Citrus Sinensis ID: 000820
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
|
|
Close Homologs for Annotation Transfer
Close Homologs in SWISS-PROT Database Detected by BLAST 
Original result of BLAST against SWISS-PROT Database
| ID | Alignment graph | Length |
Definition |
RBH(Q2H) |
RBH(H2Q) |
Q cover |
H cover |
Identity |
E-value |
| Query | 1268 | 2.2.26 [Sep-21-2011] | |||||||
| Q9FHN8 | 1260 | Kinesin-like calmodulin-b | yes | no | 0.964 | 0.970 | 0.766 | 0.0 | |
| Q7XPJ0 | 1248 | Kinesin-like calmodulin-b | yes | no | 0.962 | 0.977 | 0.747 | 0.0 | |
| O35231 | 824 | Kinesin-like protein KIFC | yes | no | 0.472 | 0.726 | 0.331 | 6e-78 | |
| O81635 | 987 | Kinesin-4 OS=Arabidopsis | no | no | 0.300 | 0.386 | 0.414 | 1e-77 | |
| Q9BVG8 | 833 | Kinesin-like protein KIFC | yes | no | 0.377 | 0.575 | 0.358 | 2e-77 | |
| P46864 | 745 | Kinesin-2 OS=Arabidopsis | no | no | 0.350 | 0.597 | 0.373 | 5e-75 | |
| Q9US03 | 817 | Kinesin-like protein 2 OS | yes | no | 0.365 | 0.567 | 0.377 | 7e-74 | |
| Q07970 | 793 | Kinesin-1 OS=Arabidopsis | no | no | 0.439 | 0.702 | 0.323 | 1e-72 | |
| P46875 | 754 | Kinesin-3 OS=Arabidopsis | no | no | 0.298 | 0.502 | 0.397 | 1e-72 | |
| P79955 | 643 | Carboxy-terminal kinesin | N/A | no | 0.344 | 0.679 | 0.370 | 1e-72 |
| >sp|Q9FHN8|KCBP_ARATH Kinesin-like calmodulin-binding protein OS=Arabidopsis thaliana GN=KCBP PE=1 SV=1 | Back alignment and function desciption |
|---|
Score = 1940 bits (5026), Expect = 0.0, Method: Compositional matrix adjust.
Identities = 939/1225 (76%), Positives = 1088/1225 (88%), Gaps = 2/1225 (0%)
Query: 42 EYDSDGSNFAPPTPAT-LSMAVPVELATAIPLIDRFQVEGFLRMMQKQIQSAGKRGFF-S 99
++D++ S+ P +PA +++++P ELA AIPLIDRFQVE FLR+MQKQIQSAGKRGFF S
Sbjct: 36 DFDAESSSLPPLSPAPQVALSIPAELAAAIPLIDRFQVEAFLRLMQKQIQSAGKRGFFYS 95
Query: 100 KKSTGAYVREKFTFEDMLCFQKDPIPTSLLKLNSDLVSRATKLFQIILKYMGVESSDRVT 159
KKS+G+ VRE+FTFEDMLCFQKDPIPTSLLK+NSDLVSRATKLF +ILKYMGV+SSDR T
Sbjct: 96 KKSSGSNVRERFTFEDMLCFQKDPIPTSLLKINSDLVSRATKLFHLILKYMGVDSSDRST 155
Query: 160 PPSLDERIDFVGKLYKHTLKRVELRDELFAQISKQTRNNPDRQCLIKAWELMYLCASSMP 219
PPSLDERID VGKL+K TLKRVELRDELFAQISKQTR+NPDRQ LIKAWELMYLCASSMP
Sbjct: 156 PPSLDERIDLVGKLFKKTLKRVELRDELFAQISKQTRHNPDRQYLIKAWELMYLCASSMP 215
Query: 220 PSKDMGGYLTEYVHNVAQGIIIDSEVQTLALNTLNALKRSVKAGPRHTIPGREEIEALLT 279
PSKD+GGYL+EY+HNVA I+ + Q LA+NTL ALKRS+KAGPRHT PGREEIEALLT
Sbjct: 216 PSKDIGGYLSEYIHNVAHDATIEPDAQVLAVNTLKALKRSIKAGPRHTTPGREEIEALLT 275
Query: 280 GRKLTTIVFFLDETFEEISYDMATTVSDAVEELAGIIKLSAHSSFSLFECRKVVTGSKAS 339
GRKLTTIVFFLDETFEEISYDMATTVSDAVEELAG IKLSA SSFSLFECRKVV+ SK+S
Sbjct: 276 GRKLTTIVFFLDETFEEISYDMATTVSDAVEELAGTIKLSAFSSFSLFECRKVVSSSKSS 335
Query: 340 DHDNEEYIGLDDNKYIGDLLAEFKAAKDRSKGEILHCKLTFKKKLFRESDEAISEPMFVQ 399
D NEEYIGLDDNKYIGDLLAEFKA KDR+KGEILHCKL FKKKLFRESDEA+++ MFVQ
Sbjct: 336 DPGNEEYIGLDDNKYIGDLLAEFKAIKDRNKGEILHCKLVFKKKLFRESDEAVTDLMFVQ 395
Query: 400 LSYVQLQHDYVLGNYPVGRDDAAQLSALQILVEIGFVGSPESCNDWTSLLERFLPRQVAI 459
LSYVQLQHDY+LGNYPVGRDDAAQL ALQILV IGFV SPESC DWTSLLERFLPRQ+AI
Sbjct: 396 LSYVQLQHDYLLGNYPVGRDDAAQLCALQILVGIGFVNSPESCIDWTSLLERFLPRQIAI 455
Query: 460 TRAKREWELDILSRYRSMEHLTKDDARQQFLRILRTLPYGNSVFFSVRKIDDPIGLLPGR 519
TRAKREWELDIL+RYRSME++TKDDARQQFLRIL+ LPYGNSVFFSVRKIDDPIGLLPGR
Sbjct: 456 TRAKREWELDILARYRSMENVTKDDARQQFLRILKALPYGNSVFFSVRKIDDPIGLLPGR 515
Query: 520 IVLGINKRGVHFFRPVPKEYLHSAELRDIMQFGSSNSAVFFKMRVAGVLHIFQFETKQGE 579
I+LGINKRGVHFFRPVPKEYLHSAELRDIMQFGSSN+AVFFKMRVAGVLHIFQFETKQGE
Sbjct: 516 IILGINKRGVHFFRPVPKEYLHSAELRDIMQFGSSNTAVFFKMRVAGVLHIFQFETKQGE 575
Query: 580 EICVALQTHINDVMLRRYSKARSAATGSVNGDLSNNVKTHSIELFEKRIQDLSKTVEESQ 639
EICVALQTHINDVMLRRYSKARSAA VNGD+S + K + E++EKR+QDLSK EESQ
Sbjct: 576 EICVALQTHINDVMLRRYSKARSAANSLVNGDISCSSKPQNFEVYEKRLQDLSKAYEESQ 635
Query: 640 RNADQLLEELHERQRQEAKMQEELDDLKDSLRFEKQKLAEVMADHDRLKSLCDEKDTSLQ 699
+ ++L++E E+ +QE ++EEL+ + + L E++KL EV D D+L+SLCDEK T++Q
Sbjct: 636 KKIEKLMDEQQEKNQQEVTLREELEAIHNGLELERRKLLEVTLDRDKLRSLCDEKGTTIQ 695
Query: 700 VVLLEKRSMEAKMAKLGNQESENNAEKNLVLTNNQTLHELQRELKICNEELHAEKENVKK 759
++ E R MEA++AK GN +S + L NNQ L+++Q+EL++ N+ELH +N K+
Sbjct: 696 SLMSELRGMEARLAKSGNTKSSKETKSELAEMNNQILYKIQKELEVRNKELHVAVDNSKR 755
Query: 760 FLNEKVLLEQKISKLEKKTEEMEILEKSFEQERKALKLQVSELERKLGEATLDLATLKST 819
L+E +LEQ ++ +KK EE+EI +K +EQE+K LKL+VSELE KL DL + +ST
Sbjct: 756 LLSENKILEQNLNIEKKKKEEVEIHQKRYEQEKKVLKLRVSELENKLEVLAQDLDSAEST 815
Query: 820 LASRNMDLAGLESHLKELEELREMKEDIDRKNEQTAAILKMQGAQLSELEVLYKEEQILR 879
+ S+N D+ L+++LKELEELREMKEDIDRKNEQTAAILKMQGAQL+ELE+LYKEEQ+LR
Sbjct: 816 IESKNSDMLLLQNNLKELEELREMKEDIDRKNEQTAAILKMQGAQLAELEILYKEEQVLR 875
Query: 880 KRYFNTIEDMKGKIRVYCRLRPLNEKEDAEKERYVLTSLDEFTVEHPWKDDKVKQHMYDQ 939
KRY+NTIEDMKGKIRVYCR+RPLNEKE +E+E+ +LT++DEFTVEHPWKDDK KQH+YD+
Sbjct: 876 KRYYNTIEDMKGKIRVYCRIRPLNEKESSEREKQMLTTVDEFTVEHPWKDDKRKQHIYDR 935
Query: 940 VFDGYATQEDVFEDTRYLVQSAVDGYNVCIFAYGQTGSGKTFTIYGSECNPGITPRAISE 999
VFD A+Q+D+FEDT+YLVQSAVDGYNVCIFAYGQTGSGKTFTIYG E NPG+TPRA E
Sbjct: 936 VFDMRASQDDIFEDTKYLVQSAVDGYNVCIFAYGQTGSGKTFTIYGHESNPGLTPRATKE 995
Query: 1000 LFRILKKENNKFSFSLKAYMVELYQDTLVDLLLPRNEKRLKLEIKKDSKGMVLVENVTVV 1059
LF ILK+++ +FSFSLKAYMVELYQDTLVDLLLP++ +RLKLEIKKDSKGMV VENVT +
Sbjct: 996 LFNILKRDSKRFSFSLKAYMVELYQDTLVDLLLPKSARRLKLEIKKDSKGMVFVENVTTI 1055
Query: 1060 PISTFEEIKSIIQRGSDQRHTSGTQMNEESSRSHLILSIVIESTNLQTQSVARGKLSFVD 1119
PIST EE++ I++RGS++RH SGT MNEESSRSHLILS+VIES +LQTQS ARGKLSFVD
Sbjct: 1056 PISTLEELRMILERGSERRHVSGTNMNEESSRSHLILSVVIESIDLQTQSAARGKLSFVD 1115
Query: 1120 LAGSERVKKSGSSGNQLKEAQSINKSLSALGDVISALSSGSQHIPYRNHKLTMLMSDSLG 1179
LAGSERVKKSGS+G QLKEAQSINKSLSALGDVI ALSSG+QHIPYRNHKLTMLMSDSLG
Sbjct: 1116 LAGSERVKKSGSAGCQLKEAQSINKSLSALGDVIGALSSGNQHIPYRNHKLTMLMSDSLG 1175
Query: 1180 GNAKTLMFVNVSPAESNLEESYNSLTYASRVRSIVNDPNKNVSSKEVARLKRLVAYWKEQ 1239
GNAKTLMFVNVSPAESNL+E+YNSL YASRVR+IVNDP+K++SSKE+ RLK+LVAYWKEQ
Sbjct: 1176 GNAKTLMFVNVSPAESNLDETYNSLLYASRVRTIVNDPSKHISSKEMVRLKKLVAYWKEQ 1235
Query: 1240 AGKKGDYEELEEIQEERLQKDRTDN 1264
AGKKG+ E+L +I+E+R +KD D+
Sbjct: 1236 AGKKGEEEDLVDIEEDRTRKDEADS 1260
|
Minus-end microtubule-dependent motor protein involved in the regulation of cell division and trichome morphogenesis. Possesses basal and microtubule-stimulated ATPase activities. Arabidopsis thaliana (taxid: 3702) |
| >sp|Q7XPJ0|KCBP_ORYSJ Kinesin-like calmodulin-binding protein homolog OS=Oryza sativa subsp. japonica GN=Os04g0666900 PE=2 SV=1 | Back alignment and function description |
|---|
| >sp|O35231|KIFC3_MOUSE Kinesin-like protein KIFC3 OS=Mus musculus GN=Kifc3 PE=1 SV=4 | Back alignment and function description |
|---|
| >sp|O81635|ATK4_ARATH Kinesin-4 OS=Arabidopsis thaliana GN=ATK4 PE=1 SV=2 | Back alignment and function description |
|---|
| >sp|Q9BVG8|KIFC3_HUMAN Kinesin-like protein KIFC3 OS=Homo sapiens GN=KIFC3 PE=1 SV=4 | Back alignment and function description |
|---|
| >sp|P46864|ATK2_ARATH Kinesin-2 OS=Arabidopsis thaliana GN=ATK2 PE=2 SV=1 | Back alignment and function description |
|---|
| >sp|Q9US03|KLP2_SCHPO Kinesin-like protein 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=klp2 PE=3 SV=1 | Back alignment and function description |
|---|
| >sp|Q07970|ATK1_ARATH Kinesin-1 OS=Arabidopsis thaliana GN=ATK1 PE=2 SV=1 | Back alignment and function description |
|---|
| >sp|P46875|ATK3_ARATH Kinesin-3 OS=Arabidopsis thaliana GN=ATK3 PE=2 SV=1 | Back alignment and function description |
|---|
| >sp|P79955|CTK2_XENLA Carboxy-terminal kinesin 2 OS=Xenopus laevis PE=2 SV=1 | Back alignment and function description |
|---|
Close Homologs in the Non-Redundant Database Detected by BLAST
Original result of BLAST against Nonredundant Database
| GI | Alignment Graph | Length |
Definition |
Q cover |
H cover |
Identity |
E-value |
| Query | 1268 | ||||||
| 255575271 | 1261 | calmodulin binding protein, putative [Ri | 0.993 | 0.999 | 0.834 | 0.0 | |
| 296088489 | 1268 | unnamed protein product [Vitis vinifera] | 0.999 | 0.999 | 0.811 | 0.0 | |
| 359477055 | 1260 | PREDICTED: kinesin-like calmodulin-bindi | 0.992 | 0.999 | 0.815 | 0.0 | |
| 449456899 | 1265 | PREDICTED: kinesin-like calmodulin-bindi | 0.993 | 0.996 | 0.805 | 0.0 | |
| 30983603 | 1209 | kinesin-like calmodulin binding protein | 0.952 | 0.999 | 0.819 | 0.0 | |
| 356540898 | 1269 | PREDICTED: kinesin-like calmodulin-bindi | 1.0 | 0.999 | 0.767 | 0.0 | |
| 1369852 | 1265 | kinesin heavy chain-like protein [Solanu | 0.978 | 0.981 | 0.777 | 0.0 | |
| 1491931 | 1265 | kinesin-like protein [Nicotiana tabacum] | 0.978 | 0.981 | 0.772 | 0.0 | |
| 356559177 | 1271 | PREDICTED: kinesin-like calmodulin-bindi | 0.993 | 0.991 | 0.762 | 0.0 | |
| 356531307 | 1269 | PREDICTED: kinesin-like calmodulin-bindi | 0.992 | 0.992 | 0.768 | 0.0 |
| >gi|255575271|ref|XP_002528539.1| calmodulin binding protein, putative [Ricinus communis] gi|223532041|gb|EEF33851.1| calmodulin binding protein, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
Score = 2154 bits (5582), Expect = 0.0, Method: Compositional matrix adjust.
Identities = 1052/1261 (83%), Positives = 1154/1261 (91%), Gaps = 1/1261 (0%)
Query: 9 MAQSMRTTQSPFSSSHGNDETPLHNSAATSNADEYDSDGSNFAPPTPATLSMAVPVELAT 68
MAQS+R++ S FSS++GN+ TPLH SA+ SN D YDSDGSNF+ PT A LS A+P ELA
Sbjct: 1 MAQSVRSSLSSFSSTYGNEGTPLHASASISNGDGYDSDGSNFSTPTQAALSAAIPAELAG 60
Query: 69 AIPLIDRFQVEGFLRMMQKQIQSAGKRGFFSKKSTGAYVREKFTFEDMLCFQKDPIPTSL 128
AIPLID+FQVEGFLR+MQKQIQS GKRGFFSKKS G VREKFTFEDMLCFQKDPIPTSL
Sbjct: 61 AIPLIDKFQVEGFLRLMQKQIQSTGKRGFFSKKSVGPQVREKFTFEDMLCFQKDPIPTSL 120
Query: 129 LKLNSDLVSRATKLFQIILKYMGVESSDRVTPPSLDERIDFVGKLYKHTLKRVELRDELF 188
LK+N DL+SRATKLFQIILKYMGV+SSDRV P SLDERI+ VGKLYKHTLKR ELRDELF
Sbjct: 121 LKINGDLISRATKLFQIILKYMGVDSSDRVAPVSLDERIELVGKLYKHTLKRAELRDELF 180
Query: 189 AQISKQTRNNPDRQCLIKAWELMYLCASSMPPSKDMGGYLTEYVHNVAQGIIIDSEVQTL 248
AQISKQTRNNPDRQ LIKAWELMYLCASSMPPSKD+GGYL+EYVHNVA G DSEVQ L
Sbjct: 181 AQISKQTRNNPDRQYLIKAWELMYLCASSMPPSKDIGGYLSEYVHNVAYGSSTDSEVQVL 240
Query: 249 ALNTLNALKRSVKAGPRHTIPGREEIEALLTGRKLTTIVFFLDETFEEISYDMATTVSDA 308
A+NTLNALKRSVKAGPRHTIPGREEIEALLTGRKLTTIVFFLDETFEEI+YDMATTVSDA
Sbjct: 241 AVNTLNALKRSVKAGPRHTIPGREEIEALLTGRKLTTIVFFLDETFEEITYDMATTVSDA 300
Query: 309 VEELAGIIKLSAHSSFSLFECRKVVTGSKASDHDNEEYIGLDDNKYIGDLLAEFKAAKDR 368
VEELAGIIKLSA+SSFSLFECRKVVTGSK+ D NEEYIGLDDNKYIGDLLAEFKAAK+R
Sbjct: 301 VEELAGIIKLSAYSSFSLFECRKVVTGSKSPDPGNEEYIGLDDNKYIGDLLAEFKAAKER 360
Query: 369 SKGEILHCKLTFKKKLFRESDEAISEPMFVQLSYVQLQHDYVLGNYPVGRDDAAQLSALQ 428
SKGEILHCKLTFKKKLFRESDEA+++PMFVQLSYVQLQHDY+LGNYPVGRDDAAQLSALQ
Sbjct: 361 SKGEILHCKLTFKKKLFRESDEAVTDPMFVQLSYVQLQHDYILGNYPVGRDDAAQLSALQ 420
Query: 429 ILVEIGFVGSPESCNDWTSLLERFLPRQVAITRAKREWELDILSRYRSMEHLTKDDARQQ 488
ILVEIGFVGSPESC DWTSLLERFLPRQ+AITR KREWELDILSRYRSMEHLTKDDARQQ
Sbjct: 421 ILVEIGFVGSPESCTDWTSLLERFLPRQIAITRGKREWELDILSRYRSMEHLTKDDARQQ 480
Query: 489 FLRILRTLPYGNSVFFSVRKIDDPIGLLPGRIVLGINKRGVHFFRPVPKEYLHSAELRDI 548
FLRILRTLPYGNSVFFSVRKIDDPIGLLPGRIVLGINKRGVHFFRPVPKEYLHSAELRDI
Sbjct: 481 FLRILRTLPYGNSVFFSVRKIDDPIGLLPGRIVLGINKRGVHFFRPVPKEYLHSAELRDI 540
Query: 549 MQFGSSNSAVFFKMRVAGVLHIFQFETKQGEEICVALQTHINDVMLRRYSKARSAATGSV 608
MQFGSSN+AVFFKMRVAGVLHIFQFETKQGEE+CVALQTHINDVMLRRYSKARS A+G V
Sbjct: 541 MQFGSSNTAVFFKMRVAGVLHIFQFETKQGEEVCVALQTHINDVMLRRYSKARSTASGLV 600
Query: 609 NGDLSNNVKTHSIELFEKRIQDLSKTVEESQRNADQLLEELHERQRQEAKMQEELDDLKD 668
NGDLSN K ++E +EKR+Q+LSK++EESQ+N D+LLE+LH++QRQE K+QEEL+ LKD
Sbjct: 601 NGDLSNTFKPPNVEAYEKRVQELSKSIEESQKNTDRLLEDLHDKQRQEVKLQEELEGLKD 660
Query: 669 SLRFEKQKLAEVMADHDRLKSLCDEKDTSLQVVLLEKRSMEAKMAKLGNQESENNAEKNL 728
SLRFEKQ LAEV +D DRL+S C EKDT+LQ L EKR+ME ++A L N +E NA+K+L
Sbjct: 661 SLRFEKQNLAEVASDRDRLRSTCAEKDTALQAALREKRNMEIRLATLDNLVAEGNAKKDL 720
Query: 729 VLTNNQTLHELQRELKICNEELHAEKENVKKFLNEKVLLEQKISKLE-KKTEEMEILEKS 787
+ TNNQ LH LQ ELK+ NEELH KEN+K+ +EKV LEQKI +LE KK EEME L+K+
Sbjct: 721 IGTNNQVLHNLQDELKLRNEELHVAKENMKRLTDEKVSLEQKIIRLEKKKVEEMEFLQKN 780
Query: 788 FEQERKALKLQVSELERKLGEATLDLATLKSTLASRNMDLAGLESHLKELEELREMKEDI 847
EQER LKLQV ELE+KL T DLA+ KSTLA R+ DLA L+++LKELEELREMKEDI
Sbjct: 781 SEQERNTLKLQVIELEKKLEGVTRDLASAKSTLAIRDADLATLQNNLKELEELREMKEDI 840
Query: 848 DRKNEQTAAILKMQGAQLSELEVLYKEEQILRKRYFNTIEDMKGKIRVYCRLRPLNEKED 907
DRKNEQTAAILKMQ AQL+ELEVLYKEEQ+LRKRYFNTIEDMKGKIRV+CRLRPL+EKE
Sbjct: 841 DRKNEQTAAILKMQAAQLAELEVLYKEEQVLRKRYFNTIEDMKGKIRVFCRLRPLSEKEI 900
Query: 908 AEKERYVLTSLDEFTVEHPWKDDKVKQHMYDQVFDGYATQEDVFEDTRYLVQSAVDGYNV 967
AEKER ++ S DEFTVEHPWKDDK KQH+YD VFDG ATQEDVFEDTRYLVQSAVDGYNV
Sbjct: 901 AEKERNIIRSTDEFTVEHPWKDDKSKQHVYDHVFDGSATQEDVFEDTRYLVQSAVDGYNV 960
Query: 968 CIFAYGQTGSGKTFTIYGSECNPGITPRAISELFRILKKENNKFSFSLKAYMVELYQDTL 1027
CIFAYGQTGSGKTFTIYGSE NPG+TPRA +ELF+IL+++N KFSFSLKAY+VELYQDT+
Sbjct: 961 CIFAYGQTGSGKTFTIYGSESNPGLTPRATAELFKILRRDNKKFSFSLKAYVVELYQDTI 1020
Query: 1028 VDLLLPRNEKRLKLEIKKDSKGMVLVENVTVVPISTFEEIKSIIQRGSDQRHTSGTQMNE 1087
VDLLLP N + LKL+IKKDSKGMV +ENVTVV ISTF+E++SIIQRG ++RHTSGTQMNE
Sbjct: 1021 VDLLLPNNVRPLKLDIKKDSKGMVSIENVTVVTISTFDELQSIIQRGFEKRHTSGTQMNE 1080
Query: 1088 ESSRSHLILSIVIESTNLQTQSVARGKLSFVDLAGSERVKKSGSSGNQLKEAQSINKSLS 1147
ESSRSHLILSIVIESTNLQTQSVARGKLSFVDLAGSERVKKSGSSG+QLKEAQSINKSLS
Sbjct: 1081 ESSRSHLILSIVIESTNLQTQSVARGKLSFVDLAGSERVKKSGSSGSQLKEAQSINKSLS 1140
Query: 1148 ALGDVISALSSGSQHIPYRNHKLTMLMSDSLGGNAKTLMFVNVSPAESNLEESYNSLTYA 1207
ALGDVISALSSG QHIPYRNHKLTMLMSDSLGGNAKTLMFVNVSP++SNL+E+YNSL YA
Sbjct: 1141 ALGDVISALSSGGQHIPYRNHKLTMLMSDSLGGNAKTLMFVNVSPSDSNLDETYNSLMYA 1200
Query: 1208 SRVRSIVNDPNKNVSSKEVARLKRLVAYWKEQAGKKGDYEELEEIQEERLQKDRTDNRHS 1267
SRVRSIVNDP+KNVSSKE+ARLK+LVA+WKEQAG++GD EE EEIQEER KDRTD RHS
Sbjct: 1201 SRVRSIVNDPSKNVSSKEIARLKKLVAHWKEQAGRRGDDEEYEEIQEERQAKDRTDGRHS 1260
Query: 1268 L 1268
+
Sbjct: 1261 M 1261
|
Source: Ricinus communis Species: Ricinus communis Genus: Ricinus Family: Euphorbiaceae Order: Malpighiales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|296088489|emb|CBI37480.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|359477055|ref|XP_002263149.2| PREDICTED: kinesin-like calmodulin-binding protein homolog [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|449456899|ref|XP_004146186.1| PREDICTED: kinesin-like calmodulin-binding protein-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|30983603|gb|AAP41107.1| kinesin-like calmodulin binding protein [Gossypium hirsutum] | Back alignment and taxonomy information |
|---|
| >gi|356540898|ref|XP_003538921.1| PREDICTED: kinesin-like calmodulin-binding protein homolog [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|1369852|gb|AAB37756.1| kinesin heavy chain-like protein [Solanum tuberosum] | Back alignment and taxonomy information |
|---|
| >gi|1491931|gb|AAC49393.1| kinesin-like protein [Nicotiana tabacum] | Back alignment and taxonomy information |
|---|
| >gi|356559177|ref|XP_003547877.1| PREDICTED: kinesin-like calmodulin-binding protein homolog [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|356531307|ref|XP_003534219.1| PREDICTED: kinesin-like calmodulin-binding protein homolog [Glycine max] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Annotation Transfer from SWISS-PROT Entries
Original result of BLAST against SWISS-PROT
| ID | Name | Annotated EC number | Identity | Query coverage | Hit coverage | RBH(Q2H) | RBH(H2Q) |
| Q9FHN8 | KCBP_ARATH | No assigned EC number | 0.7665 | 0.9645 | 0.9706 | yes | no |
| Q7XPJ0 | KCBP_ORYSJ | No assigned EC number | 0.7477 | 0.9621 | 0.9775 | yes | no |
EC Number Prediction by Ezypred Server
Original result from Ezypred Server
Fail to connect to Ezypred Server
EC Number Prediction by EFICAz Software
No EC number assignment, probably not an enzyme!
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING
Original result from the STRING server
Fail to connect to STRING server
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST
Original result of RPS-BLAST against CDD database part I
| ID | Alignment Graph | Length |
Definition |
E-value |
| Query | 1268 | |||
| cd01366 | 329 | cd01366, KISc_C_terminal, Kinesin motor domain, KI | 1e-166 | |
| smart00129 | 335 | smart00129, KISc, Kinesin motor, catalytic domain | 1e-139 | |
| pfam00225 | 326 | pfam00225, Kinesin, Kinesin motor domain | 1e-134 | |
| cd13200 | 189 | cd13200, FERM_C_KCBP, kinesin-like calmodulin bind | 1e-122 | |
| cd00106 | 328 | cd00106, KISc, Kinesin motor domain | 1e-122 | |
| cd01372 | 341 | cd01372, KISc_KIF4, Kinesin motor domain, KIF4-lik | 5e-99 | |
| cd01369 | 325 | cd01369, KISc_KHC_KIF5, Kinesin motor domain, kine | 9e-96 | |
| cd01365 | 356 | cd01365, KISc_KIF1A_KIF1B, Kinesin motor domain, K | 9e-95 | |
| cd01371 | 333 | cd01371, KISc_KIF3, Kinesin motor domain, kinesins | 1e-93 | |
| cd01370 | 338 | cd01370, KISc_KIP3_like, Kinesin motor domain, KIP | 6e-91 | |
| cd01374 | 321 | cd01374, KISc_CENP_E, Kinesin motor domain, CENP-E | 2e-84 | |
| cd01364 | 352 | cd01364, KISc_BimC_Eg5, Kinesin motor domain, BimC | 3e-84 | |
| cd01367 | 322 | cd01367, KISc_KIF2_like, Kinesin motor domain, KIF | 3e-80 | |
| cd01373 | 337 | cd01373, KISc_KLP2_like, Kinesin motor domain, KLP | 3e-71 | |
| cd01376 | 319 | cd01376, KISc_KID_like, Kinesin motor domain, KIF2 | 2e-68 | |
| cd01375 | 334 | cd01375, KISc_KIF9_like, Kinesin motor domain, KIF | 3e-68 | |
| COG5059 | 568 | COG5059, KIP1, Kinesin-like protein [Cytoskeleton] | 8e-67 | |
| cd01368 | 345 | cd01368, KISc_KIF23_like, Kinesin motor domain, KI | 4e-62 | |
| PLN03188 | 1320 | PLN03188, PLN03188, kinesin-12 family protein; Pro | 3e-52 | |
| smart00139 | 152 | smart00139, MyTH4, Domain in Myosin and Kinesin Ta | 4e-45 | |
| cd01363 | 186 | cd01363, Motor_domain, Myosin and Kinesin motor do | 8e-39 | |
| pfam00784 | 106 | pfam00784, MyTH4, MyTH4 domain | 3e-37 | |
| smart00295 | 201 | smart00295, B41, Band 4 | 2e-34 | |
| pfam00373 | 113 | pfam00373, FERM_M, FERM central domain | 1e-22 | |
| cd13199 | 176 | cd13199, FERM_C2_MyoVII, Myosin VII (MyoVII, Myo7) | 2e-19 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 8e-16 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 3e-15 | |
| TIGR02169 | 1164 | TIGR02169, SMC_prok_A, chromosome segregation prot | 3e-15 | |
| cd01363 | 186 | cd01363, Motor_domain, Myosin and Kinesin motor do | 2e-14 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 4e-14 | |
| TIGR02168 | 1179 | TIGR02168, SMC_prok_B, chromosome segregation prot | 5e-14 | |
| COG5059 | 568 | COG5059, KIP1, Kinesin-like protein [Cytoskeleton] | 4e-13 | |
| TIGR02169 | 1164 | TIGR02169, SMC_prok_A, chromosome segregation prot | 7e-12 | |
| cd13201 | 131 | cd13201, FERM_C_MyoXV, Myosin XV (MyoXV/Myo15) FER | 9e-12 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 2e-11 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 3e-11 | |
| TIGR02168 | 1179 | TIGR02168, SMC_prok_B, chromosome segregation prot | 7e-11 | |
| TIGR02168 | 1179 | TIGR02168, SMC_prok_B, chromosome segregation prot | 1e-10 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 8e-10 | |
| TIGR02169 | 1164 | TIGR02169, SMC_prok_A, chromosome segregation prot | 2e-09 | |
| TIGR02169 | 1164 | TIGR02169, SMC_prok_A, chromosome segregation prot | 2e-09 | |
| TIGR02169 | 1164 | TIGR02169, SMC_prok_A, chromosome segregation prot | 3e-09 | |
| TIGR02169 | 1164 | TIGR02169, SMC_prok_A, chromosome segregation prot | 5e-09 | |
| TIGR02168 | 1179 | TIGR02168, SMC_prok_B, chromosome segregation prot | 6e-09 | |
| pfam01576 | 859 | pfam01576, Myosin_tail_1, Myosin tail | 9e-09 | |
| pfam09379 | 79 | pfam09379, FERM_N, FERM N-terminal domain | 1e-08 | |
| COG0419 | 908 | COG0419, SbcC, ATPase involved in DNA repair [DNA | 2e-08 | |
| PRK03918 | 880 | PRK03918, PRK03918, chromosome segregation protein | 6e-08 | |
| COG0419 | 908 | COG0419, SbcC, ATPase involved in DNA repair [DNA | 2e-07 | |
| PRK02224 | 880 | PRK02224, PRK02224, chromosome segregation protein | 2e-07 | |
| pfam05622 | 713 | pfam05622, HOOK, HOOK protein | 3e-07 | |
| TIGR02169 | 1164 | TIGR02169, SMC_prok_A, chromosome segregation prot | 4e-07 | |
| COG3883 | 265 | COG3883, COG3883, Uncharacterized protein conserve | 5e-07 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 1e-06 | |
| TIGR02168 | 1179 | TIGR02168, SMC_prok_B, chromosome segregation prot | 2e-06 | |
| COG0419 | 908 | COG0419, SbcC, ATPase involved in DNA repair [DNA | 2e-06 | |
| PRK03918 | 880 | PRK03918, PRK03918, chromosome segregation protein | 2e-06 | |
| pfam02463 | 1162 | pfam02463, SMC_N, RecF/RecN/SMC N terminal domain | 3e-06 | |
| TIGR00618 | 1042 | TIGR00618, sbcc, exonuclease SbcC | 3e-06 | |
| cd13202 | 111 | cd13202, FERM_C_MyoX, Myosin X (MyoX, Myo10) FERM | 3e-06 | |
| PRK03918 | 880 | PRK03918, PRK03918, chromosome segregation protein | 4e-06 | |
| COG0419 | 908 | COG0419, SbcC, ATPase involved in DNA repair [DNA | 5e-06 | |
| PRK02224 | 880 | PRK02224, PRK02224, chromosome segregation protein | 5e-06 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 2e-05 | |
| pfam05622 | 713 | pfam05622, HOOK, HOOK protein | 3e-05 | |
| pfam13166 | 713 | pfam13166, AAA_13, AAA domain | 3e-05 | |
| TIGR02169 | 1164 | TIGR02169, SMC_prok_A, chromosome segregation prot | 4e-05 | |
| pfam01576 | 859 | pfam01576, Myosin_tail_1, Myosin tail | 4e-05 | |
| COG4942 | 420 | COG4942, COG4942, Membrane-bound metallopeptidase | 4e-05 | |
| COG0419 | 908 | COG0419, SbcC, ATPase involved in DNA repair [DNA | 5e-05 | |
| pfam02463 | 1162 | pfam02463, SMC_N, RecF/RecN/SMC N terminal domain | 5e-05 | |
| PTZ00121 | 2084 | PTZ00121, PTZ00121, MAEBL; Provisional | 5e-05 | |
| PRK03918 | 880 | PRK03918, PRK03918, chromosome segregation protein | 6e-05 | |
| pfam12128 | 1198 | pfam12128, DUF3584, Protein of unknown function (D | 7e-05 | |
| PRK12704 | 520 | PRK12704, PRK12704, phosphodiesterase; Provisional | 7e-05 | |
| COG0419 | 908 | COG0419, SbcC, ATPase involved in DNA repair [DNA | 1e-04 | |
| PRK03918 | 880 | PRK03918, PRK03918, chromosome segregation protein | 1e-04 | |
| cd00836 | 91 | cd00836, FERM_C-lobe, FERM domain C-lobe | 1e-04 | |
| pfam10174 | 774 | pfam10174, Cast, RIM-binding protein of the cytoma | 1e-04 | |
| pfam01576 | 859 | pfam01576, Myosin_tail_1, Myosin tail | 2e-04 | |
| COG0419 | 908 | COG0419, SbcC, ATPase involved in DNA repair [DNA | 2e-04 | |
| PRK03918 | 880 | PRK03918, PRK03918, chromosome segregation protein | 2e-04 | |
| TIGR00618 | 1042 | TIGR00618, sbcc, exonuclease SbcC | 2e-04 | |
| COG4372 | 499 | COG4372, COG4372, Uncharacterized protein conserve | 2e-04 | |
| pfam01576 | 859 | pfam01576, Myosin_tail_1, Myosin tail | 3e-04 | |
| pfam12128 | 1198 | pfam12128, DUF3584, Protein of unknown function (D | 3e-04 | |
| TIGR00606 | 1311 | TIGR00606, rad50, rad50 | 3e-04 | |
| pfam08614 | 194 | pfam08614, ATG16, Autophagy protein 16 (ATG16) | 3e-04 | |
| PRK12705 | 508 | PRK12705, PRK12705, hypothetical protein; Provisio | 4e-04 | |
| pfam01576 | 859 | pfam01576, Myosin_tail_1, Myosin tail | 5e-04 | |
| pfam05557 | 722 | pfam05557, MAD, Mitotic checkpoint protein | 5e-04 | |
| TIGR00606 | 1311 | TIGR00606, rad50, rad50 | 6e-04 | |
| cd00176 | 213 | cd00176, SPEC, Spectrin repeats, found in several | 7e-04 | |
| PTZ00121 | 2084 | PTZ00121, PTZ00121, MAEBL; Provisional | 8e-04 | |
| PRK02224 | 880 | PRK02224, PRK02224, chromosome segregation protein | 0.001 | |
| pfam02463 | 1162 | pfam02463, SMC_N, RecF/RecN/SMC N terminal domain | 0.001 | |
| COG4942 | 420 | COG4942, COG4942, Membrane-bound metallopeptidase | 0.002 | |
| COG2433 | 652 | COG2433, COG2433, Uncharacterized conserved protei | 0.002 | |
| pfam07888 | 546 | pfam07888, CALCOCO1, Calcium binding and coiled-co | 0.002 | |
| pfam13514 | 1118 | pfam13514, AAA_27, AAA domain | 0.004 |
| >gnl|CDD|238662 cd01366, KISc_C_terminal, Kinesin motor domain, KIFC2/KIFC3/ncd-like carboxy-terminal kinesins | Back alignment and domain information |
|---|
Score = 496 bits (1280), Expect = e-166
Identities = 181/330 (54%), Positives = 232/330 (70%), Gaps = 4/330 (1%)
Query: 890 KGKIRVYCRLRPLNEKEDAEKERYVLTSLDE-FTVEHPWKD-DKVKQHMYDQVFDGYATQ 947
KG IRV+CR+RPL E + + V++ DE K K K +D+VFD A+Q
Sbjct: 1 KGNIRVFCRVRPLLPSE-STEYSSVISFPDEDGGTIELSKGTGKKKSFSFDRVFDPDASQ 59
Query: 948 EDVFEDTRYLVQSAVDGYNVCIFAYGQTGSGKTFTIYGSECNPGITPRAISELFRILKK- 1006
EDVFE+ LVQSA+DGYNVCIFAYGQTGSGKT+T+ G NPGI PRA+ +LF ++
Sbjct: 60 EDVFEEVSPLVQSALDGYNVCIFAYGQTGSGKTYTMEGPPENPGIIPRALEQLFNTAEEL 119
Query: 1007 ENNKFSFSLKAYMVELYQDTLVDLLLPRNEKRLKLEIKKDSKGMVLVENVTVVPISTFEE 1066
+ +S+++ A M+E+Y +T+ DLL + + KLEIK DSKG V N+T VP+S+ EE
Sbjct: 120 KEKGWSYTITASMLEIYNETIRDLLATKPAPKKKLEIKHDSKGETYVTNLTEVPVSSPEE 179
Query: 1067 IKSIIQRGSDQRHTSGTQMNEESSRSHLILSIVIESTNLQTQSVARGKLSFVDLAGSERV 1126
+ ++ GS R + T MNE SSRSH + + I TNLQT RGKL+ VDLAGSER+
Sbjct: 180 VTRLLNLGSKNRSVASTNMNEHSSRSHAVFQLKIRGTNLQTGEQTRGKLNLVDLAGSERL 239
Query: 1127 KKSGSSGNQLKEAQSINKSLSALGDVISALSSGSQHIPYRNHKLTMLMSDSLGGNAKTLM 1186
KKSG++G++LKEAQ+INKSLSALGDVISAL S H+PYRN KLT L+ DSLGGN+KTLM
Sbjct: 240 KKSGATGDRLKEAQAINKSLSALGDVISALRSKDSHVPYRNSKLTYLLQDSLGGNSKTLM 299
Query: 1187 FVNVSPAESNLEESYNSLTYASRVRSIVND 1216
FVN+SP ESNL E+ SL +ASRVRS+
Sbjct: 300 FVNISPLESNLSETLCSLRFASRVRSVELG 329
|
Ncd is a spindle motor protein necessary for chromosome segregation in meiosis. KIFC2/KIFC3-like kinesins have been implicated in motility of the Golgi apparatus as well as dentritic and axonal transport in neurons. This catalytic (head) domain has ATPase activity and belongs to the larger group of P-loop NTPases. Kinesins are microtubule-dependent molecular motors that play important roles in intracellular transport and in cell division. In this subgroup the motor domain is found at the C-terminus (C-type). C-type kinesins are (-) end-directed motors, i.e. they transport cargo towards the (-) end of the microtubule. Kinesin motor domains hydrolyze ATP at a rate of about 80 per second, and move along the microtubule at a speed of about 6400 Angstroms per second. To achieve that, kinesin head groups work in pairs. Upon replacing ADP with ATP, a kinesin motor domain increases its affinity for microtubule binding and locks in place. Also, the neck linker binds to the motor domain, which repositions the other head domain through the coiled-coil domain close to a second tubulin dimer, about 80 Angstroms along the microtubule. Meanwhile, ATP hydrolysis takes place, and when the second head domain binds to the microtubule, the first domain again replaces ADP with ATP, triggering a conformational change that pulls the first domain forward. Length = 329 |
| >gnl|CDD|214526 smart00129, KISc, Kinesin motor, catalytic domain | Back alignment and domain information |
|---|
| >gnl|CDD|215803 pfam00225, Kinesin, Kinesin motor domain | Back alignment and domain information |
|---|
| >gnl|CDD|241354 cd13200, FERM_C_KCBP, kinesin-like calmodulin binding protein FERM domain C-lobe | Back alignment and domain information |
|---|
| >gnl|CDD|238054 cd00106, KISc, Kinesin motor domain | Back alignment and domain information |
|---|
| >gnl|CDD|238668 cd01372, KISc_KIF4, Kinesin motor domain, KIF4-like subfamily | Back alignment and domain information |
|---|
| >gnl|CDD|238665 cd01369, KISc_KHC_KIF5, Kinesin motor domain, kinesin heavy chain (KHC) or KIF5-like subgroup | Back alignment and domain information |
|---|
| >gnl|CDD|238661 cd01365, KISc_KIF1A_KIF1B, Kinesin motor domain, KIF1_like proteins | Back alignment and domain information |
|---|
| >gnl|CDD|238667 cd01371, KISc_KIF3, Kinesin motor domain, kinesins II or KIF3_like proteins | Back alignment and domain information |
|---|
| >gnl|CDD|238666 cd01370, KISc_KIP3_like, Kinesin motor domain, KIP3-like subgroup | Back alignment and domain information |
|---|
| >gnl|CDD|238670 cd01374, KISc_CENP_E, Kinesin motor domain, CENP-E/KIP2-like subgroup, involved in chromosome movement and/or spindle elongation during mitosis | Back alignment and domain information |
|---|
| >gnl|CDD|238660 cd01364, KISc_BimC_Eg5, Kinesin motor domain, BimC/Eg5 spindle pole proteins, participate in spindle assembly and chromosome segregation during cell division | Back alignment and domain information |
|---|
| >gnl|CDD|238663 cd01367, KISc_KIF2_like, Kinesin motor domain, KIF2-like group | Back alignment and domain information |
|---|
| >gnl|CDD|238669 cd01373, KISc_KLP2_like, Kinesin motor domain, KLP2-like subgroup | Back alignment and domain information |
|---|
| >gnl|CDD|238672 cd01376, KISc_KID_like, Kinesin motor domain, KIF22/Kid-like subgroup | Back alignment and domain information |
|---|
| >gnl|CDD|238671 cd01375, KISc_KIF9_like, Kinesin motor domain, KIF9-like subgroup; might play a role in cell shape remodeling | Back alignment and domain information |
|---|
| >gnl|CDD|227392 COG5059, KIP1, Kinesin-like protein [Cytoskeleton] | Back alignment and domain information |
|---|
| >gnl|CDD|238664 cd01368, KISc_KIF23_like, Kinesin motor domain, KIF23-like subgroup | Back alignment and domain information |
|---|
| >gnl|CDD|215621 PLN03188, PLN03188, kinesin-12 family protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|214535 smart00139, MyTH4, Domain in Myosin and Kinesin Tails | Back alignment and domain information |
|---|
| >gnl|CDD|238659 cd01363, Motor_domain, Myosin and Kinesin motor domain | Back alignment and domain information |
|---|
| >gnl|CDD|216118 pfam00784, MyTH4, MyTH4 domain | Back alignment and domain information |
|---|
| >gnl|CDD|214604 smart00295, B41, Band 4 | Back alignment and domain information |
|---|
| >gnl|CDD|215882 pfam00373, FERM_M, FERM central domain | Back alignment and domain information |
|---|
| >gnl|CDD|241353 cd13199, FERM_C2_MyoVII, Myosin VII (MyoVII, Myo7) FERM domain C-lobe, repeat 2 | Back alignment and domain information |
|---|
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type | Back alignment and domain information |
|---|
| >gnl|CDD|238659 cd01363, Motor_domain, Myosin and Kinesin motor domain | Back alignment and domain information |
|---|
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type | Back alignment and domain information |
|---|
| >gnl|CDD|227392 COG5059, KIP1, Kinesin-like protein [Cytoskeleton] | Back alignment and domain information |
|---|
| >gnl|CDD|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type | Back alignment and domain information |
|---|
| >gnl|CDD|241355 cd13201, FERM_C_MyoXV, Myosin XV (MyoXV/Myo15) FERM domain C-lobe | Back alignment and domain information |
|---|
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type | Back alignment and domain information |
|---|
| >gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type | Back alignment and domain information |
|---|
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type | Back alignment and domain information |
|---|
| >gnl|CDD|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type | Back alignment and domain information |
|---|
| >gnl|CDD|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type | Back alignment and domain information |
|---|
| >gnl|CDD|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type | Back alignment and domain information |
|---|
| >gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type | Back alignment and domain information |
|---|
| >gnl|CDD|144972 pfam01576, Myosin_tail_1, Myosin tail | Back alignment and domain information |
|---|
| >gnl|CDD|220215 pfam09379, FERM_N, FERM N-terminal domain | Back alignment and domain information |
|---|
| >gnl|CDD|223496 COG0419, SbcC, ATPase involved in DNA repair [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >gnl|CDD|235175 PRK03918, PRK03918, chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223496 COG0419, SbcC, ATPase involved in DNA repair [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >gnl|CDD|179385 PRK02224, PRK02224, chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|218661 pfam05622, HOOK, HOOK protein | Back alignment and domain information |
|---|
| >gnl|CDD|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type | Back alignment and domain information |
|---|
| >gnl|CDD|226400 COG3883, COG3883, Uncharacterized protein conserved in bacteria [Function unknown] | Back alignment and domain information |
|---|
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type | Back alignment and domain information |
|---|
| >gnl|CDD|223496 COG0419, SbcC, ATPase involved in DNA repair [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >gnl|CDD|235175 PRK03918, PRK03918, chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|217051 pfam02463, SMC_N, RecF/RecN/SMC N terminal domain | Back alignment and domain information |
|---|
| >gnl|CDD|129705 TIGR00618, sbcc, exonuclease SbcC | Back alignment and domain information |
|---|
| >gnl|CDD|241356 cd13202, FERM_C_MyoX, Myosin X (MyoX, Myo10) FERM domain C-lobe | Back alignment and domain information |
|---|
| >gnl|CDD|235175 PRK03918, PRK03918, chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223496 COG0419, SbcC, ATPase involved in DNA repair [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >gnl|CDD|179385 PRK02224, PRK02224, chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|218661 pfam05622, HOOK, HOOK protein | Back alignment and domain information |
|---|
| >gnl|CDD|221952 pfam13166, AAA_13, AAA domain | Back alignment and domain information |
|---|
| >gnl|CDD|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type | Back alignment and domain information |
|---|
| >gnl|CDD|144972 pfam01576, Myosin_tail_1, Myosin tail | Back alignment and domain information |
|---|
| >gnl|CDD|227278 COG4942, COG4942, Membrane-bound metallopeptidase [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|223496 COG0419, SbcC, ATPase involved in DNA repair [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >gnl|CDD|217051 pfam02463, SMC_N, RecF/RecN/SMC N terminal domain | Back alignment and domain information |
|---|
| >gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235175 PRK03918, PRK03918, chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|221432 pfam12128, DUF3584, Protein of unknown function (DUF3584) | Back alignment and domain information |
|---|
| >gnl|CDD|237177 PRK12704, PRK12704, phosphodiesterase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223496 COG0419, SbcC, ATPase involved in DNA repair [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >gnl|CDD|235175 PRK03918, PRK03918, chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|241233 cd00836, FERM_C-lobe, FERM domain C-lobe | Back alignment and domain information |
|---|
| >gnl|CDD|220614 pfam10174, Cast, RIM-binding protein of the cytomatrix active zone | Back alignment and domain information |
|---|
| >gnl|CDD|144972 pfam01576, Myosin_tail_1, Myosin tail | Back alignment and domain information |
|---|
| >gnl|CDD|223496 COG0419, SbcC, ATPase involved in DNA repair [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >gnl|CDD|235175 PRK03918, PRK03918, chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|129705 TIGR00618, sbcc, exonuclease SbcC | Back alignment and domain information |
|---|
| >gnl|CDD|226809 COG4372, COG4372, Uncharacterized protein conserved in bacteria with the myosin-like domain [Function unknown] | Back alignment and domain information |
|---|
| >gnl|CDD|144972 pfam01576, Myosin_tail_1, Myosin tail | Back alignment and domain information |
|---|
| >gnl|CDD|221432 pfam12128, DUF3584, Protein of unknown function (DUF3584) | Back alignment and domain information |
|---|
| >gnl|CDD|129694 TIGR00606, rad50, rad50 | Back alignment and domain information |
|---|
| >gnl|CDD|219934 pfam08614, ATG16, Autophagy protein 16 (ATG16) | Back alignment and domain information |
|---|
| >gnl|CDD|237178 PRK12705, PRK12705, hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|144972 pfam01576, Myosin_tail_1, Myosin tail | Back alignment and domain information |
|---|
| >gnl|CDD|218636 pfam05557, MAD, Mitotic checkpoint protein | Back alignment and domain information |
|---|
| >gnl|CDD|129694 TIGR00606, rad50, rad50 | Back alignment and domain information |
|---|
| >gnl|CDD|238103 cd00176, SPEC, Spectrin repeats, found in several proteins involved in cytoskeletal structure; family members include spectrin, alpha-actinin and dystrophin; the spectrin repeat forms a three helix bundle with the second helix interrupted by proline in some sequences; the repeats are independent folding units; tandem repeats are found in differing numbers and arrange in an antiparallel manner to form dimers; the repeats are defined by a characteristic tryptophan (W) residue in helix A and a leucine (L) at the carboxyl end of helix C and separated by a linker of 5 residues; two copies of the repeat are present here | Back alignment and domain information |
|---|
| >gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|179385 PRK02224, PRK02224, chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|217051 pfam02463, SMC_N, RecF/RecN/SMC N terminal domain | Back alignment and domain information |
|---|
| >gnl|CDD|227278 COG4942, COG4942, Membrane-bound metallopeptidase [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|225288 COG2433, COG2433, Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >gnl|CDD|116500 pfam07888, CALCOCO1, Calcium binding and coiled-coil domain (CALCOCO1) like | Back alignment and domain information |
|---|
| >gnl|CDD|205692 pfam13514, AAA_27, AAA domain | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch
Original result of HHsearch against CDD database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 1268 | |||
| KOG4280 | 574 | consensus Kinesin-like protein [Cytoskeleton] | 100.0 | |
| KOG0243 | 1041 | consensus Kinesin-like protein [Cytoskeleton] | 100.0 | |
| KOG0239 | 670 | consensus Kinesin (KAR3 subfamily) [Cytoskeleton] | 100.0 | |
| KOG0245 | 1221 | consensus Kinesin-like protein [Cytoskeleton] | 100.0 | |
| KOG0240 | 607 | consensus Kinesin (SMY1 subfamily) [Cytoskeleton] | 100.0 | |
| PLN03188 | 1320 | kinesin-12 family protein; Provisional | 100.0 | |
| cd01370 | 338 | KISc_KIP3_like Kinesin motor domain, KIP3-like sub | 100.0 | |
| KOG0242 | 675 | consensus Kinesin-like protein [Cytoskeleton] | 100.0 | |
| cd01373 | 337 | KISc_KLP2_like Kinesin motor domain, KLP2-like sub | 100.0 | |
| cd01368 | 345 | KISc_KIF23_like Kinesin motor domain, KIF23-like s | 100.0 | |
| KOG0241 | 1714 | consensus Kinesin-like protein [Cytoskeleton] | 100.0 | |
| cd01365 | 356 | KISc_KIF1A_KIF1B Kinesin motor domain, KIF1_like p | 100.0 | |
| cd01364 | 352 | KISc_BimC_Eg5 Kinesin motor domain, BimC/Eg5 spind | 100.0 | |
| cd01367 | 322 | KISc_KIF2_like Kinesin motor domain, KIF2-like gro | 100.0 | |
| cd01376 | 319 | KISc_KID_like Kinesin motor domain, KIF22/Kid-like | 100.0 | |
| cd01369 | 325 | KISc_KHC_KIF5 Kinesin motor domain, kinesin heavy | 100.0 | |
| cd01371 | 333 | KISc_KIF3 Kinesin motor domain, kinesins II or KIF | 100.0 | |
| cd01366 | 329 | KISc_C_terminal Kinesin motor domain, KIFC2/KIFC3/ | 100.0 | |
| cd01372 | 341 | KISc_KIF4 Kinesin motor domain, KIF4-like subfamil | 100.0 | |
| cd01374 | 321 | KISc_CENP_E Kinesin motor domain, CENP-E/KIP2-like | 100.0 | |
| cd01375 | 334 | KISc_KIF9_like Kinesin motor domain, KIF9-like sub | 100.0 | |
| smart00129 | 335 | KISc Kinesin motor, catalytic domain. ATPase. Micr | 100.0 | |
| KOG0246 | 676 | consensus Kinesin-like protein [Cytoskeleton] | 100.0 | |
| PF00225 | 335 | Kinesin: Kinesin motor domain; InterPro: IPR001752 | 100.0 | |
| KOG0247 | 809 | consensus Kinesin-like protein [Cytoskeleton] | 100.0 | |
| cd00106 | 328 | KISc Kinesin motor domain. This catalytic (head) d | 100.0 | |
| KOG0244 | 913 | consensus Kinesin-like protein [Cytoskeleton] | 100.0 | |
| COG5059 | 568 | KIP1 Kinesin-like protein [Cytoskeleton] | 100.0 | |
| cd01363 | 186 | Motor_domain Myosin and Kinesin motor domain. Thes | 100.0 | |
| KOG0248 | 936 | consensus Cytoplasmic protein Max-1, contains PH, | 100.0 | |
| smart00139 | 144 | MyTH4 Domain in Myosin and Kinesin Tails. Domain p | 100.0 | |
| PF00784 | 114 | MyTH4: MyTH4 domain; InterPro: IPR000857 The micro | 99.97 | |
| KOG3530 | 616 | consensus FERM domain protein EHM2 [General functi | 99.96 | |
| smart00295 | 207 | B41 Band 4.1 homologues. Also known as ezrin/radix | 99.96 | |
| KOG3529 | 596 | consensus Radixin, moesin and related proteins of | 99.89 | |
| KOG4261 | 1003 | consensus Talin [Cytoskeleton] | 99.89 | |
| KOG0792 | 1144 | consensus Protein tyrosine phosphatase PTPMEG, con | 99.86 | |
| KOG3527 | 975 | consensus Erythrocyte membrane protein 4.1 and rel | 99.86 | |
| PF00373 | 126 | FERM_M: FERM central domain; InterPro: IPR019748 T | 99.78 | |
| KOG3552 | 1298 | consensus FERM domain protein FRM-8 [General funct | 99.78 | |
| TIGR02169 | 1164 | SMC_prok_A chromosome segregation protein SMC, pri | 99.3 | |
| COG1196 | 1163 | Smc Chromosome segregation ATPases [Cell division | 99.27 | |
| KOG4257 | 974 | consensus Focal adhesion tyrosine kinase FAK, cont | 99.27 | |
| TIGR02168 | 1179 | SMC_prok_B chromosome segregation protein SMC, com | 99.21 | |
| TIGR02168 | 1179 | SMC_prok_B chromosome segregation protein SMC, com | 99.15 | |
| KOG3531 | 1036 | consensus Rho guanine nucleotide exchange factor C | 99.09 | |
| KOG0996 | 1293 | consensus Structural maintenance of chromosome pro | 99.09 | |
| KOG0933 | 1174 | consensus Structural maintenance of chromosome pro | 99.08 | |
| PF07888 | 546 | CALCOCO1: Calcium binding and coiled-coil domain ( | 99.06 | |
| TIGR02169 | 1164 | SMC_prok_A chromosome segregation protein SMC, pri | 99.03 | |
| KOG0161 | 1930 | consensus Myosin class II heavy chain [Cytoskeleto | 99.0 | |
| PF00261 | 237 | Tropomyosin: Tropomyosin; InterPro: IPR000533 Trop | 98.96 | |
| COG1196 | 1163 | Smc Chromosome segregation ATPases [Cell division | 98.95 | |
| PF07888 | 546 | CALCOCO1: Calcium binding and coiled-coil domain ( | 98.94 | |
| PF00261 | 237 | Tropomyosin: Tropomyosin; InterPro: IPR000533 Trop | 98.94 | |
| KOG0161 | 1930 | consensus Myosin class II heavy chain [Cytoskeleto | 98.89 | |
| KOG0977 | 546 | consensus Nuclear envelope protein lamin, intermed | 98.84 | |
| PRK02224 | 880 | chromosome segregation protein; Provisional | 98.84 | |
| KOG0250 | 1074 | consensus DNA repair protein RAD18 (SMC family pro | 98.83 | |
| KOG0250 | 1074 | consensus DNA repair protein RAD18 (SMC family pro | 98.83 | |
| KOG3784 | 407 | consensus Sorting nexin protein SNX27 [General fun | 98.82 | |
| KOG0971 | 1243 | consensus Microtubule-associated protein dynactin | 98.8 | |
| PRK02224 | 880 | chromosome segregation protein; Provisional | 98.79 | |
| KOG0971 | 1243 | consensus Microtubule-associated protein dynactin | 98.78 | |
| KOG4371 | 1332 | consensus Membrane-associated protein tyrosine pho | 98.77 | |
| PF09379 | 80 | FERM_N: FERM N-terminal domain ; InterPro: IPR0189 | 98.76 | |
| PRK11637 | 428 | AmiB activator; Provisional | 98.74 | |
| KOG0933 | 1174 | consensus Structural maintenance of chromosome pro | 98.74 | |
| KOG0976 | 1265 | consensus Rho/Rac1-interacting serine/threonine ki | 98.73 | |
| KOG0964 | 1200 | consensus Structural maintenance of chromosome pro | 98.73 | |
| KOG1029 | 1118 | consensus Endocytic adaptor protein intersectin [S | 98.72 | |
| KOG1029 | 1118 | consensus Endocytic adaptor protein intersectin [S | 98.72 | |
| PRK11637 | 428 | AmiB activator; Provisional | 98.7 | |
| KOG0964 | 1200 | consensus Structural maintenance of chromosome pro | 98.7 | |
| COG4372 | 499 | Uncharacterized protein conserved in bacteria with | 98.7 | |
| KOG0996 | 1293 | consensus Structural maintenance of chromosome pro | 98.66 | |
| COG1340 | 294 | Uncharacterized archaeal coiled-coil protein [Func | 98.65 | |
| KOG0994 | 1758 | consensus Extracellular matrix glycoprotein Lamini | 98.65 | |
| KOG0995 | 581 | consensus Centromere-associated protein HEC1 [Cell | 98.64 | |
| TIGR00606 | 1311 | rad50 rad50. This family is based on the phylogeno | 98.64 | |
| PRK03918 | 880 | chromosome segregation protein; Provisional | 98.63 | |
| PF09755 | 310 | DUF2046: Uncharacterized conserved protein H4 (DUF | 98.6 | |
| PF00038 | 312 | Filament: Intermediate filament protein; InterPro: | 98.59 | |
| COG4372 | 499 | Uncharacterized protein conserved in bacteria with | 98.58 | |
| COG1340 | 294 | Uncharacterized archaeal coiled-coil protein [Func | 98.58 | |
| KOG0977 | 546 | consensus Nuclear envelope protein lamin, intermed | 98.57 | |
| PHA02562 | 562 | 46 endonuclease subunit; Provisional | 98.57 | |
| KOG4229 | 1062 | consensus Myosin VII, myosin IXB and related myosi | 98.57 | |
| PF09726 | 697 | Macoilin: Transmembrane protein; InterPro: IPR0191 | 98.56 | |
| TIGR00606 | 1311 | rad50 rad50. This family is based on the phylogeno | 98.56 | |
| KOG0976 | 1265 | consensus Rho/Rac1-interacting serine/threonine ki | 98.55 | |
| PF00038 | 312 | Filament: Intermediate filament protein; InterPro: | 98.51 | |
| PHA02562 | 562 | 46 endonuclease subunit; Provisional | 98.49 | |
| PRK03918 | 880 | chromosome segregation protein; Provisional | 98.49 | |
| KOG0995 | 581 | consensus Centromere-associated protein HEC1 [Cell | 98.48 | |
| KOG0612 | 1317 | consensus Rho-associated, coiled-coil containing p | 98.47 | |
| KOG4673 | 961 | consensus Transcription factor TMF, TATA element m | 98.47 | |
| PRK01156 | 895 | chromosome segregation protein; Provisional | 98.47 | |
| KOG4643 | 1195 | consensus Uncharacterized coiled-coil protein [Fun | 98.45 | |
| COG4942 | 420 | Membrane-bound metallopeptidase [Cell division and | 98.44 | |
| cd01787 | 85 | GRB7_RA RA (RAS-associated like) domain of Grb7. G | 98.42 | |
| PRK04863 | 1486 | mukB cell division protein MukB; Provisional | 98.38 | |
| PRK01156 | 895 | chromosome segregation protein; Provisional | 98.38 | |
| PF15070 | 617 | GOLGA2L5: Putative golgin subfamily A member 2-lik | 98.38 | |
| PF10174 | 775 | Cast: RIM-binding protein of the cytomatrix active | 98.36 | |
| PF09726 | 697 | Macoilin: Transmembrane protein; InterPro: IPR0191 | 98.36 | |
| PRK04778 | 569 | septation ring formation regulator EzrA; Provision | 98.35 | |
| KOG0999 | 772 | consensus Microtubule-associated protein Bicaudal- | 98.35 | |
| COG4942 | 420 | Membrane-bound metallopeptidase [Cell division and | 98.35 | |
| KOG0018 | 1141 | consensus Structural maintenance of chromosome pro | 98.34 | |
| KOG0994 | 1758 | consensus Extracellular matrix glycoprotein Lamini | 98.33 | |
| PF05667 | 594 | DUF812: Protein of unknown function (DUF812); Inte | 98.33 | |
| KOG0980 | 980 | consensus Actin-binding protein SLA2/Huntingtin-in | 98.32 | |
| PF10174 | 775 | Cast: RIM-binding protein of the cytomatrix active | 98.3 | |
| KOG4643 | 1195 | consensus Uncharacterized coiled-coil protein [Fun | 98.29 | |
| PRK04863 | 1486 | mukB cell division protein MukB; Provisional | 98.27 | |
| KOG3727 | 664 | consensus Mitogen inducible gene product (contains | 98.27 | |
| COG5185 | 622 | HEC1 Protein involved in chromosome segregation, i | 98.27 | |
| PF12128 | 1201 | DUF3584: Protein of unknown function (DUF3584); In | 98.27 | |
| KOG0946 | 970 | consensus ER-Golgi vesicle-tethering protein p115 | 98.24 | |
| KOG0980 | 980 | consensus Actin-binding protein SLA2/Huntingtin-in | 98.23 | |
| KOG0612 | 1317 | consensus Rho-associated, coiled-coil containing p | 98.21 | |
| cd00836 | 92 | FERM_C FERM_C domain. The FERM_C domain is the thi | 98.2 | |
| KOG4674 | 1822 | consensus Uncharacterized conserved coiled-coil pr | 98.2 | |
| KOG2129 | 552 | consensus Uncharacterized conserved protein H4 [Fu | 98.19 | |
| PF12128 | 1201 | DUF3584: Protein of unknown function (DUF3584); In | 98.18 | |
| KOG0946 | 970 | consensus ER-Golgi vesicle-tethering protein p115 | 98.17 | |
| PF05667 | 594 | DUF812: Protein of unknown function (DUF812); Inte | 98.17 | |
| TIGR03185 | 650 | DNA_S_dndD DNA sulfur modification protein DndD. T | 98.17 | |
| KOG1003 | 205 | consensus Actin filament-coating protein tropomyos | 98.15 | |
| KOG4674 | 1822 | consensus Uncharacterized conserved coiled-coil pr | 98.14 | |
| KOG4673 | 961 | consensus Transcription factor TMF, TATA element m | 98.14 | |
| PF09730 | 717 | BicD: Microtubule-associated protein Bicaudal-D; I | 98.14 | |
| KOG0999 | 772 | consensus Microtubule-associated protein Bicaudal- | 98.1 | |
| PRK04778 | 569 | septation ring formation regulator EzrA; Provision | 98.08 | |
| KOG1003 | 205 | consensus Actin filament-coating protein tropomyos | 98.07 | |
| COG1579 | 239 | Zn-ribbon protein, possibly nucleic acid-binding [ | 98.06 | |
| COG3883 | 265 | Uncharacterized protein conserved in bacteria [Fun | 98.02 | |
| COG5059 | 568 | KIP1 Kinesin-like protein [Cytoskeleton] | 98.01 | |
| COG1579 | 239 | Zn-ribbon protein, possibly nucleic acid-binding [ | 97.97 | |
| TIGR03185 | 650 | DNA_S_dndD DNA sulfur modification protein DndD. T | 97.97 | |
| PF05483 | 786 | SCP-1: Synaptonemal complex protein 1 (SCP-1); Int | 97.94 | |
| KOG0979 | 1072 | consensus Structural maintenance of chromosome pro | 97.94 | |
| PRK11281 | 1113 | hypothetical protein; Provisional | 97.94 | |
| PF06160 | 560 | EzrA: Septation ring formation regulator, EzrA ; I | 97.91 | |
| PF09730 | 717 | BicD: Microtubule-associated protein Bicaudal-D; I | 97.9 | |
| PF12718 | 143 | Tropomyosin_1: Tropomyosin like; InterPro: IPR0005 | 97.87 | |
| PF04849 | 306 | HAP1_N: HAP1 N-terminal conserved region; InterPro | 97.87 | |
| KOG0978 | 698 | consensus E3 ubiquitin ligase involved in syntaxin | 97.86 | |
| TIGR02680 | 1353 | conserved hypothetical protein TIGR02680. Members | 97.86 | |
| KOG0963 | 629 | consensus Transcription factor/CCAAT displacement | 97.85 | |
| PRK11281 | 1113 | hypothetical protein; Provisional | 97.84 | |
| KOG0963 | 629 | consensus Transcription factor/CCAAT displacement | 97.83 | |
| PF00788 | 93 | RA: Ras association (RalGDS/AF-6) domain; InterPro | 97.83 | |
| KOG0018 | 1141 | consensus Structural maintenance of chromosome pro | 97.77 | |
| PRK10929 | 1109 | putative mechanosensitive channel protein; Provisi | 97.76 | |
| TIGR02680 | 1353 | conserved hypothetical protein TIGR02680. Members | 97.75 | |
| PF15619 | 194 | Lebercilin: Ciliary protein causing Leber congenit | 97.74 | |
| PF09789 | 319 | DUF2353: Uncharacterized coiled-coil protein (DUF2 | 97.74 | |
| cd01203 | 104 | DOK_PTB Downstream of tyrosine kinase (DOK) Phosph | 97.72 | |
| PF01576 | 859 | Myosin_tail_1: Myosin tail; InterPro: IPR002928 Mu | 97.7 | |
| PRK09039 | 343 | hypothetical protein; Validated | 97.7 | |
| KOG0979 | 1072 | consensus Structural maintenance of chromosome pro | 97.7 | |
| PF06160 | 560 | EzrA: Septation ring formation regulator, EzrA ; I | 97.66 | |
| PRK09039 | 343 | hypothetical protein; Validated | 97.66 | |
| KOG0978 | 698 | consensus E3 ubiquitin ligase involved in syntaxin | 97.64 | |
| PRK10929 | 1109 | putative mechanosensitive channel protein; Provisi | 97.63 | |
| PF01576 | 859 | Myosin_tail_1: Myosin tail; InterPro: IPR002928 Mu | 97.63 | |
| PF09728 | 309 | Taxilin: Myosin-like coiled-coil protein; InterPro | 97.61 | |
| PF08317 | 325 | Spc7: Spc7 kinetochore protein; InterPro: IPR01325 | 97.59 | |
| cd00824 | 104 | PTBI IRS-like phosphotyrosine-binding domain. IRS- | 97.59 | |
| smart00787 | 312 | Spc7 Spc7 kinetochore protein. This domain is foun | 97.59 | |
| PF08317 | 325 | Spc7: Spc7 kinetochore protein; InterPro: IPR01325 | 97.57 | |
| PF14915 | 305 | CCDC144C: CCDC144C protein coiled-coil region | 97.57 | |
| PF15619 | 194 | Lebercilin: Ciliary protein causing Leber congenit | 97.57 | |
| TIGR03007 | 498 | pepcterm_ChnLen polysaccharide chain length determ | 97.57 | |
| PF04849 | 306 | HAP1_N: HAP1 N-terminal conserved region; InterPro | 97.56 | |
| PF15066 | 527 | CAGE1: Cancer-associated gene protein 1 family | 97.56 | |
| cd01768 | 87 | RA RA (Ras-associating) ubiquitin domain. The RA ( | 97.54 | |
| COG0419 | 908 | SbcC ATPase involved in DNA repair [DNA replicatio | 97.53 | |
| COG0419 | 908 | SbcC ATPase involved in DNA repair [DNA replicatio | 97.48 | |
| COG4477 | 570 | EzrA Negative regulator of septation ring formatio | 97.47 | |
| PF09380 | 90 | FERM_C: FERM C-terminal PH-like domain; InterPro: | 97.46 | |
| PF06008 | 264 | Laminin_I: Laminin Domain I; InterPro: IPR009254 L | 97.45 | |
| smart00314 | 90 | RA Ras association (RalGDS/AF-6) domain. RasGTP ef | 97.45 | |
| KOG0962 | 1294 | consensus DNA repair protein RAD50, ABC-type ATPas | 97.39 | |
| PF13514 | 1111 | AAA_27: AAA domain | 97.39 | |
| PF06008 | 264 | Laminin_I: Laminin Domain I; InterPro: IPR009254 L | 97.37 | |
| KOG0962 | 1294 | consensus DNA repair protein RAD50, ABC-type ATPas | 97.35 | |
| PF15066 | 527 | CAGE1: Cancer-associated gene protein 1 family | 97.35 | |
| PF13514 | 1111 | AAA_27: AAA domain | 97.34 | |
| TIGR01005 | 754 | eps_transp_fam exopolysaccharide transport protein | 97.33 | |
| KOG4809 | 654 | consensus Rab6 GTPase-interacting protein involved | 97.32 | |
| PF10473 | 140 | CENP-F_leu_zip: Leucine-rich repeats of kinetochor | 97.31 | |
| PF02174 | 100 | IRS: PTB domain (IRS-1 type); InterPro: IPR002404 | 97.31 | |
| PF15397 | 258 | DUF4618: Domain of unknown function (DUF4618) | 97.29 | |
| PF10473 | 140 | CENP-F_leu_zip: Leucine-rich repeats of kinetochor | 97.29 | |
| KOG4809 | 654 | consensus Rab6 GTPase-interacting protein involved | 97.27 | |
| smart00787 | 312 | Spc7 Spc7 kinetochore protein. This domain is foun | 97.26 | |
| TIGR01843 | 423 | type_I_hlyD type I secretion membrane fusion prote | 97.25 | |
| KOG4593 | 716 | consensus Mitotic checkpoint protein MAD1 [Cell cy | 97.22 | |
| KOG0249 | 916 | consensus LAR-interacting protein and related prot | 97.2 | |
| smart00310 | 98 | PTBI Phosphotyrosine-binding domain (IRS1-like). | 97.19 | |
| PF09789 | 319 | DUF2353: Uncharacterized coiled-coil protein (DUF2 | 97.19 | |
| KOG1937 | 521 | consensus Uncharacterized conserved protein [Funct | 97.18 | |
| KOG4335 | 558 | consensus FERM domain-containing protein KRIT1 [Si | 97.18 | |
| cd01202 | 102 | FRS2 Fibroblast growth factor receptor substrate 2 | 97.11 | |
| KOG0249 | 916 | consensus LAR-interacting protein and related prot | 97.1 | |
| PF13851 | 201 | GAS: Growth-arrest specific micro-tubule binding | 97.09 | |
| TIGR00634 | 563 | recN DNA repair protein RecN. All proteins in this | 97.08 | |
| PRK10246 | 1047 | exonuclease subunit SbcC; Provisional | 97.08 | |
| TIGR01843 | 423 | type_I_hlyD type I secretion membrane fusion prote | 97.08 | |
| PF05557 | 722 | MAD: Mitotic checkpoint protein; InterPro: IPR0086 | 97.05 | |
| KOG1937 | 521 | consensus Uncharacterized conserved protein [Funct | 97.05 | |
| PF06818 | 202 | Fez1: Fez1; InterPro: IPR009638 This family repres | 96.98 | |
| TIGR00634 | 563 | recN DNA repair protein RecN. All proteins in this | 96.98 | |
| PF07111 | 739 | HCR: Alpha helical coiled-coil rod protein (HCR); | 96.95 | |
| PF05911 | 769 | DUF869: Plant protein of unknown function (DUF869) | 96.95 | |
| PF13851 | 201 | GAS: Growth-arrest specific micro-tubule binding | 96.95 | |
| PF05622 | 713 | HOOK: HOOK protein; InterPro: IPR008636 This famil | 96.94 | |
| PF05911 | 769 | DUF869: Plant protein of unknown function (DUF869) | 96.91 | |
| PRK10246 | 1047 | exonuclease subunit SbcC; Provisional | 96.89 | |
| TIGR03007 | 498 | pepcterm_ChnLen polysaccharide chain length determ | 96.89 | |
| PF09728 | 309 | Taxilin: Myosin-like coiled-coil protein; InterPro | 96.87 | |
| TIGR03017 | 444 | EpsF chain length determinant protein EpsF. Sequen | 96.84 | |
| cd01777 | 87 | SNX27_RA Ubiquitin domain of SNX27 (sorting nexin | 96.82 | |
| PLN03188 | 1320 | kinesin-12 family protein; Provisional | 96.78 | |
| KOG2991 | 330 | consensus Splicing regulator [RNA processing and m | 96.77 | |
| PRK10869 | 553 | recombination and repair protein; Provisional | 96.74 | |
| KOG0243 | 1041 | consensus Kinesin-like protein [Cytoskeleton] | 96.74 | |
| KOG0982 | 502 | consensus Centrosomal protein Nuf [Cell cycle cont | 96.72 | |
| PRK10869 | 553 | recombination and repair protein; Provisional | 96.72 | |
| PF09787 | 511 | Golgin_A5: Golgin subfamily A member 5; InterPro: | 96.67 | |
| COG4477 | 570 | EzrA Negative regulator of septation ring formatio | 96.66 | |
| TIGR01005 | 754 | eps_transp_fam exopolysaccharide transport protein | 96.64 | |
| PF07111 | 739 | HCR: Alpha helical coiled-coil rod protein (HCR); | 96.64 | |
| KOG1899 | 861 | consensus LAR transmembrane tyrosine phosphatase-i | 96.62 | |
| COG3096 | 1480 | MukB Uncharacterized protein involved in chromosom | 96.61 | |
| PF10481 | 307 | CENP-F_N: Cenp-F N-terminal domain; InterPro: IPR0 | 96.58 | |
| PF05557 | 722 | MAD: Mitotic checkpoint protein; InterPro: IPR0086 | 96.54 | |
| KOG1899 | 861 | consensus LAR transmembrane tyrosine phosphatase-i | 96.52 | |
| PF10481 | 307 | CENP-F_N: Cenp-F N-terminal domain; InterPro: IPR0 | 96.51 | |
| PF07926 | 132 | TPR_MLP1_2: TPR/MLP1/MLP2-like protein; InterPro: | 96.51 | |
| cd00435 | 85 | ACBP Acyl CoA binding protein (ACBP) binds thiol e | 96.48 | |
| PLN02939 | 977 | transferase, transferring glycosyl groups | 96.48 | |
| PF10168 | 717 | Nup88: Nuclear pore component; InterPro: IPR019321 | 96.47 | |
| KOG4360 | 596 | consensus Uncharacterized coiled coil protein [Fun | 96.46 | |
| COG3096 | 1480 | MukB Uncharacterized protein involved in chromosom | 96.43 | |
| PF03148 | 384 | Tektin: Tektin family; InterPro: IPR000435 Tektin | 96.43 | |
| KOG1853 | 333 | consensus LIS1-interacting protein NUDE [Cytoskele | 96.43 | |
| PF09755 | 310 | DUF2046: Uncharacterized conserved protein H4 (DUF | 96.4 | |
| TIGR01000 | 457 | bacteriocin_acc bacteriocin secretion accessory pr | 96.4 | |
| PF12795 | 240 | MscS_porin: Mechanosensitive ion channel porin dom | 96.39 | |
| KOG4677 | 554 | consensus Golgi integral membrane protein [Intrace | 96.31 | |
| KOG3751 | 622 | consensus Growth factor receptor-bound proteins (G | 96.2 | |
| KOG1850 | 391 | consensus Myosin-like coiled-coil protein [Cytoske | 96.19 | |
| TIGR01000 | 457 | bacteriocin_acc bacteriocin secretion accessory pr | 96.19 | |
| PF09787 | 511 | Golgin_A5: Golgin subfamily A member 5; InterPro: | 96.16 | |
| KOG1850 | 391 | consensus Myosin-like coiled-coil protein [Cytoske | 96.13 | |
| PF10168 | 717 | Nup88: Nuclear pore component; InterPro: IPR019321 | 96.09 | |
| PF06818 | 202 | Fez1: Fez1; InterPro: IPR009638 This family repres | 96.07 | |
| COG0497 | 557 | RecN ATPase involved in DNA repair [DNA replicatio | 96.07 | |
| KOG1853 | 333 | consensus LIS1-interacting protein NUDE [Cytoskele | 96.07 | |
| PF05384 | 159 | DegS: Sensor protein DegS; InterPro: IPR008595 Thi | 96.02 | |
| PLN02939 | 977 | transferase, transferring glycosyl groups | 95.98 | |
| cd01776 | 87 | Rin1_RA Ubiquitin domain of RIN1 RAS effector. Rin | 95.97 | |
| COG0497 | 557 | RecN ATPase involved in DNA repair [DNA replicatio | 95.95 | |
| PF12795 | 240 | MscS_porin: Mechanosensitive ion channel porin dom | 95.95 | |
| KOG4438 | 446 | consensus Centromere-associated protein NUF2 [Cell | 95.94 | |
| KOG4807 | 593 | consensus F-actin binding protein, regulates actin | 95.93 | |
| PF08614 | 194 | ATG16: Autophagy protein 16 (ATG16); InterPro: IPR | 95.91 | |
| PF04012 | 221 | PspA_IM30: PspA/IM30 family; InterPro: IPR007157 T | 95.88 | |
| PF06785 | 401 | UPF0242: Uncharacterised protein family (UPF0242); | 95.85 | |
| KOG0992 | 613 | consensus Uncharacterized conserved protein [Funct | 95.84 | |
| TIGR03017 | 444 | EpsF chain length determinant protein EpsF. Sequen | 95.84 | |
| PF12777 | 344 | MT: Microtubule-binding stalk of dynein motor; Int | 95.78 | |
| PF13166 | 712 | AAA_13: AAA domain | 95.77 | |
| KOG4302 | 660 | consensus Microtubule-associated protein essential | 95.76 | |
| cd01778 | 96 | RASSF1_RA Ubiquitin-like domain of RASSF1 tumour s | 95.73 | |
| KOG2129 | 552 | consensus Uncharacterized conserved protein H4 [Fu | 95.72 | |
| PF06785 | 401 | UPF0242: Uncharacterised protein family (UPF0242); | 95.67 | |
| cd01784 | 87 | rasfadin_RA Ubiquitin-like domain of Rasfadin. ras | 95.6 | |
| KOG4371 | 1332 | consensus Membrane-associated protein tyrosine pho | 95.58 | |
| PF15450 | 531 | DUF4631: Domain of unknown function (DUF4631) | 95.57 | |
| COG3206 | 458 | GumC Uncharacterized protein involved in exopolysa | 95.57 | |
| PF12325 | 120 | TMF_TATA_bd: TATA element modulatory factor 1 TATA | 95.56 | |
| PF05276 | 239 | SH3BP5: SH3 domain-binding protein 5 (SH3BP5); Int | 95.51 | |
| KOG4438 | 446 | consensus Centromere-associated protein NUF2 [Cell | 95.49 | |
| PF04012 | 221 | PspA_IM30: PspA/IM30 family; InterPro: IPR007157 T | 95.39 | |
| PF12325 | 120 | TMF_TATA_bd: TATA element modulatory factor 1 TATA | 95.31 | |
| PF04111 | 314 | APG6: Autophagy protein Apg6; InterPro: IPR007243 | 95.29 | |
| PF13166 | 712 | AAA_13: AAA domain | 95.24 | |
| PF00887 | 87 | ACBP: Acyl CoA binding protein; InterPro: IPR00058 | 95.21 | |
| KOG4302 | 660 | consensus Microtubule-associated protein essential | 95.2 | |
| cd01760 | 72 | RBD Ubiquitin-like domain of RBD-like S/T kinases. | 95.12 | |
| PF11932 | 251 | DUF3450: Protein of unknown function (DUF3450); In | 95.03 | |
| KOG1103 | 561 | consensus Predicted coiled-coil protein [Function | 95.0 | |
| PF10212 | 518 | TTKRSYEDQ: Predicted coiled-coil domain-containing | 95.0 | |
| PF04111 | 314 | APG6: Autophagy protein Apg6; InterPro: IPR007243 | 94.97 | |
| PF04912 | 388 | Dynamitin: Dynamitin ; InterPro: IPR006996 Dynamit | 94.93 | |
| PF00769 | 246 | ERM: Ezrin/radixin/moesin family; InterPro: IPR011 | 94.88 | |
| cd01817 | 73 | RGS12_RBD Ubiquitin domain of RGS12 and RGS14. RGS | 94.86 | |
| KOG2685 | 421 | consensus Cystoskeletal protein Tektin [Cytoskelet | 94.85 | |
| COG1842 | 225 | PspA Phage shock protein A (IM30), suppresses sigm | 94.84 | |
| TIGR02977 | 219 | phageshock_pspA phage shock protein A. Members of | 94.84 | |
| PTZ00458 | 90 | acyl CoA binding protein; Provisional | 94.76 | |
| PF11559 | 151 | ADIP: Afadin- and alpha -actinin-Binding; InterPro | 94.61 | |
| KOG0804 | 493 | consensus Cytoplasmic Zn-finger protein BRAP2 (BRC | 94.6 | |
| cd01775 | 97 | CYR1_RA Ubiquitin domain of CYR1 adenylate cyclase | 94.58 | |
| KOG0239 | 670 | consensus Kinesin (KAR3 subfamily) [Cytoskeleton] | 94.56 | |
| COG3206 | 458 | GumC Uncharacterized protein involved in exopolysa | 94.54 | |
| COG1842 | 225 | PspA Phage shock protein A (IM30), suppresses sigm | 94.52 | |
| KOG0244 | 913 | consensus Kinesin-like protein [Cytoskeleton] | 94.52 | |
| COG4913 | 1104 | Uncharacterized protein conserved in bacteria [Fun | 94.45 | |
| TIGR00618 | 1042 | sbcc exonuclease SbcC. This family is based on the | 94.41 | |
| PF10498 | 359 | IFT57: Intra-flagellar transport protein 57 ; Inte | 94.4 | |
| COG4913 | 1104 | Uncharacterized protein conserved in bacteria [Fun | 94.37 | |
| PF09304 | 107 | Cortex-I_coil: Cortexillin I, coiled coil; InterPr | 94.37 | |
| smart00455 | 70 | RBD Raf-like Ras-binding domain. | 94.36 | |
| KOG0804 | 493 | consensus Cytoplasmic Zn-finger protein BRAP2 (BRC | 94.35 | |
| KOG4229 | 1062 | consensus Myosin VII, myosin IXB and related myosi | 94.25 | |
| COG2433 | 652 | Uncharacterized conserved protein [Function unknow | 94.23 | |
| PF10480 | 200 | ICAP-1_inte_bdg: Beta-1 integrin binding protein; | 94.18 | |
| TIGR02977 | 219 | phageshock_pspA phage shock protein A. Members of | 94.14 | |
| PF15254 | 861 | CCDC14: Coiled-coil domain-containing protein 14 | 94.11 | |
| COG2433 | 652 | Uncharacterized conserved protein [Function unknow | 94.03 | |
| PF05384 | 159 | DegS: Sensor protein DegS; InterPro: IPR008595 Thi | 93.9 | |
| PF14073 | 178 | Cep57_CLD: Centrosome localisation domain of Cep57 | 93.89 | |
| PF04912 | 388 | Dynamitin: Dynamitin ; InterPro: IPR006996 Dynamit | 93.87 | |
| COG0556 | 663 | UvrB Helicase subunit of the DNA excision repair c | 93.86 | |
| PRK10698 | 222 | phage shock protein PspA; Provisional | 93.84 | |
| KOG0240 | 607 | consensus Kinesin (SMY1 subfamily) [Cytoskeleton] | 93.83 | |
| COG4717 | 984 | Uncharacterized conserved protein [Function unknow | 93.83 | |
| KOG4460 | 741 | consensus Nuclear pore complex, Nup88/rNup84 compo | 93.82 | |
| cd01783 | 97 | DAGK_delta_RA Ubiquitin-like domain of Diacylgylce | 93.78 | |
| PF09738 | 302 | DUF2051: Double stranded RNA binding protein (DUF2 | 93.77 | |
| PRK10698 | 222 | phage shock protein PspA; Provisional | 93.74 | |
| COG4717 | 984 | Uncharacterized conserved protein [Function unknow | 93.58 | |
| KOG4807 | 593 | consensus F-actin binding protein, regulates actin | 93.54 | |
| COG4026 | 290 | Uncharacterized protein containing TOPRIM domain, | 93.52 | |
| PF00640 | 140 | PID: Phosphotyrosine interaction domain (PTB/PID) | 93.48 | |
| PF15254 | 861 | CCDC14: Coiled-coil domain-containing protein 14 | 93.45 | |
| KOG4687 | 389 | consensus Uncharacterized coiled-coil protein [Fun | 93.3 | |
| PF09738 | 302 | DUF2051: Double stranded RNA binding protein (DUF2 | 93.15 | |
| PF15290 | 305 | Syntaphilin: Golgi-localised syntaxin-1-binding cl | 93.12 | |
| PRK10884 | 206 | SH3 domain-containing protein; Provisional | 93.09 | |
| PF15290 | 305 | Syntaphilin: Golgi-localised syntaxin-1-binding cl | 92.89 | |
| PRK09841 | 726 | cryptic autophosphorylating protein tyrosine kinas | 92.81 | |
| PF00308 | 219 | Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013 | 92.79 | |
| PRK11519 | 719 | tyrosine kinase; Provisional | 92.58 | |
| COG4026 | 290 | Uncharacterized protein containing TOPRIM domain, | 92.53 | |
| COG5283 | 1213 | Phage-related tail protein [Function unknown] | 92.42 | |
| PF11932 | 251 | DUF3450: Protein of unknown function (DUF3450); In | 92.41 | |
| PF03148 | 384 | Tektin: Tektin family; InterPro: IPR000435 Tektin | 92.39 | |
| KOG4460 | 741 | consensus Nuclear pore complex, Nup88/rNup84 compo | 92.35 | |
| PF12777 | 344 | MT: Microtubule-binding stalk of dynein motor; Int | 92.34 | |
| cd01782 | 112 | AF6_RA_repeat1 Ubiquitin domain of AT-6, first rep | 92.1 | |
| PRK12704 | 520 | phosphodiesterase; Provisional | 92.06 | |
| PF15358 | 558 | TSKS: Testis-specific serine kinase substrate | 92.0 | |
| cd01216 | 123 | Fe65 Fe65 Phosphotyrosine-binding (PTB) domain, ph | 91.98 | |
| KOG4286 | 966 | consensus Dystrophin-like protein [Cell motility; | 91.98 | |
| KOG0288 | 459 | consensus WD40 repeat protein TipD [General functi | 91.97 | |
| cd01785 | 85 | PDZ_GEF_RA Ubiquitin-like domain of PDZ_GEF_RA. PD | 91.97 | |
| PRK10865 | 857 | protein disaggregation chaperone; Provisional | 91.94 | |
| TIGR03319 | 514 | YmdA_YtgF conserved hypothetical protein YmdA/YtgF | 91.8 | |
| KOG0288 | 459 | consensus WD40 repeat protein TipD [General functi | 91.75 | |
| COG5283 | 1213 | Phage-related tail protein [Function unknown] | 91.72 | |
| cd01215 | 139 | Dab Disabled (Dab) Phosphotyrosine-binding domain. | 91.63 | |
| PRK03947 | 140 | prefoldin subunit alpha; Reviewed | 91.6 | |
| KOG3091 | 508 | consensus Nuclear pore complex, p54 component (sc | 91.57 | |
| KOG4572 | 1424 | consensus Predicted DNA-binding transcription fact | 91.41 | |
| KOG0992 | 613 | consensus Uncharacterized conserved protein [Funct | 91.35 | |
| KOG4403 | 575 | consensus Cell surface glycoprotein STIM, contains | 91.33 | |
| PF10498 | 359 | IFT57: Intra-flagellar transport protein 57 ; Inte | 91.24 | |
| PF04582 | 326 | Reo_sigmaC: Reovirus sigma C capsid protein; Inter | 91.22 | |
| COG3074 | 79 | Uncharacterized protein conserved in bacteria [Fun | 91.2 | |
| COG2805 | 353 | PilT Tfp pilus assembly protein, pilus retraction | 91.18 | |
| PF14992 | 280 | TMCO5: TMCO5 family | 91.12 | |
| cd01781 | 100 | AF6_RA_repeat2 Ubiquitin domain of AT-6, second re | 91.04 | |
| PF06005 | 72 | DUF904: Protein of unknown function (DUF904); Inte | 90.96 | |
| PF10234 | 267 | Cluap1: Clusterin-associated protein-1; InterPro: | 90.92 | |
| PF14847 | 105 | Ras_bdg_2: Ras-binding domain of Byr2; PDB: 1I35_A | 90.67 | |
| KOG4687 | 389 | consensus Uncharacterized coiled-coil protein [Fun | 90.63 | |
| PF04582 | 326 | Reo_sigmaC: Reovirus sigma C capsid protein; Inter | 90.56 | |
| cd00934 | 123 | PTB Phosphotyrosine-binding (PTB) domain. Phosphot | 90.54 | |
| PRK06835 | 329 | DNA replication protein DnaC; Validated | 90.53 | |
| PF06548 | 488 | Kinesin-related: Kinesin-related; InterPro: IPR010 | 90.41 | |
| PRK10361 | 475 | DNA recombination protein RmuC; Provisional | 90.41 | |
| COG4281 | 87 | ACB Acyl-CoA-binding protein [Lipid metabolism] | 90.38 | |
| PF11570 | 136 | E2R135: Coiled-coil receptor-binding R-domain of c | 90.2 | |
| smart00462 | 134 | PTB Phosphotyrosine-binding domain, phosphotyrosin | 90.16 | |
| PF07798 | 177 | DUF1640: Protein of unknown function (DUF1640); In | 90.16 | |
| TIGR02971 | 327 | heterocyst_DevB ABC exporter membrane fusion prote | 90.11 | |
| COG3074 | 79 | Uncharacterized protein conserved in bacteria [Fun | 89.88 | |
| COG5293 | 591 | Predicted ATPase [General function prediction only | 89.87 | |
| PF02196 | 71 | RBD: Raf-like Ras-binding domain; InterPro: IPR003 | 89.86 | |
| PRK10361 | 475 | DNA recombination protein RmuC; Provisional | 89.66 | |
| TIGR01010 | 362 | BexC_CtrB_KpsE polysaccharide export inner-membran | 89.66 | |
| PF10267 | 395 | Tmemb_cc2: Predicted transmembrane and coiled-coil | 89.66 | |
| PF08416 | 131 | PTB: Phosphotyrosine-binding domain; InterPro: IPR | 89.59 | |
| TIGR00618 | 1042 | sbcc exonuclease SbcC. This family is based on the | 89.57 | |
| PF15294 | 278 | Leu_zip: Leucine zipper | 89.56 | |
| KOG4403 | 575 | consensus Cell surface glycoprotein STIM, contains | 89.32 | |
| PLN03229 | 762 | acetyl-coenzyme A carboxylase carboxyl transferase | 89.19 | |
| PF13949 | 296 | ALIX_LYPXL_bnd: ALIX V-shaped domain binding to HI | 89.14 | |
| KOG4239 | 348 | consensus Ras GTPase effector RASSF2 [Signal trans | 89.07 | |
| KOG0817 | 142 | consensus Acyl-CoA-binding protein [Lipid transpor | 89.03 | |
| PF08647 | 96 | BRE1: BRE1 E3 ubiquitin ligase; InterPro: IPR01395 | 89.03 | |
| TIGR03794 | 421 | NHPM_micro_HlyD NHPM bacteriocin system secretion | 88.98 | |
| KOG2196 | 254 | consensus Nuclear porin [Nuclear structure] | 88.91 | |
| KOG4572 | 1424 | consensus Predicted DNA-binding transcription fact | 88.82 | |
| PF05335 | 188 | DUF745: Protein of unknown function (DUF745); Inte | 88.75 | |
| cd01779 | 105 | Myosin_IXb_RA ubitquitin-like domain of Myosin_IXb | 88.64 | |
| PF13949 | 296 | ALIX_LYPXL_bnd: ALIX V-shaped domain binding to HI | 88.63 | |
| PRK11519 | 719 | tyrosine kinase; Provisional | 88.61 | |
| TIGR03794 | 421 | NHPM_micro_HlyD NHPM bacteriocin system secretion | 88.43 | |
| PRK06620 | 214 | hypothetical protein; Validated | 88.37 | |
| PF06120 | 301 | Phage_HK97_TLTM: Tail length tape measure protein; | 88.33 | |
| PTZ00121 | 2084 | MAEBL; Provisional | 88.27 | |
| PRK09841 | 726 | cryptic autophosphorylating protein tyrosine kinas | 88.23 | |
| KOG3091 | 508 | consensus Nuclear pore complex, p54 component (sc | 88.21 | |
| PF04949 | 159 | Transcrip_act: Transcriptional activator; InterPro | 88.08 | |
| PF07889 | 126 | DUF1664: Protein of unknown function (DUF1664); In | 88.07 | |
| TIGR01242 | 364 | 26Sp45 26S proteasome subunit P45 family. Many pro | 88.06 | |
| PF10234 | 267 | Cluap1: Clusterin-associated protein-1; InterPro: | 87.92 | |
| KOG4421 | 637 | consensus Uncharacterized conserved protein [Funct | 87.92 | |
| cd01210 | 127 | EPS8 Epidermal growth factor receptor kinase subst | 87.81 | |
| TIGR01010 | 362 | BexC_CtrB_KpsE polysaccharide export inner-membran | 87.8 | |
| TIGR02971 | 327 | heterocyst_DevB ABC exporter membrane fusion prote | 87.79 | |
| PF12329 | 74 | TMF_DNA_bd: TATA element modulatory factor 1 DNA b | 87.79 | |
| PF05278 | 269 | PEARLI-4: Arabidopsis phospholipase-like protein ( | 87.78 | |
| PRK12377 | 248 | putative replication protein; Provisional | 87.72 | |
| COG2804 | 500 | PulE Type II secretory pathway, ATPase PulE/Tfp pi | 87.67 | |
| PRK10476 | 346 | multidrug resistance protein MdtN; Provisional | 87.65 | |
| PF08647 | 96 | BRE1: BRE1 E3 ubiquitin ligase; InterPro: IPR01395 | 87.49 | |
| PF07889 | 126 | DUF1664: Protein of unknown function (DUF1664); In | 87.34 | |
| PRK15178 | 434 | Vi polysaccharide export inner membrane protein Ve | 87.18 | |
| cd01273 | 142 | CED-6 CED-6 Phosphotyrosine-binding (PTB) domain. | 87.1 | |
| cd01818 | 77 | TIAM1_RBD Ubiquitin domain of Tiam1 guanine nucleo | 87.07 | |
| PRK08084 | 235 | DNA replication initiation factor; Provisional | 86.9 | |
| PRK06893 | 229 | DNA replication initiation factor; Validated | 86.85 | |
| KOG1962 | 216 | consensus B-cell receptor-associated protein and r | 86.78 | |
| cd01268 | 138 | Numb Numb Phosphotyrosine-binding (PTB) domain. Nu | 86.78 | |
| KOG2196 | 254 | consensus Nuclear porin [Nuclear structure] | 86.53 | |
| PRK00106 | 535 | hypothetical protein; Provisional | 86.52 | |
| PRK14086 | 617 | dnaA chromosomal replication initiation protein; P | 86.46 | |
| KOG3850 | 455 | consensus Predicted membrane protein [Function unk | 86.3 | |
| KOG4335 | 558 | consensus FERM domain-containing protein KRIT1 [Si | 86.27 | |
| PTZ00464 | 211 | SNF-7-like protein; Provisional | 86.15 | |
| KOG2751 | 447 | consensus Beclin-like protein [Signal transduction | 86.05 | |
| cd01267 | 132 | CED6_AIDA1b Phosphotyrosine-binding (PTB) domain, | 85.87 | |
| COG1382 | 119 | GimC Prefoldin, chaperonin cofactor [Posttranslati | 85.82 | |
| cd01208 | 156 | X11 X11 Phosphotyrosine-binding (PTB) domain. X11 | 85.8 | |
| KOG2008 | 426 | consensus BTK-associated SH3-domain binding protei | 85.69 | |
| COG1730 | 145 | GIM5 Predicted prefoldin, molecular chaperone impl | 85.61 | |
| PRK07952 | 244 | DNA replication protein DnaC; Validated | 85.61 | |
| KOG0972 | 384 | consensus Huntingtin interacting protein 1 (Hip1) | 85.55 | |
| PF10267 | 395 | Tmemb_cc2: Predicted transmembrane and coiled-coil | 85.43 | |
| PRK08116 | 268 | hypothetical protein; Validated | 85.33 | |
| PTZ00454 | 398 | 26S protease regulatory subunit 6B-like protein; P | 85.28 | |
| KOG1103 | 561 | consensus Predicted coiled-coil protein [Function | 85.15 | |
| KOG0163 | 1259 | consensus Myosin class VI heavy chain [Cytoskeleto | 85.11 | |
| PF05262 | 489 | Borrelia_P83: Borrelia P83/100 protein; InterPro: | 85.07 | |
| PLN03229 | 762 | acetyl-coenzyme A carboxylase carboxyl transferase | 85.01 | |
| PRK05642 | 234 | DNA replication initiation factor; Validated | 84.74 | |
| KOG0972 | 384 | consensus Huntingtin interacting protein 1 (Hip1) | 84.36 | |
| PRK09343 | 121 | prefoldin subunit beta; Provisional | 84.34 | |
| PRK09343 | 121 | prefoldin subunit beta; Provisional | 84.18 | |
| KOG4677 | 554 | consensus Golgi integral membrane protein [Intrace | 84.1 | |
| PRK10476 | 346 | multidrug resistance protein MdtN; Provisional | 84.1 | |
| PF14197 | 69 | Cep57_CLD_2: Centrosome localisation domain of PPC | 84.02 | |
| PF07106 | 169 | TBPIP: Tat binding protein 1(TBP-1)-interacting pr | 83.95 | |
| cd00632 | 105 | Prefoldin_beta Prefoldin beta; Prefoldin is a hexa | 83.87 | |
| KOG4603 | 201 | consensus TBP-1 interacting protein [Signal transd | 83.85 | |
| COG1382 | 119 | GimC Prefoldin, chaperonin cofactor [Posttranslati | 83.73 | |
| PF11470 | 65 | TUG-UBL1: GLUT4 regulating protein TUG; InterPro: | 83.72 | |
| PF05700 | 221 | BCAS2: Breast carcinoma amplified sequence 2 (BCAS | 83.64 | |
| PF03962 | 188 | Mnd1: Mnd1 family; InterPro: IPR005647 This family | 83.62 | |
| cd01274 | 127 | AIDA-1b AIDA-1b Phosphotyrosine-binding (PTB) doma | 83.61 | |
| cd07667 | 240 | BAR_SNX30 The Bin/Amphiphysin/Rvs (BAR) domain of | 83.58 | |
| PF11543 | 80 | UN_NPL4: Nuclear pore localisation protein NPL4; I | 83.58 | |
| COG1474 | 366 | CDC6 Cdc6-related protein, AAA superfamily ATPase | 83.53 | |
| PF11180 | 192 | DUF2968: Protein of unknown function (DUF2968); In | 83.4 | |
| PRK14088 | 440 | dnaA chromosomal replication initiation protein; P | 83.37 | |
| PF07058 | 351 | Myosin_HC-like: Myosin II heavy chain-like; InterP | 83.19 | |
| KOG1962 | 216 | consensus B-cell receptor-associated protein and r | 83.15 | |
| smart00283 | 262 | MA Methyl-accepting chemotaxis-like domains (chemo | 83.12 | |
| smart00283 | 262 | MA Methyl-accepting chemotaxis-like domains (chemo | 83.03 | |
| PF07106 | 169 | TBPIP: Tat binding protein 1(TBP-1)-interacting pr | 82.99 | |
| PRK03992 | 389 | proteasome-activating nucleotidase; Provisional | 82.88 | |
| PF14197 | 69 | Cep57_CLD_2: Centrosome localisation domain of PPC | 82.79 | |
| PF15035 | 182 | Rootletin: Ciliary rootlet component, centrosome c | 82.45 | |
| PRK09087 | 226 | hypothetical protein; Validated | 82.42 | |
| KOG2264 | 907 | consensus Exostosin EXT1L [Signal transduction mec | 82.41 | |
| KOG3647 | 338 | consensus Predicted coiled-coil protein [General f | 82.4 | |
| PF05335 | 188 | DUF745: Protein of unknown function (DUF745); Inte | 82.33 | |
| PF03915 | 424 | AIP3: Actin interacting protein 3; InterPro: IPR02 | 82.31 | |
| PF03962 | 188 | Mnd1: Mnd1 family; InterPro: IPR005647 This family | 82.26 | |
| KOG3850 | 455 | consensus Predicted membrane protein [Function unk | 82.25 | |
| PF08826 | 61 | DMPK_coil: DMPK coiled coil domain like; InterPro: | 82.19 |
| >KOG4280 consensus Kinesin-like protein [Cytoskeleton] | Back alignment and domain information |
|---|
Probab=100.00 E-value=1.5e-81 Score=725.72 Aligned_cols=349 Identities=43% Similarity=0.655 Sum_probs=309.5
Q ss_pred cccceeeecccCCCccccccCCceEEEeCCC---ceeeccC--CCCCceeeEeccccCCCCChhhHHhcH-HHHHHHHhc
Q 000820 890 KGKIRVYCRLRPLNEKEDAEKERYVLTSLDE---FTVEHPW--KDDKVKQHMYDQVFDGYATQEDVFEDT-RYLVQSAVD 963 (1268)
Q Consensus 890 k~~i~~~~RvRp~~~~e~~~~~~~~~~~~~~---~~~~~~~--~~~~~~~f~fd~vf~~~~~q~~v~~~~-~~~v~~~~~ 963 (1268)
..+++|++|+||+...+.......++..... +.+..+. .....+.|+||.||+++++|++||..+ +|+|++|++
T Consensus 4 ~~~v~vvvr~rPl~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~~ftfD~vf~~~stQ~dvy~~~~~~lV~svl~ 83 (574)
T KOG4280|consen 4 ACKVKVVVRVRPLSAAERSELLKSILSVDPAHGRVSLKNPVAGIEGKPKSFTFDAVFDSDSTQDDVYQETVAPLVESVLE 83 (574)
T ss_pred ccceeEEEeecCCCchhhhhhhccccccccccceeeecCCcccccCCCCCceeeeeecCCCCHHHHHHHHhHHHHHHHhc
Confidence 3578999999999988776666555554432 2222221 123467899999999999999999985 999999999
Q ss_pred ccceEEEeecccCCCcccccccC-CCCCCCcHHHHHHHHHHHHhcCCceEEEEEEEeeeecccccccCCCCCcccccceE
Q 000820 964 GYNVCIFAYGQTGSGKTFTIYGS-ECNPGITPRAISELFRILKKENNKFSFSLKAYMVELYQDTLVDLLLPRNEKRLKLE 1042 (1268)
Q Consensus 964 G~n~~i~ayG~tgsGKT~t~~G~-~~~~Gli~r~~~~lf~~~~~~~~~~~~~v~~s~~eiy~e~v~DLL~~~~~~~~~~~ 1042 (1268)
|||+||||||||||||||||+|+ +...|||||++.+||.+|........|.|+|||+|||||.|+|||+|.+. ..+.
T Consensus 84 GyNgtvFaYGQTGsGKTyTM~G~~~~~~GiiPraf~~LF~~I~~~~~~~~f~vrvS~lEiYnE~i~DLL~~~~~--~~l~ 161 (574)
T KOG4280|consen 84 GYNGTVFAYGQTGSGKTYTMIGPDPELRGLIPRAFEHLFRHIDERKEKTRFLVRVSYLEIYNESIRDLLSPVNP--KGLE 161 (574)
T ss_pred ccCceEEEeccCCCCCceEeeCCChhhCCchhHHHHHHHHHHHhccccceEEEEeehHHHHhHHHHHHhCccCc--CCce
Confidence 99999999999999999999999 56789999999999999998776668999999999999999999998765 4788
Q ss_pred EEeCCCCcEEecCcEEEEcCCHHHHHHHHHhccccccccccCCCCCCCCcccEEEEEEEEeec---CCCceeEEEEEEEe
Q 000820 1043 IKKDSKGMVLVENVTVVPISTFEEIKSIIQRGSDQRHTSGTQMNEESSRSHLILSIVIESTNL---QTQSVARGKLSFVD 1119 (1268)
Q Consensus 1043 i~~~~~~~~~v~~~~~~~v~s~~~~~~~l~~~~~~r~~~~t~~n~~ssrsH~i~~i~v~~~~~---~~~~~~~s~l~~vD 1119 (1268)
|+++++.||||+|++++.|.|+++++.+|..|..+|++++|.||..|||||+||+|+|++... +.....+|+|+|||
T Consensus 162 lre~p~~Gv~V~nlse~~v~s~~d~~~~l~~G~~nR~vgat~mn~~SsRSH~ift~~i~~~~~~~~~~~~~~~~rlnlvD 241 (574)
T KOG4280|consen 162 LREDPKCGVYVENLSEMDVESAEDAQQLLVVGLANRRVGATSMNEESSRSHAIFTIHIESSEKSDGGLMSGRSSKLNLVD 241 (574)
T ss_pred eeEcCCCceEecCcceeecCCHHHHHHHHHHHHhhcchhhccCCcccccceEEEEEEEEeecccCCCccccccceeeeee
Confidence 999999999999999999999999999999999999999999999999999999999998322 34466789999999
Q ss_pred cCCCccccCCCCchhhHHHHHHHhHHHHHHHHHHHHhhCCCC-CCCCCCCcccccccccCCCCccceEEEEeCCCCCCHH
Q 000820 1120 LAGSERVKKSGSSGNQLKEAQSINKSLSALGDVISALSSGSQ-HIPYRNHKLTMLMSDSLGGNAKTLMFVNVSPAESNLE 1198 (1268)
Q Consensus 1120 Lagse~~~~~~~~~~~~~e~~~in~sl~~L~~vi~al~~~~~-~vpyr~skLT~lL~~~lgg~~~t~~i~~vsp~~~~~~ 1198 (1268)
||||||..++++.|.+++|+.+||+||++||+||.||+++.+ ||||||||||+||||||||||+|+|||||+|+..+++
T Consensus 242 LagsEr~~~tga~G~rlkEa~~IN~SLs~LG~vI~aLvd~~~~HIPYRdSkLT~LLqdSLGGN~kT~mianvsp~~~~~~ 321 (574)
T KOG4280|consen 242 LAGSERQSKTGAEGERLKEATNINLSLSALGNVISALVDGSKTHIPYRDSKLTRLLQDSLGGNSKTTMIANVSPSSDNYE 321 (574)
T ss_pred ccchhhhcccCccchhhhhhcccchhHHHHHHHHHHHhccccCCCCcchhHHHHHHHHHcCCCceEEEEEecCchhhhhH
Confidence 999999999999999999999999999999999999999988 9999999999999999999999999999999999999
Q ss_pred HHHHHHHHHHHhcccccCCCCCCChH--HHHHHHHHHHHHHHHc
Q 000820 1199 ESYNSLTYASRVRSIVNDPNKNVSSK--EVARLKRLVAYWKEQA 1240 (1268)
Q Consensus 1199 et~~tL~fa~r~~~i~~~~~~~~~~~--~~~~l~~~~~~~~~~~ 1240 (1268)
||++||+||+|||.|+|.|.+|.+++ .+..|+.+++.++...
T Consensus 322 ETlsTLrfA~Rak~I~nk~~ined~~~~~~~~lq~ei~~Lk~~l 365 (574)
T KOG4280|consen 322 ETLSTLRFAQRAKAIKNKPVINEDPKDALLRELQEEIERLKKEL 365 (574)
T ss_pred HHHHHHHHHHHHHHhhccccccCCcchhhHHHHHHHHHHHHHhh
Confidence 99999999999999999999999985 3445555555554444
|
|
| >KOG0243 consensus Kinesin-like protein [Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG0239 consensus Kinesin (KAR3 subfamily) [Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG0245 consensus Kinesin-like protein [Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG0240 consensus Kinesin (SMY1 subfamily) [Cytoskeleton] | Back alignment and domain information |
|---|
| >PLN03188 kinesin-12 family protein; Provisional | Back alignment and domain information |
|---|
| >cd01370 KISc_KIP3_like Kinesin motor domain, KIP3-like subgroup | Back alignment and domain information |
|---|
| >KOG0242 consensus Kinesin-like protein [Cytoskeleton] | Back alignment and domain information |
|---|
| >cd01373 KISc_KLP2_like Kinesin motor domain, KLP2-like subgroup | Back alignment and domain information |
|---|
| >cd01368 KISc_KIF23_like Kinesin motor domain, KIF23-like subgroup | Back alignment and domain information |
|---|
| >KOG0241 consensus Kinesin-like protein [Cytoskeleton] | Back alignment and domain information |
|---|
| >cd01365 KISc_KIF1A_KIF1B Kinesin motor domain, KIF1_like proteins | Back alignment and domain information |
|---|
| >cd01364 KISc_BimC_Eg5 Kinesin motor domain, BimC/Eg5 spindle pole proteins, participate in spindle assembly and chromosome segregation during cell division | Back alignment and domain information |
|---|
| >cd01367 KISc_KIF2_like Kinesin motor domain, KIF2-like group | Back alignment and domain information |
|---|
| >cd01376 KISc_KID_like Kinesin motor domain, KIF22/Kid-like subgroup | Back alignment and domain information |
|---|
| >cd01369 KISc_KHC_KIF5 Kinesin motor domain, kinesin heavy chain (KHC) or KIF5-like subgroup | Back alignment and domain information |
|---|
| >cd01371 KISc_KIF3 Kinesin motor domain, kinesins II or KIF3_like proteins | Back alignment and domain information |
|---|
| >cd01366 KISc_C_terminal Kinesin motor domain, KIFC2/KIFC3/ncd-like carboxy-terminal kinesins | Back alignment and domain information |
|---|
| >cd01372 KISc_KIF4 Kinesin motor domain, KIF4-like subfamily | Back alignment and domain information |
|---|
| >cd01374 KISc_CENP_E Kinesin motor domain, CENP-E/KIP2-like subgroup, involved in chromosome movement and/or spindle elongation during mitosis | Back alignment and domain information |
|---|
| >cd01375 KISc_KIF9_like Kinesin motor domain, KIF9-like subgroup; might play a role in cell shape remodeling | Back alignment and domain information |
|---|
| >smart00129 KISc Kinesin motor, catalytic domain | Back alignment and domain information |
|---|
| >KOG0246 consensus Kinesin-like protein [Cytoskeleton] | Back alignment and domain information |
|---|
| >PF00225 Kinesin: Kinesin motor domain; InterPro: IPR001752 Kinesin [, , ] is a microtubule-associated force-producing protein that may play a role in organelle transport | Back alignment and domain information |
|---|
| >KOG0247 consensus Kinesin-like protein [Cytoskeleton] | Back alignment and domain information |
|---|
| >cd00106 KISc Kinesin motor domain | Back alignment and domain information |
|---|
| >KOG0244 consensus Kinesin-like protein [Cytoskeleton] | Back alignment and domain information |
|---|
| >COG5059 KIP1 Kinesin-like protein [Cytoskeleton] | Back alignment and domain information |
|---|
| >cd01363 Motor_domain Myosin and Kinesin motor domain | Back alignment and domain information |
|---|
| >KOG0248 consensus Cytoplasmic protein Max-1, contains PH, MyTH4 and FERM domains [Cytoskeleton] | Back alignment and domain information |
|---|
| >smart00139 MyTH4 Domain in Myosin and Kinesin Tails | Back alignment and domain information |
|---|
| >PF00784 MyTH4: MyTH4 domain; InterPro: IPR000857 The microtubule-based kinesin motors and actin-based myosin motors generate movements required for intracellular trafficking, cell division, and muscle contraction | Back alignment and domain information |
|---|
| >KOG3530 consensus FERM domain protein EHM2 [General function prediction only] | Back alignment and domain information |
|---|
| >smart00295 B41 Band 4 | Back alignment and domain information |
|---|
| >KOG3529 consensus Radixin, moesin and related proteins of the ERM family [General function prediction only] | Back alignment and domain information |
|---|
| >KOG4261 consensus Talin [Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG0792 consensus Protein tyrosine phosphatase PTPMEG, contains FERM domain [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG3527 consensus Erythrocyte membrane protein 4 | Back alignment and domain information |
|---|
| >PF00373 FERM_M: FERM central domain; InterPro: IPR019748 The FERM domain (F for 4 | Back alignment and domain information |
|---|
| >KOG3552 consensus FERM domain protein FRM-8 [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR02169 SMC_prok_A chromosome segregation protein SMC, primarily archaeal type | Back alignment and domain information |
|---|
| >COG1196 Smc Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >KOG4257 consensus Focal adhesion tyrosine kinase FAK, contains FERM domain [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >TIGR02168 SMC_prok_B chromosome segregation protein SMC, common bacterial type | Back alignment and domain information |
|---|
| >TIGR02168 SMC_prok_B chromosome segregation protein SMC, common bacterial type | Back alignment and domain information |
|---|
| >KOG3531 consensus Rho guanine nucleotide exchange factor CDEP [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0996 consensus Structural maintenance of chromosome protein 4 (chromosome condensation complex Condensin, subunit C) [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >KOG0933 consensus Structural maintenance of chromosome protein 2 (chromosome condensation complex Condensin, subunit E) [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >PF07888 CALCOCO1: Calcium binding and coiled-coil domain (CALCOCO1) like; InterPro: IPR012852 Proteins found in this family are similar to the coiled-coil transcriptional coactivator protein expressed by Mus musculus (CoCoA, Q8CGU1 from SWISSPROT) | Back alignment and domain information |
|---|
| >TIGR02169 SMC_prok_A chromosome segregation protein SMC, primarily archaeal type | Back alignment and domain information |
|---|
| >KOG0161 consensus Myosin class II heavy chain [Cytoskeleton] | Back alignment and domain information |
|---|
| >PF00261 Tropomyosin: Tropomyosin; InterPro: IPR000533 Tropomyosins [], are a family of closely related proteins present in muscle and non-muscle cells | Back alignment and domain information |
|---|
| >COG1196 Smc Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >PF07888 CALCOCO1: Calcium binding and coiled-coil domain (CALCOCO1) like; InterPro: IPR012852 Proteins found in this family are similar to the coiled-coil transcriptional coactivator protein expressed by Mus musculus (CoCoA, Q8CGU1 from SWISSPROT) | Back alignment and domain information |
|---|
| >PF00261 Tropomyosin: Tropomyosin; InterPro: IPR000533 Tropomyosins [], are a family of closely related proteins present in muscle and non-muscle cells | Back alignment and domain information |
|---|
| >KOG0161 consensus Myosin class II heavy chain [Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG0977 consensus Nuclear envelope protein lamin, intermediate filament superfamily [Cell cycle control, cell division, chromosome partitioning; Nuclear structure] | Back alignment and domain information |
|---|
| >PRK02224 chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >KOG0250 consensus DNA repair protein RAD18 (SMC family protein) [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >KOG0250 consensus DNA repair protein RAD18 (SMC family protein) [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >KOG3784 consensus Sorting nexin protein SNX27 [General function prediction only; Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >KOG0971 consensus Microtubule-associated protein dynactin DCTN1/Glued [Cell cycle control, cell division, chromosome partitioning; Cytoskeleton] | Back alignment and domain information |
|---|
| >PRK02224 chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >KOG0971 consensus Microtubule-associated protein dynactin DCTN1/Glued [Cell cycle control, cell division, chromosome partitioning; Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG4371 consensus Membrane-associated protein tyrosine phosphatase PTP-BAS and related proteins, contain FERM domain [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF09379 FERM_N: FERM N-terminal domain ; InterPro: IPR018979 This domain is the N-terminal ubiquitin-like structural domain of the FERM domain | Back alignment and domain information |
|---|
| >PRK11637 AmiB activator; Provisional | Back alignment and domain information |
|---|
| >KOG0933 consensus Structural maintenance of chromosome protein 2 (chromosome condensation complex Condensin, subunit E) [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >KOG0976 consensus Rho/Rac1-interacting serine/threonine kinase Citron [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0964 consensus Structural maintenance of chromosome protein 3 (sister chromatid cohesion complex Cohesin, subunit SMC3) [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >KOG1029 consensus Endocytic adaptor protein intersectin [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >KOG1029 consensus Endocytic adaptor protein intersectin [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >PRK11637 AmiB activator; Provisional | Back alignment and domain information |
|---|
| >KOG0964 consensus Structural maintenance of chromosome protein 3 (sister chromatid cohesion complex Cohesin, subunit SMC3) [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >COG4372 Uncharacterized protein conserved in bacteria with the myosin-like domain [Function unknown] | Back alignment and domain information |
|---|
| >KOG0996 consensus Structural maintenance of chromosome protein 4 (chromosome condensation complex Condensin, subunit C) [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >COG1340 Uncharacterized archaeal coiled-coil protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG0994 consensus Extracellular matrix glycoprotein Laminin subunit beta [Extracellular structures] | Back alignment and domain information |
|---|
| >KOG0995 consensus Centromere-associated protein HEC1 [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >TIGR00606 rad50 rad50 | Back alignment and domain information |
|---|
| >PRK03918 chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >PF09755 DUF2046: Uncharacterized conserved protein H4 (DUF2046); InterPro: IPR019152 This is the conserved N-terminal 350 residues of a family of proteins of unknown function possibly containing a coiled-coil domain | Back alignment and domain information |
|---|
| >PF00038 Filament: Intermediate filament protein; InterPro: IPR016044 Intermediate filaments (IF) [, , ] are proteins which are primordial components of the cytoskeleton and the nuclear envelope | Back alignment and domain information |
|---|
| >COG4372 Uncharacterized protein conserved in bacteria with the myosin-like domain [Function unknown] | Back alignment and domain information |
|---|
| >COG1340 Uncharacterized archaeal coiled-coil protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG0977 consensus Nuclear envelope protein lamin, intermediate filament superfamily [Cell cycle control, cell division, chromosome partitioning; Nuclear structure] | Back alignment and domain information |
|---|
| >PHA02562 46 endonuclease subunit; Provisional | Back alignment and domain information |
|---|
| >KOG4229 consensus Myosin VII, myosin IXB and related myosins [Cell motility] | Back alignment and domain information |
|---|
| >PF09726 Macoilin: Transmembrane protein; InterPro: IPR019130 This entry represents the multi-pass transmembrane protein Macoilin, which is highly conserved in eukaryotes | Back alignment and domain information |
|---|
| >TIGR00606 rad50 rad50 | Back alignment and domain information |
|---|
| >KOG0976 consensus Rho/Rac1-interacting serine/threonine kinase Citron [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF00038 Filament: Intermediate filament protein; InterPro: IPR016044 Intermediate filaments (IF) [, , ] are proteins which are primordial components of the cytoskeleton and the nuclear envelope | Back alignment and domain information |
|---|
| >PHA02562 46 endonuclease subunit; Provisional | Back alignment and domain information |
|---|
| >PRK03918 chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >KOG0995 consensus Centromere-associated protein HEC1 [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >KOG0612 consensus Rho-associated, coiled-coil containing protein kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG4673 consensus Transcription factor TMF, TATA element modulatory factor [Transcription] | Back alignment and domain information |
|---|
| >PRK01156 chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >KOG4643 consensus Uncharacterized coiled-coil protein [Function unknown] | Back alignment and domain information |
|---|
| >COG4942 Membrane-bound metallopeptidase [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >cd01787 GRB7_RA RA (RAS-associated like) domain of Grb7 | Back alignment and domain information |
|---|
| >PRK04863 mukB cell division protein MukB; Provisional | Back alignment and domain information |
|---|
| >PRK01156 chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >PF15070 GOLGA2L5: Putative golgin subfamily A member 2-like protein 5 | Back alignment and domain information |
|---|
| >PF10174 Cast: RIM-binding protein of the cytomatrix active zone; InterPro: IPR019323 This entry represents a family of proteins that form part of the CAZ (cytomatrix at the active zone) complex which is involved in determining the site of synaptic vesicle fusion [] | Back alignment and domain information |
|---|
| >PF09726 Macoilin: Transmembrane protein; InterPro: IPR019130 This entry represents the multi-pass transmembrane protein Macoilin, which is highly conserved in eukaryotes | Back alignment and domain information |
|---|
| >PRK04778 septation ring formation regulator EzrA; Provisional | Back alignment and domain information |
|---|
| >KOG0999 consensus Microtubule-associated protein Bicaudal-D [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >COG4942 Membrane-bound metallopeptidase [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >KOG0018 consensus Structural maintenance of chromosome protein 1 (sister chromatid cohesion complex Cohesin, subunit SMC1) [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >KOG0994 consensus Extracellular matrix glycoprotein Laminin subunit beta [Extracellular structures] | Back alignment and domain information |
|---|
| >PF05667 DUF812: Protein of unknown function (DUF812); InterPro: IPR008530 This family consists of several eukaryotic proteins of unknown function | Back alignment and domain information |
|---|
| >KOG0980 consensus Actin-binding protein SLA2/Huntingtin-interacting protein Hip1 [Cytoskeleton] | Back alignment and domain information |
|---|
| >PF10174 Cast: RIM-binding protein of the cytomatrix active zone; InterPro: IPR019323 This entry represents a family of proteins that form part of the CAZ (cytomatrix at the active zone) complex which is involved in determining the site of synaptic vesicle fusion [] | Back alignment and domain information |
|---|
| >KOG4643 consensus Uncharacterized coiled-coil protein [Function unknown] | Back alignment and domain information |
|---|
| >PRK04863 mukB cell division protein MukB; Provisional | Back alignment and domain information |
|---|
| >KOG3727 consensus Mitogen inducible gene product (contains ERM and PH domains) [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >COG5185 HEC1 Protein involved in chromosome segregation, interacts with SMC proteins [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >PF12128 DUF3584: Protein of unknown function (DUF3584); InterPro: IPR021979 This family consist of uncharacterised bacterial proteins | Back alignment and domain information |
|---|
| >KOG0946 consensus ER-Golgi vesicle-tethering protein p115 [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >KOG0980 consensus Actin-binding protein SLA2/Huntingtin-interacting protein Hip1 [Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG0612 consensus Rho-associated, coiled-coil containing protein kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >cd00836 FERM_C FERM_C domain | Back alignment and domain information |
|---|
| >KOG4674 consensus Uncharacterized conserved coiled-coil protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG2129 consensus Uncharacterized conserved protein H4 [Function unknown] | Back alignment and domain information |
|---|
| >PF12128 DUF3584: Protein of unknown function (DUF3584); InterPro: IPR021979 This family consist of uncharacterised bacterial proteins | Back alignment and domain information |
|---|
| >KOG0946 consensus ER-Golgi vesicle-tethering protein p115 [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >PF05667 DUF812: Protein of unknown function (DUF812); InterPro: IPR008530 This family consists of several eukaryotic proteins of unknown function | Back alignment and domain information |
|---|
| >TIGR03185 DNA_S_dndD DNA sulfur modification protein DndD | Back alignment and domain information |
|---|
| >KOG1003 consensus Actin filament-coating protein tropomyosin [Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG4674 consensus Uncharacterized conserved coiled-coil protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG4673 consensus Transcription factor TMF, TATA element modulatory factor [Transcription] | Back alignment and domain information |
|---|
| >PF09730 BicD: Microtubule-associated protein Bicaudal-D; InterPro: IPR018477 BicD proteins consist of three coiled-coiled domains and are involved in dynein-mediated minus end-directed transport from the Golgi apparatus to the endoplasmic reticulum (ER) [] | Back alignment and domain information |
|---|
| >KOG0999 consensus Microtubule-associated protein Bicaudal-D [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >PRK04778 septation ring formation regulator EzrA; Provisional | Back alignment and domain information |
|---|
| >KOG1003 consensus Actin filament-coating protein tropomyosin [Cytoskeleton] | Back alignment and domain information |
|---|
| >COG1579 Zn-ribbon protein, possibly nucleic acid-binding [General function prediction only] | Back alignment and domain information |
|---|
| >COG3883 Uncharacterized protein conserved in bacteria [Function unknown] | Back alignment and domain information |
|---|
| >COG5059 KIP1 Kinesin-like protein [Cytoskeleton] | Back alignment and domain information |
|---|
| >COG1579 Zn-ribbon protein, possibly nucleic acid-binding [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR03185 DNA_S_dndD DNA sulfur modification protein DndD | Back alignment and domain information |
|---|
| >PF05483 SCP-1: Synaptonemal complex protein 1 (SCP-1); InterPro: IPR008827 Synaptonemal complex protein 1 (SCP-1) is the major component of the transverse filaments of the synaptonemal complex | Back alignment and domain information |
|---|
| >KOG0979 consensus Structural maintenance of chromosome protein SMC5/Spr18, SMC superfamily [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning; Replication, recombination and repair] | Back alignment and domain information |
|---|
| >PRK11281 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PF06160 EzrA: Septation ring formation regulator, EzrA ; InterPro: IPR010379 During the bacterial cell cycle, the tubulin-like cell-division protein FtsZ polymerises into a ring structure that establishes the location of the nascent division site | Back alignment and domain information |
|---|
| >PF09730 BicD: Microtubule-associated protein Bicaudal-D; InterPro: IPR018477 BicD proteins consist of three coiled-coiled domains and are involved in dynein-mediated minus end-directed transport from the Golgi apparatus to the endoplasmic reticulum (ER) [] | Back alignment and domain information |
|---|
| >PF12718 Tropomyosin_1: Tropomyosin like; InterPro: IPR000533 Tropomyosins [], are a family of closely related proteins present in muscle and non-muscle cells | Back alignment and domain information |
|---|
| >PF04849 HAP1_N: HAP1 N-terminal conserved region; InterPro: IPR006933 This family is defined by an N-terminal conserved region found in several huntingtin-associated protein 1 (HAP1) homologues | Back alignment and domain information |
|---|
| >KOG0978 consensus E3 ubiquitin ligase involved in syntaxin degradation [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >TIGR02680 conserved hypothetical protein TIGR02680 | Back alignment and domain information |
|---|
| >KOG0963 consensus Transcription factor/CCAAT displacement protein CDP1 [Transcription] | Back alignment and domain information |
|---|
| >PRK11281 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >KOG0963 consensus Transcription factor/CCAAT displacement protein CDP1 [Transcription] | Back alignment and domain information |
|---|
| >PF00788 RA: Ras association (RalGDS/AF-6) domain; InterPro: IPR000159 Proteins with this domain are mostly RasGTP effectors and include guanine-nucleotide releasing factor in mammals [] | Back alignment and domain information |
|---|
| >KOG0018 consensus Structural maintenance of chromosome protein 1 (sister chromatid cohesion complex Cohesin, subunit SMC1) [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >PRK10929 putative mechanosensitive channel protein; Provisional | Back alignment and domain information |
|---|
| >TIGR02680 conserved hypothetical protein TIGR02680 | Back alignment and domain information |
|---|
| >PF15619 Lebercilin: Ciliary protein causing Leber congenital amaurosis disease | Back alignment and domain information |
|---|
| >PF09789 DUF2353: Uncharacterized coiled-coil protein (DUF2353); InterPro: IPR019179 Members of this family have been annotated as being coiled-coil domain-containing protein 149, however they currently have no known function | Back alignment and domain information |
|---|
| >cd01203 DOK_PTB Downstream of tyrosine kinase (DOK) Phosphotyrosine-binding domain | Back alignment and domain information |
|---|
| >PF01576 Myosin_tail_1: Myosin tail; InterPro: IPR002928 Muscle contraction is caused by sliding between the thick and thin filaments of the myofibril | Back alignment and domain information |
|---|
| >PRK09039 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >KOG0979 consensus Structural maintenance of chromosome protein SMC5/Spr18, SMC superfamily [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning; Replication, recombination and repair] | Back alignment and domain information |
|---|
| >PF06160 EzrA: Septation ring formation regulator, EzrA ; InterPro: IPR010379 During the bacterial cell cycle, the tubulin-like cell-division protein FtsZ polymerises into a ring structure that establishes the location of the nascent division site | Back alignment and domain information |
|---|
| >PRK09039 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >KOG0978 consensus E3 ubiquitin ligase involved in syntaxin degradation [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK10929 putative mechanosensitive channel protein; Provisional | Back alignment and domain information |
|---|
| >PF01576 Myosin_tail_1: Myosin tail; InterPro: IPR002928 Muscle contraction is caused by sliding between the thick and thin filaments of the myofibril | Back alignment and domain information |
|---|
| >PF09728 Taxilin: Myosin-like coiled-coil protein; InterPro: IPR019132 Taxilin contains an extraordinarily long coiled-coil domain in its C-terminal half and is ubiquitously expressed | Back alignment and domain information |
|---|
| >PF08317 Spc7: Spc7 kinetochore protein; InterPro: IPR013253 This entry consists of cell division proteins which are required for kinetochore-spindle association [] | Back alignment and domain information |
|---|
| >cd00824 PTBI IRS-like phosphotyrosine-binding domain | Back alignment and domain information |
|---|
| >smart00787 Spc7 Spc7 kinetochore protein | Back alignment and domain information |
|---|
| >PF08317 Spc7: Spc7 kinetochore protein; InterPro: IPR013253 This entry consists of cell division proteins which are required for kinetochore-spindle association [] | Back alignment and domain information |
|---|
| >PF14915 CCDC144C: CCDC144C protein coiled-coil region | Back alignment and domain information |
|---|
| >PF15619 Lebercilin: Ciliary protein causing Leber congenital amaurosis disease | Back alignment and domain information |
|---|
| >TIGR03007 pepcterm_ChnLen polysaccharide chain length determinant protein, PEP-CTERM locus subfamily | Back alignment and domain information |
|---|
| >PF04849 HAP1_N: HAP1 N-terminal conserved region; InterPro: IPR006933 This family is defined by an N-terminal conserved region found in several huntingtin-associated protein 1 (HAP1) homologues | Back alignment and domain information |
|---|
| >PF15066 CAGE1: Cancer-associated gene protein 1 family | Back alignment and domain information |
|---|
| >cd01768 RA RA (Ras-associating) ubiquitin domain | Back alignment and domain information |
|---|
| >COG0419 SbcC ATPase involved in DNA repair [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >COG0419 SbcC ATPase involved in DNA repair [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >COG4477 EzrA Negative regulator of septation ring formation [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >PF09380 FERM_C: FERM C-terminal PH-like domain; InterPro: IPR018980 The FERM domain (F for 4 | Back alignment and domain information |
|---|
| >PF06008 Laminin_I: Laminin Domain I; InterPro: IPR009254 Laminins are glycoproteins that are major constituents of the basement membrane of cells | Back alignment and domain information |
|---|
| >smart00314 RA Ras association (RalGDS/AF-6) domain | Back alignment and domain information |
|---|
| >KOG0962 consensus DNA repair protein RAD50, ABC-type ATPase/SMC superfamily [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >PF13514 AAA_27: AAA domain | Back alignment and domain information |
|---|
| >PF06008 Laminin_I: Laminin Domain I; InterPro: IPR009254 Laminins are glycoproteins that are major constituents of the basement membrane of cells | Back alignment and domain information |
|---|
| >KOG0962 consensus DNA repair protein RAD50, ABC-type ATPase/SMC superfamily [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >PF15066 CAGE1: Cancer-associated gene protein 1 family | Back alignment and domain information |
|---|
| >PF13514 AAA_27: AAA domain | Back alignment and domain information |
|---|
| >TIGR01005 eps_transp_fam exopolysaccharide transport protein family | Back alignment and domain information |
|---|
| >KOG4809 consensus Rab6 GTPase-interacting protein involved in endosome-to-TGN transport [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >PF10473 CENP-F_leu_zip: Leucine-rich repeats of kinetochore protein Cenp-F/LEK1; InterPro: IPR019513 Cenp-F, a centromeric kinetochore, microtubule-binding protein consisting of two 1,600-amino acid-long coils, is essential for the full functioning of the mitotic checkpoint pathway [, ] | Back alignment and domain information |
|---|
| >PF02174 IRS: PTB domain (IRS-1 type); InterPro: IPR002404 Insulin receptor substrate-1 proteins contain both a pleckstrin homology domain IPR001849 from INTERPRO and a phosphotyrosine binding (PTB) domain | Back alignment and domain information |
|---|
| >PF15397 DUF4618: Domain of unknown function (DUF4618) | Back alignment and domain information |
|---|
| >PF10473 CENP-F_leu_zip: Leucine-rich repeats of kinetochore protein Cenp-F/LEK1; InterPro: IPR019513 Cenp-F, a centromeric kinetochore, microtubule-binding protein consisting of two 1,600-amino acid-long coils, is essential for the full functioning of the mitotic checkpoint pathway [, ] | Back alignment and domain information |
|---|
| >KOG4809 consensus Rab6 GTPase-interacting protein involved in endosome-to-TGN transport [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >smart00787 Spc7 Spc7 kinetochore protein | Back alignment and domain information |
|---|
| >TIGR01843 type_I_hlyD type I secretion membrane fusion protein, HlyD family | Back alignment and domain information |
|---|
| >KOG4593 consensus Mitotic checkpoint protein MAD1 [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >KOG0249 consensus LAR-interacting protein and related proteins [General function prediction only] | Back alignment and domain information |
|---|
| >smart00310 PTBI Phosphotyrosine-binding domain (IRS1-like) | Back alignment and domain information |
|---|
| >PF09789 DUF2353: Uncharacterized coiled-coil protein (DUF2353); InterPro: IPR019179 Members of this family have been annotated as being coiled-coil domain-containing protein 149, however they currently have no known function | Back alignment and domain information |
|---|
| >KOG1937 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG4335 consensus FERM domain-containing protein KRIT1 [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >cd01202 FRS2 Fibroblast growth factor receptor substrate 2 (FRS2/SNT1) Phosphotyrosine-binding domain | Back alignment and domain information |
|---|
| >KOG0249 consensus LAR-interacting protein and related proteins [General function prediction only] | Back alignment and domain information |
|---|
| >PF13851 GAS: Growth-arrest specific micro-tubule binding | Back alignment and domain information |
|---|
| >TIGR00634 recN DNA repair protein RecN | Back alignment and domain information |
|---|
| >PRK10246 exonuclease subunit SbcC; Provisional | Back alignment and domain information |
|---|
| >TIGR01843 type_I_hlyD type I secretion membrane fusion protein, HlyD family | Back alignment and domain information |
|---|
| >PF05557 MAD: Mitotic checkpoint protein; InterPro: IPR008672 This family consists of several eukaryotic mitotic checkpoint (Mitotic arrest deficient or MAD) proteins | Back alignment and domain information |
|---|
| >KOG1937 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >PF06818 Fez1: Fez1; InterPro: IPR009638 This family represents the eukaryotic Fez1 protein | Back alignment and domain information |
|---|
| >TIGR00634 recN DNA repair protein RecN | Back alignment and domain information |
|---|
| >PF07111 HCR: Alpha helical coiled-coil rod protein (HCR); InterPro: IPR009800 This family consists of several mammalian alpha helical coiled-coil rod HCR proteins | Back alignment and domain information |
|---|
| >PF05911 DUF869: Plant protein of unknown function (DUF869); InterPro: IPR008587 This family consists of a number of sequences found in plants | Back alignment and domain information |
|---|
| >PF13851 GAS: Growth-arrest specific micro-tubule binding | Back alignment and domain information |
|---|
| >PF05622 HOOK: HOOK protein; InterPro: IPR008636 This family consists of several HOOK1, 2 and 3 proteins from different eukaryotic organisms | Back alignment and domain information |
|---|
| >PF05911 DUF869: Plant protein of unknown function (DUF869); InterPro: IPR008587 This family consists of a number of sequences found in plants | Back alignment and domain information |
|---|
| >PRK10246 exonuclease subunit SbcC; Provisional | Back alignment and domain information |
|---|
| >TIGR03007 pepcterm_ChnLen polysaccharide chain length determinant protein, PEP-CTERM locus subfamily | Back alignment and domain information |
|---|
| >PF09728 Taxilin: Myosin-like coiled-coil protein; InterPro: IPR019132 Taxilin contains an extraordinarily long coiled-coil domain in its C-terminal half and is ubiquitously expressed | Back alignment and domain information |
|---|
| >TIGR03017 EpsF chain length determinant protein EpsF | Back alignment and domain information |
|---|
| >cd01777 SNX27_RA Ubiquitin domain of SNX27 (sorting nexin protein 27) | Back alignment and domain information |
|---|
| >PLN03188 kinesin-12 family protein; Provisional | Back alignment and domain information |
|---|
| >KOG2991 consensus Splicing regulator [RNA processing and modification] | Back alignment and domain information |
|---|
| >PRK10869 recombination and repair protein; Provisional | Back alignment and domain information |
|---|
| >KOG0243 consensus Kinesin-like protein [Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG0982 consensus Centrosomal protein Nuf [Cell cycle control, cell division, chromosome partitioning; Cytoskeleton] | Back alignment and domain information |
|---|
| >PRK10869 recombination and repair protein; Provisional | Back alignment and domain information |
|---|
| >PF09787 Golgin_A5: Golgin subfamily A member 5; InterPro: IPR019177 This entry represents a family of proteins involved in maintaining Golgi structure | Back alignment and domain information |
|---|
| >COG4477 EzrA Negative regulator of septation ring formation [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >TIGR01005 eps_transp_fam exopolysaccharide transport protein family | Back alignment and domain information |
|---|
| >PF07111 HCR: Alpha helical coiled-coil rod protein (HCR); InterPro: IPR009800 This family consists of several mammalian alpha helical coiled-coil rod HCR proteins | Back alignment and domain information |
|---|
| >KOG1899 consensus LAR transmembrane tyrosine phosphatase-interacting protein liprin [General function prediction only] | Back alignment and domain information |
|---|
| >COG3096 MukB Uncharacterized protein involved in chromosome partitioning [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >PF10481 CENP-F_N: Cenp-F N-terminal domain; InterPro: IPR018463 Mitosin or centromere-associated protein-F (Cenp-F) is found bound across the centromere as one of the proteins of the outer layer of the kinetochore [] | Back alignment and domain information |
|---|
| >PF05557 MAD: Mitotic checkpoint protein; InterPro: IPR008672 This family consists of several eukaryotic mitotic checkpoint (Mitotic arrest deficient or MAD) proteins | Back alignment and domain information |
|---|
| >KOG1899 consensus LAR transmembrane tyrosine phosphatase-interacting protein liprin [General function prediction only] | Back alignment and domain information |
|---|
| >PF10481 CENP-F_N: Cenp-F N-terminal domain; InterPro: IPR018463 Mitosin or centromere-associated protein-F (Cenp-F) is found bound across the centromere as one of the proteins of the outer layer of the kinetochore [] | Back alignment and domain information |
|---|
| >PF07926 TPR_MLP1_2: TPR/MLP1/MLP2-like protein; InterPro: IPR012929 This domain is found in a number of proteins, including TPR protein (P12270 from SWISSPROT) and yeast myosin-like proteins 1 (MLP1, Q02455 from SWISSPROT) and 2 (MLP2, P40457 from SWISSPROT) | Back alignment and domain information |
|---|
| >cd00435 ACBP Acyl CoA binding protein (ACBP) binds thiol esters of long fatty acids and coenzyme A in a one-to-one binding mode with high specificity and affinity | Back alignment and domain information |
|---|
| >PLN02939 transferase, transferring glycosyl groups | Back alignment and domain information |
|---|
| >PF10168 Nup88: Nuclear pore component; InterPro: IPR019321 Nup88 can be divided into two structural domains; the N-terminal two-thirds of the protein have no obvious structural motifs | Back alignment and domain information |
|---|
| >KOG4360 consensus Uncharacterized coiled coil protein [Function unknown] | Back alignment and domain information |
|---|
| >COG3096 MukB Uncharacterized protein involved in chromosome partitioning [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >PF03148 Tektin: Tektin family; InterPro: IPR000435 Tektin heteropolymers form unique protofilaments of flagellar microtubules [] | Back alignment and domain information |
|---|
| >KOG1853 consensus LIS1-interacting protein NUDE [Cytoskeleton] | Back alignment and domain information |
|---|
| >PF09755 DUF2046: Uncharacterized conserved protein H4 (DUF2046); InterPro: IPR019152 This is the conserved N-terminal 350 residues of a family of proteins of unknown function possibly containing a coiled-coil domain | Back alignment and domain information |
|---|
| >TIGR01000 bacteriocin_acc bacteriocin secretion accessory protein | Back alignment and domain information |
|---|
| >PF12795 MscS_porin: Mechanosensitive ion channel porin domain | Back alignment and domain information |
|---|
| >KOG4677 consensus Golgi integral membrane protein [Intracellular trafficking, secretion, and vesicular transport; General function prediction only] | Back alignment and domain information |
|---|
| >KOG3751 consensus Growth factor receptor-bound proteins (GRB7, GRB10, GRB14) [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG1850 consensus Myosin-like coiled-coil protein [Cytoskeleton] | Back alignment and domain information |
|---|
| >TIGR01000 bacteriocin_acc bacteriocin secretion accessory protein | Back alignment and domain information |
|---|
| >PF09787 Golgin_A5: Golgin subfamily A member 5; InterPro: IPR019177 This entry represents a family of proteins involved in maintaining Golgi structure | Back alignment and domain information |
|---|
| >KOG1850 consensus Myosin-like coiled-coil protein [Cytoskeleton] | Back alignment and domain information |
|---|
| >PF10168 Nup88: Nuclear pore component; InterPro: IPR019321 Nup88 can be divided into two structural domains; the N-terminal two-thirds of the protein have no obvious structural motifs | Back alignment and domain information |
|---|
| >PF06818 Fez1: Fez1; InterPro: IPR009638 This family represents the eukaryotic Fez1 protein | Back alignment and domain information |
|---|
| >COG0497 RecN ATPase involved in DNA repair [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >KOG1853 consensus LIS1-interacting protein NUDE [Cytoskeleton] | Back alignment and domain information |
|---|
| >PF05384 DegS: Sensor protein DegS; InterPro: IPR008595 This is a group of Bacillus DegS proteins | Back alignment and domain information |
|---|
| >PLN02939 transferase, transferring glycosyl groups | Back alignment and domain information |
|---|
| >cd01776 Rin1_RA Ubiquitin domain of RIN1 RAS effector | Back alignment and domain information |
|---|
| >COG0497 RecN ATPase involved in DNA repair [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PF12795 MscS_porin: Mechanosensitive ion channel porin domain | Back alignment and domain information |
|---|
| >KOG4438 consensus Centromere-associated protein NUF2 [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >KOG4807 consensus F-actin binding protein, regulates actin cytoskeletal organization [Cytoskeleton] | Back alignment and domain information |
|---|
| >PF08614 ATG16: Autophagy protein 16 (ATG16); InterPro: IPR013923 Macroautophagy is a bulk degradation process induced by starvation in eukaryotic cells | Back alignment and domain information |
|---|
| >PF04012 PspA_IM30: PspA/IM30 family; InterPro: IPR007157 This family includes PspA a protein that suppresses sigma54-dependent transcription | Back alignment and domain information |
|---|
| >PF06785 UPF0242: Uncharacterised protein family (UPF0242); InterPro: IPR009623 This is a group of proteins of unknown function | Back alignment and domain information |
|---|
| >KOG0992 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >TIGR03017 EpsF chain length determinant protein EpsF | Back alignment and domain information |
|---|
| >PF12777 MT: Microtubule-binding stalk of dynein motor; InterPro: IPR024743 The 380 kDa motor unit of dynein belongs to the AAA class of chaperone-like ATPases | Back alignment and domain information |
|---|
| >PF13166 AAA_13: AAA domain | Back alignment and domain information |
|---|
| >KOG4302 consensus Microtubule-associated protein essential for anaphase spindle elongation [Cell cycle control, cell division, chromosome partitioning; Cytoskeleton] | Back alignment and domain information |
|---|
| >cd01778 RASSF1_RA Ubiquitin-like domain of RASSF1 tumour supproessor protein | Back alignment and domain information |
|---|
| >KOG2129 consensus Uncharacterized conserved protein H4 [Function unknown] | Back alignment and domain information |
|---|
| >PF06785 UPF0242: Uncharacterised protein family (UPF0242); InterPro: IPR009623 This is a group of proteins of unknown function | Back alignment and domain information |
|---|
| >cd01784 rasfadin_RA Ubiquitin-like domain of Rasfadin | Back alignment and domain information |
|---|
| >KOG4371 consensus Membrane-associated protein tyrosine phosphatase PTP-BAS and related proteins, contain FERM domain [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF15450 DUF4631: Domain of unknown function (DUF4631) | Back alignment and domain information |
|---|
| >COG3206 GumC Uncharacterized protein involved in exopolysaccharide biosynthesis [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >PF12325 TMF_TATA_bd: TATA element modulatory factor 1 TATA binding; InterPro: IPR022091 This is the C-terminal conserved coiled coil region of a family of TATA element modulatory factor 1 proteins conserved in eukaryotes [] | Back alignment and domain information |
|---|
| >PF05276 SH3BP5: SH3 domain-binding protein 5 (SH3BP5); InterPro: IPR007940 The SH3 domain-binding protein inhibits the auto and transphophorylation of BTK and acts as a negative regulator of BTK-related signalling in B cells | Back alignment and domain information |
|---|
| >KOG4438 consensus Centromere-associated protein NUF2 [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >PF04012 PspA_IM30: PspA/IM30 family; InterPro: IPR007157 This family includes PspA a protein that suppresses sigma54-dependent transcription | Back alignment and domain information |
|---|
| >PF12325 TMF_TATA_bd: TATA element modulatory factor 1 TATA binding; InterPro: IPR022091 This is the C-terminal conserved coiled coil region of a family of TATA element modulatory factor 1 proteins conserved in eukaryotes [] | Back alignment and domain information |
|---|
| >PF04111 APG6: Autophagy protein Apg6; InterPro: IPR007243 Macroautophagy is a bulk degradation process induced by starvation in eukaryotic cells | Back alignment and domain information |
|---|
| >PF13166 AAA_13: AAA domain | Back alignment and domain information |
|---|
| >PF00887 ACBP: Acyl CoA binding protein; InterPro: IPR000582 Acyl-CoA-binding protein (ACBP) is a small (10 Kd) protein that binds medium- and long-chain acyl-CoA esters with very high affinity and may function as an intracellular carrier of acyl-CoA esters [] | Back alignment and domain information |
|---|
| >KOG4302 consensus Microtubule-associated protein essential for anaphase spindle elongation [Cell cycle control, cell division, chromosome partitioning; Cytoskeleton] | Back alignment and domain information |
|---|
| >cd01760 RBD Ubiquitin-like domain of RBD-like S/T kinases | Back alignment and domain information |
|---|
| >PF11932 DUF3450: Protein of unknown function (DUF3450); InterPro: IPR016866 There is currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function | Back alignment and domain information |
|---|
| >KOG1103 consensus Predicted coiled-coil protein [Function unknown] | Back alignment and domain information |
|---|
| >PF10212 TTKRSYEDQ: Predicted coiled-coil domain-containing protein; InterPro: IPR019348 This entry represents a C-terminal 500 residue region, which contains a conserved TTKRSYEDQ motif | Back alignment and domain information |
|---|
| >PF04111 APG6: Autophagy protein Apg6; InterPro: IPR007243 Macroautophagy is a bulk degradation process induced by starvation in eukaryotic cells | Back alignment and domain information |
|---|
| >PF04912 Dynamitin: Dynamitin ; InterPro: IPR006996 Dynamitin is a subunit of the microtubule-dependent motor complex, it is also implicated in cell adhesion by binding to macrophage-enriched myristoylated alanine-rice C kinase substrate (MacMARCKS) [] | Back alignment and domain information |
|---|
| >PF00769 ERM: Ezrin/radixin/moesin family; InterPro: IPR011259 The ERM family consists of three closely-related proteins, ezrin, radixin and moesin [] | Back alignment and domain information |
|---|
| >cd01817 RGS12_RBD Ubiquitin domain of RGS12 and RGS14 | Back alignment and domain information |
|---|
| >KOG2685 consensus Cystoskeletal protein Tektin [Cytoskeleton] | Back alignment and domain information |
|---|
| >COG1842 PspA Phage shock protein A (IM30), suppresses sigma54-dependent transcription [Transcription / Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >TIGR02977 phageshock_pspA phage shock protein A | Back alignment and domain information |
|---|
| >PTZ00458 acyl CoA binding protein; Provisional | Back alignment and domain information |
|---|
| >PF11559 ADIP: Afadin- and alpha -actinin-Binding; InterPro: IPR021622 This family is found in mammals where it is localised at cell-cell adherens junctions [], and in Sch | Back alignment and domain information |
|---|
| >KOG0804 consensus Cytoplasmic Zn-finger protein BRAP2 (BRCA1 associated protein) [General function prediction only] | Back alignment and domain information |
|---|
| >cd01775 CYR1_RA Ubiquitin domain of CYR1 adenylate cyclase | Back alignment and domain information |
|---|
| >KOG0239 consensus Kinesin (KAR3 subfamily) [Cytoskeleton] | Back alignment and domain information |
|---|
| >COG3206 GumC Uncharacterized protein involved in exopolysaccharide biosynthesis [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >COG1842 PspA Phage shock protein A (IM30), suppresses sigma54-dependent transcription [Transcription / Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0244 consensus Kinesin-like protein [Cytoskeleton] | Back alignment and domain information |
|---|
| >COG4913 Uncharacterized protein conserved in bacteria [Function unknown] | Back alignment and domain information |
|---|
| >TIGR00618 sbcc exonuclease SbcC | Back alignment and domain information |
|---|
| >PF10498 IFT57: Intra-flagellar transport protein 57 ; InterPro: IPR019530 Eukaryotic cilia and flagella are specialised organelles found at the periphery of cells of diverse organisms | Back alignment and domain information |
|---|
| >COG4913 Uncharacterized protein conserved in bacteria [Function unknown] | Back alignment and domain information |
|---|
| >PF09304 Cortex-I_coil: Cortexillin I, coiled coil; InterPro: IPR015383 This domain is predominantly found in the actin-bundling protein cortexillin I from Dictyostelium discoideum (Slime mold) | Back alignment and domain information |
|---|
| >smart00455 RBD Raf-like Ras-binding domain | Back alignment and domain information |
|---|
| >KOG0804 consensus Cytoplasmic Zn-finger protein BRAP2 (BRCA1 associated protein) [General function prediction only] | Back alignment and domain information |
|---|
| >KOG4229 consensus Myosin VII, myosin IXB and related myosins [Cell motility] | Back alignment and domain information |
|---|
| >COG2433 Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >PF10480 ICAP-1_inte_bdg: Beta-1 integrin binding protein; InterPro: IPR019517 ICAP-1 is a serine/threonine-rich protein that binds to the cytoplasmic domains of beta-1 integrins in a highly specific manner, binding to a NPXY sequence motif on the beta-1 integrin | Back alignment and domain information |
|---|
| >TIGR02977 phageshock_pspA phage shock protein A | Back alignment and domain information |
|---|
| >PF15254 CCDC14: Coiled-coil domain-containing protein 14 | Back alignment and domain information |
|---|
| >COG2433 Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >PF05384 DegS: Sensor protein DegS; InterPro: IPR008595 This is a group of Bacillus DegS proteins | Back alignment and domain information |
|---|
| >PF14073 Cep57_CLD: Centrosome localisation domain of Cep57 | Back alignment and domain information |
|---|
| >PF04912 Dynamitin: Dynamitin ; InterPro: IPR006996 Dynamitin is a subunit of the microtubule-dependent motor complex, it is also implicated in cell adhesion by binding to macrophage-enriched myristoylated alanine-rice C kinase substrate (MacMARCKS) [] | Back alignment and domain information |
|---|
| >COG0556 UvrB Helicase subunit of the DNA excision repair complex [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PRK10698 phage shock protein PspA; Provisional | Back alignment and domain information |
|---|
| >KOG0240 consensus Kinesin (SMY1 subfamily) [Cytoskeleton] | Back alignment and domain information |
|---|
| >COG4717 Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG4460 consensus Nuclear pore complex, Nup88/rNup84 component [Nuclear structure; Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >cd01783 DAGK_delta_RA Ubiquitin-like domain of Diacylgylcerol kinase (DAGK) | Back alignment and domain information |
|---|
| >PF09738 DUF2051: Double stranded RNA binding protein (DUF2051); InterPro: IPR019139 This entry represents transcriptional repressors which preferentially bind to the GC-rich consensus sequence (5'-AGCCCCCGGCG-3') and may regulate expression of TNF, EGFR and PDGFA | Back alignment and domain information |
|---|
| >PRK10698 phage shock protein PspA; Provisional | Back alignment and domain information |
|---|
| >COG4717 Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG4807 consensus F-actin binding protein, regulates actin cytoskeletal organization [Cytoskeleton] | Back alignment and domain information |
|---|
| >COG4026 Uncharacterized protein containing TOPRIM domain, potential nuclease [General function prediction only] | Back alignment and domain information |
|---|
| >PF00640 PID: Phosphotyrosine interaction domain (PTB/PID) A page on PI domains | Back alignment and domain information |
|---|
| >PF15254 CCDC14: Coiled-coil domain-containing protein 14 | Back alignment and domain information |
|---|
| >KOG4687 consensus Uncharacterized coiled-coil protein [Function unknown] | Back alignment and domain information |
|---|
| >PF09738 DUF2051: Double stranded RNA binding protein (DUF2051); InterPro: IPR019139 This entry represents transcriptional repressors which preferentially bind to the GC-rich consensus sequence (5'-AGCCCCCGGCG-3') and may regulate expression of TNF, EGFR and PDGFA | Back alignment and domain information |
|---|
| >PF15290 Syntaphilin: Golgi-localised syntaxin-1-binding clamp | Back alignment and domain information |
|---|
| >PRK10884 SH3 domain-containing protein; Provisional | Back alignment and domain information |
|---|
| >PF15290 Syntaphilin: Golgi-localised syntaxin-1-binding clamp | Back alignment and domain information |
|---|
| >PRK09841 cryptic autophosphorylating protein tyrosine kinase Etk; Provisional | Back alignment and domain information |
|---|
| >PF00308 Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013317 This entry represents the central domain of bacterial DnaA proteins [, , ] that play an important role in initiating and regulating chromosomal replication | Back alignment and domain information |
|---|
| >PRK11519 tyrosine kinase; Provisional | Back alignment and domain information |
|---|
| >COG4026 Uncharacterized protein containing TOPRIM domain, potential nuclease [General function prediction only] | Back alignment and domain information |
|---|
| >COG5283 Phage-related tail protein [Function unknown] | Back alignment and domain information |
|---|
| >PF11932 DUF3450: Protein of unknown function (DUF3450); InterPro: IPR016866 There is currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function | Back alignment and domain information |
|---|
| >PF03148 Tektin: Tektin family; InterPro: IPR000435 Tektin heteropolymers form unique protofilaments of flagellar microtubules [] | Back alignment and domain information |
|---|
| >KOG4460 consensus Nuclear pore complex, Nup88/rNup84 component [Nuclear structure; Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >PF12777 MT: Microtubule-binding stalk of dynein motor; InterPro: IPR024743 The 380 kDa motor unit of dynein belongs to the AAA class of chaperone-like ATPases | Back alignment and domain information |
|---|
| >cd01782 AF6_RA_repeat1 Ubiquitin domain of AT-6, first repeat | Back alignment and domain information |
|---|
| >PRK12704 phosphodiesterase; Provisional | Back alignment and domain information |
|---|
| >PF15358 TSKS: Testis-specific serine kinase substrate | Back alignment and domain information |
|---|
| >cd01216 Fe65 Fe65 Phosphotyrosine-binding (PTB) domain, phosphotyrosine-interaction (PI) domain | Back alignment and domain information |
|---|
| >KOG4286 consensus Dystrophin-like protein [Cell motility; Signal transduction mechanisms; Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG0288 consensus WD40 repeat protein TipD [General function prediction only] | Back alignment and domain information |
|---|
| >cd01785 PDZ_GEF_RA Ubiquitin-like domain of PDZ_GEF_RA | Back alignment and domain information |
|---|
| >PRK10865 protein disaggregation chaperone; Provisional | Back alignment and domain information |
|---|
| >TIGR03319 YmdA_YtgF conserved hypothetical protein YmdA/YtgF | Back alignment and domain information |
|---|
| >KOG0288 consensus WD40 repeat protein TipD [General function prediction only] | Back alignment and domain information |
|---|
| >COG5283 Phage-related tail protein [Function unknown] | Back alignment and domain information |
|---|
| >cd01215 Dab Disabled (Dab) Phosphotyrosine-binding domain | Back alignment and domain information |
|---|
| >PRK03947 prefoldin subunit alpha; Reviewed | Back alignment and domain information |
|---|
| >KOG3091 consensus Nuclear pore complex, p54 component (sc Nup57) [Nuclear structure; Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >KOG4572 consensus Predicted DNA-binding transcription factor, interacts with stathmin [Transcription; General function prediction only; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0992 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG4403 consensus Cell surface glycoprotein STIM, contains SAM domain [General function prediction only] | Back alignment and domain information |
|---|
| >PF10498 IFT57: Intra-flagellar transport protein 57 ; InterPro: IPR019530 Eukaryotic cilia and flagella are specialised organelles found at the periphery of cells of diverse organisms | Back alignment and domain information |
|---|
| >PF04582 Reo_sigmaC: Reovirus sigma C capsid protein; InterPro: IPR007662 Protein sigmaC in its native state was shown to be a homotrimer | Back alignment and domain information |
|---|
| >COG3074 Uncharacterized protein conserved in bacteria [Function unknown] | Back alignment and domain information |
|---|
| >COG2805 PilT Tfp pilus assembly protein, pilus retraction ATPase PilT [Cell motility and secretion / Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >PF14992 TMCO5: TMCO5 family | Back alignment and domain information |
|---|
| >cd01781 AF6_RA_repeat2 Ubiquitin domain of AT-6, second repeat | Back alignment and domain information |
|---|
| >PF06005 DUF904: Protein of unknown function (DUF904); InterPro: IPR009252 Cell division protein ZapB is a non-essential, abundant cell division factor that is required for proper Z-ring formation | Back alignment and domain information |
|---|
| >PF10234 Cluap1: Clusterin-associated protein-1; InterPro: IPR019366 This protein of 413 amino acids contains a central coiled-coil domain, possibly the region that binds to clusterin | Back alignment and domain information |
|---|
| >PF14847 Ras_bdg_2: Ras-binding domain of Byr2; PDB: 1I35_A 1K8R_B | Back alignment and domain information |
|---|
| >KOG4687 consensus Uncharacterized coiled-coil protein [Function unknown] | Back alignment and domain information |
|---|
| >PF04582 Reo_sigmaC: Reovirus sigma C capsid protein; InterPro: IPR007662 Protein sigmaC in its native state was shown to be a homotrimer | Back alignment and domain information |
|---|
| >cd00934 PTB Phosphotyrosine-binding (PTB) domain | Back alignment and domain information |
|---|
| >PRK06835 DNA replication protein DnaC; Validated | Back alignment and domain information |
|---|
| >PF06548 Kinesin-related: Kinesin-related; InterPro: IPR010544 This entry represents a domain within kinesin-related proteins from higher plants | Back alignment and domain information |
|---|
| >PRK10361 DNA recombination protein RmuC; Provisional | Back alignment and domain information |
|---|
| >COG4281 ACB Acyl-CoA-binding protein [Lipid metabolism] | Back alignment and domain information |
|---|
| >PF11570 E2R135: Coiled-coil receptor-binding R-domain of colicin E2; InterPro: IPR024566 Bacteriocins are protein antibiotics that kill bacteria closely related to the producing species | Back alignment and domain information |
|---|
| >smart00462 PTB Phosphotyrosine-binding domain, phosphotyrosine-interaction (PI) domain | Back alignment and domain information |
|---|
| >PF07798 DUF1640: Protein of unknown function (DUF1640); InterPro: IPR024461 This family consists of uncharacterised proteins | Back alignment and domain information |
|---|
| >TIGR02971 heterocyst_DevB ABC exporter membrane fusion protein, DevB family | Back alignment and domain information |
|---|
| >COG3074 Uncharacterized protein conserved in bacteria [Function unknown] | Back alignment and domain information |
|---|
| >COG5293 Predicted ATPase [General function prediction only] | Back alignment and domain information |
|---|
| >PF02196 RBD: Raf-like Ras-binding domain; InterPro: IPR003116 This is the Ras-binding domain found in proteins related to Ras | Back alignment and domain information |
|---|
| >PRK10361 DNA recombination protein RmuC; Provisional | Back alignment and domain information |
|---|
| >TIGR01010 BexC_CtrB_KpsE polysaccharide export inner-membrane protein, BexC/CtrB/KpsE family | Back alignment and domain information |
|---|
| >PF10267 Tmemb_cc2: Predicted transmembrane and coiled-coil 2 protein; InterPro: IPR019394 This family of transmembrane coiled-coil containing proteins is conserved from worms to humans | Back alignment and domain information |
|---|
| >PF08416 PTB: Phosphotyrosine-binding domain; InterPro: IPR013625 The phosphotyrosine-binding domain (PTB, also phosphotyrosine-interaction or PI domain) of tensin tends to be found at the C terminus of a protein | Back alignment and domain information |
|---|
| >TIGR00618 sbcc exonuclease SbcC | Back alignment and domain information |
|---|
| >PF15294 Leu_zip: Leucine zipper | Back alignment and domain information |
|---|
| >KOG4403 consensus Cell surface glycoprotein STIM, contains SAM domain [General function prediction only] | Back alignment and domain information |
|---|
| >PLN03229 acetyl-coenzyme A carboxylase carboxyl transferase subunit alpha; Provisional | Back alignment and domain information |
|---|
| >PF13949 ALIX_LYPXL_bnd: ALIX V-shaped domain binding to HIV ; PDB: 2XS1_A 2XS8_A 2R03_A 2R02_A 2OEX_B 2OEV_A 2OJQ_A 2R05_A | Back alignment and domain information |
|---|
| >KOG4239 consensus Ras GTPase effector RASSF2 [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0817 consensus Acyl-CoA-binding protein [Lipid transport and metabolism] | Back alignment and domain information |
|---|
| >PF08647 BRE1: BRE1 E3 ubiquitin ligase; InterPro: IPR013956 BRE1 is an E3 ubiquitin ligase that has been shown to act as a transcriptional activator through direct activator interactions [] | Back alignment and domain information |
|---|
| >TIGR03794 NHPM_micro_HlyD NHPM bacteriocin system secretion protein | Back alignment and domain information |
|---|
| >KOG2196 consensus Nuclear porin [Nuclear structure] | Back alignment and domain information |
|---|
| >KOG4572 consensus Predicted DNA-binding transcription factor, interacts with stathmin [Transcription; General function prediction only; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF05335 DUF745: Protein of unknown function (DUF745); InterPro: IPR007999 This family consists of several uncharacterised Drosophila melanogaster proteins of unknown function | Back alignment and domain information |
|---|
| >cd01779 Myosin_IXb_RA ubitquitin-like domain of Myosin_IXb_RA | Back alignment and domain information |
|---|
| >PF13949 ALIX_LYPXL_bnd: ALIX V-shaped domain binding to HIV ; PDB: 2XS1_A 2XS8_A 2R03_A 2R02_A 2OEX_B 2OEV_A 2OJQ_A 2R05_A | Back alignment and domain information |
|---|
| >PRK11519 tyrosine kinase; Provisional | Back alignment and domain information |
|---|
| >TIGR03794 NHPM_micro_HlyD NHPM bacteriocin system secretion protein | Back alignment and domain information |
|---|
| >PRK06620 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >PF06120 Phage_HK97_TLTM: Tail length tape measure protein; InterPro: IPR009302 This entry consists of the tail length tape measure protein from Bacteriophage HK97 and related sequences from Escherichia coli (strain K12) | Back alignment and domain information |
|---|
| >PTZ00121 MAEBL; Provisional | Back alignment and domain information |
|---|
| >PRK09841 cryptic autophosphorylating protein tyrosine kinase Etk; Provisional | Back alignment and domain information |
|---|
| >KOG3091 consensus Nuclear pore complex, p54 component (sc Nup57) [Nuclear structure; Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >PF04949 Transcrip_act: Transcriptional activator; InterPro: IPR007033 Golgins are a family of coiled-coil proteins associated with the Golgi apparatus necessary for tethering events in membrane fusion and as structural supports for Golgi cisternae [] | Back alignment and domain information |
|---|
| >PF07889 DUF1664: Protein of unknown function (DUF1664); InterPro: IPR012458 The members of this family are hypothetical plant proteins of unknown function | Back alignment and domain information |
|---|
| >TIGR01242 26Sp45 26S proteasome subunit P45 family | Back alignment and domain information |
|---|
| >PF10234 Cluap1: Clusterin-associated protein-1; InterPro: IPR019366 This protein of 413 amino acids contains a central coiled-coil domain, possibly the region that binds to clusterin | Back alignment and domain information |
|---|
| >KOG4421 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >cd01210 EPS8 Epidermal growth factor receptor kinase substrate (EPS8) Phosphotyrosine-binding (PTB) domain | Back alignment and domain information |
|---|
| >TIGR01010 BexC_CtrB_KpsE polysaccharide export inner-membrane protein, BexC/CtrB/KpsE family | Back alignment and domain information |
|---|
| >TIGR02971 heterocyst_DevB ABC exporter membrane fusion protein, DevB family | Back alignment and domain information |
|---|
| >PF12329 TMF_DNA_bd: TATA element modulatory factor 1 DNA binding; InterPro: IPR022092 This is the middle region of a family of TATA element modulatory factor 1 proteins conserved in eukaryotes that contains at its N-terminal section a number of leucine zippers that could potentially form coiled coil structures | Back alignment and domain information |
|---|
| >PF05278 PEARLI-4: Arabidopsis phospholipase-like protein (PEARLI 4); InterPro: IPR007942 This family contains several phospholipase-like proteins from Arabidopsis thaliana and other members of the Streptophyta which are homologous to PEARLI 4 | Back alignment and domain information |
|---|
| >PRK12377 putative replication protein; Provisional | Back alignment and domain information |
|---|
| >COG2804 PulE Type II secretory pathway, ATPase PulE/Tfp pilus assembly pathway, ATPase PilB [Cell motility and secretion / Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >PRK10476 multidrug resistance protein MdtN; Provisional | Back alignment and domain information |
|---|
| >PF08647 BRE1: BRE1 E3 ubiquitin ligase; InterPro: IPR013956 BRE1 is an E3 ubiquitin ligase that has been shown to act as a transcriptional activator through direct activator interactions [] | Back alignment and domain information |
|---|
| >PF07889 DUF1664: Protein of unknown function (DUF1664); InterPro: IPR012458 The members of this family are hypothetical plant proteins of unknown function | Back alignment and domain information |
|---|
| >PRK15178 Vi polysaccharide export inner membrane protein VexD; Provisional | Back alignment and domain information |
|---|
| >cd01273 CED-6 CED-6 Phosphotyrosine-binding (PTB) domain | Back alignment and domain information |
|---|
| >cd01818 TIAM1_RBD Ubiquitin domain of Tiam1 guanine nucleotide exchange factor | Back alignment and domain information |
|---|
| >PRK08084 DNA replication initiation factor; Provisional | Back alignment and domain information |
|---|
| >PRK06893 DNA replication initiation factor; Validated | Back alignment and domain information |
|---|
| >KOG1962 consensus B-cell receptor-associated protein and related proteins [Defense mechanisms] | Back alignment and domain information |
|---|
| >cd01268 Numb Numb Phosphotyrosine-binding (PTB) domain | Back alignment and domain information |
|---|
| >KOG2196 consensus Nuclear porin [Nuclear structure] | Back alignment and domain information |
|---|
| >PRK00106 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK14086 dnaA chromosomal replication initiation protein; Provisional | Back alignment and domain information |
|---|
| >KOG3850 consensus Predicted membrane protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG4335 consensus FERM domain-containing protein KRIT1 [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PTZ00464 SNF-7-like protein; Provisional | Back alignment and domain information |
|---|
| >KOG2751 consensus Beclin-like protein [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >cd01267 CED6_AIDA1b Phosphotyrosine-binding (PTB) domain, phosphotyrosine-interaction (PI) domain | Back alignment and domain information |
|---|
| >COG1382 GimC Prefoldin, chaperonin cofactor [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >cd01208 X11 X11 Phosphotyrosine-binding (PTB) domain | Back alignment and domain information |
|---|
| >KOG2008 consensus BTK-associated SH3-domain binding protein SAB [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >COG1730 GIM5 Predicted prefoldin, molecular chaperone implicated in de novo protein folding [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK07952 DNA replication protein DnaC; Validated | Back alignment and domain information |
|---|
| >KOG0972 consensus Huntingtin interacting protein 1 (Hip1) interactor Hippi [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF10267 Tmemb_cc2: Predicted transmembrane and coiled-coil 2 protein; InterPro: IPR019394 This family of transmembrane coiled-coil containing proteins is conserved from worms to humans | Back alignment and domain information |
|---|
| >PRK08116 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >PTZ00454 26S protease regulatory subunit 6B-like protein; Provisional | Back alignment and domain information |
|---|
| >KOG1103 consensus Predicted coiled-coil protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG0163 consensus Myosin class VI heavy chain [Cytoskeleton] | Back alignment and domain information |
|---|
| >PF05262 Borrelia_P83: Borrelia P83/100 protein; InterPro: IPR007926 This family consists of several Borrelia P83/P100 antigen proteins | Back alignment and domain information |
|---|
| >PLN03229 acetyl-coenzyme A carboxylase carboxyl transferase subunit alpha; Provisional | Back alignment and domain information |
|---|
| >PRK05642 DNA replication initiation factor; Validated | Back alignment and domain information |
|---|
| >KOG0972 consensus Huntingtin interacting protein 1 (Hip1) interactor Hippi [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PRK09343 prefoldin subunit beta; Provisional | Back alignment and domain information |
|---|
| >PRK09343 prefoldin subunit beta; Provisional | Back alignment and domain information |
|---|
| >KOG4677 consensus Golgi integral membrane protein [Intracellular trafficking, secretion, and vesicular transport; General function prediction only] | Back alignment and domain information |
|---|
| >PRK10476 multidrug resistance protein MdtN; Provisional | Back alignment and domain information |
|---|
| >PF14197 Cep57_CLD_2: Centrosome localisation domain of PPC89 | Back alignment and domain information |
|---|
| >PF07106 TBPIP: Tat binding protein 1(TBP-1)-interacting protein (TBPIP); InterPro: IPR010776 This family consists of several eukaryotic TBP-1 interacting protein (TBPIP) sequences | Back alignment and domain information |
|---|
| >cd00632 Prefoldin_beta Prefoldin beta; Prefoldin is a hexameric molecular chaperone complex, composed of two evolutionarily related subunits (alpha and beta), which are found in both eukaryotes and archaea | Back alignment and domain information |
|---|
| >KOG4603 consensus TBP-1 interacting protein [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >COG1382 GimC Prefoldin, chaperonin cofactor [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF11470 TUG-UBL1: GLUT4 regulating protein TUG; InterPro: IPR021569 TUG is a GLUT4 regulating protein and functions to retain membrane vesicles containing GLUT4 intracellularly | Back alignment and domain information |
|---|
| >PF05700 BCAS2: Breast carcinoma amplified sequence 2 (BCAS2); InterPro: IPR008409 This family consists of several eukaryotic sequences of unknown function | Back alignment and domain information |
|---|
| >PF03962 Mnd1: Mnd1 family; InterPro: IPR005647 This family of proteins includes meiotic nuclear division protein 1 (MND1) from Saccharomyces cerevisiae (Baker's yeast) | Back alignment and domain information |
|---|
| >cd01274 AIDA-1b AIDA-1b Phosphotyrosine-binding (PTB) domain | Back alignment and domain information |
|---|
| >cd07667 BAR_SNX30 The Bin/Amphiphysin/Rvs (BAR) domain of Sorting Nexin 30 | Back alignment and domain information |
|---|
| >PF11543 UN_NPL4: Nuclear pore localisation protein NPL4; InterPro: IPR024682 Npl4, along with Ufd1, forms the heterodimer adaptor complex UN, which is involved in the recruitment of p97, an AAA ATPase, for tasks involving the ubiquitin pathway | Back alignment and domain information |
|---|
| >COG1474 CDC6 Cdc6-related protein, AAA superfamily ATPase [DNA replication, recombination, and repair / Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF11180 DUF2968: Protein of unknown function (DUF2968); InterPro: IPR021350 This family of proteins has no known function | Back alignment and domain information |
|---|
| >PRK14088 dnaA chromosomal replication initiation protein; Provisional | Back alignment and domain information |
|---|
| >PF07058 Myosin_HC-like: Myosin II heavy chain-like; InterPro: IPR009768 This family represents a conserved region within a number of myosin II heavy chain-like proteins that seem to be specific to Arabidopsis thaliana | Back alignment and domain information |
|---|
| >KOG1962 consensus B-cell receptor-associated protein and related proteins [Defense mechanisms] | Back alignment and domain information |
|---|
| >smart00283 MA Methyl-accepting chemotaxis-like domains (chemotaxis sensory transducer) | Back alignment and domain information |
|---|
| >smart00283 MA Methyl-accepting chemotaxis-like domains (chemotaxis sensory transducer) | Back alignment and domain information |
|---|
| >PF07106 TBPIP: Tat binding protein 1(TBP-1)-interacting protein (TBPIP); InterPro: IPR010776 This family consists of several eukaryotic TBP-1 interacting protein (TBPIP) sequences | Back alignment and domain information |
|---|
| >PRK03992 proteasome-activating nucleotidase; Provisional | Back alignment and domain information |
|---|
| >PF14197 Cep57_CLD_2: Centrosome localisation domain of PPC89 | Back alignment and domain information |
|---|
| >PF15035 Rootletin: Ciliary rootlet component, centrosome cohesion | Back alignment and domain information |
|---|
| >PRK09087 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >KOG2264 consensus Exostosin EXT1L [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG3647 consensus Predicted coiled-coil protein [General function prediction only] | Back alignment and domain information |
|---|
| >PF05335 DUF745: Protein of unknown function (DUF745); InterPro: IPR007999 This family consists of several uncharacterised Drosophila melanogaster proteins of unknown function | Back alignment and domain information |
|---|
| >PF03915 AIP3: Actin interacting protein 3; InterPro: IPR022782 This entry represents a domain found in yeast actin interacting protein 3 and bud site selection protein 6 | Back alignment and domain information |
|---|
| >PF03962 Mnd1: Mnd1 family; InterPro: IPR005647 This family of proteins includes meiotic nuclear division protein 1 (MND1) from Saccharomyces cerevisiae (Baker's yeast) | Back alignment and domain information |
|---|
| >KOG3850 consensus Predicted membrane protein [Function unknown] | Back alignment and domain information |
|---|
| >PF08826 DMPK_coil: DMPK coiled coil domain like; InterPro: IPR014930 This domain is found in the myotonic dystrophy protein kinase (DMPK) and adopts a coiled coil structure | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST
Original result of BLAST against Protein Data Bank
| ID | Alignment Graph | Length |
Definition |
E-value | |
| Query | 1268 | ||||
| 1sdm_A | 369 | Crystal Structure Of Kinesin-Like Calmodulin Bindin | 0.0 | ||
| 3h4s_A | 386 | Structure Of The Complex Of A Mitotic Kinesin With | 0.0 | ||
| 2h58_A | 330 | Crystal Structure Of The Kifc3 Motor Domain In Comp | 2e-72 | ||
| 4etp_A | 403 | C-Terminal Motor And Motor Homology Domain Of Kar3v | 1e-65 | ||
| 2ncd_A | 420 | Ncd (Non-Claret Disjunctional) Dimer From D. Melano | 3e-65 | ||
| 1cz7_A | 406 | The Crystal Structure Of A Minus-End Directed Micro | 3e-65 | ||
| 4gkr_A | 371 | Structure Of The C-Terminal Motor Domain Of Kar3 Fr | 4e-65 | ||
| 1f9t_A | 358 | Crystal Structures Of Kinesin Mutants Reveal A Sign | 1e-64 | ||
| 3l1c_A | 383 | Kinesin-14 Protein Ncd, T436s Mutant Length = 383 | 1e-64 | ||
| 1n6m_A | 409 | Rotation Of The StalkNECK AND ONE HEAD IN A NEW CRY | 2e-64 | ||
| 3u06_A | 412 | Crystal Structure Of The Kinesin-14 Ncdg347d Length | 2e-64 | ||
| 3b6u_A | 372 | Crystal Structure Of The Motor Domain Of Human Kine | 5e-63 | ||
| 1f9w_A | 347 | Crystal Structures Of Mutants Reveal A Signalling P | 1e-62 | ||
| 1f9u_A | 347 | Crystal Structures Of Mutants Reveal A Signalling P | 2e-62 | ||
| 1f9v_A | 347 | Crystal Structures Of Mutants Reveal A Signalling P | 2e-62 | ||
| 3kar_A | 346 | The Motor Domain Of Kinesin-Like Protein Kar3, A Sa | 3e-62 | ||
| 3t0q_A | 349 | Motor Domain Structure Of The Kar3-Like Kinesin Fro | 4e-62 | ||
| 4h1g_A | 715 | Structure Of Candida Albicans Kar3 Motor Domain Fus | 1e-61 | ||
| 1mkj_A | 349 | Human Kinesin Motor Domain With Docked Neck Linker | 5e-60 | ||
| 2vvg_A | 350 | Crystal Structure Of The G.Intestinalis Kinesin 2 G | 6e-60 | ||
| 4atx_C | 340 | Rigor Kinesin Motor Domain With An Ordered Neck-Lin | 1e-59 | ||
| 1bg2_A | 325 | Human Ubiquitous Kinesin Motor Domain Length = 325 | 2e-59 | ||
| 2y5w_A | 365 | Crystal Structure Of Drosophila Melanogaster Kinesi | 3e-59 | ||
| 3gbj_A | 354 | Crystal Structure Of The Motor Domain Of Kinesin Ki | 3e-59 | ||
| 1goj_A | 355 | Structure Of A Fast Kinesin: Implications For Atpas | 1e-58 | ||
| 2rep_A | 376 | Crystal Structure Of The Motor Domain Of Human Kine | 5e-57 | ||
| 3b6v_A | 395 | Crystal Structure Of The Motor Domain Of Human Kine | 8e-55 | ||
| 2wbe_C | 373 | Kinesin-5-Tubulin Complex With Amppnp Length = 373 | 8e-54 | ||
| 4aqv_C | 373 | Model Of Human Kinesin-5 Motor Domain (3hqd) And Ma | 2e-53 | ||
| 4a28_A | 368 | Eg5-2 Length = 368 | 2e-52 | ||
| 1q0b_A | 367 | Crystal Structure Of The Motor Protein Ksp In Compl | 2e-52 | ||
| 1ii6_A | 368 | Crystal Structure Of The Mitotic Kinesin Eg5 In Com | 2e-52 | ||
| 1x88_A | 359 | Human Eg5 Motor Domain Bound To Mg-Adp And Monastro | 2e-52 | ||
| 3hqd_A | 369 | Human Kinesin Eg5 Motor Domain In Complex With Ampp | 2e-52 | ||
| 4ap0_A | 370 | The Mitotic Kinesin Eg5 In Complex With Mg-Adp And | 2e-52 | ||
| 4a1z_A | 368 | Eg5-1 Length = 368 | 3e-52 | ||
| 1t5c_A | 349 | Crystal Structure Of The Motor Domain Of Human Kine | 5e-52 | ||
| 3zcw_A | 348 | Eg5 - New Allosteric Binding Site Length = 348 | 1e-51 | ||
| 1ia0_K | 394 | Kif1a Head-Microtubule Complex Structure In Atp-For | 1e-51 | ||
| 1i5s_A | 367 | Crystal Structure Of The Kif1a Motor Domain Complex | 1e-51 | ||
| 1i6i_A | 366 | Crystal Structure Of The Kif1a Motor Domain Complex | 1e-51 | ||
| 1vfv_A | 366 | Crystal Structure Of The Kif1a Motor Domain Complex | 2e-51 | ||
| 4a14_A | 344 | Human Kif7, A Kinesin Involved In Hedgehog Signalli | 2e-51 | ||
| 3lre_A | 355 | Crystal Structure Analysis Of Human Kinesin-8 Motor | 4e-51 | ||
| 3bfn_A | 388 | Crystal Structure Of The Motor Domain Of Human Kine | 4e-50 | ||
| 2xt3_A | 344 | Human Kif7, A Kinesin Involved In Hedgehog Signalli | 1e-48 | ||
| 2owm_A | 443 | Motor Domain Of Neurospora Crassa Kinesin-3 (Nckin3 | 3e-45 | ||
| 3nwn_A | 359 | Crystal Structure Of The Human Kif9 Motor Domain In | 2e-41 | ||
| 2gry_A | 420 | Crystal Structure Of The Human Kif2 Motor Domain In | 1e-40 | ||
| 1ry6_A | 360 | Crystal Structure Of Internal Kinesin Motor Domain | 2e-39 | ||
| 1v8j_A | 410 | The Crystal Structure Of The Minimal Functional Dom | 5e-38 | ||
| 3edl_D | 331 | Kinesin13-Microtubule Ring Complex Length = 331 | 2e-37 | ||
| 2heh_A | 387 | Crystal Structure Of The Kif2c Motor Domain (Casp T | 3e-37 | ||
| 2kin_A | 238 | Kinesin (Monomeric) From Rattus Norvegicus Length = | 2e-32 | ||
| 3dc4_A | 344 | Crystal Structure Of The Drosophila Kinesin Family | 9e-30 | ||
| 3pxn_A | 344 | Crystal Structure Of The Drosophila Kinesin Family | 1e-29 | ||
| 3pzd_A | 511 | Structure Of The Myosin X Myth4-FermDCC COMPLEX Len | 2e-17 | ||
| 3au4_A | 555 | Structure Of The Human Myosin-X Myth4-Ferm Cassette | 4e-17 | ||
| 3pvl_A | 655 | Structure Of Myosin Viia Myth4-Ferm-Sh3 In Complex | 2e-16 | ||
| 2kin_B | 100 | Kinesin (Monomeric) From Rattus Norvegicus Length = | 9e-14 | ||
| 3kin_B | 117 | Kinesin (Dimeric) From Rattus Norvegicus Length = 1 | 1e-13 | ||
| 3ivf_A | 371 | Crystal Structure Of The Talin Head Ferm Domain Len | 2e-09 | ||
| 4f7g_A | 222 | Crystal Structure Of Talin Autoinhibition Complex L | 2e-06 | ||
| 1y19_B | 202 | Structural Basis For Phosphatidylinositol Phosphate | 2e-06 | ||
| 1mix_A | 206 | Crystal Structure Of A Ferm Domain Of Talin Length | 2e-05 | ||
| 1miz_B | 201 | Crystal Structure Of An Integrin Beta3-Talin Chimer | 2e-05 | ||
| 1mk7_B | 192 | Crystal Structure Of An Integrin Beta3-Talin Chimer | 4e-05 | ||
| 3g9w_A | 223 | Crystal Structure Of Talin2 F2-f3 In Complex With T | 1e-04 |
| >pdb|1SDM|A Chain A, Crystal Structure Of Kinesin-Like Calmodulin Binding Protein Length = 369 | Back alignment and structure |
|
| >pdb|3H4S|A Chain A, Structure Of The Complex Of A Mitotic Kinesin With Its Calcium Binding Regulator Length = 386 | Back alignment and structure |
| >pdb|2H58|A Chain A, Crystal Structure Of The Kifc3 Motor Domain In Complex With Adp Length = 330 | Back alignment and structure |
| >pdb|4ETP|A Chain A, C-Terminal Motor And Motor Homology Domain Of Kar3vik1 Fused To A Synthetic Heterodimeric Coiled Coil Length = 403 | Back alignment and structure |
| >pdb|2NCD|A Chain A, Ncd (Non-Claret Disjunctional) Dimer From D. Melanogaster Length = 420 | Back alignment and structure |
| >pdb|1CZ7|A Chain A, The Crystal Structure Of A Minus-End Directed Microtubule Motor Protein Ncd Reveals Variable Dimer Conformations Length = 406 | Back alignment and structure |
| >pdb|4GKR|A Chain A, Structure Of The C-Terminal Motor Domain Of Kar3 From Candida Glabrata Length = 371 | Back alignment and structure |
| >pdb|1F9T|A Chain A, Crystal Structures Of Kinesin Mutants Reveal A Signalling Pathway For Activation Of The Motor Atpase Length = 358 | Back alignment and structure |
| >pdb|3L1C|A Chain A, Kinesin-14 Protein Ncd, T436s Mutant Length = 383 | Back alignment and structure |
| >pdb|1N6M|A Chain A, Rotation Of The StalkNECK AND ONE HEAD IN A NEW CRYSTAL Structure Of The Kinesin Motor Protein, Ncd Length = 409 | Back alignment and structure |
| >pdb|3U06|A Chain A, Crystal Structure Of The Kinesin-14 Ncdg347d Length = 412 | Back alignment and structure |
| >pdb|3B6U|A Chain A, Crystal Structure Of The Motor Domain Of Human Kinesin Family Member 3b In Complex With Adp Length = 372 | Back alignment and structure |
| >pdb|1F9W|A Chain A, Crystal Structures Of Mutants Reveal A Signalling Pathway For Activation Of The Kinesin Motor Atpase Length = 347 | Back alignment and structure |
| >pdb|1F9U|A Chain A, Crystal Structures Of Mutants Reveal A Signalling Pathway For Activation Of The Kinesin Motor Atpase Length = 347 | Back alignment and structure |
| >pdb|1F9V|A Chain A, Crystal Structures Of Mutants Reveal A Signalling Pathway For Activation Of The Kinesin Motor Atpase Length = 347 | Back alignment and structure |
| >pdb|3KAR|A Chain A, The Motor Domain Of Kinesin-Like Protein Kar3, A Saccharomyces Cerevisiae Kinesin-Related Protein Length = 346 | Back alignment and structure |
| >pdb|3T0Q|A Chain A, Motor Domain Structure Of The Kar3-Like Kinesin From Ashbya Gossypii Length = 349 | Back alignment and structure |
| >pdb|4H1G|A Chain A, Structure Of Candida Albicans Kar3 Motor Domain Fused To Maltose- Binding Protein Length = 715 | Back alignment and structure |
| >pdb|1MKJ|A Chain A, Human Kinesin Motor Domain With Docked Neck Linker Length = 349 | Back alignment and structure |
| >pdb|2VVG|A Chain A, Crystal Structure Of The G.Intestinalis Kinesin 2 Gikin2a Motor Domain Length = 350 | Back alignment and structure |
| >pdb|4ATX|C Chain C, Rigor Kinesin Motor Domain With An Ordered Neck-Linker, Docked On Tubulin Dimer, Modelled Into The 8a Cryo-Em Map Of Doublecortin-Microtubules Decorated With Kinesin Length = 340 | Back alignment and structure |
| >pdb|1BG2|A Chain A, Human Ubiquitous Kinesin Motor Domain Length = 325 | Back alignment and structure |
| >pdb|2Y5W|A Chain A, Crystal Structure Of Drosophila Melanogaster Kinesin-1 Motor Domain Dimer Length = 365 | Back alignment and structure |
| >pdb|3GBJ|A Chain A, Crystal Structure Of The Motor Domain Of Kinesin Kif13b Bound With Adp Length = 354 | Back alignment and structure |
| >pdb|1GOJ|A Chain A, Structure Of A Fast Kinesin: Implications For Atpase Mechanism And Interactions With Microtubules Length = 355 | Back alignment and structure |
| >pdb|2REP|A Chain A, Crystal Structure Of The Motor Domain Of Human Kinesin Family Member C1 Length = 376 | Back alignment and structure |
| >pdb|3B6V|A Chain A, Crystal Structure Of The Motor Domain Of Human Kinesin Family Member 3c In Complex With Adp Length = 395 | Back alignment and structure |
| >pdb|2WBE|C Chain C, Kinesin-5-Tubulin Complex With Amppnp Length = 373 | Back alignment and structure |
| >pdb|4AQV|C Chain C, Model Of Human Kinesin-5 Motor Domain (3hqd) And Mammalian Tubulin Heterodimer (1jff) Docked Into The 9.7-angstrom Cryo-em Map Of Microtubule-bound Kinesin-5 Motor Domain In The Ampppnp State. Length = 373 | Back alignment and structure |
| >pdb|4A28|A Chain A, Eg5-2 Length = 368 | Back alignment and structure |
| >pdb|1Q0B|A Chain A, Crystal Structure Of The Motor Protein Ksp In Complex With Adp And Monastrol Length = 367 | Back alignment and structure |
| >pdb|1II6|A Chain A, Crystal Structure Of The Mitotic Kinesin Eg5 In Complex With Mg-Adp. Length = 368 | Back alignment and structure |
| >pdb|1X88|A Chain A, Human Eg5 Motor Domain Bound To Mg-Adp And Monastrol Length = 359 | Back alignment and structure |
| >pdb|3HQD|A Chain A, Human Kinesin Eg5 Motor Domain In Complex With Amppnp And Mg2+ Length = 369 | Back alignment and structure |
| >pdb|4AP0|A Chain A, The Mitotic Kinesin Eg5 In Complex With Mg-Adp And Ispinesib Length = 370 | Back alignment and structure |
| >pdb|4A1Z|A Chain A, Eg5-1 Length = 368 | Back alignment and structure |
| >pdb|1T5C|A Chain A, Crystal Structure Of The Motor Domain Of Human Kinetochore Protein Cenp-E Length = 349 | Back alignment and structure |
| >pdb|3ZCW|A Chain A, Eg5 - New Allosteric Binding Site Length = 348 | Back alignment and structure |
| >pdb|1IA0|K Chain K, Kif1a Head-Microtubule Complex Structure In Atp-Form Length = 394 | Back alignment and structure |
| >pdb|1I5S|A Chain A, Crystal Structure Of The Kif1a Motor Domain Complexed With Mg-Adp Length = 367 | Back alignment and structure |
| >pdb|1I6I|A Chain A, Crystal Structure Of The Kif1a Motor Domain Complexed With Mg-Amppcp Length = 366 | Back alignment and structure |
| >pdb|1VFV|A Chain A, Crystal Structure Of The Kif1a Motor Domain Complexed With Mg-Amppnp Length = 366 | Back alignment and structure |
| >pdb|4A14|A Chain A, Human Kif7, A Kinesin Involved In Hedgehog Signalling Length = 344 | Back alignment and structure |
| >pdb|3LRE|A Chain A, Crystal Structure Analysis Of Human Kinesin-8 Motor Domain Length = 355 | Back alignment and structure |
| >pdb|3BFN|A Chain A, Crystal Structure Of The Motor Domain Of Human Kinesin Family Member 22 Length = 388 | Back alignment and structure |
| >pdb|2XT3|A Chain A, Human Kif7, A Kinesin Involved In Hedgehog Signalling Length = 344 | Back alignment and structure |
| >pdb|2OWM|A Chain A, Motor Domain Of Neurospora Crassa Kinesin-3 (Nckin3) Length = 443 | Back alignment and structure |
| >pdb|3NWN|A Chain A, Crystal Structure Of The Human Kif9 Motor Domain In Complex With Adp Length = 359 | Back alignment and structure |
| >pdb|2GRY|A Chain A, Crystal Structure Of The Human Kif2 Motor Domain In Complex With Adp Length = 420 | Back alignment and structure |
| >pdb|1RY6|A Chain A, Crystal Structure Of Internal Kinesin Motor Domain Length = 360 | Back alignment and structure |
| >pdb|1V8J|A Chain A, The Crystal Structure Of The Minimal Functional Domain Of The Microtubule Destabilizer Kif2c Complexed With Mg-adp Length = 410 | Back alignment and structure |
| >pdb|3EDL|D Chain D, Kinesin13-Microtubule Ring Complex Length = 331 | Back alignment and structure |
| >pdb|2HEH|A Chain A, Crystal Structure Of The Kif2c Motor Domain (Casp Target) Length = 387 | Back alignment and structure |
| >pdb|2KIN|A Chain A, Kinesin (Monomeric) From Rattus Norvegicus Length = 238 | Back alignment and structure |
| >pdb|3DC4|A Chain A, Crystal Structure Of The Drosophila Kinesin Family Member Nod In Complex With Adp Length = 344 | Back alignment and structure |
| >pdb|3PXN|A Chain A, Crystal Structure Of The Drosophila Kinesin Family Member Kin10NOD IN Complex With Divalent Manganese And Adp Length = 344 | Back alignment and structure |
| >pdb|3PZD|A Chain A, Structure Of The Myosin X Myth4-FermDCC COMPLEX Length = 511 | Back alignment and structure |
| >pdb|3AU4|A Chain A, Structure Of The Human Myosin-X Myth4-Ferm Cassette Bound To Its Specific Cargo, Dcc Length = 555 | Back alignment and structure |
| >pdb|3PVL|A Chain A, Structure Of Myosin Viia Myth4-Ferm-Sh3 In Complex With The Cen1 Of Sans Length = 655 | Back alignment and structure |
| >pdb|2KIN|B Chain B, Kinesin (Monomeric) From Rattus Norvegicus Length = 100 | Back alignment and structure |
| >pdb|3KIN|B Chain B, Kinesin (Dimeric) From Rattus Norvegicus Length = 117 | Back alignment and structure |
| >pdb|3IVF|A Chain A, Crystal Structure Of The Talin Head Ferm Domain Length = 371 | Back alignment and structure |
| >pdb|4F7G|A Chain A, Crystal Structure Of Talin Autoinhibition Complex Length = 222 | Back alignment and structure |
| >pdb|1Y19|B Chain B, Structural Basis For Phosphatidylinositol Phosphate Kinase Type I-Gamma Binding To Talin At Focal Adhesions Length = 202 | Back alignment and structure |
| >pdb|1MIX|A Chain A, Crystal Structure Of A Ferm Domain Of Talin Length = 206 | Back alignment and structure |
| >pdb|1MIZ|B Chain B, Crystal Structure Of An Integrin Beta3-Talin Chimera Length = 201 | Back alignment and structure |
| >pdb|1MK7|B Chain B, Crystal Structure Of An Integrin Beta3-Talin Chimera Length = 192 | Back alignment and structure |
| >pdb|3G9W|A Chain A, Crystal Structure Of Talin2 F2-f3 In Complex With The Integrin Beta1d Cytoplasmic Tail Length = 223 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST
Original result of RPS-BLAST against PDB70 database
| >3cob_A Kinesin heavy chain-like protein; motor, switch II, loop L11, conformation, nucleotide, ATP-binding, microtubule, motor protein; HET: ADP; 2.20A {Solanum tuberosum} SCOP: c.37.1.9 PDB: 3cnz_A* 1sdm_A* 3h4s_A* Length = 369 | Back alignment and structure |
|---|
Score = 563 bits (1454), Expect = 0.0
Identities = 316/369 (85%), Positives = 352/369 (95%)
Query: 887 EDMKGKIRVYCRLRPLNEKEDAEKERYVLTSLDEFTVEHPWKDDKVKQHMYDQVFDGYAT 946
EDMKGKIRVYCRLRPL EKE KER + S+DEFTVEH WKDDK KQHMYD+VFDG AT
Sbjct: 1 EDMKGKIRVYCRLRPLCEKEIIAKERNAIRSVDEFTVEHLWKDDKAKQHMYDRVFDGNAT 60
Query: 947 QEDVFEDTRYLVQSAVDGYNVCIFAYGQTGSGKTFTIYGSECNPGITPRAISELFRILKK 1006
Q+DVFEDT+YLVQSAVDGYNVCIFAYGQTGSGKTFTIYG++ NPG+TPRA+SELFRI+KK
Sbjct: 61 QDDVFEDTKYLVQSAVDGYNVCIFAYGQTGSGKTFTIYGADSNPGLTPRAMSELFRIMKK 120
Query: 1007 ENNKFSFSLKAYMVELYQDTLVDLLLPRNEKRLKLEIKKDSKGMVLVENVTVVPISTFEE 1066
++NKFSFSLKAYMVELYQDTLVDLLLP+ KRLKL+IKKDSKGMV VENVTVV IST+EE
Sbjct: 121 DSNKFSFSLKAYMVELYQDTLVDLLLPKQAKRLKLDIKKDSKGMVSVENVTVVSISTYEE 180
Query: 1067 IKSIIQRGSDQRHTSGTQMNEESSRSHLILSIVIESTNLQTQSVARGKLSFVDLAGSERV 1126
+K+IIQRGS+QRHT+GT MNE+SSRSHLI+S++IESTNLQTQ++ARGKLSFVDLAGSERV
Sbjct: 181 LKTIIQRGSEQRHTTGTLMNEQSSRSHLIVSVIIESTNLQTQAIARGKLSFVDLAGSERV 240
Query: 1127 KKSGSSGNQLKEAQSINKSLSALGDVISALSSGSQHIPYRNHKLTMLMSDSLGGNAKTLM 1186
KKSGS+GNQLKEAQSINKSLSALGDVISALSSG+QHIPYRNHKLTMLMSDSLGGNAKTLM
Sbjct: 241 KKSGSAGNQLKEAQSINKSLSALGDVISALSSGNQHIPYRNHKLTMLMSDSLGGNAKTLM 300
Query: 1187 FVNVSPAESNLEESYNSLTYASRVRSIVNDPNKNVSSKEVARLKRLVAYWKEQAGKKGDY 1246
FVN+SPAESNL+E++NSLTYASRVRSIVNDP+KNVSSKEVARLK+LV+YWKEQAG+KGD
Sbjct: 301 FVNISPAESNLDETHNSLTYASRVRSIVNDPSKNVSSKEVARLKKLVSYWKEQAGRKGDD 360
Query: 1247 EELEEIQEE 1255
EELEEIQ+E
Sbjct: 361 EELEEIQDE 369
|
| >3u06_A Protein claret segregational; motor domain, stalk rotation, power stroke, kinesin-14, MICR binding, NCD, transport, molecular motor; HET: ADP GOL; 2.35A {Drosophila melanogaster} PDB: 2ncd_A* 1n6m_A* 1cz7_A* 3l1c_A* Length = 412 | Back alignment and structure |
|---|
| >4etp_A Kinesin-like protein KAR3; kinesin motor protein, kinesin motor homology domain, karyog mitosis, microtubules; HET: ADP EBC; 2.30A {Saccharomyces cerevisiae} Length = 403 | Back alignment and structure |
|---|
| >2h58_A Kinesin-like protein KIFC3 variant; motor domain, ADP, structural genomics, structur Al genomics consortium, SGC; HET: ADP; 1.85A {Homo sapiens} Length = 330 | Back alignment and structure |
|---|
| >1f9v_A Kinesin-like protein KAR3; kinesin-related protein, motor protein, microtubinding proteinbule, contractIle protein; HET: ADP; 1.30A {Saccharomyces cerevisiae} SCOP: c.37.1.9 PDB: 1f9t_A* 1f9w_A* 1f9u_A* 3kar_A* Length = 347 | Back alignment and structure |
|---|
| >3t0q_A AGR253WP; kinesin, alpha and beta proteins, P-loop containing nucleosi triphosphate hydrolases, microtubule motor protein; HET: ADP; 2.35A {Ashbya gossypii} Length = 349 | Back alignment and structure |
|---|
| >2rep_A Kinesin-like protein KIFC1; structural genomics consortium, motor domain, ADP, binding, cell cycle, cell division, endosome, microtubule; HET: ADP; 2.60A {Homo sapiens} Length = 376 | Back alignment and structure |
|---|
| >1bg2_A Kinesin; motor protein, ATPase, microtubule associated; HET: ADP; 1.80A {Homo sapiens} SCOP: c.37.1.9 PDB: 2p4n_K* 1mkj_A* 2kin_A* 3kin_A* Length = 325 | Back alignment and structure |
|---|
| >3bfn_A Kinesin-like protein KIF22; limited proteolysis, structural genomics consortium domain, ADP, SGC, ATP-binding, DNA-binding, microtubule, MO protein; HET: ADP; 2.30A {Homo sapiens} Length = 388 | Back alignment and structure |
|---|
| >2y65_A Kinesin, kinesin heavy chain; motor protein; HET: ADP; 2.20A {Drosophila melanogaster} PDB: 2y5w_A* Length = 365 | Back alignment and structure |
|---|
| >1goj_A Kinesin, kinesin heavy chain; motor protein, ATPase; HET: ADP; 2.3A {Neurospora crassa} SCOP: c.37.1.9 Length = 355 | Back alignment and structure |
|---|
| >2vvg_A Kinesin-2; motor protein, nucleotide-binding, microtubule, ATP-binding; HET: ADP; 1.60A {Giardia intestinalis} Length = 350 | Back alignment and structure |
|---|
| >1x88_A Kinesin-like protein KIF11; switch II, motor domain, NECK linker, cell cycle; HET: ADP NAT; 1.80A {Homo sapiens} SCOP: c.37.1.9 PDB: 3hqd_A* 3ken_A* 2pg2_A* 1yrs_A* 2fme_A* 2g1q_A* 2gm1_A* 1ii6_A* 2uyi_A* 2uym_A* 2wog_A* 2x2r_A* 2x7c_A* 2x7d_A* 2x7e_A* 2xae_A* 3k3b_A* 3k5e_A* 3l9h_A* 1q0b_A* ... Length = 359 | Back alignment and structure |
|---|
| >1t5c_A CENP-E protein, centromeric protein E; kinesin motor-domain-ADP complex, stranded beta-sheet core with solvent exposed alpha-helices; HET: ADP PIN; 2.50A {Homo sapiens} Length = 349 | Back alignment and structure |
|---|
| >2wbe_C Bipolar kinesin KRP-130; EG5, KLP61F, tubulin, mitosis, GTP-binding, motor protein, cell division, cell cycle, microtubule, ATP-binding; HET: GTP ANP GDP TA1; 9.40A {Drosophila melanogaster} Length = 373 | Back alignment and structure |
|---|
| >4a14_A Kinesin, kinesin-like protein KIF7; motor protein, motor domain; HET: ADP; 1.60A {Homo sapiens} PDB: 2xt3_A* Length = 344 | Back alignment and structure |
|---|
| >1ry6_A Internal kinesin; kinesin motor domain, nucleotide-free, transport protein; 1.60A {Plasmodium falciparum} SCOP: c.37.1.9 Length = 360 | Back alignment and structure |
|---|
| >3b6u_A Kinesin-like protein KIF3B; structural genomics consortium, motor domain, ADP, SGC, ATP-binding, coiled coil, microtubule, motor protein; HET: ADP; 1.80A {Homo sapiens} PDB: 3b6v_A* Length = 372 | Back alignment and structure |
|---|
| >3gbj_A KIF13B protein; kinesin, motor domain, ADP, structural genomics, structural genomics consortium, SGC, ATP-binding, microtubule, motor protein; HET: ADP; 2.10A {Homo sapiens} Length = 354 | Back alignment and structure |
|---|
| >3lre_A Kinesin-like protein KIF18A; motor protein, nucleotide binding, microtubule binding, ATP- cell projection, cytoskeleton, glycoprotein, microtubule; HET: ADP; 2.20A {Homo sapiens} Length = 355 | Back alignment and structure |
|---|
| >2zfi_A Kinesin-like protein KIF1A, kinesin heavy chain isoform 5C; alpha and beta protein, enzyme, ATPase, P-loop, motor protein, ATP-binding, coiled coil; HET: ADP; 1.55A {Mus musculus} SCOP: c.37.1.9 PDB: 1vfw_A* 1vfx_A* 1vfz_A* 1vfv_A* 2zfj_A* 2zfk_A* 2zfl_A* 2zfm_A* 1i5s_A* 1i6i_A* 2hxf_C* 1ia0_K* 2hxh_C* Length = 366 | Back alignment and structure |
|---|
| >2heh_A KIF2C protein; kinesin, motor domain, ADP, structural genomics, structural genomics consortium, SGC, structural protein; HET: ADP; 2.15A {Homo sapiens} PDB: 3edl_D* Length = 387 | Back alignment and structure |
|---|
| >1v8k_A Kinesin-like protein KIF2C; microtubule destabilizer, structural P; HET: ANP; 2.25A {Mus musculus} SCOP: c.37.1.9 PDB: 1v8j_A* 2gry_A* Length = 410 | Back alignment and structure |
|---|
| >3dc4_A Kinesin-like protein NOD; catalytic domain, ATPase, microtubule, ADP, nucleotide-binding protein, ATP-binding, coiled coil, motor protein; HET: ADP; 1.90A {Drosophila melanogaster} PDB: 3dcb_A* 3dco_N* 3pxn_A* Length = 344 | Back alignment and structure |
|---|
| >2owm_A Nckin3-434, related to kinesin-like protein KIF1C; motor domain, ADP, NECK linker, motor PR; HET: ADP; 3.25A {Neurospora crassa} Length = 443 | Back alignment and structure |
|---|
| >3au4_A Myosin-X; protein-protein complex, motor protein cargo transportation, protein-apoptosis complex; 1.90A {Homo sapiens} PDB: 3au5_A 3pzd_A Length = 555 | Back alignment and structure |
|---|
| >3pvl_A Myosin VIIA isoform 1; protein complex, novel folding, protein cargo binding, cargo proteins, motor protein-protein transport complex; 2.80A {Mus musculus} Length = 655 | Back alignment and structure |
|---|
| >3ivf_A Talin-1; FERM domain, cell membrane, cell projection, cytoskeleton, M phosphoprotein, cell adhesion, structural protein; 1.94A {Mus musculus} PDB: 2kma_A 2kc1_A Length = 371 | Back alignment and structure |
|---|
| >4dxa_B KREV interaction trapped protein 1; GTPase, FERM, protein-protein interaction, GTP binding, CYTO protein binding; HET: GSP; 1.95A {Homo sapiens} Length = 322 | Back alignment and structure |
|---|
| >4f7g_A Talin-1; alpha-helix bundle, integrin activation, cell adhesion; 2.05A {Mus musculus} Length = 222 | Back alignment and structure |
|---|
| >1mix_A Talin; focal adhesion, integrin binding, FERM domain, cytoskeleton, structural protein; 1.75A {Gallus gallus} SCOP: a.11.2.1 b.55.1.5 PDB: 1miz_B 1mk7_B 1mk9_B 1y19_B 3g9w_A 2hrj_A 2g35_A* 2k00_A 2h7d_A* 2h7e_A* 2kgx_B Length = 206 | Back alignment and structure |
|---|
| >2kin_B Kinesin; motor protein, cytoskeleton; HET: ADP; 2.00A {Rattus norvegicus} SCOP: c.37.1.9 Length = 100 | Back alignment and structure |
|---|
| >3kin_B Kinesin heavy chain; motor protein, cytoskeleton; HET: ADP; 3.10A {Rattus norvegicus} SCOP: c.37.1.9 Length = 117 | Back alignment and structure |
|---|
| >1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 | Back alignment and structure |
|---|
| >1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 | Back alignment and structure |
|---|
| >1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 | Back alignment and structure |
|---|
| >1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 | Back alignment and structure |
|---|
| >4eku_A Protein-tyrosine kinase 2-beta; proline-rich tyrosine kinase 2, FERM domain, transferase; 3.25A {Homo sapiens} Length = 392 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >2i1j_A Moesin; FERM, coiled-coil, C-ermad, ERM, radixin, ezrin, MER actin binding, masking, regulation, SELF-inhibition, cell A membrane protein; 2.10A {Spodoptera frugiperda} PDB: 2i1k_A 1e5w_A Length = 575 | Back alignment and structure |
|---|
| >3qij_A Protein 4.1; cytoskeleton, structural genomics, structural genomics conso SGC; 1.80A {Homo sapiens} PDB: 1gg3_A 3bin_A 2he7_A 2rq1_A Length = 296 | Back alignment and structure |
|---|
| >1h4r_A Merlin; FERM, neurofibromatosis, NF2, structural protein, cytoskeleton, anti-oncogene; 1.8A {Homo sapiens} SCOP: a.11.2.1 b.55.1.5 d.15.1.4 PDB: 1isn_A 3u8z_A Length = 314 | Back alignment and structure |
|---|
| >4etp_B Spindle POLE BODY-associated protein VIK1; kinesin motor protein, kinesin motor homology domain, karyog mitosis, microtubules; HET: ADP EBC; 2.30A {Saccharomyces cerevisiae} PDB: 1u0i_A Length = 333 | Back alignment and structure |
|---|
| >1ef1_A Moesin; membrane, FERM domain, tail domain, membrane protein; 1.90A {Homo sapiens} SCOP: a.11.2.1 b.55.1.5 d.15.1.4 PDB: 1sgh_A 1j19_A 2emt_A 2ems_A 2d10_A 2d11_A 2yvc_A 2d2q_A 2zpy_A 1gc7_A 1gc6_A 1ni2_A Length = 294 | Back alignment and structure |
|---|
| >2al6_A Focal adhesion kinase 1; transferase; 2.35A {Gallus gallus} SCOP: a.11.2.1 b.55.1.5 d.15.1.4 PDB: 2j0m_A* 2aeh_A Length = 375 | Back alignment and structure |
|---|
| >1c1g_A Tropomyosin; contractIle protein; 7.00A {Sus scrofa} SCOP: h.1.5.1 PDB: 2tma_A 2w49_A 2w4u_A Length = 284 | Back alignment and structure |
|---|
| >1c1g_A Tropomyosin; contractIle protein; 7.00A {Sus scrofa} SCOP: h.1.5.1 PDB: 2tma_A 2w49_A 2w4u_A Length = 284 | Back alignment and structure |
|---|
| >1c1g_A Tropomyosin; contractIle protein; 7.00A {Sus scrofa} SCOP: h.1.5.1 PDB: 2tma_A 2w49_A 2w4u_A Length = 284 | Back alignment and structure |
|---|
| >1c1g_A Tropomyosin; contractIle protein; 7.00A {Sus scrofa} SCOP: h.1.5.1 PDB: 2tma_A 2w49_A 2w4u_A Length = 284 | Back alignment and structure |
|---|
| >1c1g_A Tropomyosin; contractIle protein; 7.00A {Sus scrofa} SCOP: h.1.5.1 PDB: 2tma_A 2w49_A 2w4u_A Length = 284 | Back alignment and structure |
|---|
| >2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080 | Back alignment and structure |
|---|
| >2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080 | Back alignment and structure |
|---|
| >1g8x_A Myosin II heavy chain fused to alpha-actinin 3; motor, lever ARM, protein engineering, structural protein; HET: ADP; 2.80A {Dictyostelium discoideum} SCOP: k.1.1.1 Length = 1010 | Back alignment and structure |
|---|
| >3vkg_A Dynein heavy chain, cytoplasmic; AAA+ protein, molecular motor, microtubles, motor protein; HET: ADP SPM; 2.81A {Dictyostelium discoideum} PDB: 3vkh_A* 3vkh_C* Length = 3245 | Back alignment and structure |
|---|
| >2ycu_A Non muscle myosin 2C, alpha-actinin; motor protein; HET: AOV; 2.25A {Homo sapiens} PDB: 1br1_A* 1br4_A* 1br2_A* Length = 995 | Back alignment and structure |
|---|
| >1f5n_A Interferon-induced guanylate-binding protein 1; GBP, GTP hydrolysis, GDP, GMP, dynamin related, large GTPase family. GMPPNP, GPPNHP.; HET: GNP; 1.70A {Homo sapiens} SCOP: a.114.1.1 c.37.1.8 PDB: 1dg3_A* 2b8w_A* 2b92_A* 2bc9_A* 2d4h_A* Length = 592 | Back alignment and structure |
|---|
| >2efr_A General control protein GCN4 and tropomyosin 1 Al; destabilizing cluster, hydrophobic core, contractIle protein; 1.80A {Saccharomyces cerevisiae} PDB: 2efs_A 2d3e_A Length = 155 | Back alignment and structure |
|---|
| >2efr_A General control protein GCN4 and tropomyosin 1 Al; destabilizing cluster, hydrophobic core, contractIle protein; 1.80A {Saccharomyces cerevisiae} PDB: 2efs_A 2d3e_A Length = 155 | Back alignment and structure |
|---|
| >1u4q_A Spectrin alpha chain, brain; alpha spectrin, three repeats of spectrin, alpha-helical linker region, 3-helix coiled-coil, structural protein; 2.50A {Gallus gallus} SCOP: a.7.1.1 a.7.1.1 a.7.1.1 Length = 322 | Back alignment and structure |
|---|
| >2b9c_A Striated-muscle alpha tropomyosin; alpha-helix, coiled coil, alanine, axial stagger, radius, SIDE-chain packing, crystal packing; 2.30A {Rattus norvegicus} SCOP: h.1.5.1 Length = 147 | Back alignment and structure |
|---|
| >2b9c_A Striated-muscle alpha tropomyosin; alpha-helix, coiled coil, alanine, axial stagger, radius, SIDE-chain packing, crystal packing; 2.30A {Rattus norvegicus} SCOP: h.1.5.1 Length = 147 | Back alignment and structure |
|---|
| >3o0z_A RHO-associated protein kinase 1; coiled-coil, transferase; HET: MSE; 2.33A {Homo sapiens} Length = 168 | Back alignment and structure |
|---|
| >1sjj_A Actinin; 3-helix bundle, calponin homology domain, calmodulin-like domain, actin binding protein, contractIle protein; 20.00A {Gallus gallus} SCOP: i.15.1.1 Length = 863 | Back alignment and structure |
|---|
| >3r6n_A Desmoplakin; spectrin repeat, SH3 domain, cell adhesion, desmosome; 2.95A {Homo sapiens} Length = 450 | Back alignment and structure |
|---|
| >3kbt_A Beta-I spectrin, spectrin beta chain, erythrocyte; complex, spectrin, spectrin repeat, three helix bundle, ANKY binding, disease mutation, structural protein, ZU5 sandwich; 2.75A {Homo sapiens} PDB: 3kbu_A Length = 326 | Back alignment and structure |
|---|
| >1hci_A Alpha-actinin 2; triple-helix coiled coil, contractIle protein, muscle, Z- LINE, actin-binding protein; 2.8A {Homo sapiens} SCOP: a.7.1.1 a.7.1.1 a.7.1.1 a.7.1.1 Length = 476 | Back alignment and structure |
|---|
| >3tkl_B LIDA protein, substrate of the DOT/ICM system; vesicle trafficking, protein transport-protein binding compl; HET: GTP; 2.18A {Legionella pneumophila} Length = 267 | Back alignment and structure |
|---|
| >2xs1_A Programmed cell death 6-interacting protein; protein transport-viral protein complex, cell cycle; 2.30A {Homo sapiens} PDB: 2xs8_A 2oev_A 2r05_A 2r02_A 2r03_A 2oex_A 2ojq_A Length = 704 | Back alignment and structure |
|---|
| >2xs1_A Programmed cell death 6-interacting protein; protein transport-viral protein complex, cell cycle; 2.30A {Homo sapiens} PDB: 2xs8_A 2oev_A 2r05_A 2r02_A 2r03_A 2oex_A 2ojq_A Length = 704 | Back alignment and structure |
|---|
| >3na7_A HP0958; flagellar biogenesis, flagellum export, C4 Zn-ribbon, coiled post-transcriptional, gene regulation, chaperone; HET: EPE; 2.20A {Helicobacter pylori} Length = 256 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch
Original result of HHsearch against PDB70 database
No hit with probability above 80.00
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST
Original result of RPS-BLAST against SCOP70(version1.75) database
| ID | Alignment Graph | Length |
Definition |
E-value |
| 1268 | ||||
| d1sdma_ | 364 | c.37.1.9 (A:) Kinesin heavy chain-like protein {Po | 1e-109 | |
| d2ncda_ | 368 | c.37.1.9 (A:) Kinesin motor Ncd (non-claret disjun | 7e-91 | |
| d1bg2a_ | 323 | c.37.1.9 (A:) Kinesin {Human (Homo sapiens) [TaxId | 4e-84 | |
| d1goja_ | 354 | c.37.1.9 (A:) Kinesin {Neurospora crassa [TaxId: 5 | 2e-79 | |
| d1ry6a_ | 330 | c.37.1.9 (A:) Kinesin {Malaria parasite (Plasmodiu | 7e-78 | |
| d1x88a1 | 345 | c.37.1.9 (A:18-362) Kinesin {Human (Homo sapiens), | 2e-77 | |
| d1f9va_ | 342 | c.37.1.9 (A:) Kinesin motor Ncd (non-claret disjun | 4e-76 | |
| d2zfia1 | 349 | c.37.1.9 (A:4-352) Kinesin {Mouse (Mus musculus), | 7e-75 | |
| d1v8ka_ | 362 | c.37.1.9 (A:) Kinesin {Mouse (Mus musculus), kif2c | 4e-73 | |
| d1mixa1 | 114 | a.11.2.1 (A:195-308) Talin {Chicken (Gallus gallus | 8e-22 | |
| d1h4ra1 | 111 | a.11.2.1 (A:104-214) Merlin {Human (Homo sapiens) | 4e-17 | |
| d1ef1a1 | 111 | a.11.2.1 (A:88-198) Moesin {Human (Homo sapiens) [ | 1e-16 | |
| d1mixa2 | 92 | b.55.1.5 (A:309-400) Talin {Chicken (Gallus gallus | 7e-14 | |
| d1gg3a1 | 106 | a.11.2.1 (A:82-187) Erythroid membrane protein 4.1 | 4e-13 | |
| d2al6a1 | 123 | a.11.2.1 (A:131-253) Focal adhesion kinase 1 {Chic | 1e-12 | |
| d1f5na1 | 300 | a.114.1.1 (A:284-583) Interferon-induced guanylate | 8e-04 | |
| d1bjta_ | 760 | e.11.1.1 (A:) DNA topoisomerase II, C-terminal fra | 0.001 | |
| d1j0wa_ | 99 | b.55.1.2 (A:) Downstream of tyrosine kinase 5, Dok | 0.004 |
| >d1sdma_ c.37.1.9 (A:) Kinesin heavy chain-like protein {Potato (Solanum tuberosum) [TaxId: 4113]} Length = 364 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: P-loop containing nucleoside triphosphate hydrolases superfamily: P-loop containing nucleoside triphosphate hydrolases family: Motor proteins domain: Kinesin heavy chain-like protein species: Potato (Solanum tuberosum) [TaxId: 4113]
Score = 345 bits (884), Expect = e-109
Identities = 311/364 (85%), Positives = 347/364 (95%)
Query: 892 KIRVYCRLRPLNEKEDAEKERYVLTSLDEFTVEHPWKDDKVKQHMYDQVFDGYATQEDVF 951
KIRVYCRLRPL EKE KER + S+DEFTVEH WKDDK KQHMYD+VFDG ATQ+DVF
Sbjct: 1 KIRVYCRLRPLCEKEIIAKERNAIRSVDEFTVEHLWKDDKAKQHMYDRVFDGNATQDDVF 60
Query: 952 EDTRYLVQSAVDGYNVCIFAYGQTGSGKTFTIYGSECNPGITPRAISELFRILKKENNKF 1011
EDT+YLVQSAVDGYNVCIFAYGQTGSGKTFTIYG++ NPG+TPRA+SELFRI+KK++NKF
Sbjct: 61 EDTKYLVQSAVDGYNVCIFAYGQTGSGKTFTIYGADSNPGLTPRAMSELFRIMKKDSNKF 120
Query: 1012 SFSLKAYMVELYQDTLVDLLLPRNEKRLKLEIKKDSKGMVLVENVTVVPISTFEEIKSII 1071
SFSLKAYMVELYQDTLVDLLLP+ KRLKL+IKKDSKGMV VENVTVV IST+EE+K+II
Sbjct: 121 SFSLKAYMVELYQDTLVDLLLPKQAKRLKLDIKKDSKGMVSVENVTVVSISTYEELKTII 180
Query: 1072 QRGSDQRHTSGTQMNEESSRSHLILSIVIESTNLQTQSVARGKLSFVDLAGSERVKKSGS 1131
QRGS+QRHT+GT MNE+SSRSHLI+S++IESTNLQTQ++ARGKLSFVDLAGSERVKKSGS
Sbjct: 181 QRGSEQRHTTGTLMNEQSSRSHLIVSVIIESTNLQTQAIARGKLSFVDLAGSERVKKSGS 240
Query: 1132 SGNQLKEAQSINKSLSALGDVISALSSGSQHIPYRNHKLTMLMSDSLGGNAKTLMFVNVS 1191
+GNQLKEAQSINKSLSALGDVISALSSG+QHIPYRNHKLTMLMSDSLGGNAKTLMFVN+S
Sbjct: 241 AGNQLKEAQSINKSLSALGDVISALSSGNQHIPYRNHKLTMLMSDSLGGNAKTLMFVNIS 300
Query: 1192 PAESNLEESYNSLTYASRVRSIVNDPNKNVSSKEVARLKRLVAYWKEQAGKKGDYEELEE 1251
PAESNL+E++NSLTYASRVRSIVNDP+KNVSSKEVARLK+LV+YWKEQAG+KGD EELEE
Sbjct: 301 PAESNLDETHNSLTYASRVRSIVNDPSKNVSSKEVARLKKLVSYWKEQAGRKGDDEELEE 360
Query: 1252 IQEE 1255
IQ+E
Sbjct: 361 IQDE 364
|
| >d2ncda_ c.37.1.9 (A:) Kinesin motor Ncd (non-claret disjunctional) {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 368 | Back information, alignment and structure |
|---|
| >d1bg2a_ c.37.1.9 (A:) Kinesin {Human (Homo sapiens) [TaxId: 9606]} Length = 323 | Back information, alignment and structure |
|---|
| >d1goja_ c.37.1.9 (A:) Kinesin {Neurospora crassa [TaxId: 5141]} Length = 354 | Back information, alignment and structure |
|---|
| >d1ry6a_ c.37.1.9 (A:) Kinesin {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Length = 330 | Back information, alignment and structure |
|---|
| >d1x88a1 c.37.1.9 (A:18-362) Kinesin {Human (Homo sapiens), mitotic kinesin eg5 [TaxId: 9606]} Length = 345 | Back information, alignment and structure |
|---|
| >d1f9va_ c.37.1.9 (A:) Kinesin motor Ncd (non-claret disjunctional) {Baker's yeast (Saccharomyces cerevisiae), Kar [TaxId: 4932]} Length = 342 | Back information, alignment and structure |
|---|
| >d2zfia1 c.37.1.9 (A:4-352) Kinesin {Mouse (Mus musculus), kif1a [TaxId: 10090]} Length = 349 | Back information, alignment and structure |
|---|
| >d1v8ka_ c.37.1.9 (A:) Kinesin {Mouse (Mus musculus), kif2c [TaxId: 10090]} Length = 362 | Back information, alignment and structure |
|---|
| >d1mixa1 a.11.2.1 (A:195-308) Talin {Chicken (Gallus gallus) [TaxId: 9031]} Length = 114 | Back information, alignment and structure |
|---|
| >d1h4ra1 a.11.2.1 (A:104-214) Merlin {Human (Homo sapiens) [TaxId: 9606]} Length = 111 | Back information, alignment and structure |
|---|
| >d1ef1a1 a.11.2.1 (A:88-198) Moesin {Human (Homo sapiens) [TaxId: 9606]} Length = 111 | Back information, alignment and structure |
|---|
| >d1mixa2 b.55.1.5 (A:309-400) Talin {Chicken (Gallus gallus) [TaxId: 9031]} Length = 92 | Back information, alignment and structure |
|---|
| >d1gg3a1 a.11.2.1 (A:82-187) Erythroid membrane protein 4.1R {Human (Homo sapiens) [TaxId: 9606]} Length = 106 | Back information, alignment and structure |
|---|
| >d2al6a1 a.11.2.1 (A:131-253) Focal adhesion kinase 1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 123 | Back information, alignment and structure |
|---|
| >d1f5na1 a.114.1.1 (A:284-583) Interferon-induced guanylate-binding protein 1 (GBP1), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 300 | Back information, alignment and structure |
|---|
| >d1bjta_ e.11.1.1 (A:) DNA topoisomerase II, C-terminal fragment (residues 410-1202) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 760 | Back information, alignment and structure |
|---|
| >d1j0wa_ b.55.1.2 (A:) Downstream of tyrosine kinase 5, Dok-5 {Human (Homo sapiens) [TaxId: 9606]} Length = 99 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch
Original result of HHsearch against SCOP70(version1.75) database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 1268 | |||
| d1sdma_ | 364 | Kinesin heavy chain-like protein {Potato (Solanum | 100.0 | |
| d2ncda_ | 368 | Kinesin motor Ncd (non-claret disjunctional) {Frui | 100.0 | |
| d1goja_ | 354 | Kinesin {Neurospora crassa [TaxId: 5141]} | 100.0 | |
| d1v8ka_ | 362 | Kinesin {Mouse (Mus musculus), kif2c [TaxId: 10090 | 100.0 | |
| d1f9va_ | 342 | Kinesin motor Ncd (non-claret disjunctional) {Bake | 100.0 | |
| d2zfia1 | 349 | Kinesin {Mouse (Mus musculus), kif1a [TaxId: 10090 | 100.0 | |
| d1x88a1 | 345 | Kinesin {Human (Homo sapiens), mitotic kinesin eg5 | 100.0 | |
| d1bg2a_ | 323 | Kinesin {Human (Homo sapiens) [TaxId: 9606]} | 100.0 | |
| d1ry6a_ | 330 | Kinesin {Malaria parasite (Plasmodium falciparum) | 100.0 | |
| d1mixa1 | 114 | Talin {Chicken (Gallus gallus) [TaxId: 9031]} | 99.69 | |
| d2al6a1 | 123 | Focal adhesion kinase 1 {Chicken (Gallus gallus) [ | 99.66 | |
| d1gg3a1 | 106 | Erythroid membrane protein 4.1R {Human (Homo sapie | 99.65 | |
| d1h4ra1 | 111 | Merlin {Human (Homo sapiens) [TaxId: 9606]} | 99.61 | |
| d1ef1a1 | 111 | Moesin {Human (Homo sapiens) [TaxId: 9606]} | 99.6 | |
| d1mixa2 | 92 | Talin {Chicken (Gallus gallus) [TaxId: 9031]} | 99.38 | |
| d1wgra_ | 100 | Growth factor receptor-bound protein 7, GRB-7 {Hum | 98.67 | |
| d1gg3a3 | 81 | Erythroid membrane protein 4.1R {Human (Homo sapie | 98.26 | |
| d1h4ra2 | 99 | Merlin {Human (Homo sapiens) [TaxId: 9606]} | 98.15 | |
| d1ef1a3 | 84 | Moesin {Human (Homo sapiens) [TaxId: 9606]} | 98.12 | |
| d1h4ra3 | 84 | Merlin {Human (Homo sapiens) [TaxId: 9606]} | 98.1 | |
| d1ef1a2 | 99 | Moesin {Human (Homo sapiens) [TaxId: 9606]} | 98.04 | |
| d1j0wa_ | 99 | Downstream of tyrosine kinase 5, Dok-5 {Human (Hom | 97.93 | |
| d1xr0b_ | 129 | FGFR substrate 2 (SNT-1) {Human (Homo sapiens) [Ta | 97.82 | |
| d1gg3a2 | 92 | Erythroid membrane protein 4.1R {Human (Homo sapie | 97.36 | |
| d1wxaa1 | 103 | Afadin {Mouse (Mus musculus) [TaxId: 10090]} | 97.01 | |
| d1p5ta_ | 107 | Docking protein 1, Dok1 {Mouse (Mus musculus) [Tax | 96.81 | |
| d1qqga2 | 104 | Insulin receptor substrate 1, IRS-1 {Human (Homo s | 96.23 | |
| d1hb6a_ | 86 | Acyl-CoA binding protein {Cow (Bos taurus) [TaxId: | 95.55 | |
| d1wj1a_ | 156 | Numb {Mouse (Mus musculus) [TaxId: 10090]} | 95.51 | |
| d2cy5a1 | 129 | EPS8-like protein 1, EPS8L1 {Mouse (Mus musculus) | 94.97 | |
| d2cs4a1 | 84 | Ras association domain-containing protein 8 {Human | 94.4 | |
| d2byea1 | 109 | Phospholipase C-epsilon-1 {Human (Homo sapiens) [T | 94.16 | |
| d1c1yb_ | 77 | c-Raf1 RBD {Human (Homo sapiens) [TaxId: 9606]} | 92.56 | |
| d1l8qa2 | 213 | Chromosomal replication initiation factor DnaA {Aq | 92.36 | |
| d1hbka_ | 89 | Acyl-CoA binding protein {Plasmodium falciparum [T | 91.54 | |
| d2al6a3 | 100 | Focal adhesion kinase 1 {Chicken (Gallus gallus) [ | 91.04 | |
| d1p3ra_ | 148 | Disabled homolog 2 (Dab2) {Mouse (Mus musculus) [T | 89.41 | |
| d1wxma1 | 73 | A-Raf proto-oncogene serine/threonine-protein kina | 89.24 | |
| d1r7ra3 | 265 | Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu | 87.98 | |
| d1wgya_ | 104 | Rap guanine nucleotide exchange factor 5, RapGEF5 | 86.02 | |
| d1ddma_ | 135 | Numb {Fruit fly (Drosophila melanogaster) [TaxId: | 85.93 | |
| d2al3a1 | 76 | Tether containing UBX domain for GLUT4 (Tug) {Mous | 85.32 | |
| d1aqca_ | 166 | X11 {Human (Homo sapiens) [TaxId: 9606]} | 84.88 | |
| d1gvnb_ | 273 | Plasmid maintenance system epsilon/zeta, toxin zet | 83.2 | |
| d2ap3a1 | 185 | Hypothetical protein MW0975 (SA0943) {Staphylococc | 81.74 | |
| d1fnna2 | 276 | CDC6, N-domain {Archaeon Pyrobaculum aerophilum [T | 80.08 |
| >d1sdma_ c.37.1.9 (A:) Kinesin heavy chain-like protein {Potato (Solanum tuberosum) [TaxId: 4113]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: P-loop containing nucleoside triphosphate hydrolases superfamily: P-loop containing nucleoside triphosphate hydrolases family: Motor proteins domain: Kinesin heavy chain-like protein species: Potato (Solanum tuberosum) [TaxId: 4113]
Probab=100.00 E-value=0 Score=650.39 Aligned_cols=361 Identities=86% Similarity=1.235 Sum_probs=340.4
Q ss_pred CCEEEECCCCCCCCCCCCCCCEEEEECCCCEEECCCCCCCCEEEEECCCCCCCCCHHHHHHCHHHHHHHHHCCCCEEEEE
Q ss_conf 53041001599832322378169970797223224789981136704103898884558730799999975564167984
Q 000820 892 KIRVYCRLRPLNEKEDAEKERYVLTSLDEFTVEHPWKDDKVKQHMYDQVFDGYATQEDVFEDTRYLVQSAVDGYNVCIFA 971 (1268)
Q Consensus 892 ~i~v~~rirp~~~~e~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~fd~vf~~~~~q~~v~~~~~~lv~~~~~G~n~~i~a 971 (1268)
+|+|++|+||+.+.|...+...++...+..++.+...+...+.|.||+||+++++|++||+.+.|+|+++++|+|+||||
T Consensus 1 rIkV~vRvRP~~~~E~~~~~~~~v~~~~~~~~~~~~~~~~~~~f~FD~vf~~~~~q~~vy~~v~~lv~~~l~G~n~~i~a 80 (364)
T d1sdma_ 1 KIRVYCRLRPLCEKEIIAKERNAIRSVDEFTVEHLWKDDKAKQHMYDRVFDGNATQDDVFEDTKYLVQSAVDGYNVCIFA 80 (364)
T ss_dssp CCEEEEEECCCCHHHHHTTCCBCEEECSTTEEEEECSSSSEEEEECSEEECTTCCHHHHHHTTTHHHHHHHTTCEEEEEE
T ss_pred CEEEEEECCCCCHHHCCCCCCCEEEECCCCEEEECCCCCCCEEEECCEECCCCCCHHHHHHHHHHHHHHHHCCCCEEEEC
T ss_conf 96999992789936622589875996799758735789985477788564999998999998999999996698503552
Q ss_pred ECCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCEEEEEEEEEEEECCCCCCCCCCCCCCCCCCEEEEECCCCCE
Q ss_conf 21347875421245899999707899999999873389629999999434314620247898764465237985899957
Q 000820 972 YGQTGSGKTFTIYGSECNPGITPRAISELFRILKKENNKFSFSLKAYMVELYQDTLVDLLLPRNEKRLKLEIKKDSKGMV 1051 (1268)
Q Consensus 972 yG~tgsGKT~tl~G~~~~~Gii~r~~~~lf~~~~~~~~~~~~~v~~s~~eiy~e~v~DLL~~~~~~~~~~~i~~~~~~~~ 1051 (1268)
||+|||||||||+|+..++||+||++.+||..+........|.|++||+|||+|+++|||.|.......+.+++++.+++
T Consensus 81 YGqTGSGKTyTm~G~~~~~Giipr~~~~lf~~i~~~~~~~~~~v~~S~~EIyne~i~DLL~~~~~~~~~l~~~~~~~~~~ 160 (364)
T d1sdma_ 81 YGQTGSGKTFTIYGADSNPGLTPRAMSELFRIMKKDSNKFSFSLKAYMVELYQDTLVDLLLPKQAKRLKLDIKKDSKGMV 160 (364)
T ss_dssp ECSTTSSHHHHHTBCSSSBCHHHHHHHHHHHHHHHGGGTEEEEEEEEEEEESSSCEEETTSCTTSCCCCCEEEECTTSCE
T ss_pred CCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHCCCCCCCEEEEEEEEEECCCCCCCCCCCCCCCCCCCEEECCCCCC
T ss_conf 23478776201656766551367899998865531034655369999888723632233576545554433133146760
Q ss_pred EECCCEEEECCCHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCEEEEEEEEEECCCCCEEEEEEEEEECCCCCCCCCCCC
Q ss_conf 73593899927987999999810025443456788888985338999999840587726678999996689965457799
Q 000820 1052 LVENVTVVPISTFEEIKSIIQRGSDQRHTSGTQMNEESSRSHLILSIVIESTNLQTQSVARGKLSFVDLAGSERVKKSGS 1131 (1268)
Q Consensus 1052 ~~~~~~~~~v~s~~~~~~~l~~~~~~r~~~~t~~n~~ssrsH~i~~i~i~~~~~~~~~~~~s~l~~vDLagse~~~~~~~ 1131 (1268)
++.|++++.|.+.++++.++..|..+|.+++|.+|..|||||+||++.+.+.+........|+|+|||||||||..++++
T Consensus 161 ~v~~l~~~~v~s~~~~~~~l~~g~~~R~~~~t~~n~~ssRsH~i~~i~v~~~~~~~~~~~~~kl~~vDLAGsEr~~~~~~ 240 (364)
T d1sdma_ 161 SVENVTVVSISTYEELKTIIQRGSEQRHTTGTLMNEQSSRSHLIVSVIIESTNLQTQAIARGKLSFVDLAGSERVKKSGS 240 (364)
T ss_dssp EEETCCCEEECSHHHHHHHHHHHHHHHCCCSSCTTCHHHHSEEEEEEEEEEEETTTCCEEEEEEEEEECCCCSCCCC---
T ss_pred CCCCCEEEEECCHHHHHHHHHCCCEEECCCCCCCCCCCCCCCEEEEEEEEEECCCCCEEEEEEEEEECHHHCCCCCCCCC
T ss_conf 20353000117788978986406600044534354103336359999999703676503567998404100352001466
Q ss_pred CHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCEEEEEECCCCCCHHHHHHHHHHHHHHC
Q ss_conf 22359999997497999999999960799999887874222234567888531399982899888899999999999851
Q 000820 1132 SGNQLKEAQSINKSLSALGDVISALSSGSQHIPYRNHKLTMLMSDSLGGNAKTLMFVNVSPAESNLEESYNSLTYASRVR 1211 (1268)
Q Consensus 1132 ~~~~~~e~~~in~sl~~L~~vi~al~~~~~~ipyr~skLT~lL~~~lgg~~~~~~i~~isp~~~~~~etl~tL~~a~r~~ 1211 (1268)
.|.+++|+..||+||.+|++||.+|+.+..|||||+||||++|+|+|||||+|+||+||||+..+++||++||+||+|++
T Consensus 241 ~g~~~~E~~~iN~SL~~L~~vi~aL~~~~~~ipyR~SkLT~lL~d~Lggns~t~~I~~isp~~~~~~eTl~TL~fa~~ak 320 (364)
T d1sdma_ 241 AGNQLKEAQSINKSLSALGDVISALSSGNQHIPYRNHKLTMLMSDSLGGNAKTLMFVNISPAESNLDETHNSLTYASRVR 320 (364)
T ss_dssp ------CCCTTCHHHHHHHHHHHHHHHTCSCCCGGGCHHHHHTTTTTTSSSEEEEEEEECCBGGGHHHHHHHHHHHHHHT
T ss_pred CCCEEEECCCCCCCHHHHHHHHHHHHCCCCCCCCHHHHHHHHHHHHCCCCCEEEEEEEECCCCCHHHHHHHHHHHHHHHH
T ss_conf 67502332335643206899999997499757730112138878634999509999996987001899999999999984
Q ss_pred CCCCCCCCCCCHHHHHHHHHHHHHHHHHCCCCCCHHHHHHH
Q ss_conf 15357777789699999999999999980899994689999
Q 000820 1212 SIVNDPNKNVSSKEVARLKRLVAYWKEQAGKKGDYEELEEI 1252 (1268)
Q Consensus 1212 ~i~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~ 1252 (1268)
+|+|+|.+|+.+.++.+|++++..+++..++..+.++++++
T Consensus 321 ~i~n~p~~n~~~~~~~~l~~~i~~l~~~~~~~~~~~~~~~l 361 (364)
T d1sdma_ 321 SIVNDPSKNVSSKEVARLKKLVSYWKEQAGRKGDDEELEEI 361 (364)
T ss_dssp TCCCCCCCCEECHHHHHHHTTTTCC-----------CCEEC
T ss_pred HCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHCCHHHHHHH
T ss_conf 20667835579899999999999999998744027799997
|
| >d2ncda_ c.37.1.9 (A:) Kinesin motor Ncd (non-claret disjunctional) {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1goja_ c.37.1.9 (A:) Kinesin {Neurospora crassa [TaxId: 5141]} | Back information, alignment and structure |
|---|
| >d1v8ka_ c.37.1.9 (A:) Kinesin {Mouse (Mus musculus), kif2c [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1f9va_ c.37.1.9 (A:) Kinesin motor Ncd (non-claret disjunctional) {Baker's yeast (Saccharomyces cerevisiae), Kar [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2zfia1 c.37.1.9 (A:4-352) Kinesin {Mouse (Mus musculus), kif1a [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1x88a1 c.37.1.9 (A:18-362) Kinesin {Human (Homo sapiens), mitotic kinesin eg5 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1bg2a_ c.37.1.9 (A:) Kinesin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ry6a_ c.37.1.9 (A:) Kinesin {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} | Back information, alignment and structure |
|---|
| >d1mixa1 a.11.2.1 (A:195-308) Talin {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d2al6a1 a.11.2.1 (A:131-253) Focal adhesion kinase 1 {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1gg3a1 a.11.2.1 (A:82-187) Erythroid membrane protein 4.1R {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1h4ra1 a.11.2.1 (A:104-214) Merlin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ef1a1 a.11.2.1 (A:88-198) Moesin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1mixa2 b.55.1.5 (A:309-400) Talin {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1wgra_ d.15.1.5 (A:) Growth factor receptor-bound protein 7, GRB-7 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1gg3a3 d.15.1.4 (A:1-81) Erythroid membrane protein 4.1R {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1h4ra2 b.55.1.5 (A:215-313) Merlin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ef1a3 d.15.1.4 (A:4-87) Moesin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1h4ra3 d.15.1.4 (A:20-103) Merlin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ef1a2 b.55.1.5 (A:199-297) Moesin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1j0wa_ b.55.1.2 (A:) Downstream of tyrosine kinase 5, Dok-5 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xr0b_ b.55.1.2 (B:) FGFR substrate 2 (SNT-1) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1gg3a2 b.55.1.5 (A:188-279) Erythroid membrane protein 4.1R {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wxaa1 d.15.1.5 (A:8-110) Afadin {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1p5ta_ b.55.1.2 (A:) Docking protein 1, Dok1 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1qqga2 b.55.1.2 (A:159-262) Insulin receptor substrate 1, IRS-1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1hb6a_ a.11.1.1 (A:) Acyl-CoA binding protein {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1wj1a_ b.55.1.2 (A:) Numb {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2cy5a1 b.55.1.2 (A:31-159) EPS8-like protein 1, EPS8L1 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2cs4a1 d.15.1.5 (A:8-91) Ras association domain-containing protein 8 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2byea1 d.15.1.5 (A:2-110) Phospholipase C-epsilon-1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1c1yb_ d.15.1.5 (B:) c-Raf1 RBD {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1l8qa2 c.37.1.20 (A:77-289) Chromosomal replication initiation factor DnaA {Aquifex aeolicus [TaxId: 63363]} | Back information, alignment and structure |
|---|
| >d1hbka_ a.11.1.1 (A:) Acyl-CoA binding protein {Plasmodium falciparum [TaxId: 5833]} | Back information, alignment and structure |
|---|
| >d2al6a3 d.15.1.4 (A:31-130) Focal adhesion kinase 1 {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1p3ra_ b.55.1.2 (A:) Disabled homolog 2 (Dab2) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1wxma1 d.15.1.5 (A:8-80) A-Raf proto-oncogene serine/threonine-protein kinase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1r7ra3 c.37.1.20 (A:471-735) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1wgya_ d.15.1.5 (A:) Rap guanine nucleotide exchange factor 5, RapGEF5 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ddma_ b.55.1.2 (A:) Numb {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d2al3a1 d.15.1.2 (A:10-85) Tether containing UBX domain for GLUT4 (Tug) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1aqca_ b.55.1.2 (A:) X11 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1gvnb_ c.37.1.21 (B:) Plasmid maintenance system epsilon/zeta, toxin zeta subunit {Streptococcus pyogenes [TaxId: 1314]} | Back information, alignment and structure |
|---|
| >d2ap3a1 a.24.27.1 (A:12-196) Hypothetical protein MW0975 (SA0943) {Staphylococcus aureus [TaxId: 1280]} | Back information, alignment and structure |
|---|
| >d1fnna2 c.37.1.20 (A:1-276) CDC6, N-domain {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} | Back information, alignment and structure |
|---|