSLP 1010 (1288)
Q Consensus 931 ~L~~L~l~~c~~l~~~~~~~~~L~~L~Ls~n~~~~~l~~~~~~L~~L~Ls~n~~l~~lp~~~~sL~~L~l~~c~~l~~lp 1010 (1288)
+|+.|++++|..+..++.. +++ . ....+.++. .
T Consensus 894 ~L~~L~l~~C~~L~~~~l~----------~~~------------------------------~--~~~~~~~n~-~---- 926 (1153)
T PLN03210 894 HLETVDFSDCGALTEASWN----------GSP------------------------------S--EVAMATDNI-H---- 926 (1153)
T ss_pred CCCeeecCCCcccccccCC----------CCc------------------------------h--hhhhhcccc-c----
Confidence 4444555555544332210 000 0 000000000 0
Q ss_pred hhhhcCCCcchhhhhhhccCCCCCCcCcccccccccceeccCccccChhhhhhhhHHHHHHHHHHHHHHhhhhhhHHhhh
Q 000780 1011 EILLCLQELDASVLEKLSKHSPDLQWAPESLKSAAICFEFTNCLKLNGKANNKILADSLLRIRHMAIASLRLGYEMAINE 1090 (1288)
Q Consensus 1011 ~~l~~L~~L~~l~l~~l~~~~p~l~~~p~~l~~~l~~l~~~nC~~L~~~~~~~i~~~~~~~~~~~~~~~~~~~~~~~~~~ 1090 (1288)
. .+| ....+.|.||.+|++++|..- +
T Consensus 927 ------------------~------~~p-----~~~~l~f~nC~~L~~~a~l~~--------~----------------- 952 (1153)
T PLN03210 927 ------------------S------KLP-----STVCINFINCFNLDQEALLQQ--------Q----------------- 952 (1153)
T ss_pred ------------------c------cCC-----chhccccccccCCCchhhhcc--------c-----------------
Confidence 0 011 123468899999998775210 0
Q ss_pred hcccccceEEEecCCCCcCCcccCCCCceEE-EEcCCCCCCCCccceEEEEEeccCCCCCccccccceeeEEEEEEEEcc
Q 000780 1091 KLSELRGSLIVLPGSEIPDWFSNQSSGSSIC-IQLPPHSSCRNLIGFAFCAVLDSKKVDSDCFRYFYVSFQFDLEIKTLS 1169 (1288)
Q Consensus 1091 ~~~~~~~~~~~~pg~~iP~wf~~~~~g~~i~-i~l~~~~~~~~~~gf~~c~v~~~~~~~~~~~~~~~~~~~~~~~c~~~~ 1169 (1288)
. ....+++||.+||+||.||+.|+++| |++|++|++..|+||++|+|+++...... ...+.+.|.|++.+
T Consensus 953 ~----~~~~~~l~g~evp~~f~hr~~g~sl~~i~l~~~~~~~~~~~f~~c~v~~~~~~~~~-----~~~~~~~~~c~~~~ 1023 (1153)
T PLN03210 953 S----IFKQLILSGEEVPSYFTHRTTGASLTNIPLLHISPCQPFFRFRACAVVDSESFFII-----SVSFDIQVCCRFID 1023 (1153)
T ss_pred c----cceEEECCCccCchhccCCcccceeeeeccCCcccCCCccceEEEEEEecCccccC-----CCceeEEEEEEEEC
Confidence 0 12237899999999999999999998 99999999888999999999987764322 23468899998876
Q ss_pred CCCccccccccccccCcccCCeEEEEEEec---------CcccC----CC--CCeeeEEEEEEEeccCceEEEeecceEe
Q 000780 1170 ETKHVDLGYNSRYIEDLIDSDRVILGFKPC---------LNVGF----PD--GYHHTIATFKFFAERKFYKIKRCGLCPV 1234 (1288)
Q Consensus 1170 ~~~~~~~~~~~~~~~~~~~sdHv~l~y~~~---------~~~~~----~~--~~~~~~~sf~f~~~~~~~~vk~CGv~lv 1234 (1288)
..+... ..+.++|+|+.|... ..... .. .|++..+.|+|+.....++||+|||+++
T Consensus 1024 ~~~~~~---------~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~f~~~~~~~~~~~~~cg~~~~ 1094 (1153)
T PLN03210 1024 RLGNHF---------DSPYQPHVFSVTKKGSHLVIFDCCFPLNEDNAPLAELNYDHVDIQFRLTNKNSQLKLKGCGIRLS 1094 (1153)
T ss_pred CCCCcc---------ccCCCceeEeeeccccceEEecccccccccccchhccCCceeeEEEEEecCCCCeEEEeeeEEEe
Confidence 533211 012345555444432 11000 11 2344445555555444579999999999
Q ss_pred ecCCCC
Q 000780 1235 YANPSE 1240 (1288)
Q Consensus 1235 y~~~~~ 1240 (1288)
|+.+..
T Consensus 1095 ~~~~~~ 1100 (1153)
T PLN03210 1095 EDDSSL 1100 (1153)
T ss_pred ccCCCc
Confidence 966554
|
syringae 6; Provisional |
| >KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PLN03194 putative disease resistance protein; Provisional | Back alignment and domain information |
|---|
| >PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional | Back alignment and domain information |
|---|
| >PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional | Back alignment and domain information |
|---|
| >PF00931 NB-ARC: NB-ARC domain; InterPro: IPR002182 This is the NB-ARC domain, a novel signalling motif found in bacteria and eukaryotes, shared by plant resistance gene products and regulators of cell death in animals [] | Back alignment and domain information |
|---|
| >KOG0472 consensus Leucine-rich repeat protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0472 consensus Leucine-rich repeat protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PLN03210 Resistant to P | Back alignment and domain information |
|---|
| >KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF01582 TIR: TIR domain; InterPro: IPR000157 In Drosophila melanogaster the Toll protein is involved in establishment of dorso-ventral polarity in the embryo | Back alignment and domain information |
|---|
| >PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional | Back alignment and domain information |
|---|
| >PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional | Back alignment and domain information |
|---|
| >smart00255 TIR Toll - interleukin 1 - resistance | Back alignment and domain information |
|---|
| >PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional | Back alignment and domain information |
|---|
| >PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional | Back alignment and domain information |
|---|
| >KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily | Back alignment and domain information |
|---|
| >PF13676 TIR_2: TIR domain; PDB: 3H16_B 3UB4_A 2Y92_A 3UB3_A 3UB2_A | Back alignment and domain information |
|---|
| >cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily | Back alignment and domain information |
|---|
| >PRK04841 transcriptional regulator MalT; Provisional | Back alignment and domain information |
|---|
| >KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PRK00411 cdc6 cell division control protein 6; Reviewed | Back alignment and domain information |
|---|
| >TIGR00635 ruvB Holliday junction DNA helicase, RuvB subunit | Back alignment and domain information |
|---|
| >KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] | Back alignment and domain information |
|---|
| >PF01637 Arch_ATPase: Archaeal ATPase; InterPro: IPR011579 This domain has been found in a number of bacterial and archaeal proteins, all of which contain a conserved P-loop motif that is involved in binding ATP | Back alignment and domain information |
|---|
| >PRK00080 ruvB Holliday junction DNA helicase RuvB; Reviewed | Back alignment and domain information |
|---|
| >COG3899 Predicted ATPase [General function prediction only] | Back alignment and domain information |
|---|
| >KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >TIGR02928 orc1/cdc6 family replication initiation protein | Back alignment and domain information |
|---|
| >COG2909 MalT ATP-dependent transcriptional regulator [Transcription] | Back alignment and domain information |
|---|
| >TIGR03015 pepcterm_ATPase putative secretion ATPase, PEP-CTERM locus subfamily | Back alignment and domain information |
|---|
| >PF05729 NACHT: NACHT domain | Back alignment and domain information |
|---|
| >PRK15386 type III secretion protein GogB; Provisional | Back alignment and domain information |
|---|
| >COG4886 Leucine-rich repeat (LRR) protein [Function unknown] | Back alignment and domain information |
|---|
| >COG4886 Leucine-rich repeat (LRR) protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] | Back alignment and domain information |
|---|
| >COG2256 MGS1 ATPase related to the helicase subunit of the Holliday junction resolvase [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PRK13342 recombination factor protein RarA; Reviewed | Back alignment and domain information |
|---|
| >PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A | Back alignment and domain information |
|---|
| >PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A | Back alignment and domain information |
|---|
| >PRK06893 DNA replication initiation factor; Validated | Back alignment and domain information |
|---|
| >PRK15386 type III secretion protein GogB; Provisional | Back alignment and domain information |
|---|
| >PTZ00202 tuzin; Provisional | Back alignment and domain information |
|---|
| >COG3903 Predicted ATPase [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR03420 DnaA_homol_Hda DnaA regulatory inactivator Hda | Back alignment and domain information |
|---|
| >KOG3678 consensus SARM protein (with sterile alpha and armadillo motifs) [Extracellular structures] | Back alignment and domain information |
|---|
| >PTZ00112 origin recognition complex 1 protein; Provisional | Back alignment and domain information |
|---|
| >PF13173 AAA_14: AAA domain | Back alignment and domain information |
|---|
| >PRK07471 DNA polymerase III subunit delta'; Validated | Back alignment and domain information |
|---|
| >PLN03150 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PF05496 RuvB_N: Holliday junction DNA helicase ruvB N-terminus; InterPro: IPR008824 The RuvB protein makes up part of the RuvABC revolvasome which catalyses the resolution of Holliday junctions that arise during genetic recombination and DNA repair | Back alignment and domain information |
|---|
| >PRK12402 replication factor C small subunit 2; Reviewed | Back alignment and domain information |
|---|
| >TIGR01242 26Sp45 26S proteasome subunit P45 family | Back alignment and domain information |
|---|
| >PRK14961 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK07003 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >PRK14963 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK14949 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK14960 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PF13191 AAA_16: AAA ATPase domain; PDB: 2V1U_A | Back alignment and domain information |
|---|
| >KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PLN03150 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >cd00009 AAA The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold | Back alignment and domain information |
|---|
| >PRK12323 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PLN03025 replication factor C subunit; Provisional | Back alignment and domain information |
|---|
| >PRK05564 DNA polymerase III subunit delta'; Validated | Back alignment and domain information |
|---|
| >KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK00440 rfc replication factor C small subunit; Reviewed | Back alignment and domain information |
|---|
| >PRK13341 recombination factor protein RarA/unknown domain fusion protein; Reviewed | Back alignment and domain information |
|---|
| >PRK09112 DNA polymerase III subunit delta'; Validated | Back alignment and domain information |
|---|
| >PRK04195 replication factor C large subunit; Provisional | Back alignment and domain information |
|---|
| >KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF13401 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S_B | Back alignment and domain information |
|---|
| >COG1474 CDC6 Cdc6-related protein, AAA superfamily ATPase [DNA replication, recombination, and repair / Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK14957 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PF14516 AAA_35: AAA-like domain | Back alignment and domain information |
|---|
| >PRK06645 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >PRK08691 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >PRK07940 DNA polymerase III subunit delta'; Validated | Back alignment and domain information |
|---|
| >PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A | Back alignment and domain information |
|---|
| >PRK14962 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK08727 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >PF00308 Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013317 This entry represents the central domain of bacterial DnaA proteins [, , ] that play an important role in initiating and regulating chromosomal replication | Back alignment and domain information |
|---|
| >PRK08903 DnaA regulatory inactivator Hda; Validated | Back alignment and domain information |
|---|
| >PRK14956 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK07994 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >PRK08084 DNA replication initiation factor; Provisional | Back alignment and domain information |
|---|
| >TIGR00678 holB DNA polymerase III, delta' subunit | Back alignment and domain information |
|---|
| >TIGR02397 dnaX_nterm DNA polymerase III, subunit gamma and tau | Back alignment and domain information |
|---|
| >PRK14087 dnaA chromosomal replication initiation protein; Provisional | Back alignment and domain information |
|---|
| >PRK14964 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK09087 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >PRK03992 proteasome-activating nucleotidase; Provisional | Back alignment and domain information |
|---|
| >PRK05642 DNA replication initiation factor; Validated | Back alignment and domain information |
|---|
| >KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] | Back alignment and domain information |
|---|
| >PRK05896 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >PRK14951 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK14955 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >TIGR02903 spore_lon_C ATP-dependent protease, Lon family | Back alignment and domain information |
|---|
| >KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PHA02544 44 clamp loader, small subunit; Provisional | Back alignment and domain information |
|---|
| >PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A | Back alignment and domain information |
|---|
| >PRK14958 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK14969 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >COG2255 RuvB Holliday junction resolvasome, helicase subunit [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >TIGR02639 ClpA ATP-dependent Clp protease ATP-binding subunit clpA | Back alignment and domain information |
|---|
| >PRK14970 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] | Back alignment and domain information |
|---|
| >PRK00149 dnaA chromosomal replication initiation protein; Reviewed | Back alignment and domain information |
|---|
| >PTZ00361 26 proteosome regulatory subunit 4-like protein; Provisional | Back alignment and domain information |
|---|
| >KOG2982 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >PRK14959 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK07133 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >PRK14952 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK14954 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK07764 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >TIGR02881 spore_V_K stage V sporulation protein K | Back alignment and domain information |
|---|
| >PRK14950 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >TIGR00362 DnaA chromosomal replication initiator protein DnaA | Back alignment and domain information |
|---|
| >PRK09111 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >KOG2227 consensus Pre-initiation complex, subunit CDC6, AAA+ superfamily ATPase [Replication, recombination and repair; Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >KOG2028 consensus ATPase related to the helicase subunit of the Holliday junction resolvase [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >PRK09376 rho transcription termination factor Rho; Provisional | Back alignment and domain information |
|---|
| >PRK14088 dnaA chromosomal replication initiation protein; Provisional | Back alignment and domain information |
|---|
| >TIGR02880 cbbX_cfxQ probable Rubsico expression protein CbbX | Back alignment and domain information |
|---|
| >PRK06305 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >TIGR03345 VI_ClpV1 type VI secretion ATPase, ClpV1 family | Back alignment and domain information |
|---|
| >PRK08451 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >TIGR03689 pup_AAA proteasome ATPase | Back alignment and domain information |
|---|
| >KOG4341 consensus F-box protein containing LRR [General function prediction only] | Back alignment and domain information |
|---|
| >PTZ00454 26S protease regulatory subunit 6B-like protein; Provisional | Back alignment and domain information |
|---|
| >PRK14953 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >KOG2982 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG2543 consensus Origin recognition complex, subunit 5 [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >PRK12422 chromosomal replication initiation protein; Provisional | Back alignment and domain information |
|---|
| >cd01128 rho_factor Transcription termination factor rho is a bacterial ATP-dependent RNA/DNA helicase | Back alignment and domain information |
|---|
| >PF08937 DUF1863: MTH538 TIR-like domain (DUF1863); InterPro: IPR015032 This protein adopts the flavodoxin fold, that is, five parallel beta-strands and four helical segments | Back alignment and domain information |
|---|
| >PRK14948 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK05707 DNA polymerase III subunit delta'; Validated | Back alignment and domain information |
|---|
| >CHL00095 clpC Clp protease ATP binding subunit | Back alignment and domain information |
|---|
| >CHL00181 cbbX CbbX; Provisional | Back alignment and domain information |
|---|
| >PRK07399 DNA polymerase III subunit delta'; Validated | Back alignment and domain information |
|---|
| >PRK06647 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >PRK07952 DNA replication protein DnaC; Validated | Back alignment and domain information |
|---|
| >PRK06620 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B | Back alignment and domain information |
|---|
| >PRK14971 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] | Back alignment and domain information |
|---|
| >PRK14086 dnaA chromosomal replication initiation protein; Provisional | Back alignment and domain information |
|---|
| >PRK10865 protein disaggregation chaperone; Provisional | Back alignment and domain information |
|---|
| >PRK11034 clpA ATP-dependent Clp protease ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PF05673 DUF815: Protein of unknown function (DUF815); InterPro: IPR008533 This domain consists of several bacterial proteins of unknown function | Back alignment and domain information |
|---|
| >TIGR00767 rho transcription termination factor Rho | Back alignment and domain information |
|---|
| >KOG4341 consensus F-box protein containing LRR [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0989 consensus Replication factor C, subunit RFC4 [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >PRK05563 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >PRK08116 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >COG0593 DnaA ATPase involved in DNA replication initiation [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PF00004 AAA: ATPase family associated with various cellular activities (AAA); InterPro: IPR003959 AAA ATPases (ATPases Associated with diverse cellular Activities) form a large protein family and play a number of roles in the cell including cell-cycle regulation, protein proteolysis and disaggregation, organelle biogenesis and intracellular transport | Back alignment and domain information |
|---|
| >CHL00195 ycf46 Ycf46; Provisional | Back alignment and domain information |
|---|
| >PRK12377 putative replication protein; Provisional | Back alignment and domain information |
|---|
| >TIGR03346 chaperone_ClpB ATP-dependent chaperone ClpB | Back alignment and domain information |
|---|
| >PRK14965 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >CHL00176 ftsH cell division protein; Validated | Back alignment and domain information |
|---|
| >KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] | Back alignment and domain information |
|---|
| >COG3267 ExeA Type II secretory pathway, component ExeA (predicted ATPase) [Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >COG1222 RPT1 ATP-dependent 26S proteasome regulatory subunit [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0991 consensus Replication factor C, subunit RFC2 [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >TIGR01241 FtsH_fam ATP-dependent metalloprotease FtsH | Back alignment and domain information |
|---|
| >PRK08769 DNA polymerase III subunit delta'; Validated | Back alignment and domain information |
|---|
| >PF05621 TniB: Bacterial TniB protein; InterPro: IPR008868 This family consists of several bacterial TniB NTP-binding proteins | Back alignment and domain information |
|---|
| >PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B | Back alignment and domain information |
|---|
| >COG1373 Predicted ATPase (AAA+ superfamily) [General function prediction only] | Back alignment and domain information |
|---|
| >PRK08181 transposase; Validated | Back alignment and domain information |
|---|
| >PRK09183 transposase/IS protein; Provisional | Back alignment and domain information |
|---|
| >smart00382 AAA ATPases associated with a variety of cellular activities | Back alignment and domain information |
|---|
| >PRK06871 DNA polymerase III subunit delta'; Validated | Back alignment and domain information |
|---|
| >TIGR01243 CDC48 AAA family ATPase, CDC48 subfamily | Back alignment and domain information |
|---|
| >TIGR01243 CDC48 AAA family ATPase, CDC48 subfamily | Back alignment and domain information |
|---|
| >COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] | Back alignment and domain information |
|---|
| >PRK08058 DNA polymerase III subunit delta'; Validated | Back alignment and domain information |
|---|
| >PRK06526 transposase; Provisional | Back alignment and domain information |
|---|
| >KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] | Back alignment and domain information |
|---|
| >PRK10865 protein disaggregation chaperone; Provisional | Back alignment and domain information |
|---|
| >KOG0744 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK10536 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >COG0466 Lon ATP-dependent Lon protease, bacterial type [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK06090 DNA polymerase III subunit delta'; Validated | Back alignment and domain information |
|---|
| >PF01695 IstB_IS21: IstB-like ATP binding protein; InterPro: IPR002611 Proteins in this entry contain an ATP/GTP binding P-loop motif | Back alignment and domain information |
|---|
| >PLN00020 ribulose bisphosphate carboxylase/oxygenase activase -RuBisCO activase (RCA); Provisional | Back alignment and domain information |
|---|
| >KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR00602 rad24 checkpoint protein rad24 | Back alignment and domain information |
|---|
| >KOG0741 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >cd01133 F1-ATPase_beta F1 ATP synthase beta subunit, nucleotide-binding domain | Back alignment and domain information |
|---|
| >PRK11034 clpA ATP-dependent Clp protease ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >TIGR02639 ClpA ATP-dependent Clp protease ATP-binding subunit clpA | Back alignment and domain information |
|---|
| >PRK00771 signal recognition particle protein Srp54; Provisional | Back alignment and domain information |
|---|
| >PRK07993 DNA polymerase III subunit delta'; Validated | Back alignment and domain information |
|---|
| >PRK11331 5-methylcytosine-specific restriction enzyme subunit McrB; Provisional | Back alignment and domain information |
|---|
| >cd01131 PilT Pilus retraction ATPase PilT | Back alignment and domain information |
|---|
| >TIGR02640 gas_vesic_GvpN gas vesicle protein GvpN | Back alignment and domain information |
|---|
| >TIGR03346 chaperone_ClpB ATP-dependent chaperone ClpB | Back alignment and domain information |
|---|
| >KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] | Back alignment and domain information |
|---|
| >PRK10787 DNA-binding ATP-dependent protease La; Provisional | Back alignment and domain information |
|---|
| >TIGR00763 lon ATP-dependent protease La | Back alignment and domain information |
|---|
| >KOG0733 consensus Nuclear AAA ATPase (VCP subfamily) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF10443 RNA12: RNA12 protein; InterPro: IPR018850 Mitochondrial escape protein 2 (also known as RNA12) plays a role in maintaining the mitochondrial genome and in controlling mtDNA escape [, ] | Back alignment and domain information |
|---|
| >PRK13531 regulatory ATPase RavA; Provisional | Back alignment and domain information |
|---|
| >PF13177 DNA_pol3_delta2: DNA polymerase III, delta subunit; PDB: 1NJF_B 3GLG_G 1XXH_I 1NJG_A 3GLF_B 3GLI_G 1IQP_E 2GNO_A 1SXJ_E 1A5T_A | Back alignment and domain information |
|---|
| >KOG0735 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF08357 SEFIR: SEFIR domain; InterPro: IPR013568 This domain is found in IL17 receptors (IL17Rs, e | Back alignment and domain information |
|---|
| >COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] | Back alignment and domain information |
|---|
| >COG0542 clpA ATP-binding subunits of Clp protease and DnaK/DnaJ chaperones [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK08118 topology modulation protein; Reviewed | Back alignment and domain information |
|---|
| >PF07728 AAA_5: AAA domain (dynein-related subfamily); InterPro: IPR011704 The ATPases Associated to a variety of cellular Activities (AAA) are a family distinguished by a highly conserved module of 230 amino acids [] | Back alignment and domain information |
|---|
| >PRK06921 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PF02562 PhoH: PhoH-like protein; InterPro: IPR003714 PhoH is a cytoplasmic protein and predicted ATPase that is induced by phosphate starvation and belongings to the phosphate regulon (pho) in Escherichia coli [] | Back alignment and domain information |
|---|
| >TIGR00959 ffh signal recognition particle protein | Back alignment and domain information |
|---|
| >PRK11889 flhF flagellar biosynthesis regulator FlhF; Provisional | Back alignment and domain information |
|---|
| >COG1484 DnaC DNA replication protein [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PRK10867 signal recognition particle protein; Provisional | Back alignment and domain information |
|---|
| >TIGR03345 VI_ClpV1 type VI secretion ATPase, ClpV1 family | Back alignment and domain information |
|---|
| >PRK07261 topology modulation protein; Provisional | Back alignment and domain information |
|---|
| >PF04665 Pox_A32: Poxvirus A32 protein; InterPro: IPR006758 This entry contains uncharacterised proteins belonging to the B354L family which include the pox virus A32 protein | Back alignment and domain information |
|---|
| >PRK06835 DNA replication protein DnaC; Validated | Back alignment and domain information |
|---|
| >PHA00729 NTP-binding motif containing protein | Back alignment and domain information |
|---|
| >PRK06964 DNA polymerase III subunit delta'; Validated | Back alignment and domain information |
|---|
| >TIGR01425 SRP54_euk signal recognition particle protein SRP54 | Back alignment and domain information |
|---|
| >PRK14974 cell division protein FtsY; Provisional | Back alignment and domain information |
|---|
| >KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] | Back alignment and domain information |
|---|
| >CHL00095 clpC Clp protease ATP binding subunit | Back alignment and domain information |
|---|
| >PRK12608 transcription termination factor Rho; Provisional | Back alignment and domain information |
|---|
| >PRK10733 hflB ATP-dependent metalloprotease; Reviewed | Back alignment and domain information |
|---|
| >KOG0730 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF13207 AAA_17: AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6_G 2QT1_A 2QSZ_A 2QSY_A 2QT0_A 2QG6_A 2P0E_A | Back alignment and domain information |
|---|
| >COG4608 AppF ABC-type oligopeptide transport system, ATPase component [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >cd01120 RecA-like_NTPases RecA-like NTPases | Back alignment and domain information |
|---|
| >cd00544 CobU Adenosylcobinamide kinase / adenosylcobinamide phosphate guanyltransferase (CobU) | Back alignment and domain information |
|---|
| >COG1618 Predicted nucleotide kinase [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >PRK06696 uridine kinase; Validated | Back alignment and domain information |
|---|
| >TIGR02902 spore_lonB ATP-dependent protease LonB | Back alignment and domain information |
|---|
| >PRK08939 primosomal protein DnaI; Reviewed | Back alignment and domain information |
|---|
| >smart00763 AAA_PrkA PrkA AAA domain | Back alignment and domain information |
|---|
| >PRK08699 DNA polymerase III subunit delta'; Validated | Back alignment and domain information |
|---|
| >PRK04296 thymidine kinase; Provisional | Back alignment and domain information |
|---|
| >COG0488 Uup ATPase components of ABC transporters with duplicated ATPase domains [General function prediction only] | Back alignment and domain information |
|---|
| >COG0470 HolB ATPase involved in DNA replication [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >COG1223 Predicted ATPase (AAA+ superfamily) [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0728 consensus 26S proteasome regulatory complex, ATPase RPT6 [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK05541 adenylylsulfate kinase; Provisional | Back alignment and domain information |
|---|
| >PRK04132 replication factor C small subunit; Provisional | Back alignment and domain information |
|---|
| >TIGR00064 ftsY signal recognition particle-docking protein FtsY | Back alignment and domain information |
|---|
| >PRK09361 radB DNA repair and recombination protein RadB; Provisional | Back alignment and domain information |
|---|
| >KOG1514 consensus Origin recognition complex, subunit 1, and related proteins [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >COG2812 DnaX DNA polymerase III, gamma/tau subunits [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PF00448 SRP54: SRP54-type protein, GTPase domain; InterPro: IPR000897 The signal recognition particle (SRP) is a multimeric protein, which along with its conjugate receptor (SR), is involved in targeting secretory proteins to the rough endoplasmic reticulum (RER) membrane in eukaryotes, or to the plasma membrane in prokaryotes [, ] | Back alignment and domain information |
|---|
| >KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] | Back alignment and domain information |
|---|
| >cd01121 Sms Sms (bacterial radA) DNA repair protein | Back alignment and domain information |
|---|
| >COG0542 clpA ATP-binding subunits of Clp protease and DnaK/DnaJ chaperones [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >cd01129 PulE-GspE PulE/GspE The type II secretory pathway is the main terminal branch of the general secretory pathway (GSP) | Back alignment and domain information |
|---|
| >PRK05800 cobU adenosylcobinamide kinase/adenosylcobinamide-phosphate guanylyltransferase; Validated | Back alignment and domain information |
|---|
| >KOG0731 consensus AAA+-type ATPase containing the peptidase M41 domain [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >cd03221 ABCF_EF-3 ABCF_EF-3 Elongation factor 3 (EF-3) is a cytosolic protein required by fungal ribosomes for in vitro protein synthesis and for in vivo growth | Back alignment and domain information |
|---|
| >PRK15429 formate hydrogenlyase transcriptional activator FhlA; Provisional | Back alignment and domain information |
|---|
| >PF14532 Sigma54_activ_2: Sigma-54 interaction domain; PDB: 3CO5_B 3N70_H | Back alignment and domain information |
|---|
| >TIGR02237 recomb_radB DNA repair and recombination protein RadB | Back alignment and domain information |
|---|
| >PRK07667 uridine kinase; Provisional | Back alignment and domain information |
|---|
| >KOG2228 consensus Origin recognition complex, subunit 4 [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >TIGR01420 pilT_fam pilus retraction protein PilT | Back alignment and domain information |
|---|
| >PRK06067 flagellar accessory protein FlaH; Validated | Back alignment and domain information |
|---|
| >PRK05703 flhF flagellar biosynthesis regulator FlhF; Validated | Back alignment and domain information |
|---|
| >PRK11608 pspF phage shock protein operon transcriptional activator; Provisional | Back alignment and domain information |
|---|
| >cd01394 radB RadB | Back alignment and domain information |
|---|
| >KOG0734 consensus AAA+-type ATPase containing the peptidase M41 domain [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >COG2884 FtsE Predicted ATPase involved in cell division [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >PRK12724 flagellar biosynthesis regulator FlhF; Provisional | Back alignment and domain information |
|---|
| >KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] | Back alignment and domain information |
|---|
| >cd03214 ABC_Iron-Siderophores_B12_Hemin ABC transporters, involved in the uptake of siderophores, heme, and vitamin B12, are widely conserved in bacteria and archaea | Back alignment and domain information |
|---|
| >cd01393 recA_like RecA is a bacterial enzyme which has roles in homologous recombination, DNA repair, and the induction of the SOS response | Back alignment and domain information |
|---|
| >cd03222 ABC_RNaseL_inhibitor The ABC ATPase RNase L inhibitor (RLI) is a key enzyme in ribosomal biogenesis, formation of translation preinitiation complexes, and assembly of HIV capsids | Back alignment and domain information |
|---|
| >COG1121 ZnuC ABC-type Mn/Zn transport systems, ATPase component [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR01817 nifA Nif-specific regulatory protein | Back alignment and domain information |
|---|
| >PRK12726 flagellar biosynthesis regulator FlhF; Provisional | Back alignment and domain information |
|---|
| >KOG0743 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK05022 anaerobic nitric oxide reductase transcription regulator; Provisional | Back alignment and domain information |
|---|
| >PRK14722 flhF flagellar biosynthesis regulator FlhF; Provisional | Back alignment and domain information |
|---|
| >PRK06762 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PF07726 AAA_3: ATPase family associated with various cellular activities (AAA); InterPro: IPR011703 This entry includes some of the AAA proteins not detected by the IPR003959 from INTERPRO model | Back alignment and domain information |
|---|
| >PF13604 AAA_30: AAA domain; PDB: 1W36_G 3K70_G 3UPU_B 3GPL_A 3E1S_A 3GP8_A | Back alignment and domain information |
|---|
| >PF01583 APS_kinase: Adenylylsulphate kinase; InterPro: IPR002891 Protein phosphorylation, which plays a key role in most cellular activities, is a reversible process mediated by protein kinases and phosphoprotein phosphatases | Back alignment and domain information |
|---|
| >PF13671 AAA_33: AAA domain; PDB: 1LTQ_A 2IA5_K 1RC8_A 1LY1_A 1RRC_A 1RPZ_A 3ZVM_A 1YJ5_A 3ZVL_A 3U7E_B | Back alignment and domain information |
|---|
| >PRK10416 signal recognition particle-docking protein FtsY; Provisional | Back alignment and domain information |
|---|
| >PF13238 AAA_18: AAA domain; PDB: 3IIK_A 3IIJ_A 3IIL_A 1RKB_A 3IIM_A 2AXP_A 3KB2_A 1KHT_A 1NKS_A 3H86_C | Back alignment and domain information |
|---|
| >cd03223 ABCD_peroxisomal_ALDP Peroxisomal ATP-binding cassette transporter (Pat) is involved in the import of very long-chain fatty acids (VLCFA) into the peroxisome | Back alignment and domain information |
|---|
| >KOG0733 consensus Nuclear AAA ATPase (VCP subfamily) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >COG0464 SpoVK ATPases of the AAA+ class [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] | Back alignment and domain information |
|---|
| >COG1066 Sms Predicted ATP-dependent serine protease [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >COG2607 Predicted ATPase (AAA+ superfamily) [General function prediction only] | Back alignment and domain information |
|---|
| >KOG2123 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >TIGR02974 phageshock_pspF psp operon transcriptional activator PspF | Back alignment and domain information |
|---|
| >PF00485 PRK: Phosphoribulokinase / Uridine kinase family; InterPro: IPR006083 Phosphoribulokinase (PRK) 2 | Back alignment and domain information |
|---|
| >cd01858 NGP_1 NGP-1 | Back alignment and domain information |
|---|
| >TIGR01359 UMP_CMP_kin_fam UMP-CMP kinase family | Back alignment and domain information |
|---|
| >cd03216 ABC_Carb_Monos_I This family represents the domain I of the carbohydrate uptake proteins that transport only monosaccharides (Monos) | Back alignment and domain information |
|---|
| >PF00406 ADK: Adenylate kinase; InterPro: IPR000850 Adenylate kinases (ADK) are phosphotransferases that catalyse the reversible reaction |
Back alignment and domain information |
|---|
| >KOG2123 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >PRK15455 PrkA family serine protein kinase; Provisional | Back alignment and domain information |
|---|
| >cd03238 ABC_UvrA The excision repair protein UvrA; Nucleotide excision repair in eubacteria is a process that repairs DNA damage by the removal of a 12-13-mer oligonucleotide containing the lesion | Back alignment and domain information |
|---|
| >cd00561 CobA_CobO_BtuR ATP:corrinoid adenosyltransferase BtuR/CobO/CobP | Back alignment and domain information |
|---|
| >COG0572 Udk Uridine kinase [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >cd03229 ABC_Class3 This class is comprised of all BPD (Binding Protein Dependent) systems that are largely represented in archaea and eubacteria and are primarily involved in scavenging solutes from the environment | Back alignment and domain information |
|---|
| >KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] | Back alignment and domain information |
|---|
| >TIGR00416 sms DNA repair protein RadA | Back alignment and domain information |
|---|
| >KOG0651 consensus 26S proteasome regulatory complex, ATPase RPT4 [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF07724 AAA_2: AAA domain (Cdc48 subfamily); InterPro: IPR013093 ATPases Associated to a variety of cellular Activities (AAA) are a family distinguished by a highly conserved module of 230 amino acids [] | Back alignment and domain information |
|---|
| >COG4088 Predicted nucleotide kinase [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >PTZ00494 tuzin-like protein; Provisional | Back alignment and domain information |
|---|
| >TIGR01650 PD_CobS cobaltochelatase, CobS subunit | Back alignment and domain information |
|---|
| >cd00267 ABC_ATPase ABC (ATP-binding cassette) transporter nucleotide-binding domain; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules | Back alignment and domain information |
|---|
| >COG1124 DppF ABC-type dipeptide/oligopeptide/nickel transport system, ATPase component [Amino acid transport and metabolism / Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PTZ00301 uridine kinase; Provisional | Back alignment and domain information |
|---|
| >COG1120 FepC ABC-type cobalamin/Fe3+-siderophores transport systems, ATPase components [Inorganic ion transport and metabolism / Coenzyme metabolism] | Back alignment and domain information |
|---|
| >COG1875 NYN ribonuclease and ATPase of PhoH family domains [General function prediction only] | Back alignment and domain information |
|---|
| >PRK11823 DNA repair protein RadA; Provisional | Back alignment and domain information |
|---|
| >PRK12727 flagellar biosynthesis regulator FlhF; Provisional | Back alignment and domain information |
|---|
| >KOG2035 consensus Replication factor C, subunit RFC3 [Cell cycle control, cell division, chromosome partitioning; Replication, recombination and repair] | Back alignment and domain information |
|---|
| >cd01135 V_A-ATPase_B V/A-type ATP synthase (non-catalytic) subunit B | Back alignment and domain information |
|---|
| >COG1136 SalX ABC-type antimicrobial peptide transport system, ATPase component [Defense mechanisms] | Back alignment and domain information |
|---|
| >KOG1969 consensus DNA replication checkpoint protein CHL12/CTF18 [Cell cycle control, cell division, chromosome partitioning; Replication, recombination and repair] | Back alignment and domain information |
|---|
| >PRK10463 hydrogenase nickel incorporation protein HypB; Provisional | Back alignment and domain information |
|---|
| >cd03115 SRP The signal recognition particle (SRP) mediates the transport to or across the plasma membrane in bacteria and the endoplasmic reticulum in eukaryotes | Back alignment and domain information |
|---|
| >cd02019 NK Nucleoside/nucleotide kinase (NK) is a protein superfamily consisting of multiple families of enzymes that share structural similarity and are functionally related to the catalysis of the reversible phosphate group transfer from nucleoside triphosphates to nucleosides/nucleotides, nucleoside monophosphates, or sugars | Back alignment and domain information |
|---|
| >TIGR02858 spore_III_AA stage III sporulation protein AA | Back alignment and domain information |
|---|
| >cd03230 ABC_DR_subfamily_A This family of ATP-binding proteins belongs to a multisubunit transporter involved in drug resistance (BcrA and DrrA), nodulation, lipid transport, and lantibiotic immunity | Back alignment and domain information |
|---|
| >PRK10820 DNA-binding transcriptional regulator TyrR; Provisional | Back alignment and domain information |
|---|
| >COG4618 ArpD ABC-type protease/lipase transport system, ATPase and permease components [General function prediction only] | Back alignment and domain information |
|---|
| >PRK03839 putative kinase; Provisional | Back alignment and domain information |
|---|
| >PF00910 RNA_helicase: RNA helicase; InterPro: IPR000605 Helicases have been classified in 5 superfamilies (SF1-SF5) | Back alignment and domain information |
|---|
| >PRK05480 uridine/cytidine kinase; Provisional | Back alignment and domain information |
|---|
| >TIGR02012 tigrfam_recA protein RecA | Back alignment and domain information |
|---|
| >PRK08233 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PF00437 T2SE: Type II/IV secretion system protein; InterPro: IPR001482 A number of bacterial proteins, some of which are involved in a general secretion pathway (GSP) for the export of proteins (also called the type II pathway) belong to this group [, ] | Back alignment and domain information |
|---|
| >PRK04040 adenylate kinase; Provisional | Back alignment and domain information |
|---|
| >KOG1970 consensus Checkpoint RAD17-RFC complex, RAD17/RAD24 component [Cell cycle control, cell division, chromosome partitioning; Replication, recombination and repair] | Back alignment and domain information |
|---|
| >PRK12723 flagellar biosynthesis regulator FlhF; Provisional | Back alignment and domain information |
|---|
| >KOG1051 consensus Chaperone HSP104 and related ATP-dependent Clp proteases [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >cd00983 recA RecA is a bacterial enzyme which has roles in homologous recombination, DNA repair, and the induction of the SOS response | Back alignment and domain information |
|---|
| >PTZ00088 adenylate kinase 1; Provisional | Back alignment and domain information |
|---|
| >TIGR00235 udk uridine kinase | Back alignment and domain information |
|---|
| >PRK00625 shikimate kinase; Provisional | Back alignment and domain information |
|---|
| >cd03283 ABC_MutS-like MutS-like homolog in eukaryotes | Back alignment and domain information |
|---|
| >PRK06995 flhF flagellar biosynthesis regulator FlhF; Validated | Back alignment and domain information |
|---|
| >COG0563 Adk Adenylate kinase and related kinases [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >KOG0738 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF00006 ATP-synt_ab: ATP synthase alpha/beta family, nucleotide-binding domain This Pfam entry corresponds to chains a,b,c,d,e and f; InterPro: IPR000194 ATPases (or ATP synthases) are membrane-bound enzyme complexes/ion transporters that combine ATP synthesis and/or hydrolysis with the transport of protons across a membrane | Back alignment and domain information |
|---|
| >PRK14723 flhF flagellar biosynthesis regulator FlhF; Provisional | Back alignment and domain information |
|---|
| >PF03308 ArgK: ArgK protein; InterPro: IPR005129 Bacterial periplasmic transport systems require the function of a specific substrate-binding protein, located in the periplasm, and several cytoplasmic membrane transport components | Back alignment and domain information |
|---|
| >cd01122 GP4d_helicase GP4d_helicase is a homohexameric 5'-3' helicases | Back alignment and domain information |
|---|
| >PF07725 LRR_3: Leucine Rich Repeat; InterPro: IPR011713 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] | Back alignment and domain information |
|---|
| >PF08433 KTI12: Chromatin associated protein KTI12 ; InterPro: IPR013641 This is a family of chromatin associated proteins which interact with the Elongator complex, a component of the elongating form of RNA polymerase II [] | Back alignment and domain information |
|---|
| >PRK13543 cytochrome c biogenesis protein CcmA; Provisional | Back alignment and domain information |
|---|
| >cd03237 ABC_RNaseL_inhibitor_domain2 The ATPase domain 2 of RNase L inhibitor | Back alignment and domain information |
|---|
| >cd01125 repA Hexameric Replicative Helicase RepA | Back alignment and domain information |
|---|
| >PRK12337 2-phosphoglycerate kinase; Provisional | Back alignment and domain information |
|---|
| >KOG0729 consensus 26S proteasome regulatory complex, ATPase RPT1 [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0652 consensus 26S proteasome regulatory complex, ATPase RPT5 [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >cd03246 ABCC_Protease_Secretion This family represents the ABC component of the protease secretion system PrtD, a 60-kDa integral membrane protein sharing 37% identity with HlyB, the ABC component of the alpha-hemolysin secretion pathway, in the C-terminal domain | Back alignment and domain information |
|---|
| >PF03969 AFG1_ATPase: AFG1-like ATPase; InterPro: IPR005654 ATPase family gene 1 (AFG1) ATPase is a 377 amino acid putative protein with an ATPase motif typical of the protein family including SEC18p PAS1, CDC48-VCP and TBP | Back alignment and domain information |
|---|
| >cd01130 VirB11-like_ATPase Type IV secretory pathway component VirB11, and related ATPases | Back alignment and domain information |
|---|
| >PHA02244 ATPase-like protein | Back alignment and domain information |
|---|
| >PRK00131 aroK shikimate kinase; Reviewed | Back alignment and domain information |
|---|
| >cd03233 ABC_PDR_domain1 The pleiotropic drug resistance (PDR) family of ATP-binding cassette (ABC) transporters | Back alignment and domain information |
|---|
| >PRK05973 replicative DNA helicase; Provisional | Back alignment and domain information |
|---|
| >TIGR03499 FlhF flagellar biosynthetic protein FlhF | Back alignment and domain information |
|---|
| >PRK08356 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >COG2274 SunT ABC-type bacteriocin/lantibiotic exporters, contain an N-terminal double-glycine peptidase domain [Defense mechanisms] | Back alignment and domain information |
|---|
| >cd03247 ABCC_cytochrome_bd The CYD subfamily implicated in cytochrome bd biogenesis | Back alignment and domain information |
|---|
| >KOG0062 consensus ATPase component of ABC transporters with duplicated ATPase domains/Translation elongation factor EF-3b [Amino acid transport and metabolism; Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >TIGR02655 circ_KaiC circadian clock protein KaiC | Back alignment and domain information |
|---|
| >PRK10923 glnG nitrogen regulation protein NR(I); Provisional | Back alignment and domain information |
|---|
| >TIGR02788 VirB11 P-type DNA transfer ATPase VirB11 | Back alignment and domain information |
|---|
| >TIGR00150 HI0065_YjeE ATPase, YjeE family | Back alignment and domain information |
|---|
| >COG1428 Deoxynucleoside kinases [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR03600 phage_DnaB phage replicative helicase, DnaB family, HK022 subfamily | Back alignment and domain information |
|---|
| >cd02027 APSK Adenosine 5'-phosphosulfate kinase (APSK) catalyzes the phosphorylation of adenosine 5'-phosphosulfate to form 3'-phosphoadenosine 5'-phosphosulfate (PAPS) | Back alignment and domain information |
|---|
| >cd03240 ABC_Rad50 The catalytic domains of Rad50 are similar to the ATP-binding cassette of ABC transporters, but are not associated with membrane-spanning domains | Back alignment and domain information |
|---|
| >PRK06547 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK00889 adenylylsulfate kinase; Provisional | Back alignment and domain information |
|---|
| >PRK07132 DNA polymerase III subunit delta'; Validated | Back alignment and domain information |
|---|
| >TIGR02524 dot_icm_DotB Dot/Icm secretion system ATPase DotB | Back alignment and domain information |
|---|
| >PF03205 MobB: Molybdopterin guanine dinucleotide synthesis protein B; PDB: 2F1R_B 1P9N_A 1NP6_B 2NPI_A 1XJC_A | Back alignment and domain information |
|---|
| >PRK05439 pantothenate kinase; Provisional | Back alignment and domain information |
|---|
| >PRK09280 F0F1 ATP synthase subunit beta; Validated | Back alignment and domain information |
|---|
| >KOG2004 consensus Mitochondrial ATP-dependent protease PIM1/LON [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK13947 shikimate kinase; Provisional | Back alignment and domain information |
|---|
| >TIGR01360 aden_kin_iso1 adenylate kinase, isozyme 1 subfamily | Back alignment and domain information |
|---|
| >TIGR00390 hslU ATP-dependent protease HslVU, ATPase subunit | Back alignment and domain information |
|---|
| >cd03228 ABCC_MRP_Like The MRP (Mutidrug Resistance Protein)-like transporters are involved in drug, peptide, and lipid export | Back alignment and domain information |
|---|
| >TIGR03740 galliderm_ABC gallidermin-class lantibiotic protection ABC transporter, ATP-binding subunit | Back alignment and domain information |
|---|
| >cd03281 ABC_MSH5_euk MutS5 homolog in eukaryotes | Back alignment and domain information |
|---|
| >COG0003 ArsA Predicted ATPase involved in chromosome partitioning [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >PRK12597 F0F1 ATP synthase subunit beta; Provisional | Back alignment and domain information |
|---|
| >cd02028 UMPK_like Uridine monophosphate kinase_like (UMPK_like) is a family of proteins highly similar to the uridine monophosphate kinase (UMPK, EC 2 | Back alignment and domain information |
|---|
| >COG0488 Uup ATPase components of ABC transporters with duplicated ATPase domains [General function prediction only] | Back alignment and domain information |
|---|
| >cd03285 ABC_MSH2_euk MutS2 homolog in eukaryotes | Back alignment and domain information |
|---|
| >PRK03846 adenylylsulfate kinase; Provisional | Back alignment and domain information |
|---|
| >TIGR03878 thermo_KaiC_2 KaiC domain protein, AF_0795 family | Back alignment and domain information |
|---|
| >TIGR00554 panK_bact pantothenate kinase, bacterial type | Back alignment and domain information |
|---|
| >COG0468 RecA RecA/RadA recombinase [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >TIGR02782 TrbB_P P-type conjugative transfer ATPase TrbB | Back alignment and domain information |
|---|
| >TIGR03574 selen_PSTK L-seryl-tRNA(Sec) kinase, archaeal | Back alignment and domain information |
|---|
| >PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] | Back alignment and domain information |
|---|
| >TIGR01069 mutS2 MutS2 family protein | Back alignment and domain information |
|---|
| >cd00227 CPT Chloramphenicol (Cm) phosphotransferase (CPT) | Back alignment and domain information |
|---|
| >PRK11388 DNA-binding transcriptional regulator DhaR; Provisional | Back alignment and domain information |
|---|
| >CHL00206 ycf2 Ycf2; Provisional | Back alignment and domain information |
|---|
| >TIGR01039 atpD ATP synthase, F1 beta subunit | Back alignment and domain information |
|---|
| >PF10236 DAP3: Mitochondrial ribosomal death-associated protein 3; InterPro: IPR019368 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms | Back alignment and domain information |
|---|
| >PRK08972 fliI flagellum-specific ATP synthase; Validated | Back alignment and domain information |
|---|
| >COG0465 HflB ATP-dependent Zn proteases [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK05201 hslU ATP-dependent protease ATP-binding subunit HslU; Provisional | Back alignment and domain information |
|---|
| >PRK14721 flhF flagellar biosynthesis regulator FlhF; Provisional | Back alignment and domain information |
|---|
| >PRK15115 response regulator GlrR; Provisional | Back alignment and domain information |
|---|
| >COG3640 CooC CO dehydrogenase maturation factor [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >COG3910 Predicted ATPase [General function prediction only] | Back alignment and domain information |
|---|
| >COG0467 RAD55 RecA-superfamily ATPases implicated in signal transduction [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >COG5635 Predicted NTPase (NACHT family) [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PRK09270 nucleoside triphosphate hydrolase domain-containing protein; Reviewed | Back alignment and domain information |
|---|
| >cd02024 NRK1 Nicotinamide riboside kinase (NRK) is an enzyme involved in the metabolism of nicotinamide adenine dinucleotide (NAD+) | Back alignment and domain information |
|---|
| >cd03220 ABC_KpsT_Wzt ABC_KpsT_Wzt The KpsT/Wzt ABC transporter subfamily is involved in extracellular polysaccharide export | Back alignment and domain information |
|---|
| >cd00071 GMPK Guanosine monophosphate kinase (GMPK, EC 2 | Back alignment and domain information |
|---|
| >COG4133 CcmA ABC-type transport system involved in cytochrome c biogenesis, ATPase component [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK13949 shikimate kinase; Provisional | Back alignment and domain information |
|---|
| >PF00625 Guanylate_kin: Guanylate kinase; InterPro: IPR008144 Guanylate kinase (2 | Back alignment and domain information |
|---|
| >cd02025 PanK Pantothenate kinase (PanK) catalyzes the phosphorylation of pantothenic acid to form 4'-phosphopantothenic, which is the first of five steps in coenzyme A (CoA) biosynthetic pathway | Back alignment and domain information |
|---|
| >COG0055 AtpD F0F1-type ATP synthase, beta subunit [Energy production and conversion] | Back alignment and domain information |
|---|
| >PRK14528 adenylate kinase; Provisional | Back alignment and domain information |
|---|
| >PF08423 Rad51: Rad51; InterPro: IPR013632 This domain is found at the C terminus of the DNA repair and recombination protein Rad51 | Back alignment and domain information |
|---|
| >cd03284 ABC_MutS1 MutS1 homolog in eukaryotes | Back alignment and domain information |
|---|
| >cd01123 Rad51_DMC1_radA Rad51_DMC1_radA,B | Back alignment and domain information |
|---|
| >cd03217 ABC_FeS_Assembly ABC-type transport system involved in Fe-S cluster assembly, ATPase component | Back alignment and domain information |
|---|
| >TIGR03877 thermo_KaiC_1 KaiC domain protein, Ph0284 family | Back alignment and domain information |
|---|
| >cd02023 UMPK Uridine monophosphate kinase (UMPK, EC 2 | Back alignment and domain information |
|---|
| >PRK00279 adk adenylate kinase; Reviewed | Back alignment and domain information |
|---|
| >cd01132 F1_ATPase_alpha F1 ATP synthase alpha, central domain | Back alignment and domain information |
|---|
| >PF03266 NTPase_1: NTPase; InterPro: IPR004948 This entry represents a family of nucleoside-triphosphatases which have activity towards ATP, GTP, CTP, TTP and UTP and may hydrolyse nucleoside diphosphates with lower efficiency [] | Back alignment and domain information |
|---|
| >PRK13948 shikimate kinase; Provisional | Back alignment and domain information |
|---|
| >COG1102 Cmk Cytidylate kinase [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >KOG3928 consensus Mitochondrial ribosome small subunit component, mediator of apoptosis DAP3 [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >PRK06217 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >PRK08506 replicative DNA helicase; Provisional | Back alignment and domain information |
|---|
| >PRK11174 cysteine/glutathione ABC transporter membrane/ATP-binding component; Reviewed | Back alignment and domain information |
|---|
| >cd03215 ABC_Carb_Monos_II This family represents domain II of the carbohydrate uptake proteins that transport only monosaccharides (Monos) | Back alignment and domain information |
|---|
| >PRK10751 molybdopterin-guanine dinucleotide biosynthesis protein B; Provisional | Back alignment and domain information |
|---|
| >PRK13765 ATP-dependent protease Lon; Provisional | Back alignment and domain information |
|---|
| >PF00158 Sigma54_activat: Sigma-54 interaction domain; InterPro: IPR002078 Some bacterial regulatory proteins activate the expression of genes from promoters recognised by core RNA polymerase associated with the alternative sigma-54 factor | Back alignment and domain information |
|---|
| >cd02020 CMPK Cytidine monophosphate kinase (CMPK) catalyzes the reversible phosphorylation of cytidine monophosphate (CMP) to produce cytidine diphosphate (CDP), using ATP as the preferred phosphoryl donor | Back alignment and domain information |
|---|
| >cd00464 SK Shikimate kinase (SK) is the fifth enzyme in the shikimate pathway, a seven-step biosynthetic pathway which converts erythrose-4-phosphate to chorismic acid, found in bacteria, fungi and plants | Back alignment and domain information |
|---|
| >cd03232 ABC_PDR_domain2 The pleiotropic drug resistance-like (PDR) family of ATP-binding cassette (ABC) transporters | Back alignment and domain information |
|---|
| >TIGR02322 phosphon_PhnN phosphonate metabolism protein/1,5-bisphosphokinase (PRPP-forming) PhnN | Back alignment and domain information |
|---|
| >cd03287 ABC_MSH3_euk MutS3 homolog in eukaryotes | Back alignment and domain information |
|---|
| >cd01857 HSR1_MMR1 HSR1/MMR1 | Back alignment and domain information |
|---|
| >PF02374 ArsA_ATPase: Anion-transporting ATPase; PDB: 2WOO_A 3IBG_B 3SJA_A 3H84_B 3SJD_A 3ZS9_A 3A37_A 2WOJ_A 3SJC_B 3A36_B | Back alignment and domain information |
|---|
| >PRK13946 shikimate kinase; Provisional | Back alignment and domain information |
|---|
| >KOG1532 consensus GTPase XAB1, interacts with DNA repair protein XPA [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >COG2842 Uncharacterized ATPase, putative transposase [General function prediction only] | Back alignment and domain information |
|---|
| >COG1703 ArgK Putative periplasmic protein kinase ArgK and related GTPases of G3E family [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >smart00534 MUTSac ATPase domain of DNA mismatch repair MUTS family | Back alignment and domain information |
|---|
| >PRK14529 adenylate kinase; Provisional | Back alignment and domain information |
|---|
| >KOG4308 consensus LRR-containing protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG0736 consensus Peroxisome assembly factor 2 containing the AAA+-type ATPase domain [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >cd02021 GntK Gluconate kinase (GntK) catalyzes the phosphoryl transfer from ATP to gluconate | Back alignment and domain information |
|---|
| >CHL00059 atpA ATP synthase CF1 alpha subunit | Back alignment and domain information |
|---|
| >TIGR02915 PEP_resp_reg putative PEP-CTERM system response regulator | Back alignment and domain information |
|---|
| >PRK14526 adenylate kinase; Provisional | Back alignment and domain information |
|---|
| >TIGR02533 type_II_gspE general secretory pathway protein E | Back alignment and domain information |
|---|
| >cd04121 Rab40 Rab40 subfamily | Back alignment and domain information |
|---|
| >PRK08927 fliI flagellum-specific ATP synthase; Validated | Back alignment and domain information |
|---|
| >PRK12339 2-phosphoglycerate kinase; Provisional | Back alignment and domain information |
|---|
| >COG3854 SpoIIIAA ncharacterized protein conserved in bacteria [Function unknown] | Back alignment and domain information |
|---|
| >PF12775 AAA_7: P-loop containing dynein motor region D3; PDB: 4AKI_A 4AI6_B 4AKH_A 4AKG_A 3QMZ_A 3VKH_A 3VKG_A | Back alignment and domain information |
|---|
| >PF06068 TIP49: TIP49 C-terminus; InterPro: IPR010339 This family consists of the C-terminal region of several eukaryotic and archaeal RuvB-like 1 (Pontin or TIP49a) and RuvB-like 2 (Reptin or TIP49b) proteins | Back alignment and domain information |
|---|
| >COG1936 Predicted nucleotide kinase (related to CMP and AMP kinases) [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >PRK05057 aroK shikimate kinase I; Reviewed | Back alignment and domain information |
|---|
| >COG0194 Gmk Guanylate kinase [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >PRK14493 putative bifunctional molybdopterin-guanine dinucleotide biosynthesis protein MobB/MoaE; Provisional | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 1288 | ||||
| 3jrn_A | 176 | Crystal Structure Of Tir Domain From Arabidopsis Th | 2e-32 | ||
| 3ozi_A | 204 | Crystal Structure Of The Tir Domain From The Flax D | 4e-30 | ||
| 3sfz_A | 1249 | Crystal Structure Of Full-Length Murine Apaf-1 Leng | 3e-10 | ||
| 3shf_A | 1256 | Crystal Structure Of The R265s Mutant Of Full-Lengt | 2e-09 | ||
| 3cvr_A | 571 | Crystal Structure Of The Full Length Ipah3 Length = | 5e-09 | ||
| 1z6t_A | 591 | Structure Of The Apoptotic Protease-activating Fact | 9e-08 | ||
| 4fcg_A | 328 | Structure Of The Leucine-Rich Repeat Domain Of The | 2e-07 | ||
| 3iza_B | 1263 | Structure Of An Apoptosome-Procaspase-9 Card Comple | 5e-07 | ||
| 1g9u_A | 454 | Crystal Structure Of Yopm-leucine Rich Effector Pro | 2e-06 | ||
| 3g06_A | 622 | The Salmonella Virulence Effector Ssph2 Functions A | 1e-04 | ||
| 4b8c_D | 727 | Nuclease Module Of The Yeast Ccr4-Not Complex Lengt | 9e-04 |
| >pdb|3JRN|A Chain A, Crystal Structure Of Tir Domain From Arabidopsis Thaliana Length = 176 | Back alignment and structure |
|
| >pdb|3OZI|A Chain A, Crystal Structure Of The Tir Domain From The Flax Disease Resistance Protein L6 Length = 204 | Back alignment and structure |
| >pdb|3SFZ|A Chain A, Crystal Structure Of Full-Length Murine Apaf-1 Length = 1249 | Back alignment and structure |
| >pdb|3SHF|A Chain A, Crystal Structure Of The R265s Mutant Of Full-Length Murine Apaf-1 Length = 1256 | Back alignment and structure |
| >pdb|3CVR|A Chain A, Crystal Structure Of The Full Length Ipah3 Length = 571 | Back alignment and structure |
| >pdb|1Z6T|A Chain A, Structure Of The Apoptotic Protease-activating Factor 1 Bound To Adp Length = 591 | Back alignment and structure |
| >pdb|4FCG|A Chain A, Structure Of The Leucine-Rich Repeat Domain Of The Type Iii Effector Xcv3220 (Xopl) Length = 328 | Back alignment and structure |
| >pdb|1G9U|A Chain A, Crystal Structure Of Yopm-leucine Rich Effector Protein From Yersinia Pestis Length = 454 | Back alignment and structure |
| >pdb|3G06|A Chain A, The Salmonella Virulence Effector Ssph2 Functions As A Novel E3 Ligase Length = 622 | Back alignment and structure |
| >pdb|4B8C|D Chain D, Nuclease Module Of The Yeast Ccr4-Not Complex Length = 727 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 1288 | |||
| 3ozi_A | 204 | L6TR; plant TIR domain, plant protein; 2.30A {Linu | 2e-86 | |
| 3jrn_A | 176 | AT1G72930 protein; TIR domain arabidopsis thaliana | 5e-86 | |
| 3h16_A | 154 | TIR protein; bacteria TIR domain, signaling protei | 1e-63 | |
| 4fcg_A | 328 | Uncharacterized protein; structural genomics, PSI- | 2e-46 | |
| 4fcg_A | 328 | Uncharacterized protein; structural genomics, PSI- | 6e-41 | |
| 4fcg_A | 328 | Uncharacterized protein; structural genomics, PSI- | 2e-26 | |
| 4fcg_A | 328 | Uncharacterized protein; structural genomics, PSI- | 9e-16 | |
| 4fcg_A | 328 | Uncharacterized protein; structural genomics, PSI- | 2e-13 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 9e-46 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 8e-11 | |
| 1jl5_A | 454 | Outer protein YOPM; leucine-rich repeat, molecular | 4e-43 | |
| 1jl5_A | 454 | Outer protein YOPM; leucine-rich repeat, molecular | 5e-41 | |
| 1jl5_A | 454 | Outer protein YOPM; leucine-rich repeat, molecular | 6e-29 | |
| 1jl5_A | 454 | Outer protein YOPM; leucine-rich repeat, molecular | 2e-16 | |
| 1jl5_A | 454 | Outer protein YOPM; leucine-rich repeat, molecular | 4e-05 | |
| 2a5y_B | 549 | CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis | 4e-43 | |
| 1z6t_A | 591 | APAF-1, apoptotic protease activating factor 1; ca | 1e-34 | |
| 4ecn_A | 876 | Leucine-rich repeat protein; leucine-rich repeats, | 6e-34 | |
| 4ecn_A | 876 | Leucine-rich repeat protein; leucine-rich repeats, | 3e-27 | |
| 4ecn_A | 876 | Leucine-rich repeat protein; leucine-rich repeats, | 3e-23 | |
| 4ecn_A | 876 | Leucine-rich repeat protein; leucine-rich repeats, | 2e-13 | |
| 4eco_A | 636 | Uncharacterized protein; leucine-rich repeats, pro | 2e-29 | |
| 4eco_A | 636 | Uncharacterized protein; leucine-rich repeats, pro | 2e-25 | |
| 4eco_A | 636 | Uncharacterized protein; leucine-rich repeats, pro | 5e-22 | |
| 3cvr_A | 571 | Invasion plasmid antigen; leucine rich repeat and | 2e-26 | |
| 3cvr_A | 571 | Invasion plasmid antigen; leucine rich repeat and | 9e-22 | |
| 3cvr_A | 571 | Invasion plasmid antigen; leucine rich repeat and | 9e-18 | |
| 3cvr_A | 571 | Invasion plasmid antigen; leucine rich repeat and | 2e-11 | |
| 3sfz_A | 1249 | APAF-1, apoptotic peptidase activating factor 1; a | 3e-26 | |
| 3t6q_A | 606 | CD180 antigen; protein-protein complex, leucine ri | 1e-24 | |
| 3t6q_A | 606 | CD180 antigen; protein-protein complex, leucine ri | 1e-21 | |
| 3t6q_A | 606 | CD180 antigen; protein-protein complex, leucine ri | 2e-21 | |
| 3t6q_A | 606 | CD180 antigen; protein-protein complex, leucine ri | 4e-07 | |
| 1o6v_A | 466 | Internalin A; bacterial infection, extracellular r | 3e-24 | |
| 1o6v_A | 466 | Internalin A; bacterial infection, extracellular r | 2e-10 | |
| 3vq2_A | 606 | TLR4, TOLL-like receptor 4; leucine rich repeat MD | 7e-24 | |
| 3vq2_A | 606 | TLR4, TOLL-like receptor 4; leucine rich repeat MD | 1e-21 | |
| 3vq2_A | 606 | TLR4, TOLL-like receptor 4; leucine rich repeat MD | 9e-17 | |
| 2z81_A | 549 | CD282 antigen, TOLL-like receptor 2, variable lymp | 1e-23 | |
| 2z81_A | 549 | CD282 antigen, TOLL-like receptor 2, variable lymp | 6e-19 | |
| 2z81_A | 549 | CD282 antigen, TOLL-like receptor 2, variable lymp | 3e-14 | |
| 2z81_A | 549 | CD282 antigen, TOLL-like receptor 2, variable lymp | 1e-11 | |
| 2z81_A | 549 | CD282 antigen, TOLL-like receptor 2, variable lymp | 3e-07 | |
| 3g06_A | 622 | SSPH2 (leucine-rich repeat protein); E3 ubiquitin | 1e-22 | |
| 3g06_A | 622 | SSPH2 (leucine-rich repeat protein); E3 ubiquitin | 5e-20 | |
| 3g06_A | 622 | SSPH2 (leucine-rich repeat protein); E3 ubiquitin | 5e-14 | |
| 2z63_A | 570 | TOLL-like receptor 4, variable lymphocyte recepto; | 3e-22 | |
| 2z63_A | 570 | TOLL-like receptor 4, variable lymphocyte recepto; | 4e-15 | |
| 2z63_A | 570 | TOLL-like receptor 4, variable lymphocyte recepto; | 2e-10 | |
| 1ziw_A | 680 | TOLL-like receptor 3; innate immunity, immune syst | 5e-22 | |
| 1ziw_A | 680 | TOLL-like receptor 3; innate immunity, immune syst | 7e-20 | |
| 1ziw_A | 680 | TOLL-like receptor 3; innate immunity, immune syst | 3e-19 | |
| 1ziw_A | 680 | TOLL-like receptor 3; innate immunity, immune syst | 8e-19 | |
| 1ziw_A | 680 | TOLL-like receptor 3; innate immunity, immune syst | 2e-16 | |
| 3j0a_A | 844 | TOLL-like receptor 5; membrane protein, leucine-ri | 4e-21 | |
| 3j0a_A | 844 | TOLL-like receptor 5; membrane protein, leucine-ri | 3e-19 | |
| 3j0a_A | 844 | TOLL-like receptor 5; membrane protein, leucine-ri | 6e-16 | |
| 3j0a_A | 844 | TOLL-like receptor 5; membrane protein, leucine-ri | 3e-15 | |
| 3j0a_A | 844 | TOLL-like receptor 5; membrane protein, leucine-ri | 2e-09 | |
| 3j0a_A | 844 | TOLL-like receptor 5; membrane protein, leucine-ri | 3e-07 | |
| 3o6n_A | 390 | APL1; leucine-rich repeat, protein binding; HET: N | 8e-21 | |
| 3o6n_A | 390 | APL1; leucine-rich repeat, protein binding; HET: N | 2e-18 | |
| 3o6n_A | 390 | APL1; leucine-rich repeat, protein binding; HET: N | 8e-10 | |
| 3o6n_A | 390 | APL1; leucine-rich repeat, protein binding; HET: N | 3e-06 | |
| 3oja_A | 487 | Leucine-rich immune molecule 1; coiled-coil, helix | 1e-20 | |
| 3oja_A | 487 | Leucine-rich immune molecule 1; coiled-coil, helix | 8e-15 | |
| 3oja_A | 487 | Leucine-rich immune molecule 1; coiled-coil, helix | 1e-09 | |
| 3jqh_A | 167 | C-type lectin domain family 4 member M; DC-signr, | 3e-20 | |
| 3jqh_A | 167 | C-type lectin domain family 4 member M; DC-signr, | 2e-19 | |
| 3jqh_A | 167 | C-type lectin domain family 4 member M; DC-signr, | 5e-19 | |
| 3jqh_A | 167 | C-type lectin domain family 4 member M; DC-signr, | 9e-17 | |
| 3fxi_A | 605 | TLR4, htoll, TOLL-like receptor 4; leucine rich re | 4e-20 | |
| 3fxi_A | 605 | TLR4, htoll, TOLL-like receptor 4; leucine rich re | 5e-14 | |
| 3fxi_A | 605 | TLR4, htoll, TOLL-like receptor 4; leucine rich re | 2e-10 | |
| 3o53_A | 317 | Protein LRIM1, AGAP006348-PA; leucine-rich repeat, | 9e-20 | |
| 3o53_A | 317 | Protein LRIM1, AGAP006348-PA; leucine-rich repeat, | 6e-15 | |
| 3o53_A | 317 | Protein LRIM1, AGAP006348-PA; leucine-rich repeat, | 8e-10 | |
| 3o53_A | 317 | Protein LRIM1, AGAP006348-PA; leucine-rich repeat, | 1e-08 | |
| 3zyi_A | 452 | Leucine-rich repeat-containing protein 4; cell adh | 2e-19 | |
| 3zyi_A | 452 | Leucine-rich repeat-containing protein 4; cell adh | 1e-09 | |
| 3zyi_A | 452 | Leucine-rich repeat-containing protein 4; cell adh | 2e-05 | |
| 3oja_B | 597 | Anopheles plasmodium-responsive leucine-rich REPE | 3e-19 | |
| 3oja_B | 597 | Anopheles plasmodium-responsive leucine-rich REPE | 7e-12 | |
| 3oja_B | 597 | Anopheles plasmodium-responsive leucine-rich REPE | 4e-08 | |
| 3zyj_A | 440 | Leucine-rich repeat-containing protein 4C; cell ad | 8e-19 | |
| 3zyj_A | 440 | Leucine-rich repeat-containing protein 4C; cell ad | 5e-10 | |
| 3zyj_A | 440 | Leucine-rich repeat-containing protein 4C; cell ad | 1e-06 | |
| 4fmz_A | 347 | Internalin; leucine rich repeat, structural genomi | 1e-17 | |
| 4fmz_A | 347 | Internalin; leucine rich repeat, structural genomi | 6e-16 | |
| 2ft3_A | 332 | Biglycan; proteoglycan, dimer interface, structura | 3e-17 | |
| 2ft3_A | 332 | Biglycan; proteoglycan, dimer interface, structura | 2e-12 | |
| 2ft3_A | 332 | Biglycan; proteoglycan, dimer interface, structura | 1e-06 | |
| 2ft3_A | 332 | Biglycan; proteoglycan, dimer interface, structura | 2e-05 | |
| 2id5_A | 477 | Lingo-1, leucine rich repeat neuronal 6A; CNS-spec | 8e-17 | |
| 2id5_A | 477 | Lingo-1, leucine rich repeat neuronal 6A; CNS-spec | 2e-16 | |
| 2id5_A | 477 | Lingo-1, leucine rich repeat neuronal 6A; CNS-spec | 2e-10 | |
| 2id5_A | 477 | Lingo-1, leucine rich repeat neuronal 6A; CNS-spec | 4e-07 | |
| 1xku_A | 330 | Decorin; proteoglycan, leucine-rich repeat, struct | 2e-16 | |
| 1xku_A | 330 | Decorin; proteoglycan, leucine-rich repeat, struct | 1e-11 | |
| 1xku_A | 330 | Decorin; proteoglycan, leucine-rich repeat, struct | 6e-06 | |
| 1xku_A | 330 | Decorin; proteoglycan, leucine-rich repeat, struct | 8e-06 | |
| 3bz5_A | 457 | Internalin-J, INLJ; leucine rich repeat (LRR), cys | 3e-16 | |
| 3bz5_A | 457 | Internalin-J, INLJ; leucine rich repeat (LRR), cys | 2e-12 | |
| 3bz5_A | 457 | Internalin-J, INLJ; leucine rich repeat (LRR), cys | 1e-09 | |
| 2z66_A | 306 | Variable lymphocyte receptor B, TOLL-like recepto; | 3e-16 | |
| 2z66_A | 306 | Variable lymphocyte receptor B, TOLL-like recepto; | 2e-12 | |
| 2z66_A | 306 | Variable lymphocyte receptor B, TOLL-like recepto; | 2e-05 | |
| 1ozn_A | 285 | Reticulon 4 receptor; NOGO receptor, MAD, myelinat | 5e-16 | |
| 1ozn_A | 285 | Reticulon 4 receptor; NOGO receptor, MAD, myelinat | 1e-09 | |
| 2xwt_C | 239 | Thyrotropin receptor; signaling protein-immune sys | 2e-15 | |
| 2xwt_C | 239 | Thyrotropin receptor; signaling protein-immune sys | 3e-14 | |
| 3ub2_A | 146 | TOLL/interleukin-1 receptor domain-containing ADA | 2e-14 | |
| 2z80_A | 353 | TOLL-like receptor 2, variable lymphocyte recepto; | 2e-13 | |
| 2z80_A | 353 | TOLL-like receptor 2, variable lymphocyte recepto; | 4e-10 | |
| 2z80_A | 353 | TOLL-like receptor 2, variable lymphocyte recepto; | 3e-09 | |
| 3rgz_A | 768 | Protein brassinosteroid insensitive 1; phytohormon | 2e-13 | |
| 3rgz_A | 768 | Protein brassinosteroid insensitive 1; phytohormon | 2e-12 | |
| 3rgz_A | 768 | Protein brassinosteroid insensitive 1; phytohormon | 3e-12 | |
| 3rgz_A | 768 | Protein brassinosteroid insensitive 1; phytohormon | 1e-10 | |
| 4ay9_X | 350 | Follicle-stimulating hormone receptor; hormone-rec | 2e-13 | |
| 3a79_B | 562 | TLR6, VLRB.59, TOLL-like receptor 6, variable lymp | 1e-12 | |
| 3a79_B | 562 | TLR6, VLRB.59, TOLL-like receptor 6, variable lymp | 4e-10 | |
| 3a79_B | 562 | TLR6, VLRB.59, TOLL-like receptor 6, variable lymp | 1e-06 | |
| 3a79_B | 562 | TLR6, VLRB.59, TOLL-like receptor 6, variable lymp | 3e-06 | |
| 3a79_B | 562 | TLR6, VLRB.59, TOLL-like receptor 6, variable lymp | 4e-06 | |
| 2p1m_B | 594 | Transport inhibitor response 1 protein; F-BOX, leu | 1e-12 | |
| 2p1m_B | 594 | Transport inhibitor response 1 protein; F-BOX, leu | 6e-11 | |
| 2p1m_B | 594 | Transport inhibitor response 1 protein; F-BOX, leu | 2e-10 | |
| 2p1m_B | 594 | Transport inhibitor response 1 protein; F-BOX, leu | 1e-07 | |
| 1wwl_A | 312 | Monocyte differentiation antigen CD14; LPS, immune | 1e-12 | |
| 3v47_A | 455 | TOLL-like receptor 5B and variable lymphocyte REC | 1e-12 | |
| 3v47_A | 455 | TOLL-like receptor 5B and variable lymphocyte REC | 1e-08 | |
| 3v47_A | 455 | TOLL-like receptor 5B and variable lymphocyte REC | 6e-07 | |
| 3v47_A | 455 | TOLL-like receptor 5B and variable lymphocyte REC | 2e-06 | |
| 2z62_A | 276 | TOLL-like receptor 4, variable lymphocyte recepto; | 3e-12 | |
| 2z62_A | 276 | TOLL-like receptor 4, variable lymphocyte recepto; | 1e-10 | |
| 1h6u_A | 308 | Internalin H; cell adhesion, leucine rich repeat, | 3e-12 | |
| 1h6u_A | 308 | Internalin H; cell adhesion, leucine rich repeat, | 6e-11 | |
| 1h6u_A | 308 | Internalin H; cell adhesion, leucine rich repeat, | 3e-04 | |
| 1m9s_A | 605 | Internalin B; cell invasion, GW domains, SH3 domai | 3e-12 | |
| 1ogq_A | 313 | PGIP-2, polygalacturonase inhibiting protein; inhi | 4e-12 | |
| 1p9a_G | 290 | Platelet glycoprotein IB alpha chain precursor; pl | 3e-11 | |
| 1p9a_G | 290 | Platelet glycoprotein IB alpha chain precursor; pl | 3e-10 | |
| 1p9a_G | 290 | Platelet glycoprotein IB alpha chain precursor; pl | 5e-10 | |
| 3ogk_B | 592 | Coronatine-insensitive protein 1; leucine rich rep | 7e-11 | |
| 3ogk_B | 592 | Coronatine-insensitive protein 1; leucine rich rep | 2e-06 | |
| 3ogk_B | 592 | Coronatine-insensitive protein 1; leucine rich rep | 5e-04 | |
| 2z7x_B | 520 | TOLL-like receptor 1, variable lymphocyte recepto; | 2e-10 | |
| 2z7x_B | 520 | TOLL-like receptor 1, variable lymphocyte recepto; | 4e-09 | |
| 2z7x_B | 520 | TOLL-like receptor 1, variable lymphocyte recepto; | 1e-07 | |
| 2z7x_B | 520 | TOLL-like receptor 1, variable lymphocyte recepto; | 2e-06 | |
| 2z7x_B | 520 | TOLL-like receptor 1, variable lymphocyte recepto; | 6e-06 | |
| 1h6t_A | 291 | Internalin B; cell adhesion, leucine rich repeat, | 3e-10 | |
| 1dce_A | 567 | Protein (RAB geranylgeranyltransferase alpha subun | 6e-10 | |
| 1dce_A | 567 | Protein (RAB geranylgeranyltransferase alpha subun | 3e-06 | |
| 1dce_A | 567 | Protein (RAB geranylgeranyltransferase alpha subun | 6e-04 | |
| 2xot_A | 361 | Amphoterin-induced protein 1; cell adhesion, neuro | 2e-09 | |
| 2xot_A | 361 | Amphoterin-induced protein 1; cell adhesion, neuro | 6e-08 | |
| 2o6q_A | 270 | Variable lymphocyte receptor A; leucine-rich repea | 3e-09 | |
| 2o6q_A | 270 | Variable lymphocyte receptor A; leucine-rich repea | 1e-06 | |
| 4ezg_A | 197 | Putative uncharacterized protein; internalin-A, le | 1e-08 | |
| 4ezg_A | 197 | Putative uncharacterized protein; internalin-A, le | 2e-05 | |
| 3rfs_A | 272 | Internalin B, repeat modules, variable lymphocyte | 3e-07 | |
| 2ast_B | 336 | S-phase kinase-associated protein 2; SCF-substrate | 1e-06 | |
| 2ast_B | 336 | S-phase kinase-associated protein 2; SCF-substrate | 4e-06 | |
| 1xeu_A | 263 | Internalin C; cellular invasion, leucine-rich repe | 2e-06 | |
| 1xeu_A | 263 | Internalin C; cellular invasion, leucine-rich repe | 2e-06 | |
| 2v9t_B | 220 | SLIT homolog 2 protein N-product; structural prote | 2e-06 | |
| 2v9t_B | 220 | SLIT homolog 2 protein N-product; structural prote | 4e-05 | |
| 2ifg_A | 347 | High affinity nerve growth factor receptor; TRK, T | 8e-06 | |
| 2ifg_A | 347 | High affinity nerve growth factor receptor; TRK, T | 8e-06 | |
| 2fna_A | 357 | Conserved hypothetical protein; structural genomic | 1e-05 | |
| 2v70_A | 220 | SLIT-2, SLIT homolog 2 protein N-product; neurogen | 4e-05 | |
| 2v70_A | 220 | SLIT-2, SLIT homolog 2 protein N-product; neurogen | 6e-04 | |
| 3m19_A | 251 | Variable lymphocyte receptor A diversity region; a | 6e-05 | |
| 3m19_A | 251 | Variable lymphocyte receptor A diversity region; a | 7e-05 | |
| 2wfh_A | 193 | SLIT homolog 2 protein C-product; developmental pr | 6e-05 | |
| 1a9n_A | 176 | U2A', U2A'; complex (nuclear protein/RNA), RNA, sn | 1e-04 | |
| 2ca6_A | 386 | RAN GTPase-activating protein 1; GAP, GTPase activ | 2e-04 | |
| 1ds9_A | 198 | Outer arm dynein; leucine-rich repeat, beta-BETA-a | 5e-04 | |
| 2o6r_A | 177 | Variable lymphocyte receptor B; leucine-rich repea | 8e-04 |
| >3ozi_A L6TR; plant TIR domain, plant protein; 2.30A {Linum usitatissimum} Length = 204 | Back alignment and structure |
|---|
Score = 278 bits (713), Expect = 2e-86
Identities = 77/185 (41%), Positives = 104/185 (56%), Gaps = 9/185 (4%)
Query: 1 MASSSSSSG-----NYEVFLNFRGEDTRTSFTCHLYDNLYERKKIRTFIDDEGLRRGDEI 55
++ S++ SG YEVFL+FRG DTR FT LY +L R KI TF DD+ L +G EI
Sbjct: 21 ISDSTNPSGSFPSVEYEVFLSFRGPDTREQFTDFLYQSL-RRYKIHTFRDDDELLKGKEI 79
Query: 56 SPALLNAIQGSKISVVIFSKDYASSKWCLHELLKILECKKMKG-QIIIPVFYGVSPSDVR 114
P LL AI SKI V I S YA SKWCL EL +I+ ++ +II+P+FY V PSDVR
Sbjct: 80 GPNLLRAIDQSKIYVPIISSGYADSKWCLMELAEIVRRQEEDPRRIILPIFYMVDPSDVR 139
Query: 115 HQNGTFGDGFDELKKQFQDKPEMVLKWRDALTETSHLAGHESAKFRHDAQLVNKIVEDVL 174
HQ G + F + +F + + W+DAL + L G K + +K+ D+
Sbjct: 140 HQTGCYKKAFRKHANKF--DGQTIQNWKDALKKVGDLKGWHIGKNDKQGAIADKVSADIW 197
Query: 175 KKLEK 179
+ K
Sbjct: 198 SHISK 202
|
| >3jrn_A AT1G72930 protein; TIR domain arabidopsis thaliana, plant protein; 2.00A {Arabidopsis thaliana} Length = 176 | Back alignment and structure |
|---|
| >3h16_A TIR protein; bacteria TIR domain, signaling protein; 2.50A {Paracoccus denitrificans PD1222} Length = 154 | Back alignment and structure |
|---|
| >4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 | Back alignment and structure |
|---|
| >4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 | Back alignment and structure |
|---|
| >4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 | Back alignment and structure |
|---|
| >4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 | Back alignment and structure |
|---|
| >4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 | Back alignment and structure |
|---|
| >1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 | Back alignment and structure |
|---|
| >1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 | Back alignment and structure |
|---|
| >1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 | Back alignment and structure |
|---|
| >1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 | Back alignment and structure |
|---|
| >2a5y_B CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis elegans} SCOP: a.4.5.80 a.77.1.3 c.37.1.20 PDB: 3lqq_A* 3lqr_A* Length = 549 | Back alignment and structure |
|---|
| >1z6t_A APAF-1, apoptotic protease activating factor 1; caspase activation, ADP, nucleotide binding, CARD, apoptosis; HET: ADP; 2.21A {Homo sapiens} Length = 591 | Back alignment and structure |
|---|
| >4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 | Back alignment and structure |
|---|
| >4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 | Back alignment and structure |
|---|
| >4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 | Back alignment and structure |
|---|
| >4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 | Back alignment and structure |
|---|
| >4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 | Back alignment and structure |
|---|
| >4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 | Back alignment and structure |
|---|
| >4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 | Back alignment and structure |
|---|
| >3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 | Back alignment and structure |
|---|
| >3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 | Back alignment and structure |
|---|
| >3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 | Back alignment and structure |
|---|
| >3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 | Back alignment and structure |
|---|
| >3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* Length = 1249 | Back alignment and structure |
|---|
| >3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 | Back alignment and structure |
|---|
| >3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 | Back alignment and structure |
|---|
| >3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 | Back alignment and structure |
|---|
| >3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 | Back alignment and structure |
|---|
| >1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 | Back alignment and structure |
|---|
| >1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 | Back alignment and structure |
|---|
| >3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 | Back alignment and structure |
|---|
| >3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 | Back alignment and structure |
|---|
| >3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 | Back alignment and structure |
|---|
| >2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 | Back alignment and structure |
|---|
| >2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 | Back alignment and structure |
|---|
| >2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 | Back alignment and structure |
|---|
| >2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 | Back alignment and structure |
|---|
| >2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 | Back alignment and structure |
|---|
| >3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 | Back alignment and structure |
|---|
| >3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 | Back alignment and structure |
|---|
| >3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 | Back alignment and structure |
|---|
| >2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 | Back alignment and structure |
|---|
| >2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 | Back alignment and structure |
|---|
| >2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 | Back alignment and structure |
|---|
| >1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 | Back alignment and structure |
|---|
| >1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 | Back alignment and structure |
|---|
| >1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 | Back alignment and structure |
|---|
| >1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 | Back alignment and structure |
|---|
| >1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 | Back alignment and structure |
|---|
| >3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 | Back alignment and structure |
|---|
| >3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 | Back alignment and structure |
|---|
| >3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 | Back alignment and structure |
|---|
| >3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 | Back alignment and structure |
|---|
| >3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 | Back alignment and structure |
|---|
| >3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 | Back alignment and structure |
|---|
| >3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 | Back alignment and structure |
|---|
| >3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 | Back alignment and structure |
|---|
| >3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 | Back alignment and structure |
|---|
| >3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 | Back alignment and structure |
|---|
| >3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 | Back alignment and structure |
|---|
| >3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 | Back alignment and structure |
|---|
| >3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 | Back alignment and structure |
|---|
| >3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 | Back alignment and structure |
|---|
| >3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 | Back alignment and structure |
|---|
| >3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 | Back alignment and structure |
|---|
| >3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 | Back alignment and structure |
|---|
| >3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 | Back alignment and structure |
|---|
| >3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 | Back alignment and structure |
|---|
| >3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 | Back alignment and structure |
|---|
| >3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 | Back alignment and structure |
|---|
| >3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 | Back alignment and structure |
|---|
| >3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 | Back alignment and structure |
|---|
| >3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 | Back alignment and structure |
|---|
| >3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 | Back alignment and structure |
|---|
| >3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 | Back alignment and structure |
|---|
| >3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 | Back alignment and structure |
|---|
| >3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 | Back alignment and structure |
|---|
| >3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 | Back alignment and structure |
|---|
| >4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 | Back alignment and structure |
|---|
| >4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 | Back alignment and structure |
|---|
| >2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 | Back alignment and structure |
|---|
| >2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 | Back alignment and structure |
|---|
| >2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 | Back alignment and structure |
|---|
| >2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 | Back alignment and structure |
|---|
| >2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 | Back alignment and structure |
|---|
| >2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 | Back alignment and structure |
|---|
| >2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 | Back alignment and structure |
|---|
| >2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 | Back alignment and structure |
|---|
| >1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 | Back alignment and structure |
|---|
| >1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 | Back alignment and structure |
|---|
| >1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 | Back alignment and structure |
|---|
| >1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 | Back alignment and structure |
|---|
| >3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 | Back alignment and structure |
|---|
| >3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 | Back alignment and structure |
|---|
| >3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 | Back alignment and structure |
|---|
| >2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 | Back alignment and structure |
|---|
| >2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 | Back alignment and structure |
|---|
| >2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 | Back alignment and structure |
|---|
| >1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 | Back alignment and structure |
|---|
| >1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 | Back alignment and structure |
|---|
| >2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 | Back alignment and structure |
|---|
| >2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 | Back alignment and structure |
|---|
| >3ub2_A TOLL/interleukin-1 receptor domain-containing ADA protein; TIR domain, TLRS adaptor, immune system; 2.40A {Homo sapiens} PDB: 3ub3_A 3ub4_A 2y92_A Length = 146 | Back alignment and structure |
|---|
| >2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 | Back alignment and structure |
|---|
| >2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 | Back alignment and structure |
|---|
| >2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 | Back alignment and structure |
|---|
| >3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 | Back alignment and structure |
|---|
| >3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 | Back alignment and structure |
|---|
| >3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 | Back alignment and structure |
|---|
| >3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 | Back alignment and structure |
|---|
| >4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 | Back alignment and structure |
|---|
| >3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 | Back alignment and structure |
|---|
| >3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 | Back alignment and structure |
|---|
| >3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 | Back alignment and structure |
|---|
| >3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 | Back alignment and structure |
|---|
| >3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 | Back alignment and structure |
|---|
| >2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 | Back alignment and structure |
|---|
| >2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 | Back alignment and structure |
|---|
| >2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 | Back alignment and structure |
|---|
| >2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 | Back alignment and structure |
|---|
| >1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 | Back alignment and structure |
|---|
| >3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 | Back alignment and structure |
|---|
| >3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 | Back alignment and structure |
|---|
| >3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 | Back alignment and structure |
|---|
| >3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 | Back alignment and structure |
|---|
| >2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 | Back alignment and structure |
|---|
| >2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 | Back alignment and structure |
|---|
| >1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 | Back alignment and structure |
|---|
| >1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 | Back alignment and structure |
|---|
| >1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 | Back alignment and structure |
|---|
| >1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 | Back alignment and structure |
|---|
| >1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 | Back alignment and structure |
|---|
| >1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 | Back alignment and structure |
|---|
| >1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 | Back alignment and structure |
|---|
| >1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 | Back alignment and structure |
|---|
| >3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 | Back alignment and structure |
|---|
| >3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 | Back alignment and structure |
|---|
| >3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 | Back alignment and structure |
|---|
| >2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 | Back alignment and structure |
|---|
| >2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 | Back alignment and structure |
|---|
| >2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 | Back alignment and structure |
|---|
| >2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 | Back alignment and structure |
|---|
| >2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 | Back alignment and structure |
|---|
| >1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 | Back alignment and structure |
|---|
| >1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 | Back alignment and structure |
|---|
| >1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 | Back alignment and structure |
|---|
| >1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 | Back alignment and structure |
|---|
| >2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 | Back alignment and structure |
|---|
| >2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 | Back alignment and structure |
|---|
| >2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 | Back alignment and structure |
|---|
| >2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 | Back alignment and structure |
|---|
| >4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 | Back alignment and structure |
|---|
| >4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 | Back alignment and structure |
|---|
| >3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 | Back alignment and structure |
|---|
| >2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336 | Back alignment and structure |
|---|
| >2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336 | Back alignment and structure |
|---|
| >1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 | Back alignment and structure |
|---|
| >1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 | Back alignment and structure |
|---|
| >2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 | Back alignment and structure |
|---|
| >2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 | Back alignment and structure |
|---|
| >2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 | Back alignment and structure |
|---|
| >2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 | Back alignment and structure |
|---|
| >2fna_A Conserved hypothetical protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE ADP; 2.00A {Sulfolobus solfataricus} SCOP: a.4.5.11 c.37.1.20 Length = 357 | Back alignment and structure |
|---|
| >2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 | Back alignment and structure |
|---|
| >2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 | Back alignment and structure |
|---|
| >3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 | Back alignment and structure |
|---|
| >3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 | Back alignment and structure |
|---|
| >2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 | Back alignment and structure |
|---|
| >1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 | Back alignment and structure |
|---|
| >2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 | Back alignment and structure |
|---|
| >1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 | Back alignment and structure |
|---|
| >2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Length = 177 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
No hit with probability above 80.00
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 1288 | ||||
| d2a5yb3 | 277 | c.37.1.20 (B:109-385) CED-4, NB-ARC domain {Caenor | 3e-33 | |
| d1fyva_ | 161 | c.23.2.1 (A:) Toll-like receptor 1, TLR1 {Human (H | 4e-18 | |
| d1fyxa_ | 149 | c.23.2.1 (A:) Toll-like receptor 2, TLR2 {Human (H | 1e-17 | |
| d1jl5a_ | 353 | c.10.2.6 (A:) Leucine rich effector protein YopM { | 4e-10 | |
| d1jl5a_ | 353 | c.10.2.6 (A:) Leucine rich effector protein YopM { | 3e-09 | |
| d1jl5a_ | 353 | c.10.2.6 (A:) Leucine rich effector protein YopM { | 8e-09 | |
| d1jl5a_ | 353 | c.10.2.6 (A:) Leucine rich effector protein YopM { | 1e-05 | |
| d1jl5a_ | 353 | c.10.2.6 (A:) Leucine rich effector protein YopM { | 5e-05 | |
| d1jl5a_ | 353 | c.10.2.6 (A:) Leucine rich effector protein YopM { | 6e-05 | |
| d1jl5a_ | 353 | c.10.2.6 (A:) Leucine rich effector protein YopM { | 8e-05 | |
| d1jl5a_ | 353 | c.10.2.6 (A:) Leucine rich effector protein YopM { | 0.002 | |
| d1xkua_ | 305 | c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 | 4e-10 | |
| d1xkua_ | 305 | c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 | 2e-05 | |
| d2omza2 | 384 | c.10.2.1 (A:33-416) Internalin A {Listeria monocyt | 1e-06 | |
| d1p9ag_ | 266 | c.10.2.7 (G:) von Willebrand factor binding domain | 2e-06 | |
| d1p9ag_ | 266 | c.10.2.7 (G:) von Willebrand factor binding domain | 4e-04 | |
| d2astb2 | 284 | c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 | 5e-06 | |
| d2astb2 | 284 | c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 | 2e-04 | |
| d1ogqa_ | 313 | c.10.2.8 (A:) Polygalacturonase inhibiting protein | 2e-05 | |
| d2ca6a1 | 344 | c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom | 2e-04 | |
| d1dcea3 | 124 | c.10.2.2 (A:444-567) Rab geranylgeranyltransferase | 0.001 | |
| d1h6ua2 | 227 | c.10.2.1 (A:36-262) Internalin H {Listeria monocyt | 0.001 | |
| d1ozna_ | 284 | c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept | 0.001 | |
| d1xwdc1 | 242 | c.10.2.7 (C:18-259) Follicle-stimulating hormone r | 0.003 |
| >d2a5yb3 c.37.1.20 (B:109-385) CED-4, NB-ARC domain {Caenorhabditis elegans [TaxId: 6239]} Length = 277 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: P-loop containing nucleoside triphosphate hydrolases superfamily: P-loop containing nucleoside triphosphate hydrolases family: Extended AAA-ATPase domain domain: CED-4, NB-ARC domain species: Caenorhabditis elegans [TaxId: 6239]
Score = 128 bits (321), Expect = 3e-33
Identities = 36/266 (13%), Positives = 80/266 (30%), Gaps = 25/266 (9%)
Query: 190 LVGLNSRIEQIKPFLCMDSSDTVQIVGIWGMGGIGKTTLAKAIFDQF----SHEFEGSCF 245
++++ L + + G G GK+ +A + ++ +
Sbjct: 22 CYIREYHVDRVIKKLDEMCDLDSFFLFLHGRAGSGKSVIASQALSKSDQLIGINYDSIVW 81
Query: 246 VSDVRGNSETAGGLEHLQKQMLSTTLSEKLEVAGPNI--------PHFTKERVRRMKLLI 297
+ D ++ + +L + L + R L
Sbjct: 82 LKDSGTAPKS--TFDLFTDILLMLKSEDDLLNFPSVEHVTSVVLKRMICNALIDRPNTLF 139
Query: 298 VLDDVNEVGQLKRLIGELDQFGQGSRIVVTTRDKRVLEKFRGEEKKIYRVNGLEFEEAFE 357
V DDV + ++ R +VTTRD + + V LE +E ++
Sbjct: 140 VFDDVVQEETIRWA------QELRLRCLVTTRDVEISNAASQ-TCEFIEVTSLEIDECYD 192
Query: 358 HFCNFAFKENHCPEDLNWHSRSVVSYTKGNPLVLEVLGSSLCLKRKSHWGKVLHDLNRIC 417
+ ++ + + + GNP L + S K + K+ N++
Sbjct: 193 FLEAYGMPMPVGEKEEDV-LNKTIELSSGNPATLMMFFKSCEPKT---FEKMAQLNNKLE 248
Query: 418 ESEIHDIYDILKISFNKLTPRVKSIF 443
+ + I S+ L ++
Sbjct: 249 SRGLVGVECITPYSYKSLAMALQRCV 274
|
| >d1fyva_ c.23.2.1 (A:) Toll-like receptor 1, TLR1 {Human (Homo sapiens) [TaxId: 9606]} Length = 161 | Back information, alignment and structure |
|---|
| >d1fyxa_ c.23.2.1 (A:) Toll-like receptor 2, TLR2 {Human (Homo sapiens) [TaxId: 9606]} Length = 149 | Back information, alignment and structure |
|---|
| >d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 | Back information, alignment and structure |
|---|
| >d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 | Back information, alignment and structure |
|---|
| >d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 | Back information, alignment and structure |
|---|
| >d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 | Back information, alignment and structure |
|---|
| >d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 | Back information, alignment and structure |
|---|
| >d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 | Back information, alignment and structure |
|---|
| >d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 | Back information, alignment and structure |
|---|
| >d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 | Back information, alignment and structure |
|---|
| >d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 | Back information, alignment and structure |
|---|
| >d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 | Back information, alignment and structure |
|---|
| >d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 | Back information, alignment and structure |
|---|
| >d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 | Back information, alignment and structure |
|---|
| >d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 | Back information, alignment and structure |
|---|
| >d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 | Back information, alignment and structure |
|---|
| >d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 | Back information, alignment and structure |
|---|
| >d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 | Back information, alignment and structure |
|---|
| >d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344 | Back information, alignment and structure |
|---|
| >d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 | Back information, alignment and structure |
|---|
| >d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 | Back information, alignment and structure |
|---|
| >d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 | Back information, alignment and structure |
|---|
| >d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 1288 | |||
| d2a5yb3 | 277 | CED-4, NB-ARC domain {Caenorhabditis elegans [TaxI | 100.0 | |
| d2omza2 | 384 | Internalin A {Listeria monocytogenes [TaxId: 1639] | 99.94 | |
| d2omza2 | 384 | Internalin A {Listeria monocytogenes [TaxId: 1639] | 99.93 | |
| d1jl5a_ | 353 | Leucine rich effector protein YopM {Yersinia pesti | 99.91 | |
| d1ogqa_ | 313 | Polygalacturonase inhibiting protein PGIP {Kidney | 99.9 | |
| d1ogqa_ | 313 | Polygalacturonase inhibiting protein PGIP {Kidney | 99.9 | |
| d1jl5a_ | 353 | Leucine rich effector protein YopM {Yersinia pesti | 99.89 | |
| d1xkua_ | 305 | Decorin {Cow (Bos taurus) [TaxId: 9913]} | 99.89 | |
| d1xkua_ | 305 | Decorin {Cow (Bos taurus) [TaxId: 9913]} | 99.86 | |
| d1p9ag_ | 266 | von Willebrand factor binding domain of glycoprote | 99.79 | |
| d1ozna_ | 284 | Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma | 99.78 | |
| d1ozna_ | 284 | Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma | 99.78 | |
| d1p9ag_ | 266 | von Willebrand factor binding domain of glycoprote | 99.77 | |
| d1fyva_ | 161 | Toll-like receptor 1, TLR1 {Human (Homo sapiens) [ | 99.75 | |
| d1h6ua2 | 227 | Internalin H {Listeria monocytogenes [TaxId: 1639] | 99.7 | |
| d1fyxa_ | 149 | Toll-like receptor 2, TLR2 {Human (Homo sapiens) [ | 99.69 | |
| d1h6ua2 | 227 | Internalin H {Listeria monocytogenes [TaxId: 1639] | 99.62 | |
| d2omxa2 | 199 | Internalin B {Listeria monocytogenes [TaxId: 1639] | 99.58 | |
| d1xwdc1 | 242 | Follicle-stimulating hormone receptor {Human (Homo | 99.57 | |
| d1h6ta2 | 210 | Internalin B {Listeria monocytogenes [TaxId: 1639] | 99.56 | |
| d1xwdc1 | 242 | Follicle-stimulating hormone receptor {Human (Homo | 99.54 | |
| d2omxa2 | 199 | Internalin B {Listeria monocytogenes [TaxId: 1639] | 99.5 | |
| d2fnaa2 | 283 | Archaeal ATPase SSO1545 {Sulfolobus solfataricus [ | 99.5 | |
| d2astb2 | 284 | Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa | 99.49 | |
| d2astb2 | 284 | Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa | 99.46 | |
| d1z7xw1 | 460 | Ribonuclease inhibitor {Human (Homo sapiens) [TaxI | 99.4 | |
| d1z7xw1 | 460 | Ribonuclease inhibitor {Human (Homo sapiens) [TaxI | 99.35 | |
| d1w8aa_ | 192 | Slit {Fruit fly (Drosophila melanogaster) [TaxId: | 99.21 | |
| d2ca6a1 | 344 | Rna1p (RanGAP1), N-terminal domain {Fission yeast | 99.15 | |
| d2ca6a1 | 344 | Rna1p (RanGAP1), N-terminal domain {Fission yeast | 99.14 | |
| d1fnna2 | 276 | CDC6, N-domain {Archaeon Pyrobaculum aerophilum [T | 99.07 | |
| d1a9na_ | 162 | Splicesomal U2A' protein {Human (Homo sapiens) [Ta | 99.02 | |
| d1r6bx2 | 268 | ClpA, an Hsp100 chaperone, AAA+ modules {Escherich | 98.99 | |
| d1sxjd2 | 237 | Replication factor C2 {Baker's yeast (Saccharomyce | 98.98 | |
| d1sxjc2 | 227 | Replication factor C3 {Baker's yeast (Saccharomyce | 98.93 | |
| d1iqpa2 | 231 | Replication factor C {Archaeon Pyrococcus furiosus | 98.9 | |
| d1sxje2 | 252 | Replication factor C5 {Baker's yeast (Saccharomyce | 98.88 | |
| d1sxjb2 | 224 | Replication factor C4 {Baker's yeast (Saccharomyce | 98.87 | |
| d1dcea3 | 124 | Rab geranylgeranyltransferase alpha-subunit, C-ter | 98.82 | |
| d1m9la_ | 198 | Outer arm dynein light chain 1 {Green algae (Chlam | 98.77 | |
| d1w5sa2 | 287 | CDC6-like protein APE0152, N-terminal domain {Aero | 98.77 | |
| d1njfa_ | 239 | delta prime subunit of DNA polymerase III, N-domai | 98.77 | |
| d1jbka_ | 195 | ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} | 98.76 | |
| d1e32a2 | 258 | Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu | 98.75 | |
| d1m9la_ | 198 | Outer arm dynein light chain 1 {Green algae (Chlam | 98.72 | |
| d2ifga3 | 156 | High affinity nerve growth factor receptor, N-term | 98.72 | |
| d1ixza_ | 247 | AAA domain of cell division protein FtsH {Thermus | 98.71 | |
| d1qvra2 | 387 | ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 | 98.7 | |
| d1sxja2 | 253 | Replication factor C1 {Baker's yeast (Saccharomyce | 98.69 | |
| d1a5ta2 | 207 | delta prime subunit of DNA polymerase III, N-domai | 98.67 | |
| d1lv7a_ | 256 | AAA domain of cell division protein FtsH {Escheric | 98.63 | |
| d1r7ra3 | 265 | Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu | 98.62 | |
| d2ifga3 | 156 | High affinity nerve growth factor receptor, N-term | 98.62 | |
| d1in4a2 | 238 | Holliday junction helicase RuvB {Thermotoga mariti | 98.59 | |
| d1d2na_ | 246 | Hexamerization domain of N-ethylmalemide-sensitive | 98.55 | |
| d1ixsb2 | 239 | Holliday junction helicase RuvB {Thermus thermophi | 98.52 | |
| d1l8qa2 | 213 | Chromosomal replication initiation factor DnaA {Aq | 98.49 | |
| d1ny5a2 | 247 | Transcriptional activator sigm54 (NtrC1), C-termin | 97.7 | |
| d1qvra3 | 315 | ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 | 97.55 | |
| d1r6bx3 | 315 | ClpA, an Hsp100 chaperone, AAA+ modules {Escherich | 97.44 | |
| d2gnoa2 | 198 | gamma subunit of DNA polymerase III, N-domain {The | 97.36 | |
| d1gvnb_ | 273 | Plasmid maintenance system epsilon/zeta, toxin zet | 97.34 | |
| d1rz3a_ | 198 | Hypothetical protein rbstp0775 {Bacillus stearothe | 97.15 | |
| d1ye8a1 | 178 | Hypothetical kinase-like protein Aq_1292 {Aquifex | 96.97 | |
| d1m8pa3 | 183 | ATP sulfurylase C-terminal domain {Fungus (Penicil | 96.96 | |
| d1lw7a2 | 192 | Transcriptional regulator NadR, ribosylnicotinamid | 96.94 | |
| d1ofha_ | 309 | HslU {Haemophilus influenzae [TaxId: 727]} | 96.85 | |
| d2qy9a2 | 211 | GTPase domain of the signal recognition particle r | 96.8 | |
| d1x6va3 | 195 | Adenosine-5'phosphosulfate kinase (APS kinase) {Hu | 96.77 | |
| d2i3ba1 | 189 | Cancer-related NTPase, C1orf57 {Human (Homo sapien | 96.72 | |
| d1koha1 | 162 | mRNA export factor tap {Human (Homo sapiens) [TaxI | 96.68 | |
| d1kaga_ | 169 | Shikimate kinase (AroK) {Escherichia coli [TaxId: | 96.62 | |
| d1ls1a2 | 207 | GTPase domain of the signal sequence recognition p | 96.47 | |
| d2bdta1 | 176 | Hypothetical protein BH3686 {Bacillus halodurans [ | 96.43 | |
| d1np6a_ | 170 | Molybdopterin-guanine dinucleotide biosynthesis pr | 96.41 | |
| d2iyva1 | 165 | Shikimate kinase (AroK) {Mycobacterium tuberculosi | 96.41 | |
| d1w44a_ | 321 | NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} | 96.4 | |
| d1ihua2 | 279 | Arsenite-translocating ATPase ArsA {Escherichia co | 96.39 | |
| d1cp2a_ | 269 | Nitrogenase iron protein {Clostridium pasteurianum | 96.35 | |
| d2qm8a1 | 323 | Metallochaperone MeaB {Methylobacterium extorquens | 96.33 | |
| d1svma_ | 362 | Papillomavirus large T antigen helicase domain {Si | 96.32 | |
| d1sq5a_ | 308 | Pantothenate kinase PanK {Escherichia coli [TaxId: | 96.31 | |
| d2p67a1 | 327 | LAO/AO transport system kinase ArgK {Escherichia c | 96.31 | |
| d1rkba_ | 173 | Adenylate kinase {Human (Homo sapiens), isoenzyme | 96.29 | |
| d1qhxa_ | 178 | Chloramphenicol phosphotransferase {Streptomyces v | 96.23 | |
| d1knqa_ | 171 | Gluconate kinase {Escherichia coli [TaxId: 562]} | 96.23 | |
| d1khta_ | 190 | Adenylate kinase {Archaeon Methanococcus voltae [T | 96.2 | |
| d1viaa_ | 161 | Shikimate kinase (AroK) {Campylobacter jejuni [Tax | 96.11 | |
| d1bifa1 | 213 | 6-phosphofructo-2-kinase/fructose-2,6-bisphosphata | 96.1 | |
| d1ly1a_ | 152 | Polynucleotide kinase, kinase domain {Bacteriophag | 96.09 | |
| d1u94a1 | 263 | RecA protein, ATPase-domain {Escherichia coli [Tax | 96.06 | |
| d1vmaa2 | 213 | GTPase domain of the signal recognition particle r | 96.06 | |
| d1e6ca_ | 170 | Shikimate kinase (AroK) {Erwinia chrysanthemi [Tax | 95.98 | |
| d1m7ga_ | 208 | Adenosine-5'phosphosulfate kinase (APS kinase) {Fu | 95.98 | |
| d1qf9a_ | 194 | UMP/CMP kinase {Dictyostelium discoideum [TaxId: 4 | 95.97 | |
| d1pgva_ | 167 | Tropomodulin C-terminal domain {nematode (Caenorha | 95.94 | |
| d1nksa_ | 194 | Adenylate kinase {Archaeon Sulfolobus acidocaldari | 95.93 | |
| d2jdid3 | 276 | Central domain of beta subunit of F1 ATP synthase | 95.92 | |
| d1tf7a2 | 242 | Circadian clock protein KaiC {Synechococcus sp. st | 95.9 | |
| d1xjca_ | 165 | Molybdopterin-guanine dinucleotide biosynthesis pr | 95.88 | |
| d1y63a_ | 174 | Probable kinase LmjF30.1890 {Leishmania major [Tax | 95.82 | |
| d1yj5a2 | 172 | 5' polynucleotide kinase-3' phosphatase, C-termina | 95.82 | |
| d1ukza_ | 196 | Uridylate kinase {Baker's yeast (Saccharomyces cer | 95.79 | |
| d2afhe1 | 289 | Nitrogenase iron protein {Azotobacter vinelandii [ | 95.74 | |
| d1zp6a1 | 176 | Hypothetical protein Atu3015 {Agrobacterium tumefa | 95.73 | |
| d1g8pa_ | 333 | ATPase subunit of magnesium chelatase, BchI {Rhodo | 95.66 | |
| d1uj2a_ | 213 | Uridine-cytidine kinase 2 {Human (Homo sapiens) [T | 95.65 | |
| d1j8yf2 | 211 | GTPase domain of the signal sequence recognition p | 95.64 | |
| d1ckea_ | 225 | CMP kinase {Escherichia coli [TaxId: 562]} | 95.64 | |
| d1ihua1 | 296 | Arsenite-translocating ATPase ArsA {Escherichia co | 95.6 | |
| d1xp8a1 | 268 | RecA protein, ATPase-domain {Deinococcus radiodura | 95.51 | |
| d3b60a1 | 253 | Multidrug resistance ABC transporter MsbA, C-termi | 95.51 | |
| d1v43a3 | 239 | Hypothetical protein PH0022, N-terminal domain {Py | 95.48 | |
| d1okkd2 | 207 | GTPase domain of the signal recognition particle r | 95.46 | |
| d1gkya_ | 186 | Guanylate kinase {Baker's yeast (Saccharomyces cer | 95.38 | |
| d1lvga_ | 190 | Guanylate kinase {Mouse (Mus musculus) [TaxId: 100 | 95.32 | |
| d2awna2 | 232 | Maltose transport protein MalK, N-terminal domain | 95.29 | |
| d1nn5a_ | 209 | Thymidylate kinase {Human (Homo sapiens) [TaxId: 9 | 95.19 | |
| d3adka_ | 194 | Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} | 95.14 | |
| d1xpua3 | 289 | Transcription termination factor Rho, ATPase domai | 95.09 | |
| d1q3ta_ | 223 | CMP kinase {Streptococcus pneumoniae [TaxId: 1313] | 95.05 | |
| d1kgda_ | 178 | Guanylate kinase-like domain of Cask {Human (Homo | 95.02 | |
| d1teva_ | 194 | UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606] | 95.0 | |
| d1p9ra_ | 401 | Extracellular secretion NTPase EpsE {Vibrio choler | 94.92 | |
| d1odfa_ | 286 | Hypothetical protein Ygr205W {Baker's yeast (Sacch | 94.89 | |
| d1um8a_ | 364 | ClpX {Helicobacter pylori [TaxId: 210]} | 94.87 | |
| d1oxxk2 | 242 | Glucose transport protein GlcV, N-terminal domain | 94.74 | |
| d1zaka1 | 189 | Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} | 94.74 | |
| d1hyqa_ | 232 | Cell division regulator MinD {Archaeon Archaeoglob | 94.68 | |
| d1ak2a1 | 190 | Adenylate kinase {Cow (Bos taurus), mitochondrial | 94.65 | |
| d1g41a_ | 443 | HslU {Haemophilus influenzae [TaxId: 727]} | 94.58 | |
| d1v5wa_ | 258 | Meiotic recombination protein DMC1/LIM15 homolog { | 94.53 | |
| d1fx0a3 | 276 | Central domain of alpha subunit of F1 ATP synthase | 94.47 | |
| d1a7ja_ | 288 | Phosphoribulokinase {Rhodobacter sphaeroides [TaxI | 94.4 | |
| d1zina1 | 182 | Adenylate kinase {Bacillus stearothermophilus [Tax | 94.33 | |
| d1mo6a1 | 269 | RecA protein, ATPase-domain {Mycobacterium tubercu | 94.25 | |
| d1g3qa_ | 237 | Cell division regulator MinD {Archaeon Pyrococcus | 94.25 | |
| d2cdna1 | 181 | Adenylate kinase {Mycobacterium tuberculosis [TaxI | 94.2 | |
| d2ak3a1 | 189 | Adenylate kinase {Cow (Bos taurus), mitochondrial | 94.19 | |
| d2hyda1 | 255 | Putative multidrug export ATP-binding/permease pro | 94.15 | |
| d1akya1 | 180 | Adenylate kinase {Baker's yeast (Saccharomyces cer | 94.15 | |
| d1pzna2 | 254 | DNA repair protein Rad51, catalytic domain {Archae | 94.11 | |
| d1znwa1 | 182 | Guanylate kinase {Mycobacterium tuberculosis [TaxI | 94.04 | |
| d1io0a_ | 166 | Tropomodulin C-terminal domain {Chicken (Gallus ga | 94.03 | |
| d1uf9a_ | 191 | Dephospho-CoA kinase {Thermus thermophilus [TaxId: | 94.02 | |
| d2ocpa1 | 241 | Deoxyguanosine kinase {Human (Homo sapiens) [TaxId | 93.79 | |
| d1s3ga1 | 182 | Adenylate kinase {Bacillus globisporus [TaxId: 145 | 93.79 | |
| d1tf7a1 | 242 | Circadian clock protein KaiC {Synechococcus sp. st | 93.66 | |
| d2jdia3 | 285 | Central domain of alpha subunit of F1 ATP synthase | 93.55 | |
| d1yrba1 | 244 | ATP(GTP)-binding protein PAB0955 {Pyrococcus abyss | 93.5 | |
| d1e4va1 | 179 | Adenylate kinase {Escherichia coli [TaxId: 562]} | 93.37 | |
| d2vp4a1 | 197 | Deoxyribonucleoside kinase {Fruit fly (Drosophila | 93.28 | |
| d2i1qa2 | 258 | DNA repair protein Rad51, catalytic domain {Archae | 93.24 | |
| d1n0wa_ | 242 | DNA repair protein Rad51, catalytic domain {Human | 93.14 | |
| d1s96a_ | 205 | Guanylate kinase {Escherichia coli [TaxId: 562]} | 92.98 | |
| d1g6oa_ | 323 | Hexameric traffic ATPase, HP0525 {Helicobacter pyl | 92.91 | |
| d1gsia_ | 208 | Thymidylate kinase {Mycobacterium tuberculosis [Ta | 92.86 | |
| d1byia_ | 224 | Dethiobiotin synthetase {Escherichia coli [TaxId: | 92.78 | |
| d1tmka_ | 214 | Thymidylate kinase {Baker's yeast (Saccharomyces c | 92.76 | |
| d1szpa2 | 251 | DNA repair protein Rad51, catalytic domain {Baker' | 92.28 | |
| d1vhta_ | 208 | Dephospho-CoA kinase {Escherichia coli [TaxId: 562 | 91.55 | |
| d1p6xa_ | 333 | Thymidine kinase {Equine herpesvirus type 4 [TaxId | 91.46 | |
| d1p5zb_ | 241 | Deoxycytidine kinase {Human (Homo sapiens) [TaxId: | 91.39 | |
| d1r0wa_ | 281 | Cystic fibrosis transmembrane conductance regulato | 91.36 | |
| d4tmka_ | 210 | Thymidylate kinase {Escherichia coli [TaxId: 562]} | 91.15 | |
| d1g2912 | 240 | Maltose transport protein MalK, N-terminal domain | 91.1 | |
| d1w36d1 | 359 | Exodeoxyribonuclease V alpha chain (RecD) {Escheri | 91.04 | |
| d1b0ua_ | 258 | ATP-binding subunit of the histidine permease {Sal | 90.81 | |
| d3dhwc1 | 240 | Methionine import ATP-binding protein MetN {Escher | 90.68 | |
| d1jjva_ | 205 | Dephospho-CoA kinase {Haemophilus influenzae [TaxI | 90.66 | |
| d1deka_ | 241 | Deoxynucleoside monophosphate kinase {Bacteriophag | 90.6 | |
| d2pmka1 | 241 | Haemolysin B ATP-binding protein {Escherichia coli | 90.44 | |
| d1mv5a_ | 242 | Multidrug resistance ABC transporter LmrA, C-termi | 90.43 | |
| d1cr2a_ | 277 | Gene 4 protein (g4p, DNA primase), helicase domain | 90.39 | |
| d1puja_ | 273 | Probable GTPase YlqF {Bacillus subtilis [TaxId: 14 | 90.24 | |
| d1jj7a_ | 251 | Peptide transporter Tap1, C-terminal ABC domain {H | 90.15 | |
| d1htwa_ | 158 | Hypothetical protein HI0065 {Haemophilus influenza | 89.97 | |
| d1f6ba_ | 186 | SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: | 89.94 | |
| d1l2ta_ | 230 | MJ0796 {Archaeon Methanococcus jannaschii [TaxId: | 89.9 | |
| d1nlfa_ | 274 | Hexameric replicative helicase repA {Escherichia c | 89.78 | |
| d3d31a2 | 229 | Sulfate/molybdate ABC transporter, ATP-binding pro | 89.6 | |
| d1sgwa_ | 200 | Putative ABC transporter PF0895 {Pyrococcus furios | 89.56 | |
| d1fzqa_ | 176 | ADP-ribosylation factor {Mouse (Mus musculus), ARL | 89.55 | |
| d1r8sa_ | 160 | ADP-ribosylation factor {Human (Homo sapiens), ARF | 89.47 | |
| d1svia_ | 195 | Probable GTPase EngB {Bacillus subtilis [TaxId: 14 | 89.35 | |
| d2onka1 | 240 | Molybdate/tungstate import ATP-binding protein Wtp | 89.3 | |
| d2atva1 | 168 | Ras-like estrogen-regulated growth inhibitor, RERG | 89.22 | |
| d2bv3a2 | 276 | Elongation factor G (EF-G), N-terminal (G) domain | 89.03 | |
| d1z06a1 | 165 | Rab-33b {Mouse (Mus musculus) [TaxId: 10090]} | 89.0 | |
| d1nija1 | 222 | Hypothetical protein YjiA, N-terminal domain {Esch | 88.99 | |
| d2a5ja1 | 173 | Rab2b {Human (Homo sapiens) [TaxId: 9606]} | 88.98 | |
| d1z0fa1 | 166 | Rab14 {Human (Homo sapiens) [TaxId: 9606]} | 88.85 | |
| d1z2aa1 | 164 | Rab23 {Mouse (Mus musculus) [TaxId: 10090]} | 88.72 | |
| d2ew1a1 | 171 | Rab30 {Human (Homo sapiens) [TaxId: 9606]} | 88.41 | |
| d1upta_ | 169 | ADP-ribosylation factor {Human (Homo sapiens), ARL | 88.36 | |
| d2fh5b1 | 207 | Signal recognition particle receptor beta-subunit | 88.3 | |
| d1osna_ | 331 | Thymidine kinase {Varicella-zoster virus [TaxId: 1 | 88.29 | |
| d1yzqa1 | 164 | Rab6 {Human (Homo sapiens) [TaxId: 9606]} | 88.19 | |
| d2fn4a1 | 173 | r-Ras {Human (Homo sapiens) [TaxId: 9606]} | 88.16 | |
| d1z08a1 | 167 | Rab21 {Human (Homo sapiens) [TaxId: 9606]} | 88.08 | |
| d3raba_ | 169 | Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} | 87.97 | |
| d1r2qa_ | 170 | Rab5a {Human (Homo sapiens) [TaxId: 9606]} | 87.82 | |
| d1kmqa_ | 177 | RhoA {Human (Homo sapiens) [TaxId: 9606]} | 87.69 | |
| d1g16a_ | 166 | Rab-related protein Sec4 {Baker's yeast (Saccharom | 87.66 | |
| d2erxa1 | 171 | di-Ras2 {Human (Homo sapiens) [TaxId: 9606]} | 87.55 | |
| d1g6ha_ | 254 | MJ1267 {Archaeon Methanococcus jannaschii [TaxId: | 87.52 | |
| d2bmea1 | 174 | Rab4a {Human (Homo sapiens) [TaxId: 9606]} | 87.51 | |
| d1mkya1 | 171 | Probable GTPase Der, N-terminal and middle domains | 87.51 | |
| d1z0ja1 | 167 | Rab-22a {Mouse (Mus musculus) [TaxId: 10090]} | 87.47 | |
| d1u0la2 | 225 | Probable GTPase EngC (YjeQ), C-terminal domain {Th | 87.41 | |
| d1kaoa_ | 167 | Rap2a {Human (Homo sapiens) [TaxId: 9606]} | 87.35 | |
| d2erya1 | 171 | r-Ras2 {Human (Homo sapiens) [TaxId: 9606]} | 87.35 | |
| d2bcgy1 | 194 | GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisi | 87.33 | |
| d2atxa1 | 185 | RhoQ {Human (Homo sapiens) [TaxId: 9606]} | 87.32 | |
| d2f7sa1 | 186 | Rab27b {Human (Homo sapiens) [TaxId: 9606]} | 87.31 | |
| d1wf3a1 | 178 | GTPase Era, N-terminal domain {Thermus thermophilu | 87.29 | |
| d1xtqa1 | 167 | GTP-binding protein RheB {Human (Homo sapiens) [Ta | 87.24 | |
| d2gjsa1 | 168 | Rad {Human (Homo sapiens) [TaxId: 9606]} | 87.14 | |
| d1ky3a_ | 175 | Rab-related protein ypt7p {Baker's yeast (Saccharo | 87.09 | |
| d1vpla_ | 238 | Putative ABC transporter TM0544 {Thermotoga mariti | 87.05 | |
| d1ji0a_ | 240 | Branched chain aminoacid ABC transporter {Thermoto | 87.03 | |
| d1mh1a_ | 183 | Rac {Human (Homo sapiens) [TaxId: 9606]} | 87.03 | |
| d1moza_ | 182 | ADP-ribosylation factor {Baker's yeast (Saccharomy | 86.97 | |
| d1svsa1 | 195 | Transducin (alpha subunit) {Rat (Rattus norvegicus | 86.79 | |
| d1h65a_ | 257 | Chloroplast protein translocon GTPase Toc34 {Garde | 86.77 | |
| d1m7ba_ | 179 | RhoE (RND3) {Mouse (Mus musculus) [TaxId: 10090]} | 86.75 | |
| d1c1ya_ | 167 | Rap1A {Human (Homo sapiens) [TaxId: 9606]} | 86.72 | |
| d1kkma_ | 176 | HPr kinase HprK C-terminal domain {Lactobacillus c | 86.68 | |
| d1zcba2 | 200 | Transducin (alpha subunit) {Mouse (Mus musculus) [ | 86.68 | |
| d2g6ba1 | 170 | Rab26 {Human (Homo sapiens) [TaxId: 9606]} | 86.53 | |
| d1nrjb_ | 209 | Signal recognition particle receptor beta-subunit | 86.52 | |
| d1ksha_ | 165 | ADP-ribosylation factor {Mouse (Mus musculus), ARL | 86.4 | |
| d1egaa1 | 179 | GTPase Era, N-terminal domain {Escherichia coli [T | 86.31 | |
| d1u0ja_ | 267 | Rep 40 protein helicase domain {Adeno-associated v | 86.3 | |
| d2ngra_ | 191 | CDC42 {Human (Homo sapiens) [TaxId: 9606]} | 86.26 | |
| d2dy1a2 | 267 | Elongation factor G (EF-G), N-terminal (G) domain | 86.22 | |
| d1ek0a_ | 170 | Ypt51 {Baker's yeast (Saccharomyces cerevisiae) [T | 86.17 | |
| d1ctqa_ | 166 | cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9 | 86.15 | |
| d2f9la1 | 175 | Rab11b {Human (Homo sapiens) [TaxId: 9606]} | 86.0 | |
| d1vg8a_ | 184 | Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]} | 85.82 | |
| d1n0ua2 | 341 | Elongation factor 2 (eEF-2), N-terminal (G) domain | 85.8 | |
| d2bcjq2 | 200 | Transducin (alpha subunit) {Mouse (Mus musculus) [ | 85.66 | |
| d1azta2 | 221 | Transducin (alpha subunit) {Cow (Bos taurus) [TaxI | 85.66 | |
| d2g3ya1 | 172 | GTP-binding protein GEM {Human (Homo sapiens) [Tax | 85.64 | |
| d1udxa2 | 180 | Obg GTP-binding protein middle domain {Thermus the | 85.59 | |
| d1knxa2 | 177 | HPr kinase HprK C-terminal domain {Mycoplasma pneu | 85.59 | |
| d1ko7a2 | 169 | HPr kinase HprK C-terminal domain {Staphylococcus | 85.35 | |
| d1x3sa1 | 177 | Rab18 {Human (Homo sapiens) [TaxId: 9606]} | 85.15 | |
| d1l7vc_ | 231 | ABC transporter involved in vitamin B12 uptake, Bt | 85.05 | |
| d1u8za_ | 168 | Ras-related protein RalA {Cotton-top tamarin (Sagu | 84.89 | |
| d1zj6a1 | 177 | ADP-ribosylation factor {Human (Homo sapiens), ARL | 84.75 | |
| d2bmja1 | 175 | Centaurin gamma 1, G domain {Human (Homo sapiens) | 84.49 | |
| d1x1ra1 | 169 | Ras-related protein M-Ras (XRas) {Mouse (Mus muscu | 84.45 | |
| d1wmsa_ | 174 | Rab9a {Human (Homo sapiens) [TaxId: 9606]} | 84.25 | |
| d1zd9a1 | 164 | ADP-ribosylation factor {Human (Homo sapiens), ARL | 84.21 | |
| d1tuea_ | 205 | Replication protein E1 helicase domain {Human papi | 83.86 | |
| d2qtvb1 | 166 | SAR1 {Baker's yeast (Saccharomyces cerevisiae) [Ta | 83.68 | |
| d2cxxa1 | 184 | GTP-binding protein engB {Pyrococcus horikoshii [T | 83.17 | |
| d1e2ka_ | 329 | Thymidine kinase {Herpes simplex virus type 1, dif | 83.06 | |
| d1lnza2 | 185 | Obg GTP-binding protein middle domain {Bacillus su | 82.4 | |
| d1i2ma_ | 170 | Ran {Human (Homo sapiens) [TaxId: 9606]} | 82.39 | |
| d1e0sa_ | 173 | ADP-ribosylation factor {Human (Homo sapiens), ARF | 82.16 | |
| d1puia_ | 188 | Probable GTPase EngB {Escherichia coli [TaxId: 562 | 81.5 | |
| d1mkya2 | 186 | Probable GTPase Der, N-terminal and middle domains | 81.41 | |
| d2gj8a1 | 161 | Probable tRNA modification GTPase TrmE (MnmE), G d | 81.17 | |
| g1f2t.1 | 292 | Rad50 {Archaeon Pyrococcus furiosus [TaxId: 2261]} | 80.61 |
| >d2a5yb3 c.37.1.20 (B:109-385) CED-4, NB-ARC domain {Caenorhabditis elegans [TaxId: 6239]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: P-loop containing nucleoside triphosphate hydrolases superfamily: P-loop containing nucleoside triphosphate hydrolases family: Extended AAA-ATPase domain domain: CED-4, NB-ARC domain species: Caenorhabditis elegans [TaxId: 6239]
Probab=100.00 E-value=4.3e-44 Score=298.32 Aligned_cols=250 Identities=14% Similarity=0.142 Sum_probs=194.9
Q ss_pred CCCCCCCCCCHHHHHHHHHHHCCCCCCCCEEEEEEECCCCHHHHHHHHHHHH----HHCCCCEEEEEEECCCCCCCCCCH
Q ss_conf 6889982121136988888520279998169999813875488999999998----621465039962053212567996
Q 000780 184 TDSSNGLVGLNSRIEQIKPFLCMDSSDTVQIVGIWGMGGIGKTTLAKAIFDQ----FSHEFEGSCFVSDVRGNSETAGGL 259 (1288)
Q Consensus 184 ~~~~~~~vGr~~~~~~l~~~L~~~~~~~~~vi~I~G~gGiGKTtLA~~v~~~----~~~~F~~~~~~~~~~~~~~~~~~l 259 (1288)
.+....++||+.+++++.++|....+.+.++|+|+|||||||||||+++|++ ....|+.++|+...+. ... ..+
T Consensus 16 ~p~~~~~~gR~~~~~~i~~~L~~~~~~~~~~v~I~GmgGiGKTtLA~~v~~~~~~~~~~~f~~~~Wv~vs~~-~~~-~~l 93 (277)
T d2a5yb3 16 VPKQMTCYIREYHVDRVIKKLDEMCDLDSFFLFLHGRAGSGKSVIASQALSKSDQLIGINYDSIVWLKDSGT-APK-STF 93 (277)
T ss_dssp CBCCCCSCCCHHHHHHHHHHHHHHTTSSSEEEEEECSTTSSHHHHHHHHHHHCSSTBTTTBSEEEEEECCCC-STT-HHH
T ss_pred CCCCCCEECCHHHHHHHHHHHHHCCCCCCEEEEEECCCCCCHHHHHHHHHHHHHHHHHHCCCEEEEEEECCC-CCH-HHH
T ss_conf 999886237399999999998734687840899977997888999999998556554012764899993687-777-789
Q ss_pred HHHHHHHHHHHCCCCCC---CCCCCC-----HHHHHHHHHCCEEEEEECCCCCHHHHHHHHHCCCCCCCCCEEEEECCCH
Q ss_conf 99999998421175631---149996-----2689998714608999656899578999970249889995899990885
Q 000780 260 EHLQKQMLSTTLSEKLE---VAGPNI-----PHFTKERVRRMKLLIVLDDVNEVGQLKRLIGELDQFGQGSRIVVTTRDK 331 (1288)
Q Consensus 260 ~~l~~~ll~~l~~~~~~---~~~~~~-----~~~l~~~l~~kk~LlVLDdv~~~~~~~~l~~~l~~~~~gsrIIiTTR~~ 331 (1288)
......++..++..... ...... ...+.+.+.++++|+||||||+.++++.+. ..|||||||||++
T Consensus 94 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~L~~kr~LlVLDDv~~~~~~~~~~------~~~srilvTTR~~ 167 (277)
T d2a5yb3 94 DLFTDILLMLKSEDDLLNFPSVEHVTSVVLKRMICNALIDRPNTLFVFDDVVQEETIRWAQ------ELRLRCLVTTRDV 167 (277)
T ss_dssp HHHHHHHHHHTTTSCCTTCCCCTTCCHHHHHHHHHHHHTTSTTEEEEEEEECCHHHHHHHH------HTTCEEEEEESBG
T ss_pred HHHHHHHHHHHCCHHHCCCCCCHHHHHHHHHHHHHHHHHCCCCEEEECCHHHHHHHHHHHC------CCCCEEEEEEEHH
T ss_conf 9999999987220220278632123369999999999844688167525066776655520------4575599996448
Q ss_pred HHHHHHCCCCCEEEECCCCCHHHHHHHHHHHHCCCCCCCCHHHHHHHHHHHHHCCCCHHHHHHHHHCCCCCHHHHHHHHH
Q ss_conf 67864079601199758999778999996400399999711799999998420699416898842208989889998756
Q 000780 332 RVLEKFRGEEKKIYRVNGLEFEEAFEHFCNFAFKENHCPEDLNWHSRSVVSYTKGNPLVLEVLGSSLCLKRKSHWGKVLH 411 (1288)
Q Consensus 332 ~~~~~~~~~~~~~~~l~~L~~~ea~~Lf~~~af~~~~~~~~~~~l~~~i~~~~~GlPLal~~l~~~L~~~~~~~w~~~l~ 411 (1288)
.++..+.. ...+|++++|+.+||++||+.++|....+ +..++++++|+++|+|+||||+++|+.|+.++.++|.....
T Consensus 168 ~v~~~~~~-~~~~~~l~~L~~~ea~~Lf~~~~~~~~~~-~~~~~~~~~iv~~c~GlPLAl~~ig~~l~~k~~~~~~~~~~ 245 (277)
T d2a5yb3 168 EISNAASQ-TCEFIEVTSLEIDECYDFLEAYGMPMPVG-EKEEDVLNKTIELSSGNPATLMMFFKSCEPKTFEKMAQLNN 245 (277)
T ss_dssp GGGGGCCS-CEEEEECCCCCHHHHHHHHHHTSCCCC---CHHHHHHHHHHHHHTTCHHHHHHHHTTCCSSSHHHHHHHHH
T ss_pred HHHHHCCC-CCCEEECCCCCHHHHHHHHHHHHCCCCCC-HHHHHHHHHHHHHHCCCHHHHHHHHHHHCCCCHHHHHHHHH
T ss_conf 99986378-87168778899799999999984776674-25679999999995899899999999865598999999999
Q ss_pred HHHHCCCCCHHHHHHHHHHHHCCCCHHHHHHHHHC
Q ss_conf 54311863235589788730038996568786320
Q 000780 412 DLNRICESEIHDIYDILKISFNKLTPRVKSIFLDI 446 (1288)
Q Consensus 412 ~l~~~~~~~~~~i~~~l~~sy~~L~~~~k~~fl~~ 446 (1288)
++......++ ..++..||+.|+++.|.||.++
T Consensus 246 ~L~~~~~~~v---~~il~~sY~~L~~~lk~c~~~l 277 (277)
T d2a5yb3 246 KLESRGLVGV---ECITPYSYKSLAMALQRCVEVL 277 (277)
T ss_dssp HHHHHCSSTT---CCCSSSSSSSHHHHHHHHHHTS
T ss_pred HHHCCCHHHH---HHHHHHHHHCCCHHHHHHHHHC
T ss_conf 9734867889---9999998851269999999739
|
| >d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} | Back information, alignment and structure |
|---|
| >d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} | Back information, alignment and structure |
|---|
| >d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} | Back information, alignment and structure |
|---|
| >d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} | Back information, alignment and structure |
|---|
| >d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fyva_ c.23.2.1 (A:) Toll-like receptor 1, TLR1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d1fyxa_ c.23.2.1 (A:) Toll-like receptor 2, TLR2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d2fnaa2 c.37.1.20 (A:1-283) Archaeal ATPase SSO1545 {Sulfolobus solfataricus [TaxId: 2287]} | Back information, alignment and structure |
|---|
| >d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} | Back information, alignment and structure |
|---|
| >d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} | Back information, alignment and structure |
|---|
| >d1fnna2 c.37.1.20 (A:1-276) CDC6, N-domain {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} | Back information, alignment and structure |
|---|
| >d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1r6bx2 c.37.1.20 (X:169-436) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1sxjd2 c.37.1.20 (D:26-262) Replication factor C2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1sxjc2 c.37.1.20 (C:12-238) Replication factor C3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1iqpa2 c.37.1.20 (A:2-232) Replication factor C {Archaeon Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d1sxje2 c.37.1.20 (E:4-255) Replication factor C5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1sxjb2 c.37.1.20 (B:7-230) Replication factor C4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} | Back information, alignment and structure |
|---|
| >d1w5sa2 c.37.1.20 (A:7-293) CDC6-like protein APE0152, N-terminal domain {Aeropyrum pernix [TaxId: 56636]} | Back information, alignment and structure |
|---|
| >d1njfa_ c.37.1.20 (A:) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1jbka_ c.37.1.20 (A:) ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1e32a2 c.37.1.20 (A:201-458) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} | Back information, alignment and structure |
|---|
| >d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ixza_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1qvra2 c.37.1.20 (A:149-535) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1sxja2 c.37.1.20 (A:295-547) Replication factor C1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1a5ta2 c.37.1.20 (A:1-207) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1lv7a_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1r7ra3 c.37.1.20 (A:471-735) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1in4a2 c.37.1.20 (A:17-254) Holliday junction helicase RuvB {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1d2na_ c.37.1.20 (A:) Hexamerization domain of N-ethylmalemide-sensitive fusion (NSF) protein {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} | Back information, alignment and structure |
|---|
| >d1ixsb2 c.37.1.20 (B:4-242) Holliday junction helicase RuvB {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1l8qa2 c.37.1.20 (A:77-289) Chromosomal replication initiation factor DnaA {Aquifex aeolicus [TaxId: 63363]} | Back information, alignment and structure |
|---|
| >d1ny5a2 c.37.1.20 (A:138-384) Transcriptional activator sigm54 (NtrC1), C-terminal domain {Aquifex aeolicus [TaxId: 63363]} | Back information, alignment and structure |
|---|
| >d1qvra3 c.37.1.20 (A:536-850) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1r6bx3 c.37.1.20 (X:437-751) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2gnoa2 c.37.1.20 (A:11-208) gamma subunit of DNA polymerase III, N-domain {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1gvnb_ c.37.1.21 (B:) Plasmid maintenance system epsilon/zeta, toxin zeta subunit {Streptococcus pyogenes [TaxId: 1314]} | Back information, alignment and structure |
|---|
| >d1rz3a_ c.37.1.6 (A:) Hypothetical protein rbstp0775 {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1ye8a1 c.37.1.11 (A:1-178) Hypothetical kinase-like protein Aq_1292 {Aquifex aeolicus [TaxId: 63363]} | Back information, alignment and structure |
|---|
| >d1m8pa3 c.37.1.15 (A:391-573) ATP sulfurylase C-terminal domain {Fungus (Penicillium chrysogenum) [TaxId: 5076]} | Back information, alignment and structure |
|---|
| >d1lw7a2 c.37.1.1 (A:220-411) Transcriptional regulator NadR, ribosylnicotinamide kinase domain {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1ofha_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d2qy9a2 c.37.1.10 (A:285-495) GTPase domain of the signal recognition particle receptor FtsY {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1x6va3 c.37.1.4 (A:34-228) Adenosine-5'phosphosulfate kinase (APS kinase) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2i3ba1 c.37.1.11 (A:1-189) Cancer-related NTPase, C1orf57 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1kaga_ c.37.1.2 (A:) Shikimate kinase (AroK) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1ls1a2 c.37.1.10 (A:89-295) GTPase domain of the signal sequence recognition protein Ffh {Thermus aquaticus [TaxId: 271]} | Back information, alignment and structure |
|---|
| >d2bdta1 c.37.1.25 (A:1-176) Hypothetical protein BH3686 {Bacillus halodurans [TaxId: 86665]} | Back information, alignment and structure |
|---|
| >d1np6a_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2iyva1 c.37.1.2 (A:2-166) Shikimate kinase (AroK) {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1w44a_ c.37.1.11 (A:) NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} | Back information, alignment and structure |
|---|
| >d1ihua2 c.37.1.10 (A:308-586) Arsenite-translocating ATPase ArsA {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1cp2a_ c.37.1.10 (A:) Nitrogenase iron protein {Clostridium pasteurianum [TaxId: 1501]} | Back information, alignment and structure |
|---|
| >d2qm8a1 c.37.1.10 (A:5-327) Metallochaperone MeaB {Methylobacterium extorquens [TaxId: 408]} | Back information, alignment and structure |
|---|
| >d1svma_ c.37.1.20 (A:) Papillomavirus large T antigen helicase domain {Simian virus 40 [TaxId: 10633]} | Back information, alignment and structure |
|---|
| >d1sq5a_ c.37.1.6 (A:) Pantothenate kinase PanK {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2p67a1 c.37.1.10 (A:1-327) LAO/AO transport system kinase ArgK {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1rkba_ c.37.1.1 (A:) Adenylate kinase {Human (Homo sapiens), isoenzyme 6 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1qhxa_ c.37.1.3 (A:) Chloramphenicol phosphotransferase {Streptomyces venezuelae [TaxId: 54571]} | Back information, alignment and structure |
|---|
| >d1knqa_ c.37.1.17 (A:) Gluconate kinase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1khta_ c.37.1.1 (A:) Adenylate kinase {Archaeon Methanococcus voltae [TaxId: 2188]} | Back information, alignment and structure |
|---|
| >d1viaa_ c.37.1.2 (A:) Shikimate kinase (AroK) {Campylobacter jejuni [TaxId: 197]} | Back information, alignment and structure |
|---|
| >d1bifa1 c.37.1.7 (A:37-249) 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase, kinase domain {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1ly1a_ c.37.1.1 (A:) Polynucleotide kinase, kinase domain {Bacteriophage T4 [TaxId: 10665]} | Back information, alignment and structure |
|---|
| >d1u94a1 c.37.1.11 (A:6-268) RecA protein, ATPase-domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1vmaa2 c.37.1.10 (A:82-294) GTPase domain of the signal recognition particle receptor FtsY {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1e6ca_ c.37.1.2 (A:) Shikimate kinase (AroK) {Erwinia chrysanthemi [TaxId: 556]} | Back information, alignment and structure |
|---|
| >d1m7ga_ c.37.1.4 (A:) Adenosine-5'phosphosulfate kinase (APS kinase) {Fungus (Penicillium chrysogenum) [TaxId: 5076]} | Back information, alignment and structure |
|---|
| >d1qf9a_ c.37.1.1 (A:) UMP/CMP kinase {Dictyostelium discoideum [TaxId: 44689]} | Back information, alignment and structure |
|---|
| >d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d1nksa_ c.37.1.1 (A:) Adenylate kinase {Archaeon Sulfolobus acidocaldarius [TaxId: 2285]} | Back information, alignment and structure |
|---|
| >d2jdid3 c.37.1.11 (D:82-357) Central domain of beta subunit of F1 ATP synthase {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1tf7a2 c.37.1.11 (A:256-497) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} | Back information, alignment and structure |
|---|
| >d1xjca_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1y63a_ c.37.1.1 (A:) Probable kinase LmjF30.1890 {Leishmania major [TaxId: 5664]} | Back information, alignment and structure |
|---|
| >d1yj5a2 c.37.1.1 (A:351-522) 5' polynucleotide kinase-3' phosphatase, C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1ukza_ c.37.1.1 (A:) Uridylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2afhe1 c.37.1.10 (E:1-289) Nitrogenase iron protein {Azotobacter vinelandii [TaxId: 354]} | Back information, alignment and structure |
|---|
| >d1zp6a1 c.37.1.25 (A:6-181) Hypothetical protein Atu3015 {Agrobacterium tumefaciens [TaxId: 358]} | Back information, alignment and structure |
|---|
| >d1g8pa_ c.37.1.20 (A:) ATPase subunit of magnesium chelatase, BchI {Rhodobacter capsulatus [TaxId: 1061]} | Back information, alignment and structure |
|---|
| >d1uj2a_ c.37.1.6 (A:) Uridine-cytidine kinase 2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1j8yf2 c.37.1.10 (F:87-297) GTPase domain of the signal sequence recognition protein Ffh {Archaeon Acidianus ambivalens [TaxId: 2283]} | Back information, alignment and structure |
|---|
| >d1ckea_ c.37.1.1 (A:) CMP kinase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1ihua1 c.37.1.10 (A:1-296) Arsenite-translocating ATPase ArsA {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1xp8a1 c.37.1.11 (A:15-282) RecA protein, ATPase-domain {Deinococcus radiodurans [TaxId: 1299]} | Back information, alignment and structure |
|---|
| >d3b60a1 c.37.1.12 (A:329-581) Multidrug resistance ABC transporter MsbA, C-terminal domain {Salmonella typhimurium [TaxId: 90371]} | Back information, alignment and structure |
|---|
| >d1v43a3 c.37.1.12 (A:7-245) Hypothetical protein PH0022, N-terminal domain {Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d1okkd2 c.37.1.10 (D:97-303) GTPase domain of the signal recognition particle receptor FtsY {Thermus aquaticus [TaxId: 271]} | Back information, alignment and structure |
|---|
| >d1gkya_ c.37.1.1 (A:) Guanylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1lvga_ c.37.1.1 (A:) Guanylate kinase {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2awna2 c.37.1.12 (A:4-235) Maltose transport protein MalK, N-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1nn5a_ c.37.1.1 (A:) Thymidylate kinase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d3adka_ c.37.1.1 (A:) Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d1xpua3 c.37.1.11 (A:129-417) Transcription termination factor Rho, ATPase domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1q3ta_ c.37.1.1 (A:) CMP kinase {Streptococcus pneumoniae [TaxId: 1313]} | Back information, alignment and structure |
|---|
| >d1kgda_ c.37.1.1 (A:) Guanylate kinase-like domain of Cask {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1teva_ c.37.1.1 (A:) UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1p9ra_ c.37.1.11 (A:) Extracellular secretion NTPase EpsE {Vibrio cholerae [TaxId: 666]} | Back information, alignment and structure |
|---|
| >d1odfa_ c.37.1.6 (A:) Hypothetical protein Ygr205W {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1um8a_ c.37.1.20 (A:) ClpX {Helicobacter pylori [TaxId: 210]} | Back information, alignment and structure |
|---|
| >d1oxxk2 c.37.1.12 (K:1-242) Glucose transport protein GlcV, N-terminal domain {Archaeon Sulfolobus solfataricus [TaxId: 2287]} | Back information, alignment and structure |
|---|
| >d1zaka1 c.37.1.1 (A:3-127,A:159-222) Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} | Back information, alignment and structure |
|---|
| >d1hyqa_ c.37.1.10 (A:) Cell division regulator MinD {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d1ak2a1 c.37.1.1 (A:14-146,A:177-233) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-2 [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1g41a_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1v5wa_ c.37.1.11 (A:) Meiotic recombination protein DMC1/LIM15 homolog {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fx0a3 c.37.1.11 (A:97-372) Central domain of alpha subunit of F1 ATP synthase {Spinach (Spinacia oleracea), chloroplast [TaxId: 3562]} | Back information, alignment and structure |
|---|
| >d1a7ja_ c.37.1.6 (A:) Phosphoribulokinase {Rhodobacter sphaeroides [TaxId: 1063]} | Back information, alignment and structure |
|---|
| >d1zina1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1mo6a1 c.37.1.11 (A:1-269) RecA protein, ATPase-domain {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1g3qa_ c.37.1.10 (A:) Cell division regulator MinD {Archaeon Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d2cdna1 c.37.1.1 (A:1-181) Adenylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d2ak3a1 c.37.1.1 (A:0-124,A:162-225) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-3 [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d2hyda1 c.37.1.12 (A:324-578) Putative multidrug export ATP-binding/permease protein SAV1866 {Staphylococcus aureus [TaxId: 1280]} | Back information, alignment and structure |
|---|
| >d1akya1 c.37.1.1 (A:3-130,A:169-220) Adenylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1pzna2 c.37.1.11 (A:96-349) DNA repair protein Rad51, catalytic domain {Archaeon Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d1znwa1 c.37.1.1 (A:20-201) Guanylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1uf9a_ c.37.1.1 (A:) Dephospho-CoA kinase {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d2ocpa1 c.37.1.1 (A:37-277) Deoxyguanosine kinase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1s3ga1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus globisporus [TaxId: 1459]} | Back information, alignment and structure |
|---|
| >d1tf7a1 c.37.1.11 (A:14-255) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} | Back information, alignment and structure |
|---|
| >d2jdia3 c.37.1.11 (A:95-379) Central domain of alpha subunit of F1 ATP synthase {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1yrba1 c.37.1.10 (A:1-244) ATP(GTP)-binding protein PAB0955 {Pyrococcus abyssi [TaxId: 29292]} | Back information, alignment and structure |
|---|
| >d1e4va1 c.37.1.1 (A:1-121,A:157-214) Adenylate kinase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2vp4a1 c.37.1.1 (A:12-208) Deoxyribonucleoside kinase {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d2i1qa2 c.37.1.11 (A:65-322) DNA repair protein Rad51, catalytic domain {Archaeon Methanococcus voltae [TaxId: 2188]} | Back information, alignment and structure |
|---|
| >d1n0wa_ c.37.1.11 (A:) DNA repair protein Rad51, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1s96a_ c.37.1.1 (A:) Guanylate kinase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1g6oa_ c.37.1.11 (A:) Hexameric traffic ATPase, HP0525 {Helicobacter pylori [TaxId: 210]} | Back information, alignment and structure |
|---|
| >d1gsia_ c.37.1.1 (A:) Thymidylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1byia_ c.37.1.10 (A:) Dethiobiotin synthetase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1tmka_ c.37.1.1 (A:) Thymidylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1szpa2 c.37.1.11 (A:145-395) DNA repair protein Rad51, catalytic domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1vhta_ c.37.1.1 (A:) Dephospho-CoA kinase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1p6xa_ c.37.1.1 (A:) Thymidine kinase {Equine herpesvirus type 4 [TaxId: 10331]} | Back information, alignment and structure |
|---|
| >d1p5zb_ c.37.1.1 (B:) Deoxycytidine kinase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1r0wa_ c.37.1.12 (A:) Cystic fibrosis transmembrane conductance regulator, CFTR, nucleotide-binding domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d4tmka_ c.37.1.1 (A:) Thymidylate kinase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1g2912 c.37.1.12 (1:1-240) Maltose transport protein MalK, N-terminal domain {Archaeon Thermococcus litoralis [TaxId: 2265]} | Back information, alignment and structure |
|---|
| >d1w36d1 c.37.1.19 (D:2-360) Exodeoxyribonuclease V alpha chain (RecD) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1b0ua_ c.37.1.12 (A:) ATP-binding subunit of the histidine permease {Salmonella typhimurium [TaxId: 90371]} | Back information, alignment and structure |
|---|
| >d3dhwc1 c.37.1.12 (C:1-240) Methionine import ATP-binding protein MetN {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1jjva_ c.37.1.1 (A:) Dephospho-CoA kinase {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1deka_ c.37.1.1 (A:) Deoxynucleoside monophosphate kinase {Bacteriophage T4 [TaxId: 10665]} | Back information, alignment and structure |
|---|
| >d2pmka1 c.37.1.12 (A:467-707) Haemolysin B ATP-binding protein {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1mv5a_ c.37.1.12 (A:) Multidrug resistance ABC transporter LmrA, C-terminal domain {Lactococcus lactis [TaxId: 1358]} | Back information, alignment and structure |
|---|
| >d1cr2a_ c.37.1.11 (A:) Gene 4 protein (g4p, DNA primase), helicase domain {Bacteriophage T7 [TaxId: 10760]} | Back information, alignment and structure |
|---|
| >d1puja_ c.37.1.8 (A:) Probable GTPase YlqF {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1jj7a_ c.37.1.12 (A:) Peptide transporter Tap1, C-terminal ABC domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1htwa_ c.37.1.18 (A:) Hypothetical protein HI0065 {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1f6ba_ c.37.1.8 (A:) SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} | Back information, alignment and structure |
|---|
| >d1l2ta_ c.37.1.12 (A:) MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d1nlfa_ c.37.1.11 (A:) Hexameric replicative helicase repA {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d3d31a2 c.37.1.12 (A:1-229) Sulfate/molybdate ABC transporter, ATP-binding protein {Methanosarcina acetivorans [TaxId: 2214]} | Back information, alignment and structure |
|---|
| >d1sgwa_ c.37.1.12 (A:) Putative ABC transporter PF0895 {Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d1fzqa_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL3 [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1r8sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF1 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1svia_ c.37.1.8 (A:) Probable GTPase EngB {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d2onka1 c.37.1.12 (A:1-240) Molybdate/tungstate import ATP-binding protein WtpC (ModC) {Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d2atva1 c.37.1.8 (A:5-172) Ras-like estrogen-regulated growth inhibitor, RERG {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2bv3a2 c.37.1.8 (A:7-282) Elongation factor G (EF-G), N-terminal (G) domain {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1z06a1 c.37.1.8 (A:32-196) Rab-33b {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1nija1 c.37.1.10 (A:2-223) Hypothetical protein YjiA, N-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2a5ja1 c.37.1.8 (A:9-181) Rab2b {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1z0fa1 c.37.1.8 (A:8-173) Rab14 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1z2aa1 c.37.1.8 (A:8-171) Rab23 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2ew1a1 c.37.1.8 (A:4-174) Rab30 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1upta_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARL1 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2fh5b1 c.37.1.8 (B:63-269) Signal recognition particle receptor beta-subunit {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1osna_ c.37.1.1 (A:) Thymidine kinase {Varicella-zoster virus [TaxId: 10335]} | Back information, alignment and structure |
|---|
| >d1yzqa1 c.37.1.8 (A:14-177) Rab6 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2fn4a1 c.37.1.8 (A:24-196) r-Ras {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1z08a1 c.37.1.8 (A:17-183) Rab21 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d3raba_ c.37.1.8 (A:) Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1r2qa_ c.37.1.8 (A:) Rab5a {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1kmqa_ c.37.1.8 (A:) RhoA {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1g16a_ c.37.1.8 (A:) Rab-related protein Sec4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2erxa1 c.37.1.8 (A:6-176) di-Ras2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1g6ha_ c.37.1.12 (A:) MJ1267 {Archaeon Methanococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d2bmea1 c.37.1.8 (A:6-179) Rab4a {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1mkya1 c.37.1.8 (A:2-172) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1z0ja1 c.37.1.8 (A:2-168) Rab-22a {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1u0la2 c.37.1.8 (A:69-293) Probable GTPase EngC (YjeQ), C-terminal domain {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1kaoa_ c.37.1.8 (A:) Rap2a {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2erya1 c.37.1.8 (A:10-180) r-Ras2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2bcgy1 c.37.1.8 (Y:3-196) GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2atxa1 c.37.1.8 (A:9-193) RhoQ {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2f7sa1 c.37.1.8 (A:5-190) Rab27b {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wf3a1 c.37.1.8 (A:3-180) GTPase Era, N-terminal domain {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1xtqa1 c.37.1.8 (A:3-169) GTP-binding protein RheB {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2gjsa1 c.37.1.8 (A:91-258) Rad {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ky3a_ c.37.1.8 (A:) Rab-related protein ypt7p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1vpla_ c.37.1.12 (A:) Putative ABC transporter TM0544 {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1ji0a_ c.37.1.12 (A:) Branched chain aminoacid ABC transporter {Thermotoga maritima, TM1139 [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1mh1a_ c.37.1.8 (A:) Rac {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1moza_ c.37.1.8 (A:) ADP-ribosylation factor {Baker's yeast (Saccharomyces cerevisiae), ARL1 [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1svsa1 c.37.1.8 (A:32-60,A:182-347) Transducin (alpha subunit) {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1h65a_ c.37.1.8 (A:) Chloroplast protein translocon GTPase Toc34 {Garden pea (Pisum sativum) [TaxId: 3888]} | Back information, alignment and structure |
|---|
| >d1m7ba_ c.37.1.8 (A:) RhoE (RND3) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1c1ya_ c.37.1.8 (A:) Rap1A {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1kkma_ c.91.1.2 (A:) HPr kinase HprK C-terminal domain {Lactobacillus casei [TaxId: 1582]} | Back information, alignment and structure |
|---|
| >d1zcba2 c.37.1.8 (A:47-75,A:202-372) Transducin (alpha subunit) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2g6ba1 c.37.1.8 (A:58-227) Rab26 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1nrjb_ c.37.1.8 (B:) Signal recognition particle receptor beta-subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1ksha_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL2 [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1egaa1 c.37.1.8 (A:4-182) GTPase Era, N-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1u0ja_ c.37.1.20 (A:) Rep 40 protein helicase domain {Adeno-associated virus 2, AAV2 [TaxId: 10804]} | Back information, alignment and structure |
|---|
| >d2ngra_ c.37.1.8 (A:) CDC42 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2dy1a2 c.37.1.8 (A:8-274) Elongation factor G (EF-G), N-terminal (G) domain {Thermus thermophilus, EF-G-2 [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1ek0a_ c.37.1.8 (A:) Ypt51 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1ctqa_ c.37.1.8 (A:) cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2f9la1 c.37.1.8 (A:8-182) Rab11b {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1vg8a_ c.37.1.8 (A:) Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1n0ua2 c.37.1.8 (A:3-343) Elongation factor 2 (eEF-2), N-terminal (G) domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2bcjq2 c.37.1.8 (Q:38-66,Q:184-354) Transducin (alpha subunit) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1azta2 c.37.1.8 (A:35-65,A:202-391) Transducin (alpha subunit) {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d2g3ya1 c.37.1.8 (A:73-244) GTP-binding protein GEM {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1udxa2 c.37.1.8 (A:157-336) Obg GTP-binding protein middle domain {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1knxa2 c.91.1.2 (A:133-309) HPr kinase HprK C-terminal domain {Mycoplasma pneumoniae [TaxId: 2104]} | Back information, alignment and structure |
|---|
| >d1ko7a2 c.91.1.2 (A:130-298) HPr kinase HprK C-terminal domain {Staphylococcus xylosus [TaxId: 1288]} | Back information, alignment and structure |
|---|
| >d1x3sa1 c.37.1.8 (A:2-178) Rab18 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1l7vc_ c.37.1.12 (C:) ABC transporter involved in vitamin B12 uptake, BtuD {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1u8za_ c.37.1.8 (A:) Ras-related protein RalA {Cotton-top tamarin (Saguinus oedipus) [TaxId: 9490]} | Back information, alignment and structure |
|---|
| >d1zj6a1 c.37.1.8 (A:2-178) ADP-ribosylation factor {Human (Homo sapiens), ARL5A [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2bmja1 c.37.1.8 (A:66-240) Centaurin gamma 1, G domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x1ra1 c.37.1.8 (A:10-178) Ras-related protein M-Ras (XRas) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1wmsa_ c.37.1.8 (A:) Rab9a {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1zd9a1 c.37.1.8 (A:18-181) ADP-ribosylation factor {Human (Homo sapiens), ARL8A [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1tuea_ c.37.1.20 (A:) Replication protein E1 helicase domain {Human papillomavirus type 18 [TaxId: 333761]} | Back information, alignment and structure |
|---|
| >d2qtvb1 c.37.1.8 (B:24-189) SAR1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2cxxa1 c.37.1.8 (A:2-185) GTP-binding protein engB {Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d1e2ka_ c.37.1.1 (A:) Thymidine kinase {Herpes simplex virus type 1, different strains [TaxId: 10298]} | Back information, alignment and structure |
|---|
| >d1lnza2 c.37.1.8 (A:158-342) Obg GTP-binding protein middle domain {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1i2ma_ c.37.1.8 (A:) Ran {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1e0sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF6 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1puia_ c.37.1.8 (A:) Probable GTPase EngB {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1mkya2 c.37.1.8 (A:173-358) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d2gj8a1 c.37.1.8 (A:216-376) Probable tRNA modification GTPase TrmE (MnmE), G domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|