Citrus Sinensis ID: 000861

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820-------830-------840-------850-------860-------870-------880-------890-------900-------910-------920-------930-------940-------950-------960-------970-------980-------990------1000------1010------1020------1030------1040------1050------1060------1070------1080------1090------1100------1110------1120------1130------1140------1150------1160------1170------1180------1190------1200------1210------1220------1230------1240------125
MFPGTHIWVSAVRFLLQVAMCRSVFPEILKQMMGNKSSEDIGSGVGTPSTAMSVKESQERVTKQNLNLAKALLEKREEMEKGRVQNRFRLLGDISTLIGDGKESNQCSNVKPMPEDVPNSTFSQDLRNSSVESSGELLQSISDAFRKNGHPFLKKITMNNLSSLMSEYDSQSDTFGMPFLPLPEDSMKCEGIVLIASLLCSCVRNVKLPHYRRAAILLLKSSSLFIDDEDRLQRVLPHVIAMLSDPAAIVRCAALETLCDILPLVRNFPPSDAKIFPEYILPMLSMLPDDPEESVRICYASNIAKLALTAYGFLVHSIRLSEAGVLDKLSAPHKSPSSSNETSVQLQRLNADVQLSQLRKSIAEVVQELVMGPKQTPSIRRALLQDIGNLCSFFGQRQSNDFLLPILPAFLNDRDEQLRAVFYGQIVYVCFFVGERSVEEYLLPYIEQALSDATEAVIVNALDCLAILCKSGYLRKRILLEMIERAFPLLCYPSQWVRRSVVTFIAASSESLGAVDSYVFLAPVIRPFLRRQPASLASVKALLSCLKPPVSREVFYQVLENARSSDMLERQRKIWYNTSSQSKQQETADLLKRGAEDLSSIKCWPDKQQSSEGHRPAGDTSKQPEFAQSDDNDGAKLRTLGSLVYNASSMADIRDPLCPEKLLFSGFMSQQVSGVNSLRCDKSSEGIPLYSFSMDKRAMGNLPVASDSVLQVNSLGIGSSTMPWMDTTNQSFSLASSVPPPNLVSGSFSISNGSKQFYRVVHEPEGRENDQMASVNCKFPEMGTSGTAKGSSINVEDASSPADLTGLPSFVRTSSIPDSGWRPRGILVAHLQEHCSAVNEIAISHDHSFFVSASDDSTVKVWDSRKLEKDISFRSRLTYHLEGSRALCTMMLRHSAQVVVGACDGIIHMFSVDHISRGLGNVEKYSGISDIKKKDTKEGAIVTLVNYNTDNCASHMFMYSTQNCGIHLWDTRSNSNTWTLKAIPEEGYVSSLVTGPCGNWFVSGSSRGVLTLWDLRFLVPVNSWQYSQVCPIEKMCLFVPPPNAAVSTTARPLIYVAAGCNEVSLWNAENGSCHQVLRTANYDGDTEMSDLPWAFARPSSRSNPKTDLRRNVNQKYRVDELNEPPPRLLGIRSLLPLPGGDLLTGGTDLKIRRWDHCSPGRSYCICGPNLKGVGNDEFYETRSSSGVQVVQERKRQPLTSKLTAKAVLAAAATDSAGCHRDSILSLGSVKLNQRLLISSSRDGAIKVWK
cccccEEEEEHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHcHHHHHHHccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHccccccHHHHHHcccccccccccccccccccccccccccccccEEEEHHHHHHHHHHccccHHHHHHHHHHHHHHccccccHHHHHHHccEEEEcccccccHHHHHHHHHHHHHcccccEEcccccccccccccccccccccccccEEEHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccHHHHHcccHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHccHHHcccccccccccccccccccccccccHHHHHHHHHccccEEEEEcccccHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHccccccHHHHHccccHHHHcccccccccHHHHHHccccccHHHHHHHHHHHHcccHHHHHHHHHHHHccccHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccHHHHHHHcccccccccccccccccccccccccccccccccccccEEEEccccccEEEEEEEccccccccccccccccEEEcccccccccccccccccccccEEccccccccEEccccccccccccEEEEEccccccccEEEcccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEcccccccEEEEEEcccccEEEEEcccccEEEEEcccccccccccccEEEEcccccEEEEEEcccccEEEEEEccccEEEEEcccccccccccccccccccEEEcccccccEEEEEEEccccccEEEEEEEEccccEEEEEcccccccEEEEcccccccEEEEEEcccccEEEEEEccccEEEEEcccccccccccccccccEEEEEEEccccccEEEcccccEEEEEEcccEEEEEEcccccEEEEEEcccccccEEEEcccccccccccccccccccEEEccccccccccccccccccEEEEEEEccccEEEEEEccccEEEEEcccccccEEEEcccccccccccEEEEEcccccEEEEEEcccccccccccccccccccccccccccccEEEEEEEEccccEEEEEEccccEEEcc
cccccEEEEcHHHHHHHHHHHHHHHHHHHHHHHccccHHHHcccccccccccccccccEEEEcccccccccccccccHHcccccccHHHHHccHHHHHHHHHHcccccccccccccccccccHHHHHHcccccccHHHHHHHHHHHcccccHHHHccHccHHHHHcccccccccccccccccccccccccHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHcccccccccHcHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccHHHcccccHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHcHHHHHHHccccHHcHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHcHccHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHcccHHHHHHEEHHcHHHHHcccccccccHHHHHHHccccccHHHHHHHHHccccHHHHHHHHHHcHcccccccccHHHHHcccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEcccccccccccccccccccccccccHHHHHHHccccccccHHHHccccccccccccccccccccEEEEcccccccEEEEEEcccccEEEEEccccEEEEEEcccccccccccccEEEcccccEEEEEEEEccccEEEEEccccEEEEEEEEccccccccccccccEEEEEccccccccEEEEEEEccccccccEEEEEEcccEEEEEEcccccccEEcccccccccEEEEEEcccccEEEEEccccEEEEEEEccccccccccccccccEEEEEEcccccEEEEEcccccEEEEEEcccEEEEEEcccccEEEEEEcccccccccccccccccccccccccccccEEccccccHHHHccccccccEEEEEEEEcccccEEEEEccccEEEEEEcccccccEEEEcccccccccccEEEEEcccccEEEEcccccccccccccccccccccccccccccccEEEEEEEcccccEEEEEccccEEEEEc
MFPGTHIWVSAVRFLLQVAMCRSVFPEILKQMmgnkssedigsgvgtpstamsVKESQERVTKQNLNLAKALLEKREEMEKGRVQNRFRLLGDIStligdgkesnqcsnvkpmpedvpnstfsqdlrnssveSSGELLQSISDAFRKNGHPFLKKITMNNLSSLMSeydsqsdtfgmpflplpedsmkcEGIVLIASLLCSCvrnvklphYRRAAILLLKssslfiddedRLQRVLPHVIAMLSDPAAIVRCAALETLCdilplvrnfppsdakifpeyilpmlsmlpddpeesvRICYASNIAKLALTAYGFLVHSIRLseagvldklsaphkspsssnetSVQLQRLNADVQLSQLRKSIAEVVQELvmgpkqtpSIRRALLQDIGNLCSffgqrqsndfllpilpaflnDRDEQLRAVFYGQIVYVCFFVGERSVEEYLLPYIEQALSDATEAVIVNALDCLAILCKSGYLRKRILLEMIERAfpllcypsqwvRRSVVTFIAASSeslgavdsyvflapvirpflrrqpASLASVKALLsclkppvsrEVFYQVLENARSSDMLERQRKIWYNTSSQSKQQETADLLKRGaedlssikcwpdkqqsseghrpagdtskqpefaqsddndgakLRTLGSLVynassmadirdplcpekllfsgfmsqqvsgvnslrcdkssegiplysfsmdkramgnlpvasdSVLQVNslgigsstmpwmdttnqsfslassvpppnlvsgsfsisngsKQFYRVvhepegrendqmasvnckfpemgtsgtakgssinvedasspadltglpsfvrtssipdsgwrprGILVAHLQEHCSAVNEIaishdhsffvsasddstvkvwdsrklekdiSFRSRLTYHLEGSRALCTMMLRHSAQVVVGACDGIIHMFSVDHIsrglgnvekysgisdikkkdtkegAIVTLVNyntdncashMFMYStqncgihlwdtrsnsntwtlkaipeegyvsslvtgpcgnwfvsgssrgvltlwdlrflvpvnswqysqvcpiekmclfvpppnaavsttarPLIYVAAGCNEvslwnaengschQVLRTanydgdtemsdlpwafarpssrsnpktdlrrnvnqkyrvdelneppprllgirsllplpggdlltggtdlkirrwdhcspgrsycicgpnlkgvgndefyetrsssgvqvvqerkrqpltsKLTAKAVLAAAAtdsagchrdsilsLGSVKLNQRLLISSSRDGAIKVWK
MFPGTHIWVSAVRFLLQVAMCRSVFPEILKQMMGNKSSEDIGSGVGTPSTAMSVKESQERVTKQNLNLAKALlekreemekgrvqnrfrLLGDISTLIGDGKESNQCSNVKPMPEDVPNSTFSQDLRNSSVESSGELLQSISDAFRKNGHPFLKKITMNNLSSLMSEYDSQSDTFGMPFLPLPEDSMKCEGIVLIASLLCSCVRNVKLPHYRRAAILLLKSSSLFIDDEDRLQRVLPHVIAMLSDPAAIVRCAALETLCDILPLVRNFPPSDAKIFPEYILPMLSMLPDDPEESVRICYASNIAKLALTAYGFLVHSIRLSEAGVLDKLsaphkspsssnetsVQLQRLNADVQLSQLRKSIAEVVQELVMGPKQTPSIRRALLQDIGNLCSFFGQRQSNDFLLPILPAFLNDRDEQLRAVFYGQIVYVCFFVGERSVEEYLLPYIEQALSDATEAVIVNALDCLAILCKSGYLRKRILLEMIERAFPLLCYPSQWVRRSVVTFIAASseslgavdSYVFLAPVIRPFLRRQPASLASVKALLSCLKPPVSREVFYQVLENarssdmleRQRKIWyntssqskqqETADLLKRGAEDLSSIKCWPDKQQSSEGHRPAGDTSKQPEFAQSDDNDGAKLRTLGSLVYNASSMADIRDPLCPEKLLFSGFMSQQVSGVNSLRCDKSSEGIPLYSFSMDKRAMGNLPVASDSVLQVNSLGIGSSTMPWMDTTNQSFSLASSVPPPNLVSGSFSISNGSKQFYRVVHEPEGRENDQMASVNCKFPEMGTSGTAKGSSINVEDASSPADLTGLPSFVRTSSIPDSGWRPRGILVAHLQEHCSAVNEIAISHDHSFfvsasddstvkvwdsrklekdisfrsrltYHLEGSRALCTMMLRHSAQVVVGACDGIIHMFSVDHISRGLGNVEKYsgisdikkkdtkegAIVTLVNYNTDNCASHMFMYSTQNCGIHLWDTRSNSNTWTLKAIPEEGYVSSLVTGPCGNWFVSGSSRGVLTLWDLRFLVPVNSWQYSQVCPIEKMCLFVPPPNAAVSTTARPLIYVAAGCNEVSLWNAENGSCHQVLRTANYDGDTEMSDLPWafarpssrsnpktdlrrnvnqkyrvdelneppprLLGIRSLLPLPGGDLLTGGTDLKIRRWDHCSPGRSYCICGPNLKGVGNDEFYETrsssgvqvvqerkrqpltskLTAKAVLAAAATDSAGCHRDSILslgsvklnqrllisssrdgaikvwk
MFPGTHIWVSAVRFLLQVAMCRSVFPEILKQMMGNKSSEDIGSGVGTPSTAMSVKESQERVTKQNLNLAKALLEKREEMEKGRVQNRFRLLGDISTLIGDGKESNQCSNVKPMPEDVPNSTFSQDLRNSSVESSGELLQSISDAFRKNGHPFLKKITMNNLSSLMSEYDSQSDTFGMPFLPLPEDSMKCEGIVLIASLLCSCVRNVKLPHYRRAAILLLKSSSLFIDDEDRLQRVLPHVIAMLSDPAAIVRCAALETLCDILPLVRNFPPSDAKIFPEYILPMLSMLPDDPEESVRICYASNIAKLALTAYGFLVHSIRLSEAGVLDKLSAPHKSPSSSNETSVQLQRLNADVQLSQLRKSIAEVVQELVMGPKQTPSIRRALLQDIGNLCSFFGQRQSNDFLLPILPAFLNDRDEQLRAVFYGQIVYVCFFVGERSVEEYLLPYIEQALSDATEAVIVNALDCLAILCKSGYLRKRILLEMIERAFPLLCYPSQWVRRSVVTFIAASSESLGAVDSYVFLAPVIRPFLRRQPASLASVKALLSCLKPPVSREVFYQVLENARSSDMLERQRKIWYNTSSQSKQQETADLLKRGAEDLSSIKCWPDKQQSSEGHRPAGDTSKQPEFAQSDDNDGAKLRTLGSLVYNASSMADIRDPLCPEKLLFSGFMSQQVSGVNSLRCDKSSEGIPLYSFSMDKRAMGNLPVASDSVLQVNSLGIGSSTMPWMDTTNQSFSLASSVPPPNLVSGSFSISNGSKQFYRVVHEPEGRENDQMASVNCKFPEMGTSGTAKGSSINVEDASSPADLTGLPSFVRTSSIPDSGWRPRGILVAHLQEHCSAVNEIAISHDHSFFVSASDDSTVKVWDSRKLEKDISFRSRLTYHLEGSRALCTMMLRHSAQVVVGACDGIIHMFSVDHISRGLGNVEKYSGISDIKKKDTKEGAIVTLVNYNTDNCASHMFMYSTQNCGIHLWDTRSNSNTWTLKAIPEEGYVSSLVTGPCGNWFVSGSSRGVLTLWDLRFLVPVNSWQYSQVCPIEKMCLFVPPPNAAVSTTARPLIYVAAGCNEVSLWNAENGSCHQVLRTANYDGDTEMSDLPWAFARPSSRSNPKTDLRRNVNQKYRVDELNEPPPRLLGIRSllplpggdlltggtdlKIRRWDHCSPGRSYCICGPNLKGVGNDEFYETRSSSGVQVVQERKRQPltskltakavlaaaatdsaGCHRDSILSLGSVKLNQRLLISSSRDGAIKVWK
****THIWVSAVRFLLQVAMCRSVFPEILK********************************************************RFRLLGDISTLI****************************************************************************FGMPFLPLPEDSMKCEGIVLIASLLCSCVRNVKLPHYRRAAILLLKSSSLFIDDEDRLQRVLPHVIAMLSDPAAIVRCAALETLCDILPLVRNFPPSDAKIFPEYILPMLSMLPDDPEESVRICYASNIAKLALTAYGFLVHSIRLSEAGVL*********************************KSIAEVVQELVMGPKQTPSIRRALLQDIGNLCSFFGQRQSNDFLLPILPAFLNDRDEQLRAVFYGQIVYVCFFVGERSVEEYLLPYIEQALSDATEAVIVNALDCLAILCKSGYLRKRILLEMIERAFPLLCYPSQWVRRSVVTFIAASSESLGAVDSYVFLAPVIRPFLRRQPASLASVKALLSCLKPPVSREVFYQVLENA***********IWY**************************************************************TLGSLVYNASSMADIRDPLCPEKLLFSGFMSQQVSGVNSLRC******IPLYSFS***************VLQVNSLGI****************************************************************************************************DSGWRPRGILVAHLQEHCSAVNEIAISHDHSFFVSASDDSTVKVWDSRKLEKDISFRSRLTYHLEGSRALCTMMLRHSAQVVVGACDGIIHMFSVDHISRGLGNVEKYSGISDIKKKDTKEGAIVTLVNYNTDNCASHMFMYSTQNCGIHLWDTRSNSNTWTLKAIPEEGYVSSLVTGPCGNWFVSGSSRGVLTLWDLRFLVPVNSWQYSQVCPIEKMCLFVPPPNAAVSTTARPLIYVAAGCNEVSLWNAENGSCHQVLRTANYDGDT****LPWA*********************************LLGIRSLLPLPGGDLLTGGTDLKIRRWDHCSPGRSYCICGPNLKGVGNDEFY************************AKAVLAAAATDSAGCHRDSILSLGSVKLNQRLLI************
**PGTHIWVSAVRFLLQVAMCRSVFPEILK********************************************************RFRLLGDISTLI*****************************************SISDAFRKNGHPFLKKI**********************************GIVLIASLLCSCVRNVKLPHYRRAAILLLKSSSLFIDDEDRLQRVLPHVIAMLSDPAAIVRCAALETLCDILPLVRNFPPSDAKIFPEYILPMLSMLPDDPEESVRICYASNIAKLALTAYGFLVHSIR*********************************VQLSQLRKSIAEVVQELVMGPKQTPSIRRALLQDIGNLCSFFGQRQSNDFLLPILPAFLNDRDEQLRAVFYGQIVYVCFFVGERSVEEYLLPYIEQALSDATEAVIVNALDCLAILCKSGYLRKRILLEMIERAFPLLCYPSQWVRRSVVTFIAASSESLGAVDSYVFLAPVIRPFLRRQPASLASVKALLSCLKPPVSREVFYQVLENARSSDMLERQRKIWYNTSSQSKQQETADLLKR*AE*LS***CW************AGDTSKQPEFAQSDDNDGAKLRTLGSLVYNASSMADIRDPLCPEKLLFSGFMSQQVSGVNSLRCDKSSEGIPLYSF*********************************************V*****VSGSFSISNGSKQFYRVVHEPEGRENDQMASVNCKFPE******AKGSSINVEDASSPADLTGLPSFVRTSSIPDSGWRPRGILVAHLQEHCSAVNEIAISHDHSFFVSASDDSTVKVWDSRKLE*********TYHLEGSRALCTMMLRHSAQVVVGACDGIIHMFSVDHISRG******YSGISDIKKKDTKEGAIVTLVNYNTDNCASHMFMYSTQNCGIHLWDTRSNSNTWTLKAIPEEGYVSSLVTGPCGNWFVSGSSRGVLTLWDLRFLVPVNSWQYSQVCPIEKMCLFVPPPNAAVSTTARPLIYVAAGCNEVSLWNAENGSCHQVLRTANYDGDTEMSDLPW*********NPKTDLRRNVNQKYRVDELNEPPPRLLGIRSLLPLPGGDLLTGGTDLKIRRWDHCSPGRSYCICGPNLKGVGNDEFYETRSSSGVQVVQERKR**********AVLAAAATDSAGCHRDSILSLGSVKLNQRLLISSSRDGAIKVWK
MFPGTHIWVSAVRFLLQVAMCRSVFPEILKQMMGN**************************TKQNLNLAKALLEKREEMEKGRVQNRFRLLGDISTLIGDGKESNQCSNVKPMPEDVPNSTFSQ************LLQSISDAFRKNGHPFLKKITMNNLSSLMSEYDSQSDTFGMPFLPLPEDSMKCEGIVLIASLLCSCVRNVKLPHYRRAAILLLKSSSLFIDDEDRLQRVLPHVIAMLSDPAAIVRCAALETLCDILPLVRNFPPSDAKIFPEYILPMLSMLPDDPEESVRICYASNIAKLALTAYGFLVHSIRLSEAGVLDK*****************LQRLNADVQLSQLRKSIAEVVQELVMGPKQTPSIRRALLQDIGNLCSFFGQRQSNDFLLPILPAFLNDRDEQLRAVFYGQIVYVCFFVGERSVEEYLLPYIEQALSDATEAVIVNALDCLAILCKSGYLRKRILLEMIERAFPLLCYPSQWVRRSVVTFIAASSESLGAVDSYVFLAPVIRPFLRRQPASLASVKALLSCLKPPVSREVFYQVLENARSSDMLERQRKIWYNTS*********DLLKRGAEDLSSIKCWP**********************QSDDNDGAKLRTLGSLVYNASSMADIRDPLCPEKLLFSGFMSQQVSGVNSLRCDKSSEGIPLYSFSMDKRAMGNLPVASDSVLQVNSLGIGSSTMPWMDTTNQSFSLASSVPPPNLVSGSFSISNGSKQFYRVVHEPEGRENDQMASVNCKFPEMGTSGTAKGSSINVEDASSPADLTGLPSFVRTSSIPDSGWRPRGILVAHLQEHCSAVNEIAISHDHSFFVSASDDSTVKVWDSRKLEKDISFRSRLTYHLEGSRALCTMMLRHSAQVVVGACDGIIHMFSVDHISRGLGNVEKYSGISDIKKKDTKEGAIVTLVNYNTDNCASHMFMYSTQNCGIHLWDTRSNSNTWTLKAIPEEGYVSSLVTGPCGNWFVSGSSRGVLTLWDLRFLVPVNSWQYSQVCPIEKMCLFVPPPNAAVSTTARPLIYVAAGCNEVSLWNAENGSCHQVLRTANYDGDTEMSDLPWAFAR*********DLRRNVNQKYRVDELNEPPPRLLGIRSLLPLPGGDLLTGGTDLKIRRWDHCSPGRSYCICGPNLKGVGNDEFYE**************RQPLTSKLTAKAVLAAAATDSAGCHRDSILSLGSVKLNQRLLISSSRDGAIKVWK
*FPGTHIWVSAVRFLLQVAMCRSVFPEILKQMMG***********GTPS*******SQERVTKQNLNLAKA**EKREEMEKGRVQNRFRLLGDISTLIGDGKES*****VKPMPEDVPNSTFSQDLRNSSVESSGELLQSISDAFRKNGHPFLKKITMNNLSSLMSEYDSQSDTFGMPFLPLPEDSMKCEGIVLIASLLCSCVRNVKLPHYRRAAILLLKSSSLFIDDEDRLQRVLPHVIAMLSDPAAIVRCAALETLCDILPLVRNFPPSDAKIFPEYILPMLSMLPDDPEESVRICYASNIAKLALTAYGFLVHSIRLSEA***********************QRLNADVQLSQLRKSIAEVVQELVMGPKQTPSIRRALLQDIGNLCSFFGQRQSNDFLLPILPAFLNDRDEQLRAVFYGQIVYVCFFVGERSVEEYLLPYIEQALSDATEAVIVNALDCLAILCKSGYLRKRILLEMIERAFPLLCYPSQWVRRSVVTFIAASSESLGAVDSYVFLAPVIRPFLRRQPASLASVKALLSCLKPPVSREVFYQVLENARSSDMLERQRKIWYNTSSQSKQQETADLLKR*******************************EFAQSDDNDGAKLRTLGSLVYNASSMADIRDPLCPEKLLFS**********************************************************************************************************M*SVNCKFPEMGTSGTAKGSSINVEDASSPADLTGLPSFVRTSSIPDSGWRPRGILVAHLQEHCSAVNEIAISHDHSFFVSASDDSTVKVWDSRKLEKDISFRSRLTYHLEGSRALCTMMLRHSAQVVVGACDGIIHMFSVDHISRGLGNVEKYSGISDIKKKDTKEGAIVTLVNYNTDNCASHMFMYSTQNCGIHLWDTRSNSNTWTLKAIPEEGYVSSLVTGPCGNWFVSGSSRGVLTLWDLRFLVPVNSWQYSQVCPIEKMCLFVPPPNAAVSTTARPLIYVAAGCNEVSLWNAENGSCHQVLRTANYDGDTEMSDLP*AFARPSSRSNPKTDLRRNVNQKYRVDELNEPPPRLLGIRSLLPLPGGDLLTGGTDLKIRRWDHCSPGRSYCICGPNLKGVGNDEFYETRSSSGVQVVQERKRQPLTSK***KAVLAAA***SAGCHRDSILSLGSVKLNQRLLISSSRDGAIKVWK
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MFPGTHIWVSAVRFLLQVAMCRSVFPEILKQMMGNKSSEDIGSGVGTPSTAMSVKESQERVTKQNLNLAKALLEKREEMEKGRVQNRFRLLGDISTLIGDGKESNQCSNVKPMPEDVPNSTFSQDLRNSSVESSGELLQSISDAFRKNGHPFLKKITMNNLSSLMSEYDSQSDTFGMPFLPLPEDSMKCEGIVLIASLLCSCVRNVKLPHYRRAAILLLKSSSLFIDDEDRLQRVLPHVIAMLSDPAAIVRCAALETLCDILPLVRNFPPSDAKIFPEYILPMLSMLPDDPEESVRICYASNIAKLALTAYGFLVHSIRLSEAGVLDKLSAPHKSPSSSNETSVQLQRLNADVQLSQLRKSIAEVVQELVMGPKQTPSIRRALLQDIGNLCSFFGQRQSNDFLLPILPAFLNDRDEQLRAVFYGQIVYVCFFVGERSVEEYLLPYIEQALSDATEAVIVNALDCLAILCKSGYLRKRILLEMIERAFPLLCYPSQWVRRSVVTFIAASSESLGAVDSYVFLAPVIRPFLRRQPASLASVKALLSCLKPPVSREVFYQVLENARSSDMLERQRKIWYNTSSQSKQQETADLLKRGAEDLSSIKCWPDKQQSSEGHRPAGDTSKQPEFAQSDDNDGAKLRTLGSLVYNASSMADIRDPLCPEKLLFSGFMSQQVSGVNSLRCDKSSEGIPLYSFSMDKRAMGNLPVASDSVLQVNSLGIGSSTMPWMDTTNQSFSLASSVPPPNLVSGSFSISNGSKQFYRVVHEPEGRENDQMASVNCKFPEMGTSGTAKGSSINVEDASSPADLTGLPSFVRTSSIPDSGWRPRGILVAHLQEHCSAVNEIAISHDHSFFVSASDDSTVKVWDSRKLEKDISFRSRLTYHLEGSRALCTMMLRHSAQVVVGACDGIIHMFSVDHISRGLGNVEKYSGISDIKKKDTKEGAIVTLVNYNTDNCASHMFMYSTQNCGIHLWDTRSNSNTWTLKAIPEEGYVSSLVTGPCGNWFVSGSSRGVLTLWDLRFLVPVNSWQYSQVCPIEKMCLFVPPPNAAVSTTARPLIYVAAGCNEVSLWNAENGSCHQVLRTANYDGDTEMSDLPWAFARPSSRSNPKTDLRRNVNQKYRVDELNEPPPRLLGIRSLLPLPGGDLLTGGTDLKIRRWDHCSPGRSYCICGPNLKGVGNDEFYETRSSSGVQVVQERKRQPLTSKLTAKAVLAAAATDSAGCHRDSILSLGSVKLNQRLLISSSRDGAIKVWK
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query1249 2.2.26 [Sep-21-2011]
Q995701358 Phosphoinositide 3-kinase yes no 0.297 0.273 0.345 5e-50
Q8VD651358 Phosphoinositide 3-kinase yes no 0.294 0.270 0.342 8e-50
Q5R9I31358 Phosphoinositide 3-kinase yes no 0.290 0.267 0.343 1e-49
P0C0R51358 Phosphoinositide 3-kinase yes no 0.294 0.270 0.340 3e-49
Q54S77 1966 Probable serine/threonine yes no 0.284 0.180 0.323 2e-48
O42900 1706 Serine/threonine-protein yes no 0.385 0.281 0.274 5e-43
Q9UVG61340 Putative serine/threonine yes no 0.265 0.247 0.302 8e-42
P222191454 Serine/threonine-protein yes no 0.281 0.242 0.278 3e-37
Q96DI7357 U5 small nuclear ribonucl no no 0.157 0.551 0.266 1e-05
Q2HJH6358 U5 small nuclear ribonucl no no 0.129 0.452 0.274 2e-05
>sp|Q99570|PI3R4_HUMAN Phosphoinositide 3-kinase regulatory subunit 4 OS=Homo sapiens GN=PIK3R4 PE=1 SV=3 Back     alignment and function desciption
 Score =  200 bits (509), Expect = 5e-50,   Method: Compositional matrix adjust.
 Identities = 135/391 (34%), Positives = 203/391 (51%), Gaps = 19/391 (4%)

Query: 182 LPEDSM---KCEGIVLIASLLCSCVRNVKLPHYRRAAILLLKSSSLFIDDEDRLQRVLPH 238
           LPE +    K  G+V++ S++ SC++ +K    + AA+ L+   +  +  E  L R+ P+
Sbjct: 362 LPEKAEGEPKENGLVILVSVITSCLQTLKYCDSKLAALELILHLAPRLSVEILLDRITPY 421

Query: 239 VIAMLSDPAAIVRCAALETLCDILPLVRNFPPSDAKIFPEYILPMLSMLPDDPEESVRIC 298
           ++   +D    VR  AL TL  +L LV+  P +D  I+PEYILP ++ L  D    VR+ 
Sbjct: 422 LLHFSNDSVPRVRAEALRTLTKVLALVKEVPRNDINIYPEYILPGIAHLAQDDATIVRLA 481

Query: 299 YASNIAKLALTAYGFLVHSIRLSEAGVLDKLSAPHKSPSSSNETSVQLQRLNADVQLSQL 358
           YA NIA LA TA  FL       E   L  L+     P++     V     N D +L  L
Sbjct: 482 YAENIALLAETALRFL-------ELVQLKNLNM-ENDPNNEEIDEVTHPNGNYDTELQAL 533

Query: 359 RKSIAEVVQELVMGPKQTPSIRRALLQD-IGNLCSFFGQRQSNDFLLPILPAFLNDR-DE 416
            + + + V  L+  P+    +++ L+++ I  LC FFG++++ND LL  +  FLND+ D 
Sbjct: 534 HEMVQQKVVTLLSDPENI--VKQTLMENGITRLCVFFGRQKANDVLLSHMITFLNDKNDW 591

Query: 417 QLRAVFYGQIVYVCFFVGERSVEEYLLPYIEQALSDATEAVIVNALDCLAILCKSGYLRK 476
            LR  F+  IV V  +VG +S    L P ++Q LSDA E VIV AL  L  +C+ G L+K
Sbjct: 592 HLRGAFFDSIVGVAAYVGWQS-SSILKPLLQQGLSDAEEFVIVKALYALTCMCQLGLLQK 650

Query: 477 RILLEMIERAFPLLCYPSQWVRRSVVTFIAASSESLGAVDSYVFLAPVIRPFLRRQPASL 536
             + E      P LC+P+ W+R   V FI   +  +   D Y  L P + P++ +    +
Sbjct: 651 PHVYEFASDIAPFLCHPNLWIRYGAVGFITVVARQISTADVYCKLMPYLDPYITQPIIQI 710

Query: 537 ASVKALLSCLKPPVSREVFYQVLENARSSDM 567
                LLS LK PVSR +F   L   RS D+
Sbjct: 711 ERKLVLLSVLKEPVSRSIFDYAL---RSKDI 738
Regulatory subunit of the PI3K complex. May regulate membrane trafficking late in the endocytic pathway.
Homo sapiens (taxid: 9606)
EC: 2EC: .EC: 7EC: .EC: 1EC: 1EC: .EC: 1
>sp|Q8VD65|PI3R4_MOUSE Phosphoinositide 3-kinase regulatory subunit 4 OS=Mus musculus GN=Pik3r4 PE=1 SV=3 Back     alignment and function description
>sp|Q5R9I3|PI3R4_PONAB Phosphoinositide 3-kinase regulatory subunit 4 OS=Pongo abelii GN=PIK3R4 PE=2 SV=3 Back     alignment and function description
>sp|P0C0R5|PI3R4_RAT Phosphoinositide 3-kinase regulatory subunit 4 OS=Rattus norvegicus GN=Pik3r4 PE=2 SV=2 Back     alignment and function description
>sp|Q54S77|VPS15_DICDI Probable serine/threonine-protein kinase vps15 OS=Dictyostelium discoideum GN=vps15 PE=3 SV=1 Back     alignment and function description
>sp|O42900|PPK19_SCHPO Serine/threonine-protein kinase ppk19 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ppk19 PE=1 SV=1 Back     alignment and function description
>sp|Q9UVG6|VPS15_PICPA Putative serine/threonine-protein kinase VPS15 OS=Komagataella pastoris GN=VPS15 PE=3 SV=3 Back     alignment and function description
>sp|P22219|VPS15_YEAST Serine/threonine-protein kinase VPS15 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=VPS15 PE=1 SV=4 Back     alignment and function description
>sp|Q96DI7|SNR40_HUMAN U5 small nuclear ribonucleoprotein 40 kDa protein OS=Homo sapiens GN=SNRNP40 PE=1 SV=1 Back     alignment and function description
>sp|Q2HJH6|SNR40_BOVIN U5 small nuclear ribonucleoprotein 40 kDa protein OS=Bos taurus GN=SNRNP40 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query1249
2240880491209 predicted protein [Populus trichocarpa] 0.967 0.999 0.755 0.0
359484532 1455 PREDICTED: phosphoinositide 3-kinase reg 0.907 0.778 0.737 0.0
255546297 1455 ATP binding protein, putative [Ricinus c 0.907 0.779 0.719 0.0
356497575 1521 PREDICTED: phosphoinositide 3-kinase reg 0.959 0.787 0.725 0.0
356520822 1488 PREDICTED: phosphoinositide 3-kinase reg 0.934 0.784 0.718 0.0
449435788 1445 PREDICTED: phosphoinositide 3-kinase reg 0.899 0.777 0.691 0.0
449489804 1445 PREDICTED: LOW QUALITY PROTEIN: phosphoi 0.899 0.777 0.690 0.0
297803098 1494 kinase family protein [Arabidopsis lyrat 0.939 0.785 0.664 0.0
15233564 1494 phosphoinositide-3-kinase, regulatory su 0.939 0.785 0.668 0.0
2977387421349 unnamed protein product [Vitis vinifera] 0.760 0.704 0.752 0.0
>gi|224088049|ref|XP_002308305.1| predicted protein [Populus trichocarpa] gi|222854281|gb|EEE91828.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
 Score = 1856 bits (4807), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 921/1219 (75%), Positives = 1031/1219 (84%), Gaps = 11/1219 (0%)

Query: 32   MMGNKSSEDIGSGVGTPSTAMSVKESQERVTKQNLNLAKALLEKREEMEKGRVQNRFRLL 91
            MMG+++SE  G+     + +++ K S+E V KQNL+ + +    RE +E G    ++ LL
Sbjct: 1    MMGSRTSEVAGTRRDVFANSLNGKLSEEMVEKQNLD-STSHWRNRERIENGLTCQQYNLL 59

Query: 92   GDISTLIGDGKESNQCSNVKPMPEDVPNSTFSQDLRNSSVESSGELLQSISDAFRKNGHP 151
            GDI++L+GD K+S+   + K MPE  P S F QDL+  S +S  ELLQ+IS+AFR+N HP
Sbjct: 60   GDINSLLGDVKQSSGYYSAKLMPESAPGSEFCQDLKQCSTKSPDELLQTISNAFRRNDHP 119

Query: 152  FLKKITMNNLSSLMSEYDSQSDTFGMPFLPLPEDSMKCEGIVLIASLLCSCVRNVKLPHY 211
            FLKKIT+++LSSLMSEYDSQSDTFGMPFLPLPEDSMKCEG+VLIASLLCSC+RNVKLPH 
Sbjct: 120  FLKKITVDDLSSLMSEYDSQSDTFGMPFLPLPEDSMKCEGMVLIASLLCSCIRNVKLPHL 179

Query: 212  RRAAILLLKSSSLFIDDEDRLQRVLPHVIAMLSDPAAIVRCAALETLCDILPLVRNFPPS 271
            RR AILLLKS SL+IDDEDRLQRVLP+VIAMLSDPAAIVR AALETLCDILPLVR+FPPS
Sbjct: 180  RRGAILLLKSCSLYIDDEDRLQRVLPYVIAMLSDPAAIVRSAALETLCDILPLVRDFPPS 239

Query: 272  DAKIFPEYILPMLSMLPDDPEESVRICYASNIAKLALTAYGFLVHSIRLSEAGVLDKLSA 331
            DAKIFPEYILPMLSMLPDDPEESVRICYASNIAKLALTAYGFL+HSI LS+AGVLD++S+
Sbjct: 240  DAKIFPEYILPMLSMLPDDPEESVRICYASNIAKLALTAYGFLIHSIGLSKAGVLDEMSS 299

Query: 332  PHKSPSSSNETSVQLQRLNADVQLSQLRKSIAEVVQELVMGPKQTPSIRRALLQDIGNLC 391
            P  S +S  E   QLQR+N D QLSQLRKSIAEVVQELVMGPKQTP+IRRALLQDIGNLC
Sbjct: 300  PQNSMASFIERPGQLQRVNNDAQLSQLRKSIAEVVQELVMGPKQTPNIRRALLQDIGNLC 359

Query: 392  SFFGQRQSNDFLLPILPAFLNDRDEQLRAVFYGQIVYVCFFVGERSVEEYLLPYIEQALS 451
             FFG RQSNDFLLPILPAFLNDRDEQLRA+FY +IVYVCFFVG+RSVEEYLLPYI+QALS
Sbjct: 360  CFFGHRQSNDFLLPILPAFLNDRDEQLRALFYSKIVYVCFFVGQRSVEEYLLPYIDQALS 419

Query: 452  DATEAVIVNALDCLAILCKSGYLRKRILLEMIERAFPLLCYPSQWVRRSVVTFIAASSES 511
            D TE VIVNALDCLAILCK G+LRKR+LLEMIERAFPLLCYPSQWVRRS V+FIAASSES
Sbjct: 420  DQTEVVIVNALDCLAILCKRGFLRKRVLLEMIERAFPLLCYPSQWVRRSAVSFIAASSES 479

Query: 512  LGAVDSYVFLAPVIRPFLRRQPASLASVKALLSCLKPPVSREVFYQVLENARSSDMLERQ 571
            LGAVDSYVFLAPVIRPFL R PASLAS K+LL CL PPVSR+VFY  LENARSSDMLERQ
Sbjct: 480  LGAVDSYVFLAPVIRPFLCRHPASLASEKSLLLCLVPPVSRQVFYHDLENARSSDMLERQ 539

Query: 572  RKIWYNTSSQSKQQETADLLKRGAEDLSSIKCWPDKQQSSEGHRPAGDTSKQPEFAQSDD 631
            RKIWYN+S+QSKQ E  DLLK   ++ +S+K WP+K+ S        D  +QPE     D
Sbjct: 540  RKIWYNSSAQSKQWEPEDLLKGDDKEPNSMKSWPEKEPSPGDQNHDADRLEQPE-----D 594

Query: 632  NDGAKLRTLGSLVYNASSMADIRDPLCPEKLLFSGFMSQQVSGVNSLRCDKSSEGIPLYS 691
             D AKL  +G  + NASS  DIRD L  EKL FSG MS Q SGVNS   DKSSEGIPLYS
Sbjct: 595  GD-AKLIAMG-FIANASSKVDIRDALSSEKLQFSGCMSPQFSGVNSFLHDKSSEGIPLYS 652

Query: 692  FSMDKRAMGNLPVASDSVLQVNSLGIGSSTMPWMDTTNQSFSLASSVPPPNLVSGSFSIS 751
            FSMD+RA+   P  SDS LQ+NSL I SS MPW+D   +SFSLASSVP P LVSGSFSI+
Sbjct: 653  FSMDRRAVKFPPATSDSSLQMNSLAISSSYMPWVDHGIKSFSLASSVPAPKLVSGSFSIT 712

Query: 752  NGSKQFYRVVHEPEGRENDQMASVNCKFPEMGTSGTAKGSSINVEDASSPADLTGLPSFV 811
            NGSK FYRVVHEPE REN+Q +  N K+ ++G  GT+KGSS  VEDA  P DLTGLP F 
Sbjct: 713  NGSKPFYRVVHEPESRENEQTSFFNGKYQDVGLYGTSKGSSFTVEDA-PPTDLTGLPLFA 771

Query: 812  RTSSIPDSGWRPRGILVAHLQEHCSAVNEIAISHDHSFFVSASDDSTVKVWDSRKLEKDI 871
            RT+SIPDSGW+PRG+LVAHLQEH SA+N+IA+S DHS FVSASDDST+KVWDSRKLEKDI
Sbjct: 772  RTASIPDSGWKPRGVLVAHLQEHRSAINDIAVSSDHSVFVSASDDSTIKVWDSRKLEKDI 831

Query: 872  SFRSRLTYHLEGSRALCTMMLRHSAQVVVGACDGIIHMFSVDHISRGLGN-VEKYSGISD 930
            SFRSRLTYHLEGSRALCT+ML + AQVVVGACDG IHMFSV+H+SRGLGN VEKYSGI+D
Sbjct: 832  SFRSRLTYHLEGSRALCTVMLHNIAQVVVGACDGTIHMFSVEHMSRGLGNVVEKYSGIAD 891

Query: 931  IKKKDTKEGAIVTLVNYNTDNCASHMFMYSTQNCGIHLWDTRSNSNTWTLKAIPEEGYVS 990
            IKKKD KEGAI++L+NY +DN      MYSTQNCGIHLWD R+NSN WTLKA+PEEGY+S
Sbjct: 892  IKKKDIKEGAILSLLNYTSDNSDGQSVMYSTQNCGIHLWDIRANSNAWTLKAVPEEGYIS 951

Query: 991  SLVTGPCGNWFVSGSSRGVLTLWDLRFLVPVNSWQYSQVCPIEKMCLFVPPPNAAVSTTA 1050
            SLVTGPCGNWFVSGSSRGVLTLWDLRFL+PVNSW+YS VCP+EKMCLFVPPPN  V++TA
Sbjct: 952  SLVTGPCGNWFVSGSSRGVLTLWDLRFLIPVNSWKYSHVCPVEKMCLFVPPPNVTVTSTA 1011

Query: 1051 RPLIYVAAGCNEVSLWNAENGSCHQVLRTANYDGDTEMSDLPWAFARPSSRSNPKTDLRR 1110
            RPLIYVAAG NEVSLWNAE GSCHQV+R ANYD + EMSD+PWA ARPSS++N K D+RR
Sbjct: 1012 RPLIYVAAGSNEVSLWNAETGSCHQVMRVANYDNE-EMSDIPWALARPSSKTNLKLDVRR 1070

Query: 1111 NVNQKYRVDELNEPPPRLLGIRSLLPLPGGDLLTGGTDLKIRRWDHCSPGRSYCICGPNL 1170
            NV  KYRV+ELNEPPPR  GIR++LPLPGGDLLTGGTDLKIRRWDH SP RSYCI GPNL
Sbjct: 1071 NVKPKYRVEELNEPPPRFPGIRAMLPLPGGDLLTGGTDLKIRRWDHFSPDRSYCISGPNL 1130

Query: 1171 KGVGNDEFYETRSSSGVQVVQERKRQPLTSKLTAKAVLAAAATDSAGCHRDSILSLGSVK 1230
             G GND  YETRSS GVQ+VQE KR+ LT+KLTAK VLAAAATDSAGCHRDSILSL SVK
Sbjct: 1131 NGAGNDNPYETRSSFGVQIVQETKRRHLTAKLTAKQVLAAAATDSAGCHRDSILSLASVK 1190

Query: 1231 LNQRLLISSSRDGAIKVWK 1249
            LNQRLLISSSRDGAIKVWK
Sbjct: 1191 LNQRLLISSSRDGAIKVWK 1209

Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|359484532|ref|XP_002280317.2| PREDICTED: phosphoinositide 3-kinase regulatory subunit 4-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|255546297|ref|XP_002514208.1| ATP binding protein, putative [Ricinus communis] gi|223546664|gb|EEF48162.1| ATP binding protein, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|356497575|ref|XP_003517635.1| PREDICTED: phosphoinositide 3-kinase regulatory subunit 4-like [Glycine max] Back     alignment and taxonomy information
>gi|356520822|ref|XP_003529059.1| PREDICTED: phosphoinositide 3-kinase regulatory subunit 4-like [Glycine max] Back     alignment and taxonomy information
>gi|449435788|ref|XP_004135676.1| PREDICTED: phosphoinositide 3-kinase regulatory subunit 4-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|449489804|ref|XP_004158421.1| PREDICTED: LOW QUALITY PROTEIN: phosphoinositide 3-kinase regulatory subunit 4-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|297803098|ref|XP_002869433.1| kinase family protein [Arabidopsis lyrata subsp. lyrata] gi|297315269|gb|EFH45692.1| kinase family protein [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|15233564|ref|NP_194667.1| phosphoinositide-3-kinase, regulatory subunit 4, p150 [Arabidopsis thaliana] gi|7269836|emb|CAB79696.1| putative protein [Arabidopsis thaliana] gi|332660224|gb|AEE85624.1| phosphoinositide-3-kinase, regulatory subunit 4, p150 [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|297738742|emb|CBI27987.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query1249
TAIR|locus:21182341494 VPS15 "vacuolar protein sortin 0.914 0.764 0.671 0.0
UNIPROTKB|E2QZF51358 PIK3R4 "Uncharacterized protei 0.296 0.272 0.339 6.8e-85
ZFIN|ZDB-GENE-050309-841386 pik3r4 "phosphoinositide-3-kin 0.294 0.265 0.338 1.7e-84
MGI|MGI:19229191358 Pik3r4 "phosphatidylinositol 3 0.294 0.270 0.340 2.6e-84
RGD|13118091358 Pik3r4 "phosphoinositide-3-kin 0.296 0.272 0.336 5.5e-84
DICTYBASE|DDB_G0282627 1966 vps15 "VPS15 family protein ki 0.285 0.181 0.325 1.4e-83
UNIPROTKB|Q995701358 PIK3R4 "Phosphoinositide 3-kin 0.296 0.272 0.336 2.3e-83
UNIPROTKB|A6QLW11358 PIK3R4 "PIK3R4 protein" [Bos t 0.302 0.278 0.335 6.9e-83
UNIPROTKB|Q5R9I31358 PIK3R4 "Phosphoinositide 3-kin 0.296 0.272 0.334 4.1e-82
UNIPROTKB|I3LEJ81354 PIK3R4 "Uncharacterized protei 0.305 0.281 0.326 3.2e-80
TAIR|locus:2118234 VPS15 "vacuolar protein sorting 15" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 4015 (1418.4 bits), Expect = 0., Sum P(2) = 0.
 Identities = 780/1161 (67%), Positives = 923/1161 (79%)

Query:    99 GD--GKESNQCSNVKPMPEDVPNSTF-------SQDLRNSSVESSGELLQSISDAFRKNG 149
             GD  G +S   SN  PM       TF       S+DL  ++V S  E+  SISDA +KN 
Sbjct:   343 GDEIGVDSPVTSN--PMNASTVQETFANHKLNSSKDLIRNTVNSKDEIFYSISDALKKNR 400

Query:   150 HPFLKKITMNNLSSLMSEYDSQSDTFGMPFLPLPEDSMKCEGIVLIASLLCSCVRNVKLP 209
             HPFLKKITM++L +LMS YDS+SDT+G PFLP+ E +M+CEG+VLIAS+LCSC+RN+KLP
Sbjct:   401 HPFLKKITMDDLGTLMSLYDSRSDTYGTPFLPV-EGNMRCEGMVLIASMLCSCIRNIKLP 459

Query:   210 HYRRAAILLLKSSSLFIDDEDRLQRVLPHVIAMLSDPAAIVRCAALETLCDILPLVRNFP 269
             H RR AILLL+S SL+IDD+DRLQRVLP+V+A+LSDP AIVRCAA+ETLCDILPLVR+FP
Sbjct:   460 HLRREAILLLRSCSLYIDDDDRLQRVLPYVVALLSDPTAIVRCAAMETLCDILPLVRDFP 519

Query:   270 PSDAKIFPEYILPMLSMLPDDPEESVRICYASNIAKLALTAYGFLVHSIRLSEAGVLDKL 329
             PSDAKIFPEYI PMLSMLP+D EESVRICYASNIAKLALTAYGFL+HS +LS+ GVL++L
Sbjct:   520 PSDAKIFPEYIFPMLSMLPEDTEESVRICYASNIAKLALTAYGFLIHSFQLSDVGVLNEL 579

Query:   330 SAPHKSPSSSNETSVQLQRLNADVQLSQLRKSIAEVVQELVMGPKQTPSIRRALLQDIGN 389
             ++   S + ++ET   LQ+ N + QL QLRK+IAEVVQELVMGPKQTP++RRALLQDIG 
Sbjct:   580 NSQQISTTPASETPSHLQKANGNAQLQQLRKTIAEVVQELVMGPKQTPNVRRALLQDIGE 639

Query:   390 LCSFFGQRQSNDFLLPILPAFLNDRDEQLRAVFYGQIVYVCFFVGERSVEEYLLPYIEQA 449
             LC FFGQRQSNDFLLPILPAFLNDRDEQLR+VF+ +IVYVCFFVG+RSVEEYLLPYI+QA
Sbjct:   640 LCFFFGQRQSNDFLLPILPAFLNDRDEQLRSVFFEKIVYVCFFVGQRSVEEYLLPYIDQA 699

Query:   450 LSDATEAVIVNALDCLAILCKSGYLRKRILLEMIERAFPLLCYPSQWVRRSVVTFIAASS 509
             LSD TEAVIVNAL+CL+ LCKS +LRKR LL+MIE  +PLLCYPSQWVRR+VVTFIAASS
Sbjct:   700 LSDQTEAVIVNALECLSTLCKSSFLRKRALLQMIECVYPLLCYPSQWVRRAVVTFIAASS 759

Query:   510 ESLGAVDSYVFLAPVIRPFLRRQPASLASVKALLSCLKPPVSREVFYQVLENARSSDMLE 569
             E LGAVDSY F+APVIR +L R PAS+AS + LLSCLKPPV+REV Y++ E  R+ + + 
Sbjct:   760 ECLGAVDSYAFIAPVIRSYLSRLPASIASEEGLLSCLKPPVTREVVYRIFEKTRNPEFMA 819

Query:   570 RQRKIWYNTSSQSKQQETADLLKRGAEDLSSIKCWPDKQQSSEGHRPAGDTSKQPEFAQS 629
             +QRK+WY++S QSK  E+ DL  + A +L+S++C  +++QS EG +     SKQPE    
Sbjct:   820 KQRKMWYSSSPQSKDWESVDLFDKDAGELNSVECRAEQKQSVEGKKQIKSASKQPEVQGK 879

Query:   630 DDNDGAKLRTLGSLVYNASSMADIRDPLCPEKLLFSGFMSQQVSGVNSLRCDKSSEGIPL 689
                  AKLR   +   NAS+  ++RDP+ PEKL FSGFM+  VSG NS       E IPL
Sbjct:   880 YAEKDAKLRIPRNPRPNASNTVELRDPVYPEKLQFSGFMAPYVSGANSFI---EPENIPL 936

Query:   690 YSFSMDKRAMGNLPVASDSVLQVNSLGIGSSTMPWMDTTNQSFSLASSVPPPNLVSGSFS 749
             YSFSMDKRA  N PVAS+S LQ+NSLG+GS ++PWMD+ ++SF+LASSVP P L+SGSF 
Sbjct:   937 YSFSMDKRAATNPPVASESSLQMNSLGMGSLSVPWMDSMSKSFNLASSVPVPKLISGSFH 996

Query:   750 ISNGSKQFYRVVHEPEGRENDQMASVNCKFPEMGTSGTAKGSSINVEDASSPADLTGLPS 809
             +    KQFYRVVHEPE RENDQ++S   KF ++G S ++K +S+  EDASSPADL G PS
Sbjct:   997 VGTNPKQFYRVVHEPESRENDQISSAISKFQDLGVSSSSKSASVTSEDASSPADLVGEPS 1056

Query:   810 FVRTSSIPDSGWRPRGILVAHLQEHCSAVNEIAISHDHSFFVSASDDSTVKVWDSRKLEK 869
               RTS +PDSGW+PRG+LVAHLQEH SAVN+IA S DHSFFVSASDDSTVKVWDSRKLEK
Sbjct:  1057 LSRTS-VPDSGWKPRGVLVAHLQEHRSAVNDIATSSDHSFFVSASDDSTVKVWDSRKLEK 1115

Query:   870 DISFRSRLTYHLEGSRALCTMMLRHSAQVVVGACDGIIHMFSVDHISRGLGNV-EKYSGI 928
             DISFRSRLTYHLEGSR +CT MLR+S QVVVGA DG+IHMFS+DHISRGLGNV EKYSGI
Sbjct:  1116 DISFRSRLTYHLEGSRGMCTTMLRNSTQVVVGASDGVIHMFSIDHISRGLGNVVEKYSGI 1175

Query:   929 SDIKKKDTKEGAIVTLVNYNTDNCASHMFMYSTQNCGIHLWDTRSNSNTWTLKAIPEEGY 988
              DIKKKD KEGA+V+L+NY  D+ +  M MYSTQNCGIHLWDTRS+ + WTLKA PEEGY
Sbjct:  1176 VDIKKKDVKEGALVSLLNYTADSLSGPMVMYSTQNCGIHLWDTRSDLDAWTLKANPEEGY 1235

Query:   989 VSSLVTGPCGNWFVSGSSRGVLTLWDLRFLVPVNSWQYSQVCPIEKMCLFVPPPNAAVST 1048
             VSSLVT PCGNWFVSGSSRGVLTLWDLRF VPVNSWQY  +CPIEKMCL   PP+ +VST
Sbjct:  1236 VSSLVTSPCGNWFVSGSSRGVLTLWDLRFRVPVNSWQYPIICPIEKMCLCFLPPSVSVST 1295

Query:  1049 TARPLIYVAAGCNEVSLWNAENGSCHQVLRTANYDGDTEMSDLPWAFARPSSRSNPKTDL 1108
             T +PLIYVAAGCNEVSLWNAE GSCHQVLR ANY+ +T++S+  W    PS++ NPK + 
Sbjct:  1296 TMKPLIYVAAGCNEVSLWNAEGGSCHQVLRVANYENETDVSEFQWKL--PSNKVNPKPNH 1353

Query:  1109 RRNVNQKYRVDELNEPPPRLLGIRSXXXXXXXXXXXXXXXXKIRRWDHCSPGRSYCICGP 1168
             R+N++ KYR++ELNEPPPRL GIRS                KIRRWD+ SP RSYCICGP
Sbjct:  1354 RQNMSSKYRIEELNEPPPRLPGIRSLLPLPGGDLLTGGTDLKIRRWDYSSPERSYCICGP 1413

Query:  1169 NLKGVGNDEFYETRSSSGVQVVQERKRQPXXXXXXXXXXXXXXXXXXXGCHRDSILSLGS 1228
             +LKGVGND+FYE ++++GVQ VQE KR+P                   GCHRDS+ SL S
Sbjct:  1414 SLKGVGNDDFYELKTNTGVQFVQETKRRPLATKLTAKAVLAAAATDTAGCHRDSVQSLAS 1473

Query:  1229 VKLNQRLLISSSRDGAIKVWK 1249
             VKLNQRLLISSSRDGAIKVWK
Sbjct:  1474 VKLNQRLLISSSRDGAIKVWK 1494
GO:0004672 "protein kinase activity" evidence=IEA;ISS
GO:0004674 "protein serine/threonine kinase activity" evidence=IEA
GO:0005524 "ATP binding" evidence=IEA;ISS
GO:0005794 "Golgi apparatus" evidence=ISM
GO:0006468 "protein phosphorylation" evidence=IEA;ISS
GO:0016772 "transferase activity, transferring phosphorus-containing groups" evidence=IEA
GO:0080008 "Cul4-RING ubiquitin ligase complex" evidence=ISS
GO:0005737 "cytoplasm" evidence=IDA
GO:0009555 "pollen development" evidence=IMP
GO:0009846 "pollen germination" evidence=IMP
GO:0000303 "response to superoxide" evidence=RCA
GO:0006635 "fatty acid beta-oxidation" evidence=RCA
GO:0006869 "lipid transport" evidence=RCA
GO:0006891 "intra-Golgi vesicle-mediated transport" evidence=RCA
GO:0007165 "signal transduction" evidence=RCA
GO:0008219 "cell death" evidence=RCA
GO:0009630 "gravitropism" evidence=RCA
GO:0009755 "hormone-mediated signaling pathway" evidence=RCA
GO:0009863 "salicylic acid mediated signaling pathway" evidence=RCA
GO:0009873 "ethylene mediated signaling pathway" evidence=RCA
GO:0010351 "lithium ion transport" evidence=RCA
GO:0016558 "protein import into peroxisome matrix" evidence=RCA
GO:0044265 "cellular macromolecule catabolic process" evidence=RCA
GO:0048573 "photoperiodism, flowering" evidence=RCA
UNIPROTKB|E2QZF5 PIK3R4 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-050309-84 pik3r4 "phosphoinositide-3-kinase, regulatory subunit 4" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
MGI|MGI:1922919 Pik3r4 "phosphatidylinositol 3 kinase, regulatory subunit, polypeptide 4, p150" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
RGD|1311809 Pik3r4 "phosphoinositide-3-kinase, regulatory subunit 4" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
DICTYBASE|DDB_G0282627 vps15 "VPS15 family protein kinase Vps15" [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms
UNIPROTKB|Q99570 PIK3R4 "Phosphoinositide 3-kinase regulatory subunit 4" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|A6QLW1 PIK3R4 "PIK3R4 protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|Q5R9I3 PIK3R4 "Phosphoinositide 3-kinase regulatory subunit 4" [Pongo abelii (taxid:9601)] Back     alignment and assigned GO terms
UNIPROTKB|I3LEJ8 PIK3R4 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
grail3.0151000801
hypothetical protein (1209 aa)
(Populus trichocarpa)
Predicted Functional Partners:
fgenesh4_pm.C_LG_XII000263
hypothetical protein (810 aa)
    ••• 0.934

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query1249
cd00200289 cd00200, WD40, WD40 domain, found in a number of e 4e-13
pfam0040039 pfam00400, WD40, WD domain, G-beta repeat 1e-07
COG2319466 COG2319, COG2319, FOG: WD40 repeat [General functi 2e-07
smart0032040 smart00320, WD40, WD40 repeats 2e-07
COG2319466 COG2319, COG2319, FOG: WD40 repeat [General functi 2e-06
cd00200289 cd00200, WD40, WD40 domain, found in a number of e 3e-06
pfam0298531 pfam02985, HEAT, HEAT repeat 0.003
>gnl|CDD|238121 cd00200, WD40, WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and bottom surface of the propeller are proposed to coordinate interactions with other proteins and/or small ligands; 7 copies of the repeat are present in this alignment Back     alignment and domain information 
 Score = 71.2 bits (175), Expect = 4e-13
 Identities = 57/259 (22%), Positives = 97/259 (37%), Gaps = 46/259 (17%)

Query: 825  GILVAHLQEHCSAVNEIAISHDHSFFVSASDDSTVKVWDSRKLEKDISFRSRLTYHLEGS 884
            G L+  L+ H   V ++A S D ++  S S D T+++WD    E   +       H    
Sbjct: 41   GELLRTLKGHTGPVRDVAASADGTYLASGSSDKTIRLWDLETGECVRTLTG----HTS-- 94

Query: 885  RALCTMMLRHSAQVVVGA-CDGIIHMFSVDHISRGLGNVEKYSGISDIK-KKDTKEGAIV 942
              + ++      +++  +  D  I ++          +VE    ++ ++   D      V
Sbjct: 95   -YVSSVAFSPDGRILSSSSRDKTIKVW----------DVETGKCLTTLRGHTDW-----V 138

Query: 943  TLVNYNTDNCASHMFMYSTQNCGIHLWDTRSNSNTWTLKAIPEEGYVSSLVTGPCGNWFV 1002
              V ++ D         S+Q+  I LWD R+     TL      G V+S+   P G   +
Sbjct: 139  NSVAFSPDG---TFVASSSQDGTIKLWDLRTGKCVATLTG--HTGEVNSVAFSPDGEKLL 193

Query: 1003 SGSSRGVLTLWDLRFLVPVNSWQYSQVCPIEKMCLFVPPPNAAVSTTARPLIYVAAGCNE 1062
            S SS G + LWDL                 + +       N   S    P  Y+ A  +E
Sbjct: 194  SSSSDGTIKLWDLSTG--------------KCLGTLRGHENGVNSVAFSPDGYLLASGSE 239

Query: 1063 ---VSLWNAENGSCHQVLR 1078
               + +W+   G C Q L 
Sbjct: 240  DGTIRVWDLRTGECVQTLS 258

Length = 289
>gnl|CDD|201208 pfam00400, WD40, WD domain, G-beta repeat Back     alignment and domain information
>gnl|CDD|225201 COG2319, COG2319, FOG: WD40 repeat [General function prediction only] Back     alignment and domain information
>gnl|CDD|197651 smart00320, WD40, WD40 repeats Back     alignment and domain information
>gnl|CDD|225201 COG2319, COG2319, FOG: WD40 repeat [General function prediction only] Back     alignment and domain information
>gnl|CDD|238121 cd00200, WD40, WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and bottom surface of the propeller are proposed to coordinate interactions with other proteins and/or small ligands; 7 copies of the repeat are present in this alignment Back     alignment and domain information
>gnl|CDD|202500 pfam02985, HEAT, HEAT repeat Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 1249
KOG12401431 consensus Protein kinase containing WD40 repeats [ 100.0
KOG0271480 consensus Notchless-like WD40 repeat-containing pr 100.0
KOG0271480 consensus Notchless-like WD40 repeat-containing pr 100.0
KOG0272459 consensus U4/U6 small nuclear ribonucleoprotein Pr 100.0
KOG0272459 consensus U4/U6 small nuclear ribonucleoprotein Pr 100.0
KOG0286343 consensus G-protein beta subunit [General function 100.0
KOG0295406 consensus WD40 repeat-containing protein [Function 100.0
KOG0285460 consensus Pleiotropic regulator 1 [RNA processing 100.0
KOG0279315 consensus G protein beta subunit-like protein [Sig 100.0
KOG0279315 consensus G protein beta subunit-like protein [Sig 100.0
KOG0315311 consensus G-protein beta subunit-like protein (con 99.98
KOG0315311 consensus G-protein beta subunit-like protein (con 99.98
KOG0286343 consensus G-protein beta subunit [General function 99.97
KOG0319 775 consensus WD40-repeat-containing subunit of the 18 99.97
KOG0319 775 consensus WD40-repeat-containing subunit of the 18 99.97
cd00200289 WD40 WD40 domain, found in a number of eukaryotic 99.97
KOG0265338 consensus U5 snRNP-specific protein-like factor an 99.97
KOG0284464 consensus Polyadenylation factor I complex, subuni 99.97
KOG0296399 consensus Angio-associated migratory cell protein 99.97
KOG0291 893 consensus WD40-repeat-containing subunit of the 18 99.97
KOG0318603 consensus WD40 repeat stress protein/actin interac 99.97
KOG0318603 consensus WD40 repeat stress protein/actin interac 99.97
KOG0282503 consensus mRNA splicing factor [Function unknown] 99.97
KOG0266456 consensus WD40 repeat-containing protein [General 99.97
KOG0273524 consensus Beta-transducin family (WD-40 repeat) pr 99.97
KOG0273524 consensus Beta-transducin family (WD-40 repeat) pr 99.96
KOG0211759 consensus Protein phosphatase 2A regulatory subuni 99.96
KOG0284464 consensus Polyadenylation factor I complex, subuni 99.96
KOG0645312 consensus WD40 repeat protein [General function pr 99.96
KOG0293519 consensus WD40 repeat-containing protein [Function 99.96
PLN00181793 protein SPA1-RELATED; Provisional 99.96
KOG0281499 consensus Beta-TrCP (transducin repeats containing 99.96
KOG0263707 consensus Transcription initiation factor TFIID, s 99.96
KOG0263707 consensus Transcription initiation factor TFIID, s 99.96
KOG0306 888 consensus WD40-repeat-containing subunit of the 18 99.96
KOG0295406 consensus WD40 repeat-containing protein [Function 99.96
KOG0285460 consensus Pleiotropic regulator 1 [RNA processing 99.96
KOG0291 893 consensus WD40-repeat-containing subunit of the 18 99.96
KOG0275508 consensus Conserved WD40 repeat-containing protein 99.95
KOG0316307 consensus Conserved WD40 repeat-containing protein 99.95
KOG0645312 consensus WD40 repeat protein [General function pr 99.95
KOG0266456 consensus WD40 repeat-containing protein [General 99.95
KOG0276 794 consensus Vesicle coat complex COPI, beta' subunit 99.95
KOG0293519 consensus WD40 repeat-containing protein [Function 99.95
cd00200289 WD40 WD40 domain, found in a number of eukaryotic 99.95
KOG0640430 consensus mRNA cleavage stimulating factor complex 99.95
KOG0278334 consensus Serine/threonine kinase receptor-associa 99.95
KOG0296399 consensus Angio-associated migratory cell protein 99.95
KOG0643327 consensus Translation initiation factor 3, subunit 99.94
KOG0313423 consensus Microtubule binding protein YTM1 (contai 99.94
KOG0292 1202 consensus Vesicle coat complex COPI, alpha subunit 99.94
KOG0281499 consensus Beta-TrCP (transducin repeats containing 99.94
KOG0643327 consensus Translation initiation factor 3, subunit 99.94
KOG0276 794 consensus Vesicle coat complex COPI, beta' subunit 99.94
KOG0292 1202 consensus Vesicle coat complex COPI, alpha subunit 99.94
KOG0278334 consensus Serine/threonine kinase receptor-associa 99.94
KOG0313423 consensus Microtubule binding protein YTM1 (contai 99.94
KOG0288459 consensus WD40 repeat protein TipD [General functi 99.94
KOG0265338 consensus U5 snRNP-specific protein-like factor an 99.93
KOG0282503 consensus mRNA splicing factor [Function unknown] 99.93
KOG0316307 consensus Conserved WD40 repeat-containing protein 99.93
KOG0306 888 consensus WD40-repeat-containing subunit of the 18 99.93
KOG0268433 consensus Sof1-like rRNA processing protein (conta 99.93
PLN00181793 protein SPA1-RELATED; Provisional 99.93
KOG0772 641 consensus Uncharacterized conserved protein, conta 99.93
KOG1407313 consensus WD40 repeat protein [Function unknown] 99.92
KOG0275508 consensus Conserved WD40 repeat-containing protein 99.92
KOG0305484 consensus Anaphase promoting complex, Cdc20, Cdh1, 99.92
KOG0274537 consensus Cdc4 and related F-box and WD-40 protein 99.92
KOG0274537 consensus Cdc4 and related F-box and WD-40 protein 99.92
KOG0283712 consensus WD40 repeat-containing protein [Function 99.92
KOG0277311 consensus Peroxisomal targeting signal type 2 rece 99.92
KOG0973 942 consensus Histone transcription regulator HIRA, WD 99.92
KOG1446311 consensus Histone H3 (Lys4) methyltransferase comp 99.92
KOG0300481 consensus WD40 repeat-containing protein [Function 99.91
KOG0310 487 consensus Conserved WD40 repeat-containing protein 99.91
KOG0640430 consensus mRNA cleavage stimulating factor complex 99.91
KOG0299479 consensus U3 snoRNP-associated protein (contains W 99.91
KOG0300481 consensus WD40 repeat-containing protein [Function 99.91
KOG0641350 consensus WD40 repeat protein [General function pr 99.91
PTZ00421 493 coronin; Provisional 99.91
KOG0305484 consensus Anaphase promoting complex, Cdc20, Cdh1, 99.9
KOG0288459 consensus WD40 repeat protein TipD [General functi 99.9
KOG0289506 consensus mRNA splicing factor [General function p 99.9
KOG0641350 consensus WD40 repeat protein [General function pr 99.9
PTZ00421493 coronin; Provisional 99.9
KOG0277311 consensus Peroxisomal targeting signal type 2 rece 99.9
KOG0289506 consensus mRNA splicing factor [General function p 99.9
KOG0301 745 consensus Phospholipase A2-activating protein (con 99.9
KOG0283 712 consensus WD40 repeat-containing protein [Function 99.89
KOG0308 735 consensus Conserved WD40 repeat-containing protein 99.89
KOG0268433 consensus Sof1-like rRNA processing protein (conta 99.89
KOG1539 910 consensus WD repeat protein [General function pred 99.89
PTZ00420 568 coronin; Provisional 99.89
KOG0308 735 consensus Conserved WD40 repeat-containing protein 99.89
PTZ00420568 coronin; Provisional 99.89
KOG1408 1080 consensus WD40 repeat protein [Function unknown] 99.89
KOG0294362 consensus WD40 repeat-containing protein [Function 99.88
KOG2096420 consensus WD40 repeat protein [General function pr 99.88
KOG0647347 consensus mRNA export protein (contains WD40 repea 99.88
KOG12401431 consensus Protein kinase containing WD40 repeats [ 99.88
KOG0294362 consensus WD40 repeat-containing protein [Function 99.88
KOG0973 942 consensus Histone transcription regulator HIRA, WD 99.88
KOG0301 745 consensus Phospholipase A2-activating protein (con 99.87
KOG0264422 consensus Nucleosome remodeling factor, subunit CA 99.87
KOG0310487 consensus Conserved WD40 repeat-containing protein 99.87
KOG0639705 consensus Transducin-like enhancer of split protei 99.87
KOG1539 910 consensus WD repeat protein [General function pred 99.87
KOG0772641 consensus Uncharacterized conserved protein, conta 99.87
KOG1407313 consensus WD40 repeat protein [Function unknown] 99.87
KOG1036323 consensus Mitotic spindle checkpoint protein BUB3, 99.86
KOG0646 476 consensus WD40 repeat protein [General function pr 99.86
KOG0299479 consensus U3 snoRNP-associated protein (contains W 99.86
KOG0269 839 consensus WD40 repeat-containing protein [Function 99.85
KOG1446311 consensus Histone H3 (Lys4) methyltransferase comp 99.85
KOG2055514 consensus WD40 repeat protein [General function pr 99.85
KOG2048 691 consensus WD40 repeat protein [General function pr 99.84
KOG0264422 consensus Nucleosome remodeling factor, subunit CA 99.84
KOG0647347 consensus mRNA export protein (contains WD40 repea 99.84
KOG1274 933 consensus WD40 repeat protein [General function pr 99.83
KOG4283397 consensus Transcription-coupled repair protein CSA 99.83
KOG2048 691 consensus WD40 repeat protein [General function pr 99.83
KOG1332299 consensus Vesicle coat complex COPII, subunit SEC1 99.83
KOG2445361 consensus Nuclear pore complex component (sc Seh1) 99.83
KOG2106 626 consensus Uncharacterized conserved protein, conta 99.83
KOG0267 825 consensus Microtubule severing protein katanin p80 99.82
KOG2106626 consensus Uncharacterized conserved protein, conta 99.82
KOG4328498 consensus WD40 protein [Function unknown] 99.82
KOG1332299 consensus Vesicle coat complex COPII, subunit SEC1 99.82
KOG1036323 consensus Mitotic spindle checkpoint protein BUB3, 99.82
TIGR03866300 PQQ_ABC_repeats PQQ-dependent catabolism-associate 99.82
KOG4283397 consensus Transcription-coupled repair protein CSA 99.82
KOG2445361 consensus Nuclear pore complex component (sc Seh1) 99.81
KOG1063 764 consensus RNA polymerase II elongator complex, sub 99.81
KOG0269 839 consensus WD40 repeat-containing protein [Function 99.81
TIGR03866300 PQQ_ABC_repeats PQQ-dependent catabolism-associate 99.8
KOG0267 825 consensus Microtubule severing protein katanin p80 99.8
KOG0321 720 consensus WD40 repeat-containing protein L2DTL [Fu 99.8
KOG0650733 consensus WD40 repeat nucleolar protein Bop1, invo 99.8
KOG1273405 consensus WD40 repeat protein [General function pr 99.79
KOG0302440 consensus Ribosome Assembly protein [General funct 99.79
KOG1063 764 consensus RNA polymerase II elongator complex, sub 99.79
KOG1408 1080 consensus WD40 repeat protein [Function unknown] 99.78
KOG0646476 consensus WD40 repeat protein [General function pr 99.78
KOG2055514 consensus WD40 repeat protein [General function pr 99.78
KOG0321 720 consensus WD40 repeat-containing protein L2DTL [Fu 99.77
KOG15171387 consensus Guanine nucleotide binding protein MIP1 99.77
KOG0639705 consensus Transducin-like enhancer of split protei 99.77
KOG1274 933 consensus WD40 repeat protein [General function pr 99.77
KOG0307 1049 consensus Vesicle coat complex COPII, subunit SEC3 99.76
KOG4227 609 consensus WD40 repeat protein [General function pr 99.75
KOG4378 673 consensus Nuclear protein COP1 [Signal transductio 99.74
KOG2919406 consensus Guanine nucleotide-binding protein [Gene 99.74
KOG2096420 consensus WD40 repeat protein [General function pr 99.74
KOG0307 1049 consensus Vesicle coat complex COPII, subunit SEC3 99.73
KOG0642577 consensus Cell-cycle nuclear protein, contains WD- 99.73
KOG0270463 consensus WD40 repeat-containing protein [Function 99.73
KOG1188376 consensus WD40 repeat protein [General function pr 99.73
KOG1273405 consensus WD40 repeat protein [General function pr 99.72
KOG0270463 consensus WD40 repeat-containing protein [Function 99.71
KOG0211759 consensus Protein phosphatase 2A regulatory subuni 99.7
KOG4378 673 consensus Nuclear protein COP1 [Signal transductio 99.69
KOG1538 1081 consensus Uncharacterized conserved protein WDR10, 99.69
KOG0322323 consensus G-protein beta subunit-like protein GNB1 99.69
KOG1034385 consensus Transcriptional repressor EED/ESC/FIE, r 99.69
KOG1445 1012 consensus Tumor-specific antigen (contains WD repe 99.69
KOG0302440 consensus Ribosome Assembly protein [General funct 99.69
KOG4328498 consensus WD40 protein [Function unknown] 99.69
KOG1007370 consensus WD repeat protein TSSC1, WD repeat super 99.68
KOG1963 792 consensus WD40 repeat protein [General function pr 99.67
KOG1538 1081 consensus Uncharacterized conserved protein WDR10, 99.67
KOG0650733 consensus WD40 repeat nucleolar protein Bop1, invo 99.67
KOG0303472 consensus Actin-binding protein Coronin, contains 99.66
KOG1007370 consensus WD repeat protein TSSC1, WD repeat super 99.66
KOG1310 758 consensus WD40 repeat protein [General function pr 99.65
KOG1009434 consensus Chromatin assembly complex 1 subunit B/C 99.65
COG2319466 FOG: WD40 repeat [General function prediction only 99.65
KOG0642577 consensus Cell-cycle nuclear protein, contains WD- 99.63
COG2319466 FOG: WD40 repeat [General function prediction only 99.63
KOG0649325 consensus WD40 repeat protein [General function pr 99.6
KOG1034385 consensus Transcriptional repressor EED/ESC/FIE, r 99.6
KOG0649325 consensus WD40 repeat protein [General function pr 99.59
KOG0303472 consensus Actin-binding protein Coronin, contains 99.59
KOG1334559 consensus WD40 repeat protein [General function pr 99.59
KOG2919406 consensus Guanine nucleotide-binding protein [Gene 99.58
KOG0644 1113 consensus Uncharacterized conserved protein, conta 99.58
KOG1188376 consensus WD40 repeat protein [General function pr 99.58
KOG1587555 consensus Cytoplasmic dynein intermediate chain [C 99.57
PRK11028330 6-phosphogluconolactonase; Provisional 99.57
KOG1009434 consensus Chromatin assembly complex 1 subunit B/C 99.56
KOG1587555 consensus Cytoplasmic dynein intermediate chain [C 99.55
KOG14451012 consensus Tumor-specific antigen (contains WD repe 99.52
KOG15171387 consensus Guanine nucleotide binding protein MIP1 99.52
KOG2110391 consensus Uncharacterized conserved protein, conta 99.5
KOG0290364 consensus Conserved WD40 repeat-containing protein 99.49
KOG1523361 consensus Actin-related protein Arp2/3 complex, su 99.48
KOG0771398 consensus Prolactin regulatory element-binding pro 99.47
PRK11028330 6-phosphogluconolactonase; Provisional 99.46
PRK01742429 tolB translocation protein TolB; Provisional 99.45
KOG1963 792 consensus WD40 repeat protein [General function pr 99.44
KOG0644 1113 consensus Uncharacterized conserved protein, conta 99.43
KOG0771398 consensus Prolactin regulatory element-binding pro 99.42
KOG0322323 consensus G-protein beta subunit-like protein GNB1 99.42
KOG4227 609 consensus WD40 repeat protein [General function pr 99.38
KOG2110 391 consensus Uncharacterized conserved protein, conta 99.36
KOG1523361 consensus Actin-related protein Arp2/3 complex, su 99.34
KOG1524 737 consensus WD40 repeat-containing protein CHE-2 [Ge 99.33
KOG1524 737 consensus WD40 repeat-containing protein CHE-2 [Ge 99.33
KOG2321 703 consensus WD40 repeat protein [General function pr 99.33
KOG0290364 consensus Conserved WD40 repeat-containing protein 99.32
KOG2139445 consensus WD40 repeat protein [General function pr 99.31
KOG3881412 consensus Uncharacterized conserved protein [Funct 99.3
PRK01742429 tolB translocation protein TolB; Provisional 99.28
KOG1409404 consensus Uncharacterized conserved protein, conta 99.27
KOG41901034 consensus Uncharacterized conserved protein [Funct 99.26
KOG2111346 consensus Uncharacterized conserved protein, conta 99.26
PRK13800897 putative oxidoreductase/HEAT repeat-containing pro 99.25
PRK02889427 tolB translocation protein TolB; Provisional 99.24
KOG1272545 consensus WD40-repeat-containing subunit of the 18 99.23
KOG1272545 consensus WD40-repeat-containing subunit of the 18 99.22
PRK03629429 tolB translocation protein TolB; Provisional 99.22
PRK04922433 tolB translocation protein TolB; Provisional 99.21
KOG1334559 consensus WD40 repeat protein [General function pr 99.2
PRK05137435 tolB translocation protein TolB; Provisional 99.19
KOG2394636 consensus WD40 protein DMR-N9 [General function pr 99.19
KOG4497447 consensus Uncharacterized conserved protein WDR8, 99.18
KOG10642439 consensus RAVE (regulator of V-ATPase assembly) co 99.13
KOG1310 758 consensus WD40 repeat protein [General function pr 99.12
KOG4497447 consensus Uncharacterized conserved protein WDR8, 99.12
PF02239369 Cytochrom_D1: Cytochrome D1 heme domain; PDB: 1NNO 99.11
KOG2394636 consensus WD40 protein DMR-N9 [General function pr 99.11
PRK13800897 putative oxidoreductase/HEAT repeat-containing pro 99.11
PRK03629429 tolB translocation protein TolB; Provisional 99.09
KOG0974 967 consensus WD-repeat protein WDR6, WD repeat superf 99.09
PRK09687280 putative lyase; Provisional 99.06
KOG2139445 consensus WD40 repeat protein [General function pr 99.06
PF02239369 Cytochrom_D1: Cytochrome D1 heme domain; PDB: 1NNO 99.06
KOG3881412 consensus Uncharacterized conserved protein [Funct 99.05
KOG2111346 consensus Uncharacterized conserved protein, conta 99.05
PRK09687280 putative lyase; Provisional 99.05
PF08662194 eIF2A: Eukaryotic translation initiation factor eI 99.04
PF08662194 eIF2A: Eukaryotic translation initiation factor eI 98.98
KOG1354433 consensus Serine/threonine protein phosphatase 2A, 98.96
KOG0280339 consensus Uncharacterized conserved protein [Amino 98.95
PRK00178430 tolB translocation protein TolB; Provisional 98.95
KOG0974 967 consensus WD-repeat protein WDR6, WD repeat superf 98.94
TIGR02800417 propeller_TolB tol-pal system beta propeller repea 98.93
PRK05137435 tolB translocation protein TolB; Provisional 98.93
PRK04922433 tolB translocation protein TolB; Provisional 98.91
KOG1354433 consensus Serine/threonine protein phosphatase 2A, 98.9
PF10282345 Lactonase: Lactonase, 7-bladed beta-propeller; Int 98.89
KOG41901034 consensus Uncharacterized conserved protein [Funct 98.88
PRK04792448 tolB translocation protein TolB; Provisional 98.87
PRK02889427 tolB translocation protein TolB; Provisional 98.85
KOG4547 541 consensus WD40 repeat-containing protein [General 98.81
KOG21711075 consensus Karyopherin (importin) beta 3 [Nuclear s 98.8
KOG2315566 consensus Predicted translation initiation factor 98.79
KOG2315 566 consensus Predicted translation initiation factor 98.78
KOG10642439 consensus RAVE (regulator of V-ATPase assembly) co 98.75
KOG0309 1081 consensus Conserved WD40 repeat-containing protein 98.75
PRK01029428 tolB translocation protein TolB; Provisional 98.73
KOG0280339 consensus Uncharacterized conserved protein [Amino 98.71
KOG4547 541 consensus WD40 repeat-containing protein [General 98.71
TIGR02800417 propeller_TolB tol-pal system beta propeller repea 98.71
KOG2321 703 consensus WD40 repeat protein [General function pr 98.71
KOG1912 1062 consensus WD40 repeat protein [General function pr 98.7
TIGR03300377 assembly_YfgL outer membrane assembly lipoprotein 98.7
COG5354561 Uncharacterized protein, contains Trp-Asp (WD) rep 98.68
PF01602526 Adaptin_N: Adaptin N terminal region; InterPro: IP 98.68
KOG1409404 consensus Uncharacterized conserved protein, conta 98.67
KOG21711075 consensus Karyopherin (importin) beta 3 [Nuclear s 98.67
KOG2314698 consensus Translation initiation factor 3, subunit 98.65
COG2706346 3-carboxymuconate cyclase [Carbohydrate transport 98.64
TIGR02658352 TTQ_MADH_Hv methylamine dehydrogenase heavy chain. 98.62
PF10282345 Lactonase: Lactonase, 7-bladed beta-propeller; Int 98.6
KOG2041 1189 consensus WD40 repeat protein [General function pr 98.57
PRK01029428 tolB translocation protein TolB; Provisional 98.57
KOG3914390 consensus WD repeat protein WDR4 [Function unknown 98.57
PRK04792448 tolB translocation protein TolB; Provisional 98.57
PLN029191057 haloacid dehalogenase-like hydrolase family protei 98.54
PLN029191057 haloacid dehalogenase-like hydrolase family protei 98.54
PRK00178430 tolB translocation protein TolB; Provisional 98.53
TIGR03300377 assembly_YfgL outer membrane assembly lipoprotein 98.51
KOG1242569 consensus Protein containing adaptin N-terminal re 98.51
KOG1242569 consensus Protein containing adaptin N-terminal re 98.5
KOG4714319 consensus Nucleoporin [Nuclear structure] 98.5
PTZ00429746 beta-adaptin; Provisional 98.49
PF01602526 Adaptin_N: Adaptin N terminal region; InterPro: IP 98.49
PF04762 928 IKI3: IKI3 family; InterPro: IPR006849 Members of 98.45
KOG2041 1189 consensus WD40 repeat protein [General function pr 98.43
KOG02131172 consensus Splicing factor 3b, subunit 1 [RNA proce 98.42
PF0040039 WD40: WD domain, G-beta repeat; InterPro: IPR01978 98.41
PF04762 928 IKI3: IKI3 family; InterPro: IPR006849 Members of 98.39
KOG2023885 consensus Nuclear transport receptor Karyopherin-b 98.37
KOG4532344 consensus WD40-like repeat containing protein [Gen 98.37
KOG0309 1081 consensus Conserved WD40 repeat-containing protein 98.36
COG5181975 HSH155 U2 snRNP spliceosome subunit [RNA processin 98.36
KOG1912 1062 consensus WD40 repeat protein [General function pr 98.35
KOG3914390 consensus WD repeat protein WDR4 [Function unknown 98.33
KOG4714319 consensus Nucleoporin [Nuclear structure] 98.32
KOG0882 558 consensus Cyclophilin-related peptidyl-prolyl cis- 98.32
COG2706346 3-carboxymuconate cyclase [Carbohydrate transport 98.31
COG4946668 Uncharacterized protein related to the periplasmic 98.31
KOG2023885 consensus Nuclear transport receptor Karyopherin-b 98.28
PRK04043419 tolB translocation protein TolB; Provisional 98.27
PF15492282 Nbas_N: Neuroblastoma-amplified sequence, N termin 98.27
COG5354 561 Uncharacterized protein, contains Trp-Asp (WD) rep 98.26
PF13360238 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 98.25
TIGR02658352 TTQ_MADH_Hv methylamine dehydrogenase heavy chain. 98.24
KOG1241859 consensus Karyopherin (importin) beta 1 [Nuclear s 98.23
KOG2695425 consensus WD40 repeat protein [General function pr 98.19
COG4946668 Uncharacterized protein related to the periplasmic 98.18
KOG0882558 consensus Cyclophilin-related peptidyl-prolyl cis- 98.14
PF15492282 Nbas_N: Neuroblastoma-amplified sequence, N termin 98.14
PF10508503 Proteasom_PSMB: Proteasome non-ATPase 26S subunit; 98.13
KOG18241233 consensus TATA-binding protein-interacting protein 98.12
KOG18321516 consensus HIV-1 Vpr-binding protein [Cell cycle co 98.11
KOG4532344 consensus WD40-like repeat containing protein [Gen 98.11
PRK11138394 outer membrane biogenesis protein BamB; Provisiona 98.1
PF07433305 DUF1513: Protein of unknown function (DUF1513); In 98.08
PTZ00429746 beta-adaptin; Provisional 98.05
KOG1243690 consensus Protein kinase [General function predict 98.05
KOG2314698 consensus Translation initiation factor 3, subunit 98.05
PF12348228 CLASP_N: CLASP N terminal; InterPro: IPR024395 Thi 98.04
KOG2695425 consensus WD40 repeat protein [General function pr 98.01
PF13360238 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 97.98
PF08450246 SGL: SMP-30/Gluconolaconase/LRE-like region; Inter 97.96
PLN03200 2102 cellulose synthase-interactive protein; Provisiona 97.94
COG5170460 CDC55 Serine/threonine protein phosphatase 2A, reg 97.93
KOG1060968 consensus Vesicle coat complex AP-3, beta subunit 97.93
KOG2066 846 consensus Vacuolar assembly/sorting protein VPS41 97.86
PRK11138394 outer membrane biogenesis protein BamB; Provisiona 97.78
PRK04043419 tolB translocation protein TolB; Provisional 97.74
KOG2066 846 consensus Vacuolar assembly/sorting protein VPS41 97.73
KOG1645463 consensus RING-finger-containing E3 ubiquitin liga 97.73
PF0040039 WD40: WD domain, G-beta repeat; InterPro: IPR01978 97.72
PF08450246 SGL: SMP-30/Gluconolaconase/LRE-like region; Inter 97.72
KOG02131172 consensus Splicing factor 3b, subunit 1 [RNA proce 97.71
KOG2137700 consensus Protein kinase [Signal transduction mech 97.69
KOG1645463 consensus RING-finger-containing E3 ubiquitin liga 97.68
KOG1275 1118 consensus PAB-dependent poly(A) ribonuclease, subu 97.68
PF08596395 Lgl_C: Lethal giant larvae(Lgl) like, C-terminal; 97.68
PF07433305 DUF1513: Protein of unknown function (DUF1513); In 97.66
KOG2114 933 consensus Vacuolar assembly/sorting protein PEP5/V 97.65
KOG1275 1118 consensus PAB-dependent poly(A) ribonuclease, subu 97.64
KOG2259823 consensus Uncharacterized conserved protein [Funct 97.64
COG1413335 FOG: HEAT repeat [Energy production and conversion 97.63
COG5170460 CDC55 Serine/threonine protein phosphatase 2A, reg 97.61
KOG2137700 consensus Protein kinase [Signal transduction mech 97.6
KOG3617 1416 consensus WD40 and TPR repeat-containing protein [ 97.58
KOG4649354 consensus PQQ (pyrrolo-quinoline quinone) repeat p 97.58
PF10508503 Proteasom_PSMB: Proteasome non-ATPase 26S subunit; 97.57
KOG2025892 consensus Chromosome condensation complex Condensi 97.56
KOG2114 933 consensus Vacuolar assembly/sorting protein PEP5/V 97.56
PLN03200 2102 cellulose synthase-interactive protein; Provisiona 97.49
PF12717178 Cnd1: non-SMC mitotic condensation complex subunit 97.49
KOG0212675 consensus Uncharacterized conserved protein [Funct 97.49
KOG09151702 consensus Uncharacterized conserved protein [Funct 97.48
PF12348228 CLASP_N: CLASP N terminal; InterPro: IPR024395 Thi 97.47
KOG3617 1416 consensus WD40 and TPR repeat-containing protein [ 97.44
KOG4649354 consensus PQQ (pyrrolo-quinoline quinone) repeat p 97.44
TIGR02270410 conserved hypothetical protein. Members are found 97.43
COG1413335 FOG: HEAT repeat [Energy production and conversion 97.43
cd00216488 PQQ_DH Dehydrogenases with pyrrolo-quinoline quino 97.42
cd00020120 ARM Armadillo/beta-catenin-like repeats. An approx 97.39
COG5096757 Vesicle coat complex, various subunits [Intracellu 97.39
KOG1832 1516 consensus HIV-1 Vpr-binding protein [Cell cycle co 97.33
KOG3621 726 consensus WD40 repeat-containing protein [General 97.28
KOG1920 1265 consensus IkappaB kinase complex, IKAP component [ 97.27
PF04841410 Vps16_N: Vps16, N-terminal region; InterPro: IPR00 97.26
PF1275597 Vac14_Fab1_bd: Vacuolar 14 Fab1-binding region 97.23
COG5181975 HSH155 U2 snRNP spliceosome subunit [RNA processin 97.22
PF12717178 Cnd1: non-SMC mitotic condensation complex subunit 97.19
KOG1008 783 consensus Uncharacterized conserved protein, conta 97.19
KOG4653982 consensus Uncharacterized conserved protein [Funct 97.17
PF1364688 HEAT_2: HEAT repeats; PDB: 1OYZ_A 3FGA_A 2PF4_C 2I 97.16
TIGR02270410 conserved hypothetical protein. Members are found 97.15
smart0032040 WD40 WD40 repeats. Note that these repeats are per 97.12
KOG1243690 consensus Protein kinase [General function predict 97.12
PF1364688 HEAT_2: HEAT repeats; PDB: 1OYZ_A 3FGA_A 2PF4_C 2I 97.09
PF11768545 DUF3312: Protein of unknown function (DUF3312); In 97.09
PF0298531 HEAT: HEAT repeat; InterPro: IPR000357 The HEAT re 97.06
KOG0166514 consensus Karyopherin (importin) alpha [Intracellu 97.06
PF05918556 API5: Apoptosis inhibitory protein 5 (API5); Inter 97.04
KOG1241859 consensus Karyopherin (importin) beta 1 [Nuclear s 97.02
COG5218885 YCG1 Chromosome condensation complex Condensin, su 97.01
KOG4224550 consensus Armadillo repeat protein VAC8 required f 96.98
PF11768545 DUF3312: Protein of unknown function (DUF3312); In 96.96
PF06433342 Me-amine-dh_H: Methylamine dehydrogenase heavy cha 96.94
cd00020120 ARM Armadillo/beta-catenin-like repeats. An approx 96.94
PF06977248 SdiA-regulated: SdiA-regulated; InterPro: IPR00972 96.93
KOG1920 1265 consensus IkappaB kinase complex, IKAP component [ 96.92
PF1275597 Vac14_Fab1_bd: Vacuolar 14 Fab1-binding region 96.91
KOG1820815 consensus Microtubule-associated protein [Cytoskel 96.91
PRK02888 635 nitrous-oxide reductase; Validated 96.88
PF1351355 HEAT_EZ: HEAT-like repeat; PDB: 2Z5J_A 2OT8_B 2Z5O 96.86
KOG19491005 consensus Uncharacterized conserved protein [Funct 96.78
KOG0166514 consensus Karyopherin (importin) alpha [Intracellu 96.78
cd00216488 PQQ_DH Dehydrogenases with pyrrolo-quinoline quino 96.75
PF00930353 DPPIV_N: Dipeptidyl peptidase IV (DPP IV) N-termin 96.73
PF14783111 BBS2_Mid: Ciliary BBSome complex subunit 2, middle 96.7
PF08596395 Lgl_C: Lethal giant larvae(Lgl) like, C-terminal; 96.69
PF08553794 VID27: VID27 cytoplasmic protein; InterPro: IPR013 96.68
PF14783111 BBS2_Mid: Ciliary BBSome complex subunit 2, middle 96.64
KOG1820815 consensus Microtubule-associated protein [Cytoskel 96.62
KOG0212675 consensus Uncharacterized conserved protein [Funct 96.59
COG5215858 KAP95 Karyopherin (importin) beta [Intracellular t 96.56
PF04841410 Vps16_N: Vps16, N-terminal region; InterPro: IPR00 96.53
PF0298531 HEAT: HEAT repeat; InterPro: IPR000357 The HEAT re 96.52
PF00780275 CNH: CNH domain; InterPro: IPR001180 Based on sequ 96.47
KOG09151702 consensus Uncharacterized conserved protein [Funct 96.46
KOG4640 665 consensus Anaphase-promoting complex (APC), subuni 96.4
KOG1008 783 consensus Uncharacterized conserved protein, conta 96.3
PRK02888635 nitrous-oxide reductase; Validated 96.29
PF12460415 MMS19_C: RNAPII transcription regulator C-terminal 96.27
TIGR03075527 PQQ_enz_alc_DH PQQ-dependent dehydrogenase, methan 96.26
PF06977248 SdiA-regulated: SdiA-regulated; InterPro: IPR00972 96.22
PF04053443 Coatomer_WDAD: Coatomer WD associated region ; Int 96.18
KOG18241233 consensus TATA-binding protein-interacting protein 96.17
KOG2259823 consensus Uncharacterized conserved protein [Funct 96.1
COG50981128 Chromosome condensation complex Condensin, subunit 96.1
PF06433342 Me-amine-dh_H: Methylamine dehydrogenase heavy cha 96.09
PF03178321 CPSF_A: CPSF A subunit region; InterPro: IPR004871 96.05
KOG3621 726 consensus WD40 repeat-containing protein [General 96.05
COG3490366 Uncharacterized protein conserved in bacteria [Fun 95.91
COG0823425 TolB Periplasmic component of the Tol biopolymer t 95.87
COG0823425 TolB Periplasmic component of the Tol biopolymer t 95.86
KOG1059877 consensus Vesicle coat complex AP-3, delta subunit 95.86
PF14583386 Pectate_lyase22: Oligogalacturonate lyase; PDB: 3C 95.84
KOG19491005 consensus Uncharacterized conserved protein [Funct 95.83
KOG1078865 consensus Vesicle coat complex COPI, gamma subunit 95.81
PF04053443 Coatomer_WDAD: Coatomer WD associated region ; Int 95.8
COG5215858 KAP95 Karyopherin (importin) beta [Intracellular t 95.62
PF03178321 CPSF_A: CPSF A subunit region; InterPro: IPR004871 95.58
COG5240898 SEC21 Vesicle coat complex COPI, gamma subunit [In 95.47
smart0032040 WD40 WD40 repeats. Note that these repeats are per 95.44
COG3391381 Uncharacterized conserved protein [Function unknow 95.44
KOG2079 1206 consensus Vacuolar assembly/sorting protein VPS8 [ 95.42
PF02897414 Peptidase_S9_N: Prolyl oligopeptidase, N-terminal 95.41
KOG12481176 consensus Uncharacterized conserved protein [Funct 95.37
KOG1061734 consensus Vesicle coat complex AP-1/AP-2/AP-4, bet 95.32
COG5096757 Vesicle coat complex, various subunits [Intracellu 95.29
PF10521282 DUF2454: Protein of unknown function (DUF2454); In 95.21
PF08553794 VID27: VID27 cytoplasmic protein; InterPro: IPR013 95.2
PF04826254 Arm_2: Armadillo-like; InterPro: IPR006911 This en 95.09
PF1351355 HEAT_EZ: HEAT-like repeat; PDB: 2Z5J_A 2OT8_B 2Z5O 95.09
KOG1077938 consensus Vesicle coat complex AP-2, alpha subunit 94.99
PF00780275 CNH: CNH domain; InterPro: IPR001180 Based on sequ 94.88
PF14655415 RAB3GAP2_N: Rab3 GTPase-activating protein regulat 94.83
KOG4640 665 consensus Anaphase-promoting complex (APC), subuni 94.76
KOG4653982 consensus Uncharacterized conserved protein [Funct 94.62
KOG1897 1096 consensus Damage-specific DNA binding complex, sub 94.51
PF08506370 Cse1: Cse1; InterPro: IPR013713 The exchange of ma 94.45
KOG2079 1206 consensus Vacuolar assembly/sorting protein VPS8 [ 94.38
PF05004309 IFRD: Interferon-related developmental regulator ( 94.37
PF05004309 IFRD: Interferon-related developmental regulator ( 94.36
COG3386307 Gluconolactonase [Carbohydrate transport and metab 94.26
PF02897414 Peptidase_S9_N: Prolyl oligopeptidase, N-terminal 94.24
KOG2395644 consensus Protein involved in vacuole import and d 94.19
KOG2280 829 consensus Vacuolar assembly/sorting protein VPS16 94.17
KOG04141251 consensus Chromosome condensation complex Condensi 93.95
PF12530234 DUF3730: Protein of unknown function (DUF3730) ; I 93.9
COG5240898 SEC21 Vesicle coat complex COPI, gamma subunit [In 93.85
KOG0567289 consensus HEAT repeat-containing protein [General 93.72
TIGR03074 764 PQQ_membr_DH membrane-bound PQQ-dependent dehydrog 93.7
PF05096264 Glu_cyclase_2: Glutamine cyclotransferase; InterPr 93.68
COG5656970 SXM1 Importin, protein involved in nuclear import 93.4
KOG2956516 consensus CLIP-associating protein [General functi 93.32
COG3386307 Gluconolactonase [Carbohydrate transport and metab 93.3
TIGR03075 527 PQQ_enz_alc_DH PQQ-dependent dehydrogenase, methan 93.3
KOG1916 1283 consensus Nuclear protein, contains WD40 repeats [ 93.25
KOG2444238 consensus WD40 repeat protein [General function pr 93.24
PF10168 717 Nup88: Nuclear pore component; InterPro: IPR019321 93.23
KOG1992960 consensus Nuclear export receptor CSE1/CAS (import 93.17
KOG1062866 consensus Vesicle coat complex AP-1, gamma subunit 93.08
PF05096264 Glu_cyclase_2: Glutamine cyclotransferase; InterPr 92.91
KOG01681051 consensus Putative ubiquitin fusion degradation pr 92.9
COG3204316 Uncharacterized protein conserved in bacteria [Fun 92.69
PRK13616591 lipoprotein LpqB; Provisional 92.67
PF14583386 Pectate_lyase22: Oligogalacturonate lyase; PDB: 3C 92.64
PF13251182 DUF4042: Domain of unknown function (DUF4042) 92.59
PF12719298 Cnd3: Nuclear condensing complex subunits, C-term 92.59
KOG12481176 consensus Uncharacterized conserved protein [Funct 92.51
PF05694461 SBP56: 56kDa selenium binding protein (SBP56); Int 92.47
KOG1897 1096 consensus Damage-specific DNA binding complex, sub 92.43
KOG2025892 consensus Chromosome condensation complex Condensi 92.43
PF05804708 KAP: Kinesin-associated protein (KAP) 92.21
COG3490366 Uncharacterized protein conserved in bacteria [Fun 92.17
PRK13616591 lipoprotein LpqB; Provisional 92.14
KOG4224550 consensus Armadillo repeat protein VAC8 required f 92.12
KOG19431133 consensus Beta-tubulin folding cofactor D [Posttra 92.11
PF12719298 Cnd3: Nuclear condensing complex subunits, C-term 92.04
KOG2395644 consensus Protein involved in vacuole import and d 91.9
PF14655415 RAB3GAP2_N: Rab3 GTPase-activating protein regulat 91.86
TIGR03074 764 PQQ_membr_DH membrane-bound PQQ-dependent dehydrog 91.78
KOG3630 1405 consensus Nuclear pore complex, Nup214/CAN compone 91.46
PF12830187 Nipped-B_C: Sister chromatid cohesion C-terminus 91.37
KOG1060968 consensus Vesicle coat complex AP-3, beta subunit 91.31
KOG10201692 consensus Sister chromatid cohesion protein SCC2/N 91.23
KOG1061734 consensus Vesicle coat complex AP-1/AP-2/AP-4, bet 91.16
>KOG1240 consensus Protein kinase containing WD40 repeats [Signal transduction mechanisms] Back     alignment and domain information 
Probab=100.00  E-value=1e-128  Score=1153.86  Aligned_cols=1042  Identities=37%  Similarity=0.547  Sum_probs=783.8

Q ss_pred             cccchhhHHHhHhhhhcCCcccccccccccchhhhccccCCCCCCCCCCCCCCCCCCcccchhhHHHHHhhhccCCCchh
Q 000861          132 ESSGELLQSISDAFRKNGHPFLKKITMNNLSSLMSEYDSQSDTFGMPFLPLPEDSMKCEGIVLIASLLCSCVRNVKLPHY  211 (1249)
Q Consensus       132 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~i~s~~r~~~~~~~  211 (1249)
                      .+..+.+..+..++-...+-.-.+..+.+|--..+.+++.++++.        ..++++|+++|+++|+||||+++...+
T Consensus       368 ~S~De~~~~~~~al~~~r~~~~~l~~~~dl~~~~q~~~~~~~~~~--------~~~~~~ga~l~vs~lts~IR~lk~~~t  439 (1431)
T KOG1240|consen  368 TSSDEIIDSISKALEFSRHLIENLDVIQDLKPEKQLWTARSSPNI--------KDPKEEGAVLFVSVLTSCIRALKTIQT  439 (1431)
T ss_pred             cCCcHHHHHHHHHHhhhhhhcccchhhhccchHHhcccccCCccc--------CCccccceeeeHHHHHHHHHhhhcchh
Confidence            455667777777777777777788888999899999999998882        258999999999999999999999999


Q ss_pred             HHHHHHHHHHHhhcCChHHHHHhhHHHHHHhcCCCChhHHHHHHHHHHHHhccccccCCCCCcchhhchhhhccCCCCC-
Q 000861          212 RRAAILLLKSSSLFIDDEDRLQRVLPHVIAMLSDPAAIVRCAALETLCDILPLVRNFPPSDAKIFPEYILPMLSMLPDD-  290 (1249)
Q Consensus       212 r~~a~~ll~~l~~~~~de~~l~~ilP~~~~ll~D~~~~VR~~A~~~l~~~l~~v~~~~~~~~~if~eyilP~l~~l~~D-  290 (1249)
                      |++|++||..|+.+++||.++|||+||+++|++|+++.||++|+++|+++|.+|+.+||+|++||||||||.|++|+.| 
T Consensus       440 K~~ALeLl~~lS~~i~de~~LDRVlPY~v~l~~Ds~a~Vra~Al~Tlt~~L~~Vr~~~~~daniF~eYlfP~L~~l~~d~  519 (1431)
T KOG1240|consen  440 KLAALELLQELSTYIDDEVKLDRVLPYFVHLLMDSEADVRATALETLTELLALVRDIPPSDANIFPEYLFPHLNHLLNDS  519 (1431)
T ss_pred             HHHHHHHHHHHhhhcchHHHHhhhHHHHHHHhcCchHHHHHHHHHHHHHHHhhccCCCcccchhhHhhhhhhhHhhhccC
Confidence            9999999999999999999999999999999999999999999999999999999999999999999999999999999 


Q ss_pred             CchhHHHHHHHHHHHHHHHHHHHHHHHHHhhhcccccccCCCCCCCCCCCcchhhhhccchhHHHHHHHHHHHHHHHHHh
Q 000861          291 PEESVRICYASNIAKLALTAYGFLVHSIRLSEAGVLDKLSAPHKSPSSSNETSVQLQRLNADVQLSQLRKSIAEVVQELV  370 (1249)
Q Consensus       291 ~~~~VR~~~A~~l~~LA~~a~rf~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~Ll  370 (1249)
                      ...+||++||+||+.||.+|.||++.+|+++..|.++..+++            .....++++++++|++.+.+.|.+||
T Consensus       520 ~~~~vRiayAsnla~LA~tA~rFle~~q~~~~~g~~n~~nse------------t~~~~~~~~~~~~L~~~V~~~v~sLl  587 (1431)
T KOG1240|consen  520 SAQIVRIAYASNLAQLAKTAYRFLELTQELRQAGMLNDPNSE------------TAPEQNYNTELQALHHTVEQMVSSLL  587 (1431)
T ss_pred             ccceehhhHHhhHHHHHHHHHHHHHHHHHHHhcccccCcccc------------cccccccchHHHHHHHHHHHHHHHHH
Confidence            789999999999999999999999999999998887765432            11233456799999999999999999


Q ss_pred             cCCCCCHHHHHHHHHhchhhhhhcCccccchhhhhhHhhhhcCCCHHHHHHHHhhhhhhhcccChhhHHHhHHHHHHHHc
Q 000861          371 MGPKQTPSIRRALLQDIGNLCSFFGQRQSNDFLLPILPAFLNDRDEQLRAVFYGQIVYVCFFVGERSVEEYLLPYIEQAL  450 (1249)
Q Consensus       371 ~~~D~~~~Vr~all~~i~~l~~f~G~~~~~d~lLp~l~t~lnD~~w~lR~a~~~~i~~la~~lG~~~~~~~llPll~q~L  450 (1249)
                      +  |+.|.||++||++|.+||.|||++++||+|||||+|||||+||+||+|||+.|+|||.|||+++++|||+|||+|+|
T Consensus       588 s--d~~~~Vkr~Lle~i~~LC~FFGk~ksND~iLshLiTfLNDkDw~LR~aFfdsI~gvsi~VG~rs~seyllPLl~Q~l  665 (1431)
T KOG1240|consen  588 S--DSPPIVKRALLESIIPLCVFFGKEKSNDVILSHLITFLNDKDWRLRGAFFDSIVGVSIFVGWRSVSEYLLPLLQQGL  665 (1431)
T ss_pred             c--CCchHHHHHHHHHHHHHHHHhhhcccccchHHHHHHHhcCccHHHHHHHHhhccceEEEEeeeeHHHHHHHHHHHhc
Confidence            6  77899999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             cCCcHHHHHHHHHHHHHHHhcCCCchHHHHHHHHHhcccccCCCHHHHHHHHHHHHHHhhcCCccceeeEeeeccchhhh
Q 000861          451 SDATEAVIVNALDCLAILCKSGYLRKRILLEMIERAFPLLCYPSQWVRRSVVTFIAASSESLGAVDSYVFLAPVIRPFLR  530 (1249)
Q Consensus       451 ~D~~e~V~~~~l~~l~~l~~~gl~~~~~~~~l~~~~~~ll~hpn~wiR~~~~~~i~~~a~~l~~~d~~~~l~P~l~~~l~  530 (1249)
                      +|+||+|+++||.||+.|||.|+++|+...+++..++||++|||.|||++++.+|.+++++|+.+|+||+|+|+|+|||.
T Consensus       666 tD~EE~Viv~aL~~ls~Lik~~ll~K~~v~~i~~~v~PlL~hPN~WIR~~~~~iI~~~~~~ls~advyc~l~P~irpfl~  745 (1431)
T KOG1240|consen  666 TDGEEAVIVSALGSLSILIKLGLLRKPAVKDILQDVLPLLCHPNLWIRRAVLGIIAAIARQLSAADVYCKLMPLIRPFLE  745 (1431)
T ss_pred             cCcchhhHHHHHHHHHHHHHhcccchHHHHHHHHhhhhheeCchHHHHHHHHHHHHHHHhhhhhhhheEEeehhhHHhhh
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             cCCCCcCCHHHHHhccCCCCcHHHHHHHHHhhc-chhHHHHHhhhhhccCCCCcchhhhHHhhcccCccccccccc----
Q 000861          531 RQPASLASVKALLSCLKPPVSREVFYQVLENAR-SSDMLERQRKIWYNTSSQSKQQETADLLKRGAEDLSSIKCWP----  605 (1249)
Q Consensus       531 ~~v~~i~~~~~ll~~l~~PlsR~vf~~~~~~~~-~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~----  605 (1249)
                      .+|.+|.+++.|++||||||||+||+++++|.. .......++..|+....++++|.-.+...+.+|..+.-....    
T Consensus       746 ~~v~~i~s~~~LlsclkpPVsRsv~~~l~r~~~ens~f~k~l~~~~~~s~~~s~d~~~~~~~~k~~g~l~~~e~~~~~~~  825 (1431)
T KOG1240|consen  746 RPVIQIESKEVLLSCLKPPVSRSVFNQLLRWSDENSSFWKKLLERHYSSSGNSRDEFIKNYSSKRYGFLPFEEGAGSSKW  825 (1431)
T ss_pred             ccHhhhcchHHHHHHhcCCCcHHHHHHHHHHhhcchHHHHHHHHHhhhccCccchhhhhcchhhhcccCCccccccchhh
Confidence            999999999999999999999999999999987 444445666778888888888777666666666554332222    


Q ss_pred             -----ccccCcCCCCCCCCCCCCCcccCCCCCchhhHhhcccchhccccccCCCCCCCC-cccccccccccccccccccc
Q 000861          606 -----DKQQSSEGHRPAGDTSKQPEFAQSDDNDGAKLRTLGSLVYNASSMADIRDPLCP-EKLLFSGFMSQQVSGVNSLR  679 (1249)
Q Consensus       606 -----~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~kl~~~~~~i~~~~~~~~~~~~~~~-~~~~~~~~~~~~~~~~~~~~  679 (1249)
                           +++++.+...-..++       + ..++.|+..+++.+-... ......+...+ +.....++...++.+.+.+.
T Consensus       826 ~~~~~~~i~S~~~~e~~e~~-------l-~~k~~~~~~~r~~~~~~s-~~~~l~d~~~~~~~~~~~~v~~~~~n~~~t~~  896 (1431)
T KOG1240|consen  826 SNTGFKKIKSEGKTELVEDK-------L-LEKDIFLIRSRKPKSNIS-NRVLLDDPAYPRNTNGREGVLTRQVNLVGTII  896 (1431)
T ss_pred             hhhhcceeeccccccccccc-------c-chhchhhhcccCCccchh-hhhhhcCcccccccCCceeeeccccccccccc
Confidence                 222222222222111       1 123334444444321111 01111122222 22333444444433333221


Q ss_pred             cCCCCCCCCcccccccccccCCCCccccccccccccCCCCCCCCCCCcccCCCCCCCCCCCCCcccccccccCCCCccee
Q 000861          680 CDKSSEGIPLYSFSMDKRAMGNLPVASDSVLQVNSLGIGSSTMPWMDTTNQSFSLASSVPPPNLVSGSFSISNGSKQFYR  759 (1249)
Q Consensus       680 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  759 (1249)
                         -+..++..++..+..-....+..+...++...++++..+..|....-+...+....+-+.+.++++....+.+.++.
T Consensus       897 ---~P~~~~~~~~~~d~n~~~~~~~~~~~~n~~~~l~~~~~~~~~~~~~~~~t~~~~~~~vp~~ts~~~~~~t~~~~~~~  973 (1431)
T KOG1240|consen  897 ---EPSNIHARVRRKDSNREGNESNMESPQNSKHLLPIGSPNKLNHTGSPRSTLLLDGNSVPTLTSSSVRVVTNLKPTKP  973 (1431)
T ss_pred             ---ccccchhhhhhhhccccCCCccccCCCcchhhccCCCCCcccccCCCcccccccCCccceeeccceeeeeccCCccc
Confidence               13344444444332211122222222233333333333222222111111111122223334445554445554444


Q ss_pred             eeccCCCCCccc-cccccccCCCCCCCCccccccccccCCCCCCCCCCCCccccccCCCCCccCCCCcEEEEeccccCce
Q 000861          760 VVHEPEGRENDQ-MASVNCKFPEMGTSGTAKGSSINVEDASSPADLTGLPSFVRTSSIPDSGWRPRGILVAHLQEHCSAV  838 (1249)
Q Consensus       760 ~~~~~~~~~~~~-~~~~~~~~~~~g~~~~i~~~~~~~~~~~~~~s~~G~~~~~~s~~~~~~~W~~~G~lv~~L~~H~~~V  838 (1249)
                      +.+.+.++.+.+ ..++.+...++++...+........+. -.....+.|..... ..+...|+|+|.+|++|++|+..|
T Consensus       974 ~~p~~ns~~~~~~~r~~~~~~dL~~~~~~~~~~~ss~~~s-~p~~~~~ep~~~~~-~~p~~gW~p~G~lVAhL~Ehs~~v 1051 (1431)
T KOG1240|consen  974 VMPVPNSTANNQVERSLTCLNDLEMLTVSIPKRPSSESIS-HPCLLNSEPSAWSV-GSPPPGWNPRGILVAHLHEHSSAV 1051 (1431)
T ss_pred             ccccCCCCcccchhHHHHHHHhhhhhhhhcccccchhhcc-chhhhccCCchhhc-CCCCCCCCccceEeehhhhccccc
Confidence            455444443332 334455555666655443322222211 01111222222222 345677999999999999999999


Q ss_pred             eEEEEcCCC-CEEEEEECCCcEEEEECCCCccc-cccceeeEeeccCCceEEEEEecCCCEEEEEeCCCeEEEEEccccc
Q 000861          839 NEIAISHDH-SFFVSASDDSTVKVWDSRKLEKD-ISFRSRLTYHLEGSRALCTMMLRHSAQVVVGACDGIIHMFSVDHIS  916 (1249)
Q Consensus       839 ~~la~spdg-~~laTgs~DgtVkIWD~~~~~~~-~~~~~~~t~~~h~~~V~sl~fspdg~~Lasgs~Dg~I~vwdv~~~~  916 (1249)
                      +.++.+++. .+|+|||.||+||+||....+.. .++++..+|...++++.++.++++++.+|+++.||.|++.+++.. 
T Consensus      1052 ~k~a~s~~~~s~FvsgS~DGtVKvW~~~k~~~~~~s~rS~ltys~~~sr~~~vt~~~~~~~~Av~t~DG~v~~~~id~~- 1130 (1431)
T KOG1240|consen 1052 IKLAVSSEHTSLFVSGSDDGTVKVWNLRKLEGEGGSARSELTYSPEGSRVEKVTMCGNGDQFAVSTKDGSVRVLRIDHY- 1130 (1431)
T ss_pred             cceeecCCCCceEEEecCCceEEEeeehhhhcCcceeeeeEEEeccCCceEEEEeccCCCeEEEEcCCCeEEEEEcccc-
Confidence            999998766 89999999999999999988765 788999999988889999999999999999999999999999931 


Q ss_pred             cCCCccccccCccceeeecC-CCCcEEEEEEecCCCCCccEEEEEECCCeEEEEEcCCCccceeeecCCCCCceEEEEEc
Q 000861          917 RGLGNVEKYSGISDIKKKDT-KEGAIVTLVNYNTDNCASHMFMYSTQNCGIHLWDTRSNSNTWTLKAIPEEGYVSSLVTG  995 (1249)
Q Consensus       917 ~~~g~~~~~~~~~~i~~l~~-h~~~V~~l~~fs~d~~~g~~L~sgs~dg~I~iwDlrt~~~~~~l~~~~h~~~I~sl~~s  995 (1249)
                          +..++.. ...+..+. ..|.+.++.+|.....+ ..+++++..+.|..||+++....|+++....+|.|++++.+
T Consensus      1131 ----~~~~~~~-~~~ri~n~~~~g~vv~m~a~~~~~~S-~~lvy~T~~~~iv~~D~r~~~~~w~lk~~~~hG~vTSi~id 1204 (1431)
T KOG1240|consen 1131 ----NVSKRVA-TQVRIPNLKKDGVVVSMHAFTAIVQS-HVLVYATDLSRIVSWDTRMRHDAWRLKNQLRHGLVTSIVID 1204 (1431)
T ss_pred             ----cccccee-eeeecccccCCCceEEeecccccccc-eeEEEEEeccceEEecchhhhhHHhhhcCccccceeEEEec
Confidence                1111111 22333333 45678888777776533 48999999999999999999999999999999999999999


Q ss_pred             CCCCEEEEEecCCcEEEEeCCCCCcccccccCCCCCeeEEEEEcCCCCCcccCCCCCEEEEEE-CCCeEEEEECCCCcee
Q 000861          996 PCGNWFVSGSSRGVLTLWDLRFLVPVNSWQYSQVCPIEKMCLFVPPPNAAVSTTARPLIYVAA-GCNEVSLWNAENGSCH 1074 (1249)
Q Consensus       996 pdg~~L~sgs~dG~I~lWDlr~~~~l~s~~~~~~~~I~~l~~~sp~g~~~~~~~~~~~l~t~s-~Dg~I~vWDl~tg~~~ 1074 (1249)
                      |.++|+++|+..|.+.+||+|++.++.+|.+++..+|+.+.. +|...     .+...+.++. +.+.|.+|++++|.|.
T Consensus      1205 p~~~WlviGts~G~l~lWDLRF~~~i~sw~~P~~~~i~~v~~-~~~~~-----~~S~~vs~~~~~~nevs~wn~~~g~~~ 1278 (1431)
T KOG1240|consen 1205 PWCNWLVIGTSRGQLVLWDLRFRVPILSWEHPARAPIRHVWL-CPTYP-----QESVSVSAGSSSNNEVSTWNMETGLRQ 1278 (1431)
T ss_pred             CCceEEEEecCCceEEEEEeecCceeecccCcccCCcceEEe-eccCC-----CCceEEEecccCCCceeeeecccCcce
Confidence            999999999999999999999999999999999999999998 66543     1122344444 5789999999999999


Q ss_pred             EEEecccCCCCCCcccccccccCCCCCCCCCccccccccccccccccCCCCCCCCCeEEEeecCCCeEEEEeCCCcEEEE
Q 000861         1075 QVLRTANYDGDTEMSDLPWAFARPSSRSNPKTDLRRNVNQKYRVDELNEPPPRLLGIRSLLPLPGGDLLTGGTDLKIRRW 1154 (1249)
Q Consensus      1075 ~~l~~~~~~~~~~i~~l~~sp~~p~~~~~~s~dg~~~~~~~~~~~~~~~~~~~~~~V~sl~~spdg~L~tgs~Dg~IriW 1154 (1249)
                      .+++...+     ...+.+..  |..      +.              ..++...++.|....+.|.+++||.|+.||.|
T Consensus      1279 ~vl~~s~~-----~p~ls~~~--Ps~------~~--------------~kp~~~~~~~~~~~~~~~~~ltggsd~kIR~w 1331 (1431)
T KOG1240|consen 1279 TVLWASDG-----APILSYAL--PSN------DA--------------RKPDSLAGISCGVCEKNGFLLTGGSDMKIRKW 1331 (1431)
T ss_pred             EEEEcCCC-----Ccchhhhc--ccc------cC--------------CCCCcccceeeecccCCceeeecCCccceeec
Confidence            99996522     11111110  111      00              00222335666665666699999999999999


Q ss_pred             eCCCCCcc-EEEeCCCCCCCCCCcceeeccCCceEEeeccccCCccchhh----HHHHHhhhcccccCCcccceeEEEee
Q 000861         1155 DHCSPGRS-YCICGPNLKGVGNDEFYETRSSSGVQVVQERKRQPLTSKLT----AKAVLAAAATDSAGCHRDSILSLGSV 1229 (1249)
Q Consensus      1155 Dl~~~~~~-~~l~g~~~~~~~~~~~y~~~~~~~v~~~~e~~~~~~~~~~~----~~~~~~~~~~~~l~~H~d~I~~la~~ 1229 (1249)
                      |...++.+ +.+.|+.....++...|..+.+.+.+++++..........+    ..........+...+|.+.|++++++
T Consensus      1332 D~~~p~~ss~~~~~~s~~~~~~~~s~~~~~i~~~~~i~e~i~~~~tv~~t~~~~~~~~~~~~~~~ps~~H~d~Itdma~~ 1411 (1431)
T KOG1240|consen 1332 DPTRPEISSYAVPGPSTSYSTNSESYDLSTIPGSQFIDEFIIYQQTVGLTEALRENQKLRPGPSDPSTYHHDPITDMATL 1411 (1431)
T ss_pred             cCCCcccccccccCccccccccchhccccccCCCccchhhhhhhhhcCchhhcccccccccCCCCCcccccchhhhhhhh
Confidence            99999887 67777765556677788888899988888744333311111    12223333344667899999999977


Q ss_pred             ecCCCEEEEEeCCCeEEEcC
Q 000861         1230 KLNQRLLISSSRDGAIKVWK 1249 (1249)
Q Consensus      1230 s~dg~~LaSgs~DG~IkVWd 1249 (1249)
                      ..+..+|+++|+||.|+||+
T Consensus      1412 ~~~q~llvs~s~dG~IkiWk 1431 (1431)
T KOG1240|consen 1412 KSEQPLLVSSSRDGVIKIWK 1431 (1431)
T ss_pred             ccCccEEEEecCCCeeeecC
Confidence            77789999999999999996

>KOG0271 consensus Notchless-like WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0271 consensus Notchless-like WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0272 consensus U4/U6 small nuclear ribonucleoprotein Prp4 (contains WD40 repeats) [RNA processing and modification] Back     alignment and domain information
>KOG0272 consensus U4/U6 small nuclear ribonucleoprotein Prp4 (contains WD40 repeats) [RNA processing and modification] Back     alignment and domain information
>KOG0286 consensus G-protein beta subunit [General function prediction only] Back     alignment and domain information
>KOG0295 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0285 consensus Pleiotropic regulator 1 [RNA processing and modification] Back     alignment and domain information
>KOG0279 consensus G protein beta subunit-like protein [Signal transduction mechanisms] Back     alignment and domain information
>KOG0279 consensus G protein beta subunit-like protein [Signal transduction mechanisms] Back     alignment and domain information
>KOG0315 consensus G-protein beta subunit-like protein (contains WD40 repeats) [General function prediction only] Back     alignment and domain information
>KOG0315 consensus G-protein beta subunit-like protein (contains WD40 repeats) [General function prediction only] Back     alignment and domain information
>KOG0286 consensus G-protein beta subunit [General function prediction only] Back     alignment and domain information
>KOG0319 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification] Back     alignment and domain information
>KOG0319 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification] Back     alignment and domain information
>cd00200 WD40 WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and botto Back     alignment and domain information
>KOG0265 consensus U5 snRNP-specific protein-like factor and related proteins [RNA processing and modification] Back     alignment and domain information
>KOG0284 consensus Polyadenylation factor I complex, subunit PFS2 [RNA processing and modification] Back     alignment and domain information
>KOG0296 consensus Angio-associated migratory cell protein (contains WD40 repeats) [Function unknown] Back     alignment and domain information
>KOG0291 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification] Back     alignment and domain information
>KOG0318 consensus WD40 repeat stress protein/actin interacting protein [Cytoskeleton] Back     alignment and domain information
>KOG0318 consensus WD40 repeat stress protein/actin interacting protein [Cytoskeleton] Back     alignment and domain information
>KOG0282 consensus mRNA splicing factor [Function unknown] Back     alignment and domain information
>KOG0266 consensus WD40 repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG0273 consensus Beta-transducin family (WD-40 repeat) protein [Chromatin structure and dynamics] Back     alignment and domain information
>KOG0273 consensus Beta-transducin family (WD-40 repeat) protein [Chromatin structure and dynamics] Back     alignment and domain information
>KOG0211 consensus Protein phosphatase 2A regulatory subunit A and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG0284 consensus Polyadenylation factor I complex, subunit PFS2 [RNA processing and modification] Back     alignment and domain information
>KOG0645 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0293 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>PLN00181 protein SPA1-RELATED; Provisional Back     alignment and domain information
>KOG0281 consensus Beta-TrCP (transducin repeats containing)/Slimb proteins [Function unknown] Back     alignment and domain information
>KOG0263 consensus Transcription initiation factor TFIID, subunit TAF5 (also component of histone acetyltransferase SAGA) [Transcription] Back     alignment and domain information
>KOG0263 consensus Transcription initiation factor TFIID, subunit TAF5 (also component of histone acetyltransferase SAGA) [Transcription] Back     alignment and domain information
>KOG0306 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification] Back     alignment and domain information
>KOG0295 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0285 consensus Pleiotropic regulator 1 [RNA processing and modification] Back     alignment and domain information
>KOG0291 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification] Back     alignment and domain information
>KOG0275 consensus Conserved WD40 repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG0316 consensus Conserved WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0645 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0266 consensus WD40 repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG0276 consensus Vesicle coat complex COPI, beta' subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0293 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>cd00200 WD40 WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and botto Back     alignment and domain information
>KOG0640 consensus mRNA cleavage stimulating factor complex; subunit 1 [RNA processing and modification] Back     alignment and domain information
>KOG0278 consensus Serine/threonine kinase receptor-associated protein [Lipid transport and metabolism] Back     alignment and domain information
>KOG0296 consensus Angio-associated migratory cell protein (contains WD40 repeats) [Function unknown] Back     alignment and domain information
>KOG0643 consensus Translation initiation factor 3, subunit i (eIF-3i)/TGF-beta receptor-interacting protein (TRIP-1) [Translation, ribosomal structure and biogenesis; Signal transduction mechanisms] Back     alignment and domain information
>KOG0313 consensus Microtubule binding protein YTM1 (contains WD40 repeats) [Cytoskeleton] Back     alignment and domain information
>KOG0292 consensus Vesicle coat complex COPI, alpha subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0281 consensus Beta-TrCP (transducin repeats containing)/Slimb proteins [Function unknown] Back     alignment and domain information
>KOG0643 consensus Translation initiation factor 3, subunit i (eIF-3i)/TGF-beta receptor-interacting protein (TRIP-1) [Translation, ribosomal structure and biogenesis; Signal transduction mechanisms] Back     alignment and domain information
>KOG0276 consensus Vesicle coat complex COPI, beta' subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0292 consensus Vesicle coat complex COPI, alpha subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0278 consensus Serine/threonine kinase receptor-associated protein [Lipid transport and metabolism] Back     alignment and domain information
>KOG0313 consensus Microtubule binding protein YTM1 (contains WD40 repeats) [Cytoskeleton] Back     alignment and domain information
>KOG0288 consensus WD40 repeat protein TipD [General function prediction only] Back     alignment and domain information
>KOG0265 consensus U5 snRNP-specific protein-like factor and related proteins [RNA processing and modification] Back     alignment and domain information
>KOG0282 consensus mRNA splicing factor [Function unknown] Back     alignment and domain information
>KOG0316 consensus Conserved WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0306 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification] Back     alignment and domain information
>KOG0268 consensus Sof1-like rRNA processing protein (contains WD40 repeats) [RNA processing and modification] Back     alignment and domain information
>PLN00181 protein SPA1-RELATED; Provisional Back     alignment and domain information
>KOG0772 consensus Uncharacterized conserved protein, contains WD40 repeat [Function unknown] Back     alignment and domain information
>KOG1407 consensus WD40 repeat protein [Function unknown] Back     alignment and domain information
>KOG0275 consensus Conserved WD40 repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG0305 consensus Anaphase promoting complex, Cdc20, Cdh1, and Ama1 subunits [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0274 consensus Cdc4 and related F-box and WD-40 proteins [General function prediction only] Back     alignment and domain information
>KOG0274 consensus Cdc4 and related F-box and WD-40 proteins [General function prediction only] Back     alignment and domain information
>KOG0283 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0277 consensus Peroxisomal targeting signal type 2 receptor [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0973 consensus Histone transcription regulator HIRA, WD repeat superfamily [Cell cycle control, cell division, chromosome partitioning; Transcription] Back     alignment and domain information
>KOG1446 consensus Histone H3 (Lys4) methyltransferase complex and RNA cleavage factor II complex, subunit SWD2 [RNA processing and modification; Chromatin structure and dynamics; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0300 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0310 consensus Conserved WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0640 consensus mRNA cleavage stimulating factor complex; subunit 1 [RNA processing and modification] Back     alignment and domain information
>KOG0299 consensus U3 snoRNP-associated protein (contains WD40 repeats) [RNA processing and modification] Back     alignment and domain information
>KOG0300 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0641 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PTZ00421 coronin; Provisional Back     alignment and domain information
>KOG0305 consensus Anaphase promoting complex, Cdc20, Cdh1, and Ama1 subunits [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0288 consensus WD40 repeat protein TipD [General function prediction only] Back     alignment and domain information
>KOG0289 consensus mRNA splicing factor [General function prediction only] Back     alignment and domain information
>KOG0641 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PTZ00421 coronin; Provisional Back     alignment and domain information
>KOG0277 consensus Peroxisomal targeting signal type 2 receptor [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0289 consensus mRNA splicing factor [General function prediction only] Back     alignment and domain information
>KOG0301 consensus Phospholipase A2-activating protein (contains WD40 repeats) [Lipid transport and metabolism] Back     alignment and domain information
>KOG0283 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0308 consensus Conserved WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0268 consensus Sof1-like rRNA processing protein (contains WD40 repeats) [RNA processing and modification] Back     alignment and domain information
>KOG1539 consensus WD repeat protein [General function prediction only] Back     alignment and domain information
>PTZ00420 coronin; Provisional Back     alignment and domain information
>KOG0308 consensus Conserved WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>PTZ00420 coronin; Provisional Back     alignment and domain information
>KOG1408 consensus WD40 repeat protein [Function unknown] Back     alignment and domain information
>KOG0294 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG2096 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0647 consensus mRNA export protein (contains WD40 repeats) [RNA processing and modification] Back     alignment and domain information
>KOG1240 consensus Protein kinase containing WD40 repeats [Signal transduction mechanisms] Back     alignment and domain information
>KOG0294 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0973 consensus Histone transcription regulator HIRA, WD repeat superfamily [Cell cycle control, cell division, chromosome partitioning; Transcription] Back     alignment and domain information
>KOG0301 consensus Phospholipase A2-activating protein (contains WD40 repeats) [Lipid transport and metabolism] Back     alignment and domain information
>KOG0264 consensus Nucleosome remodeling factor, subunit CAF1/NURF55/MSI1 [Chromatin structure and dynamics] Back     alignment and domain information
>KOG0310 consensus Conserved WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0639 consensus Transducin-like enhancer of split protein (contains WD40 repeats) [Chromatin structure and dynamics] Back     alignment and domain information
>KOG1539 consensus WD repeat protein [General function prediction only] Back     alignment and domain information
>KOG0772 consensus Uncharacterized conserved protein, contains WD40 repeat [Function unknown] Back     alignment and domain information
>KOG1407 consensus WD40 repeat protein [Function unknown] Back     alignment and domain information
>KOG1036 consensus Mitotic spindle checkpoint protein BUB3, WD repeat superfamily [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0646 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0299 consensus U3 snoRNP-associated protein (contains WD40 repeats) [RNA processing and modification] Back     alignment and domain information
>KOG0269 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG1446 consensus Histone H3 (Lys4) methyltransferase complex and RNA cleavage factor II complex, subunit SWD2 [RNA processing and modification; Chromatin structure and dynamics; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2055 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG2048 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0264 consensus Nucleosome remodeling factor, subunit CAF1/NURF55/MSI1 [Chromatin structure and dynamics] Back     alignment and domain information
>KOG0647 consensus mRNA export protein (contains WD40 repeats) [RNA processing and modification] Back     alignment and domain information
>KOG1274 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG4283 consensus Transcription-coupled repair protein CSA, contains WD40 domain [Transcription; Replication, recombination and repair] Back     alignment and domain information
>KOG2048 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG1332 consensus Vesicle coat complex COPII, subunit SEC13 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG2445 consensus Nuclear pore complex component (sc Seh1) [Nuclear structure; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG2106 consensus Uncharacterized conserved protein, contains HELP and WD40 domains [Function unknown] Back     alignment and domain information
>KOG0267 consensus Microtubule severing protein katanin p80 subunit B (contains WD40 repeats) [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG2106 consensus Uncharacterized conserved protein, contains HELP and WD40 domains [Function unknown] Back     alignment and domain information
>KOG4328 consensus WD40 protein [Function unknown] Back     alignment and domain information
>KOG1332 consensus Vesicle coat complex COPII, subunit SEC13 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1036 consensus Mitotic spindle checkpoint protein BUB3, WD repeat superfamily [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>TIGR03866 PQQ_ABC_repeats PQQ-dependent catabolism-associated beta-propeller protein Back     alignment and domain information
>KOG4283 consensus Transcription-coupled repair protein CSA, contains WD40 domain [Transcription; Replication, recombination and repair] Back     alignment and domain information
>KOG2445 consensus Nuclear pore complex component (sc Seh1) [Nuclear structure; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1063 consensus RNA polymerase II elongator complex, subunit ELP2, WD repeat superfamily [Chromatin structure and dynamics; Transcription] Back     alignment and domain information
>KOG0269 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>TIGR03866 PQQ_ABC_repeats PQQ-dependent catabolism-associated beta-propeller protein Back     alignment and domain information
>KOG0267 consensus Microtubule severing protein katanin p80 subunit B (contains WD40 repeats) [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0321 consensus WD40 repeat-containing protein L2DTL [Function unknown] Back     alignment and domain information
>KOG0650 consensus WD40 repeat nucleolar protein Bop1, involved in ribosome biogenesis [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG1273 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0302 consensus Ribosome Assembly protein [General function prediction only] Back     alignment and domain information
>KOG1063 consensus RNA polymerase II elongator complex, subunit ELP2, WD repeat superfamily [Chromatin structure and dynamics; Transcription] Back     alignment and domain information
>KOG1408 consensus WD40 repeat protein [Function unknown] Back     alignment and domain information
>KOG0646 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG2055 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0321 consensus WD40 repeat-containing protein L2DTL [Function unknown] Back     alignment and domain information
>KOG1517 consensus Guanine nucleotide binding protein MIP1 [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0639 consensus Transducin-like enhancer of split protein (contains WD40 repeats) [Chromatin structure and dynamics] Back     alignment and domain information
>KOG1274 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0307 consensus Vesicle coat complex COPII, subunit SEC31 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG4227 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG4378 consensus Nuclear protein COP1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG2919 consensus Guanine nucleotide-binding protein [General function prediction only] Back     alignment and domain information
>KOG2096 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0307 consensus Vesicle coat complex COPII, subunit SEC31 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0642 consensus Cell-cycle nuclear protein, contains WD-40 repeats [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0270 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG1188 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG1273 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0270 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0211 consensus Protein phosphatase 2A regulatory subunit A and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG4378 consensus Nuclear protein COP1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG1538 consensus Uncharacterized conserved protein WDR10, contains WD40 repeats [General function prediction only] Back     alignment and domain information
>KOG0322 consensus G-protein beta subunit-like protein GNB1L, contains WD repeats [General function prediction only] Back     alignment and domain information
>KOG1034 consensus Transcriptional repressor EED/ESC/FIE, required for transcriptional silencing, WD repeat superfamily [Transcription] Back     alignment and domain information
>KOG1445 consensus Tumor-specific antigen (contains WD repeats) [Cytoskeleton] Back     alignment and domain information
>KOG0302 consensus Ribosome Assembly protein [General function prediction only] Back     alignment and domain information
>KOG4328 consensus WD40 protein [Function unknown] Back     alignment and domain information
>KOG1007 consensus WD repeat protein TSSC1, WD repeat superfamily [Function unknown] Back     alignment and domain information
>KOG1963 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG1538 consensus Uncharacterized conserved protein WDR10, contains WD40 repeats [General function prediction only] Back     alignment and domain information
>KOG0650 consensus WD40 repeat nucleolar protein Bop1, involved in ribosome biogenesis [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG0303 consensus Actin-binding protein Coronin, contains WD40 repeats [Cytoskeleton] Back     alignment and domain information
>KOG1007 consensus WD repeat protein TSSC1, WD repeat superfamily [Function unknown] Back     alignment and domain information
>KOG1310 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG1009 consensus Chromatin assembly complex 1 subunit B/CAC2 (contains WD40 repeats) [Chromatin structure and dynamics; Replication, recombination and repair] Back     alignment and domain information
>COG2319 FOG: WD40 repeat [General function prediction only] Back     alignment and domain information
>KOG0642 consensus Cell-cycle nuclear protein, contains WD-40 repeats [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>COG2319 FOG: WD40 repeat [General function prediction only] Back     alignment and domain information
>KOG0649 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG1034 consensus Transcriptional repressor EED/ESC/FIE, required for transcriptional silencing, WD repeat superfamily [Transcription] Back     alignment and domain information
>KOG0649 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0303 consensus Actin-binding protein Coronin, contains WD40 repeats [Cytoskeleton] Back     alignment and domain information
>KOG1334 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG2919 consensus Guanine nucleotide-binding protein [General function prediction only] Back     alignment and domain information
>KOG0644 consensus Uncharacterized conserved protein, contains WD40 repeat and BROMO domains [General function prediction only] Back     alignment and domain information
>KOG1188 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG1587 consensus Cytoplasmic dynein intermediate chain [Cytoskeleton] Back     alignment and domain information
>PRK11028 6-phosphogluconolactonase; Provisional Back     alignment and domain information
>KOG1009 consensus Chromatin assembly complex 1 subunit B/CAC2 (contains WD40 repeats) [Chromatin structure and dynamics; Replication, recombination and repair] Back     alignment and domain information
>KOG1587 consensus Cytoplasmic dynein intermediate chain [Cytoskeleton] Back     alignment and domain information
>KOG1445 consensus Tumor-specific antigen (contains WD repeats) [Cytoskeleton] Back     alignment and domain information
>KOG1517 consensus Guanine nucleotide binding protein MIP1 [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG2110 consensus Uncharacterized conserved protein, contains WD40 repeats [Function unknown] Back     alignment and domain information
>KOG0290 consensus Conserved WD40 repeat-containing protein AN11 [Function unknown] Back     alignment and domain information
>KOG1523 consensus Actin-related protein Arp2/3 complex, subunit ARPC1/p41-ARC [Cytoskeleton] Back     alignment and domain information
>KOG0771 consensus Prolactin regulatory element-binding protein/Protein transport protein SEC12p [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PRK11028 6-phosphogluconolactonase; Provisional Back     alignment and domain information
>PRK01742 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG1963 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0644 consensus Uncharacterized conserved protein, contains WD40 repeat and BROMO domains [General function prediction only] Back     alignment and domain information
>KOG0771 consensus Prolactin regulatory element-binding protein/Protein transport protein SEC12p [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0322 consensus G-protein beta subunit-like protein GNB1L, contains WD repeats [General function prediction only] Back     alignment and domain information
>KOG4227 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG2110 consensus Uncharacterized conserved protein, contains WD40 repeats [Function unknown] Back     alignment and domain information
>KOG1523 consensus Actin-related protein Arp2/3 complex, subunit ARPC1/p41-ARC [Cytoskeleton] Back     alignment and domain information
>KOG1524 consensus WD40 repeat-containing protein CHE-2 [General function prediction only] Back     alignment and domain information
>KOG1524 consensus WD40 repeat-containing protein CHE-2 [General function prediction only] Back     alignment and domain information
>KOG2321 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0290 consensus Conserved WD40 repeat-containing protein AN11 [Function unknown] Back     alignment and domain information
>KOG2139 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG3881 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK01742 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG1409 consensus Uncharacterized conserved protein, contains WD40 repeats and FYVE domains [Function unknown] Back     alignment and domain information
>KOG4190 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2111 consensus Uncharacterized conserved protein, contains WD40 repeats [Function unknown] Back     alignment and domain information
>PRK13800 putative oxidoreductase/HEAT repeat-containing protein; Provisional Back     alignment and domain information
>PRK02889 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG1272 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification] Back     alignment and domain information
>KOG1272 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification] Back     alignment and domain information
>PRK03629 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK04922 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG1334 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PRK05137 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG2394 consensus WD40 protein DMR-N9 [General function prediction only] Back     alignment and domain information
>KOG4497 consensus Uncharacterized conserved protein WDR8, contains WD repeats [General function prediction only] Back     alignment and domain information
>KOG1064 consensus RAVE (regulator of V-ATPase assembly) complex subunit RAV1/DMX protein, WD repeat superfamily [General function prediction only] Back     alignment and domain information
>KOG1310 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG4497 consensus Uncharacterized conserved protein WDR8, contains WD repeats [General function prediction only] Back     alignment and domain information
>PF02239 Cytochrom_D1: Cytochrome D1 heme domain; PDB: 1NNO_B 1HZU_A 1N15_B 1N50_A 1GJQ_A 1BL9_B 1NIR_B 1N90_B 1HZV_A 1AOQ_A Back     alignment and domain information
>KOG2394 consensus WD40 protein DMR-N9 [General function prediction only] Back     alignment and domain information
>PRK13800 putative oxidoreductase/HEAT repeat-containing protein; Provisional Back     alignment and domain information
>PRK03629 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG0974 consensus WD-repeat protein WDR6, WD repeat superfamily [General function prediction only] Back     alignment and domain information
>PRK09687 putative lyase; Provisional Back     alignment and domain information
>KOG2139 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PF02239 Cytochrom_D1: Cytochrome D1 heme domain; PDB: 1NNO_B 1HZU_A 1N15_B 1N50_A 1GJQ_A 1BL9_B 1NIR_B 1N90_B 1HZV_A 1AOQ_A Back     alignment and domain information
>KOG3881 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2111 consensus Uncharacterized conserved protein, contains WD40 repeats [Function unknown] Back     alignment and domain information
>PRK09687 putative lyase; Provisional Back     alignment and domain information
>PF08662 eIF2A: Eukaryotic translation initiation factor eIF2A; InterPro: IPR013979 This entry contains beta propellor domains found in eukaryotic translation initiation factors and TolB domain-containing proteins Back     alignment and domain information
>PF08662 eIF2A: Eukaryotic translation initiation factor eIF2A; InterPro: IPR013979 This entry contains beta propellor domains found in eukaryotic translation initiation factors and TolB domain-containing proteins Back     alignment and domain information
>KOG1354 consensus Serine/threonine protein phosphatase 2A, regulatory subunit [Signal transduction mechanisms] Back     alignment and domain information
>KOG0280 consensus Uncharacterized conserved protein [Amino acid transport and metabolism] Back     alignment and domain information
>PRK00178 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG0974 consensus WD-repeat protein WDR6, WD repeat superfamily [General function prediction only] Back     alignment and domain information
>TIGR02800 propeller_TolB tol-pal system beta propeller repeat protein TolB Back     alignment and domain information
>PRK05137 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK04922 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG1354 consensus Serine/threonine protein phosphatase 2A, regulatory subunit [Signal transduction mechanisms] Back     alignment and domain information
>PF10282 Lactonase: Lactonase, 7-bladed beta-propeller; InterPro: IPR019405 6-phosphogluconolactonases (6PGL) 3 Back     alignment and domain information
>KOG4190 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK04792 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK02889 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG4547 consensus WD40 repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG2171 consensus Karyopherin (importin) beta 3 [Nuclear structure; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG2315 consensus Predicted translation initiation factor related to eIF-3a [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG2315 consensus Predicted translation initiation factor related to eIF-3a [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG1064 consensus RAVE (regulator of V-ATPase assembly) complex subunit RAV1/DMX protein, WD repeat superfamily [General function prediction only] Back     alignment and domain information
>KOG0309 consensus Conserved WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>PRK01029 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG0280 consensus Uncharacterized conserved protein [Amino acid transport and metabolism] Back     alignment and domain information
>KOG4547 consensus WD40 repeat-containing protein [General function prediction only] Back     alignment and domain information
>TIGR02800 propeller_TolB tol-pal system beta propeller repeat protein TolB Back     alignment and domain information
>KOG2321 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG1912 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>TIGR03300 assembly_YfgL outer membrane assembly lipoprotein YfgL Back     alignment and domain information
>COG5354 Uncharacterized protein, contains Trp-Asp (WD) repeat [General function prediction only] Back     alignment and domain information
>PF01602 Adaptin_N: Adaptin N terminal region; InterPro: IPR002553 Proteins synthesized on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>KOG1409 consensus Uncharacterized conserved protein, contains WD40 repeats and FYVE domains [Function unknown] Back     alignment and domain information
>KOG2171 consensus Karyopherin (importin) beta 3 [Nuclear structure; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG2314 consensus Translation initiation factor 3, subunit b (eIF-3b) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>COG2706 3-carboxymuconate cyclase [Carbohydrate transport and metabolism] Back     alignment and domain information
>TIGR02658 TTQ_MADH_Hv methylamine dehydrogenase heavy chain Back     alignment and domain information
>PF10282 Lactonase: Lactonase, 7-bladed beta-propeller; InterPro: IPR019405 6-phosphogluconolactonases (6PGL) 3 Back     alignment and domain information
>KOG2041 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PRK01029 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG3914 consensus WD repeat protein WDR4 [Function unknown] Back     alignment and domain information
>PRK04792 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PLN02919 haloacid dehalogenase-like hydrolase family protein Back     alignment and domain information
>PLN02919 haloacid dehalogenase-like hydrolase family protein Back     alignment and domain information
>PRK00178 tolB translocation protein TolB; Provisional Back     alignment and domain information
>TIGR03300 assembly_YfgL outer membrane assembly lipoprotein YfgL Back     alignment and domain information
>KOG1242 consensus Protein containing adaptin N-terminal region [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG1242 consensus Protein containing adaptin N-terminal region [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG4714 consensus Nucleoporin [Nuclear structure] Back     alignment and domain information
>PTZ00429 beta-adaptin; Provisional Back     alignment and domain information
>PF01602 Adaptin_N: Adaptin N terminal region; InterPro: IPR002553 Proteins synthesized on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>PF04762 IKI3: IKI3 family; InterPro: IPR006849 Members of this family are components of the elongator multi-subunit component of a novel RNA polymerase II holoenzyme for transcriptional elongation [] Back     alignment and domain information
>KOG2041 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0213 consensus Splicing factor 3b, subunit 1 [RNA processing and modification] Back     alignment and domain information
>PF00400 WD40: WD domain, G-beta repeat; InterPro: IPR019781 WD-40 repeats (also known as WD or beta-transducin repeats) are short ~40 amino acid motifs, often terminating in a Trp-Asp (W-D) dipeptide Back     alignment and domain information
>PF04762 IKI3: IKI3 family; InterPro: IPR006849 Members of this family are components of the elongator multi-subunit component of a novel RNA polymerase II holoenzyme for transcriptional elongation [] Back     alignment and domain information
>KOG2023 consensus Nuclear transport receptor Karyopherin-beta2/Transportin (importin beta superfamily) [Nuclear structure; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG4532 consensus WD40-like repeat containing protein [General function prediction only] Back     alignment and domain information
>KOG0309 consensus Conserved WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>COG5181 HSH155 U2 snRNP spliceosome subunit [RNA processing and modification] Back     alignment and domain information
>KOG1912 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG3914 consensus WD repeat protein WDR4 [Function unknown] Back     alignment and domain information
>KOG4714 consensus Nucleoporin [Nuclear structure] Back     alignment and domain information
>KOG0882 consensus Cyclophilin-related peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG2706 3-carboxymuconate cyclase [Carbohydrate transport and metabolism] Back     alignment and domain information
>COG4946 Uncharacterized protein related to the periplasmic component of the Tol biopolymer transport system [Function unknown] Back     alignment and domain information
>KOG2023 consensus Nuclear transport receptor Karyopherin-beta2/Transportin (importin beta superfamily) [Nuclear structure; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PRK04043 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PF15492 Nbas_N: Neuroblastoma-amplified sequence, N terminal Back     alignment and domain information
>COG5354 Uncharacterized protein, contains Trp-Asp (WD) repeat [General function prediction only] Back     alignment and domain information
>PF13360 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 3Q54_A 2YH3_A 3PRW_A 3P1L_A 3Q7M_A 3Q7O_A 3Q7N_A Back     alignment and domain information
>TIGR02658 TTQ_MADH_Hv methylamine dehydrogenase heavy chain Back     alignment and domain information
>KOG1241 consensus Karyopherin (importin) beta 1 [Nuclear structure; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG2695 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>COG4946 Uncharacterized protein related to the periplasmic component of the Tol biopolymer transport system [Function unknown] Back     alignment and domain information
>KOG0882 consensus Cyclophilin-related peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF15492 Nbas_N: Neuroblastoma-amplified sequence, N terminal Back     alignment and domain information
>PF10508 Proteasom_PSMB: Proteasome non-ATPase 26S subunit; InterPro: IPR019538 The 26S proteasome is an enzymatic complex that degrades ubiquitinated proteins in eukaryotic cells Back     alignment and domain information
>KOG1824 consensus TATA-binding protein-interacting protein [General function prediction only] Back     alignment and domain information
>KOG1832 consensus HIV-1 Vpr-binding protein [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG4532 consensus WD40-like repeat containing protein [General function prediction only] Back     alignment and domain information
>PRK11138 outer membrane biogenesis protein BamB; Provisional Back     alignment and domain information
>PF07433 DUF1513: Protein of unknown function (DUF1513); InterPro: IPR008311 There are currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function Back     alignment and domain information
>PTZ00429 beta-adaptin; Provisional Back     alignment and domain information
>KOG1243 consensus Protein kinase [General function prediction only] Back     alignment and domain information
>KOG2314 consensus Translation initiation factor 3, subunit b (eIF-3b) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PF12348 CLASP_N: CLASP N terminal; InterPro: IPR024395 This domain is found in the N-terminal region of CLIP-associated proteins (CLASPs), which are widely conserved microtubule plus-end-tracking proteins that regulate the stability of dynamic microtubules [, ] Back     alignment and domain information
>KOG2695 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PF13360 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 3Q54_A 2YH3_A 3PRW_A 3P1L_A 3Q7M_A 3Q7O_A 3Q7N_A Back     alignment and domain information
>PF08450 SGL: SMP-30/Gluconolaconase/LRE-like region; InterPro: IPR013658 This family describes a region that is found in proteins expressed by a variety of eukaryotic and prokaryotic species Back     alignment and domain information
>PLN03200 cellulose synthase-interactive protein; Provisional Back     alignment and domain information
>COG5170 CDC55 Serine/threonine protein phosphatase 2A, regulatory subunit [Signal transduction mechanisms] Back     alignment and domain information
>KOG1060 consensus Vesicle coat complex AP-3, beta subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG2066 consensus Vacuolar assembly/sorting protein VPS41 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PRK11138 outer membrane biogenesis protein BamB; Provisional Back     alignment and domain information
>PRK04043 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG2066 consensus Vacuolar assembly/sorting protein VPS41 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1645 consensus RING-finger-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF00400 WD40: WD domain, G-beta repeat; InterPro: IPR019781 WD-40 repeats (also known as WD or beta-transducin repeats) are short ~40 amino acid motifs, often terminating in a Trp-Asp (W-D) dipeptide Back     alignment and domain information
>PF08450 SGL: SMP-30/Gluconolaconase/LRE-like region; InterPro: IPR013658 This family describes a region that is found in proteins expressed by a variety of eukaryotic and prokaryotic species Back     alignment and domain information
>KOG0213 consensus Splicing factor 3b, subunit 1 [RNA processing and modification] Back     alignment and domain information
>KOG2137 consensus Protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG1645 consensus RING-finger-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1275 consensus PAB-dependent poly(A) ribonuclease, subunit PAN2 [Replication, recombination and repair] Back     alignment and domain information
>PF08596 Lgl_C: Lethal giant larvae(Lgl) like, C-terminal; InterPro: IPR013905 The Lethal giant larvae (Lgl) tumour suppressor protein is conserved from yeast to mammals Back     alignment and domain information
>PF07433 DUF1513: Protein of unknown function (DUF1513); InterPro: IPR008311 There are currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function Back     alignment and domain information
>KOG2114 consensus Vacuolar assembly/sorting protein PEP5/VPS11 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1275 consensus PAB-dependent poly(A) ribonuclease, subunit PAN2 [Replication, recombination and repair] Back     alignment and domain information
>KOG2259 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG1413 FOG: HEAT repeat [Energy production and conversion] Back     alignment and domain information
>COG5170 CDC55 Serine/threonine protein phosphatase 2A, regulatory subunit [Signal transduction mechanisms] Back     alignment and domain information
>KOG2137 consensus Protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG3617 consensus WD40 and TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG4649 consensus PQQ (pyrrolo-quinoline quinone) repeat protein [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PF10508 Proteasom_PSMB: Proteasome non-ATPase 26S subunit; InterPro: IPR019538 The 26S proteasome is an enzymatic complex that degrades ubiquitinated proteins in eukaryotic cells Back     alignment and domain information
>KOG2025 consensus Chromosome condensation complex Condensin, subunit G [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG2114 consensus Vacuolar assembly/sorting protein PEP5/VPS11 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PLN03200 cellulose synthase-interactive protein; Provisional Back     alignment and domain information
>PF12717 Cnd1: non-SMC mitotic condensation complex subunit 1 Back     alignment and domain information
>KOG0212 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG0915 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF12348 CLASP_N: CLASP N terminal; InterPro: IPR024395 This domain is found in the N-terminal region of CLIP-associated proteins (CLASPs), which are widely conserved microtubule plus-end-tracking proteins that regulate the stability of dynamic microtubules [, ] Back     alignment and domain information
>KOG3617 consensus WD40 and TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG4649 consensus PQQ (pyrrolo-quinoline quinone) repeat protein [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>TIGR02270 conserved hypothetical protein Back     alignment and domain information
>COG1413 FOG: HEAT repeat [Energy production and conversion] Back     alignment and domain information
>cd00216 PQQ_DH Dehydrogenases with pyrrolo-quinoline quinone (PQQ) as cofactor, like ethanol, methanol, and membrane bound glucose dehydrogenases Back     alignment and domain information
>cd00020 ARM Armadillo/beta-catenin-like repeats Back     alignment and domain information
>COG5096 Vesicle coat complex, various subunits [Intracellular trafficking and secretion] Back     alignment and domain information
>KOG1832 consensus HIV-1 Vpr-binding protein [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG3621 consensus WD40 repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG1920 consensus IkappaB kinase complex, IKAP component [Transcription] Back     alignment and domain information
>PF04841 Vps16_N: Vps16, N-terminal region; InterPro: IPR006926 This protein forms part of the Class C vacuolar protein sorting (Vps) complex Back     alignment and domain information
>PF12755 Vac14_Fab1_bd: Vacuolar 14 Fab1-binding region Back     alignment and domain information
>COG5181 HSH155 U2 snRNP spliceosome subunit [RNA processing and modification] Back     alignment and domain information
>PF12717 Cnd1: non-SMC mitotic condensation complex subunit 1 Back     alignment and domain information
>KOG1008 consensus Uncharacterized conserved protein, contains WD40 repeats [Function unknown] Back     alignment and domain information
>KOG4653 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF13646 HEAT_2: HEAT repeats; PDB: 1OYZ_A 3FGA_A 2PF4_C 2IAE_A 3B2A_A Back     alignment and domain information
>TIGR02270 conserved hypothetical protein Back     alignment and domain information
>smart00320 WD40 WD40 repeats Back     alignment and domain information
>KOG1243 consensus Protein kinase [General function prediction only] Back     alignment and domain information
>PF13646 HEAT_2: HEAT repeats; PDB: 1OYZ_A 3FGA_A 2PF4_C 2IAE_A 3B2A_A Back     alignment and domain information
>PF11768 DUF3312: Protein of unknown function (DUF3312); InterPro: IPR024511 This is a eukaryotic family of uncharacterised proteins that contain WD40 repeats Back     alignment and domain information
>PF02985 HEAT: HEAT repeat; InterPro: IPR000357 The HEAT repeat is a tandemly repeated, 37-47 amino acid long module occurring in a number of cytoplasmic proteins, including the four name-giving proteins huntingtin, elongation factor 3 (EF3), the 65 Kd alpha regulatory subunit of protein phosphatase 2A (PP2A) and the yeast PI3-kinase TOR1 [] Back     alignment and domain information
>KOG0166 consensus Karyopherin (importin) alpha [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF05918 API5: Apoptosis inhibitory protein 5 (API5); InterPro: IPR008383 This family consists of apoptosis inhibitory protein 5 (API5) sequences from several organisms Back     alignment and domain information
>KOG1241 consensus Karyopherin (importin) beta 1 [Nuclear structure; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>COG5218 YCG1 Chromosome condensation complex Condensin, subunit G [Chromatin structure and dynamics / Cell division and chromosome partitioning] Back     alignment and domain information
>KOG4224 consensus Armadillo repeat protein VAC8 required for vacuole fusion, inheritance and cytosol-to-vacuole protein targeting [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF11768 DUF3312: Protein of unknown function (DUF3312); InterPro: IPR024511 This is a eukaryotic family of uncharacterised proteins that contain WD40 repeats Back     alignment and domain information
>PF06433 Me-amine-dh_H: Methylamine dehydrogenase heavy chain (MADH); InterPro: IPR009451 Methylamine dehydrogenase (1 Back     alignment and domain information
>cd00020 ARM Armadillo/beta-catenin-like repeats Back     alignment and domain information
>PF06977 SdiA-regulated: SdiA-regulated; InterPro: IPR009722 This entry represents a conserved region approximately 100 residues long within a number of hypothetical bacterial proteins that may be regulated by SdiA, a member of the LuxR family of transcriptional regulators [] Back     alignment and domain information
>KOG1920 consensus IkappaB kinase complex, IKAP component [Transcription] Back     alignment and domain information
>PF12755 Vac14_Fab1_bd: Vacuolar 14 Fab1-binding region Back     alignment and domain information
>KOG1820 consensus Microtubule-associated protein [Cytoskeleton] Back     alignment and domain information
>PRK02888 nitrous-oxide reductase; Validated Back     alignment and domain information
>PF13513 HEAT_EZ: HEAT-like repeat; PDB: 2Z5J_A 2OT8_B 2Z5O_A 2H4M_A 2QMR_A 1QBK_B 2Z5M_A 2Z5K_A 2Z5N_A 1GCJ_B Back     alignment and domain information
>KOG1949 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG0166 consensus Karyopherin (importin) alpha [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>cd00216 PQQ_DH Dehydrogenases with pyrrolo-quinoline quinone (PQQ) as cofactor, like ethanol, methanol, and membrane bound glucose dehydrogenases Back     alignment and domain information
>PF00930 DPPIV_N: Dipeptidyl peptidase IV (DPP IV) N-terminal region; InterPro: IPR002469 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>PF14783 BBS2_Mid: Ciliary BBSome complex subunit 2, middle region Back     alignment and domain information
>PF08596 Lgl_C: Lethal giant larvae(Lgl) like, C-terminal; InterPro: IPR013905 The Lethal giant larvae (Lgl) tumour suppressor protein is conserved from yeast to mammals Back     alignment and domain information
>PF08553 VID27: VID27 cytoplasmic protein; InterPro: IPR013863 This entry represents fungal and plant proteins and contains many hypothetical proteins Back     alignment and domain information
>PF14783 BBS2_Mid: Ciliary BBSome complex subunit 2, middle region Back     alignment and domain information
>KOG1820 consensus Microtubule-associated protein [Cytoskeleton] Back     alignment and domain information
>KOG0212 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG5215 KAP95 Karyopherin (importin) beta [Intracellular trafficking and secretion] Back     alignment and domain information
>PF04841 Vps16_N: Vps16, N-terminal region; InterPro: IPR006926 This protein forms part of the Class C vacuolar protein sorting (Vps) complex Back     alignment and domain information
>PF02985 HEAT: HEAT repeat; InterPro: IPR000357 The HEAT repeat is a tandemly repeated, 37-47 amino acid long module occurring in a number of cytoplasmic proteins, including the four name-giving proteins huntingtin, elongation factor 3 (EF3), the 65 Kd alpha regulatory subunit of protein phosphatase 2A (PP2A) and the yeast PI3-kinase TOR1 [] Back     alignment and domain information
>PF00780 CNH: CNH domain; InterPro: IPR001180 Based on sequence similarities a domain of homology has been identified in the following proteins []: Citron and Citron kinase Back     alignment and domain information
>KOG0915 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG4640 consensus Anaphase-promoting complex (APC), subunit 4 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1008 consensus Uncharacterized conserved protein, contains WD40 repeats [Function unknown] Back     alignment and domain information
>PRK02888 nitrous-oxide reductase; Validated Back     alignment and domain information
>PF12460 MMS19_C: RNAPII transcription regulator C-terminal; InterPro: IPR024687 This domain, approximately 60 amino acids in length, is found in the N-terminal region of MMS19 proteins Back     alignment and domain information
>TIGR03075 PQQ_enz_alc_DH PQQ-dependent dehydrogenase, methanol/ethanol family Back     alignment and domain information
>PF06977 SdiA-regulated: SdiA-regulated; InterPro: IPR009722 This entry represents a conserved region approximately 100 residues long within a number of hypothetical bacterial proteins that may be regulated by SdiA, a member of the LuxR family of transcriptional regulators [] Back     alignment and domain information
>PF04053 Coatomer_WDAD: Coatomer WD associated region ; InterPro: IPR006692 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>KOG1824 consensus TATA-binding protein-interacting protein [General function prediction only] Back     alignment and domain information
>KOG2259 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG5098 Chromosome condensation complex Condensin, subunit D2 [Chromatin structure and dynamics / Cell division and chromosome partitioning] Back     alignment and domain information
>PF06433 Me-amine-dh_H: Methylamine dehydrogenase heavy chain (MADH); InterPro: IPR009451 Methylamine dehydrogenase (1 Back     alignment and domain information
>PF03178 CPSF_A: CPSF A subunit region; InterPro: IPR004871 This family includes a region that lies towards the C terminus of the cleavage and polyadenylation specificity factor (CPSF) A (160 kDa) subunit Back     alignment and domain information
>KOG3621 consensus WD40 repeat-containing protein [General function prediction only] Back     alignment and domain information
>COG3490 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>COG0823 TolB Periplasmic component of the Tol biopolymer transport system [Intracellular trafficking and secretion] Back     alignment and domain information
>COG0823 TolB Periplasmic component of the Tol biopolymer transport system [Intracellular trafficking and secretion] Back     alignment and domain information
>KOG1059 consensus Vesicle coat complex AP-3, delta subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF14583 Pectate_lyase22: Oligogalacturonate lyase; PDB: 3C5M_C 3PE7_A Back     alignment and domain information
>KOG1949 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1078 consensus Vesicle coat complex COPI, gamma subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF04053 Coatomer_WDAD: Coatomer WD associated region ; InterPro: IPR006692 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>COG5215 KAP95 Karyopherin (importin) beta [Intracellular trafficking and secretion] Back     alignment and domain information
>PF03178 CPSF_A: CPSF A subunit region; InterPro: IPR004871 This family includes a region that lies towards the C terminus of the cleavage and polyadenylation specificity factor (CPSF) A (160 kDa) subunit Back     alignment and domain information
>COG5240 SEC21 Vesicle coat complex COPI, gamma subunit [Intracellular trafficking and secretion] Back     alignment and domain information
>smart00320 WD40 WD40 repeats Back     alignment and domain information
>COG3391 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2079 consensus Vacuolar assembly/sorting protein VPS8 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF02897 Peptidase_S9_N: Prolyl oligopeptidase, N-terminal beta-propeller domain; InterPro: IPR004106 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>KOG1248 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1061 consensus Vesicle coat complex AP-1/AP-2/AP-4, beta subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>COG5096 Vesicle coat complex, various subunits [Intracellular trafficking and secretion] Back     alignment and domain information
>PF10521 DUF2454: Protein of unknown function (DUF2454); InterPro: IPR018870 Putative protein of unknown function; subunit of the ASTRA complex which is part of the chromatin remodeling machinery; similar to Schizosaccharomyces pombe (Fission yeast) Tti2p; may interact with Rsm23p [] Back     alignment and domain information
>PF08553 VID27: VID27 cytoplasmic protein; InterPro: IPR013863 This entry represents fungal and plant proteins and contains many hypothetical proteins Back     alignment and domain information
>PF04826 Arm_2: Armadillo-like; InterPro: IPR006911 This entry consists of mammalian proteins of unknown function Back     alignment and domain information
>PF13513 HEAT_EZ: HEAT-like repeat; PDB: 2Z5J_A 2OT8_B 2Z5O_A 2H4M_A 2QMR_A 1QBK_B 2Z5M_A 2Z5K_A 2Z5N_A 1GCJ_B Back     alignment and domain information
>KOG1077 consensus Vesicle coat complex AP-2, alpha subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF00780 CNH: CNH domain; InterPro: IPR001180 Based on sequence similarities a domain of homology has been identified in the following proteins []: Citron and Citron kinase Back     alignment and domain information
>PF14655 RAB3GAP2_N: Rab3 GTPase-activating protein regulatory subunit N-terminus Back     alignment and domain information
>KOG4640 consensus Anaphase-promoting complex (APC), subunit 4 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4653 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1897 consensus Damage-specific DNA binding complex, subunit DDB1 [Replication, recombination and repair] Back     alignment and domain information
>PF08506 Cse1: Cse1; InterPro: IPR013713 The exchange of macromolecules between the nucleus and cytoplasm takes place through nuclear pore complexes within the nuclear membrane Back     alignment and domain information
>KOG2079 consensus Vacuolar assembly/sorting protein VPS8 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF05004 IFRD: Interferon-related developmental regulator (IFRD); InterPro: IPR007701 Interferon-related developmental regulator (IFRD1) is the human homologue of the Rattus norvegicus early response protein PC4 and its murine homologue TIS7 [] Back     alignment and domain information
>PF05004 IFRD: Interferon-related developmental regulator (IFRD); InterPro: IPR007701 Interferon-related developmental regulator (IFRD1) is the human homologue of the Rattus norvegicus early response protein PC4 and its murine homologue TIS7 [] Back     alignment and domain information
>COG3386 Gluconolactonase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PF02897 Peptidase_S9_N: Prolyl oligopeptidase, N-terminal beta-propeller domain; InterPro: IPR004106 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>KOG2395 consensus Protein involved in vacuole import and degradation [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG2280 consensus Vacuolar assembly/sorting protein VPS16 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0414 consensus Chromosome condensation complex Condensin, subunit D2 [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PF12530 DUF3730: Protein of unknown function (DUF3730) ; InterPro: IPR022542 This domain is found in eukaryotes, and is typically between 220 and 262 amino acids in length Back     alignment and domain information
>COG5240 SEC21 Vesicle coat complex COPI, gamma subunit [Intracellular trafficking and secretion] Back     alignment and domain information
>KOG0567 consensus HEAT repeat-containing protein [General function prediction only] Back     alignment and domain information
>TIGR03074 PQQ_membr_DH membrane-bound PQQ-dependent dehydrogenase, glucose/quinate/shikimate family Back     alignment and domain information
>PF05096 Glu_cyclase_2: Glutamine cyclotransferase; InterPro: IPR007788 This family of enzymes 2 Back     alignment and domain information
>COG5656 SXM1 Importin, protein involved in nuclear import [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2956 consensus CLIP-associating protein [General function prediction only] Back     alignment and domain information
>COG3386 Gluconolactonase [Carbohydrate transport and metabolism] Back     alignment and domain information
>TIGR03075 PQQ_enz_alc_DH PQQ-dependent dehydrogenase, methanol/ethanol family Back     alignment and domain information
>KOG1916 consensus Nuclear protein, contains WD40 repeats [General function prediction only] Back     alignment and domain information
>KOG2444 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PF10168 Nup88: Nuclear pore component; InterPro: IPR019321 Nup88 can be divided into two structural domains; the N-terminal two-thirds of the protein have no obvious structural motifs Back     alignment and domain information
>KOG1992 consensus Nuclear export receptor CSE1/CAS (importin beta superfamily) [Nuclear structure; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1062 consensus Vesicle coat complex AP-1, gamma subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF05096 Glu_cyclase_2: Glutamine cyclotransferase; InterPro: IPR007788 This family of enzymes 2 Back     alignment and domain information
>KOG0168 consensus Putative ubiquitin fusion degradation protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG3204 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PRK13616 lipoprotein LpqB; Provisional Back     alignment and domain information
>PF14583 Pectate_lyase22: Oligogalacturonate lyase; PDB: 3C5M_C 3PE7_A Back     alignment and domain information
>PF13251 DUF4042: Domain of unknown function (DUF4042) Back     alignment and domain information
>PF12719 Cnd3: Nuclear condensing complex subunits, C-term domain Back     alignment and domain information
>KOG1248 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF05694 SBP56: 56kDa selenium binding protein (SBP56); InterPro: IPR008826 This family consists of several eukaryotic selenium binding proteins as well as three sequences from archaea Back     alignment and domain information
>KOG1897 consensus Damage-specific DNA binding complex, subunit DDB1 [Replication, recombination and repair] Back     alignment and domain information
>KOG2025 consensus Chromosome condensation complex Condensin, subunit G [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PF05804 KAP: Kinesin-associated protein (KAP) Back     alignment and domain information
>COG3490 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PRK13616 lipoprotein LpqB; Provisional Back     alignment and domain information
>KOG4224 consensus Armadillo repeat protein VAC8 required for vacuole fusion, inheritance and cytosol-to-vacuole protein targeting [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1943 consensus Beta-tubulin folding cofactor D [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF12719 Cnd3: Nuclear condensing complex subunits, C-term domain Back     alignment and domain information
>KOG2395 consensus Protein involved in vacuole import and degradation [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF14655 RAB3GAP2_N: Rab3 GTPase-activating protein regulatory subunit N-terminus Back     alignment and domain information
>TIGR03074 PQQ_membr_DH membrane-bound PQQ-dependent dehydrogenase, glucose/quinate/shikimate family Back     alignment and domain information
>KOG3630 consensus Nuclear pore complex, Nup214/CAN component [Nuclear structure; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF12830 Nipped-B_C: Sister chromatid cohesion C-terminus Back     alignment and domain information
>KOG1060 consensus Vesicle coat complex AP-3, beta subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1020 consensus Sister chromatid cohesion protein SCC2/Nipped-B [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning; Replication, recombination and repair] Back     alignment and domain information
>KOG1061 consensus Vesicle coat complex AP-1/AP-2/AP-4, beta subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query1249
3gre_A437 Crystal Structure Of Saccharomyces Cerevisiae Vps15 2e-10
3n0d_A315 Crystal Structure Of Wdr5 Mutant (W330f) Length = 3 6e-04
3n0e_A315 Crystal Structure Of Wdr5 Mutant (W330y) Length = 3 6e-04
3mxx_A315 Crystal Structure Of Wdr5 Mutant (S62a) Length = 31 6e-04
2g9a_A311 Structural Basis For The Specific Recognition Of Me 7e-04
2g99_A308 Structural Basis For The Specific Recognition Of Me 7e-04
3smr_A312 Crystal Structure Of Human Wd Repeat Domain 5 With 7e-04
2h13_A317 Crystal Structure Of Wdr5HISTONE H3 COMPLEX Length 8e-04
2h9l_A329 Wdr5delta23 Length = 329 8e-04
2h68_A312 Histone H3 Recognition And Presentation By The Wdr5 8e-04
3emh_A318 Structural Basis Of Wdr5-Mll Interaction Length = 3 9e-04
2h9m_A313 Wdr5 In Complex With Unmodified H3k4 Peptide Length 9e-04
3psl_A318 Fine-Tuning The Stimulation Of Mll1 Methyltransfera 9e-04
>pdb|3GRE|A Chain A, Crystal Structure Of Saccharomyces Cerevisiae Vps15 Wd Repeat Domain Length = 437 Back     alignment and structure 
Iteration: 1

 Score = 65.1 bits (157), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 59/267 (22%), Positives = 115/267 (43%), Gaps = 37/267 (13%)
Query: 824  RGILVAHLQEH-CSAVNEIAISHDHS-FFVSASDDSTVKVWDSRKLEKDISFRSRLTYHL 881
            RG L+A L E+  +++   A+S   + + ++ SD   +K+W+ +++     + S LTY  
Sbjct: 51   RGKLIATLMENEPNSITSSAVSPGETPYLITGSDQGVIKIWNLKEIIVGEVYSSSLTYDC 110
Query: 882  EGSRALCTMMLRHSAQVVVGACDGIIHMFSVDHISRGLGNVEKYSGISDIKKKDTKEGAI 941
              +    TM+    A   V + DG I +  V+H          Y   S++K  + +    
Sbjct: 111  SSTVTQITMIPNFDA-FAVSSKDGQIIVLKVNH----------YQQESEVKFLNCECIRK 159
Query: 942  VTLVNYNTDNCASHMFMYSTQNCG----------IHLWDTRSNSNTWTLKAIPEEGYVSS 991
            + L N+  +  A  M  +  +             + ++D R+      ++  P  G VSS
Sbjct: 160  INLKNFGKNEYAVRMRAFVNEEKSLLVALTNLSRVIIFDIRTLERLQIIENSPRHGAVSS 219
Query: 992  LVTGPCGNWFVSGSSRGVLTLWDLRFLVPVNSWQYSQVCPIE--KMCLFVPPPNAAVSTT 1049
            +         + G++RG++ +WD+RF V + SW +    PI   ++C F           
Sbjct: 220  ICIDEECCVLILGTTRGIIDIWDIRFNVLIRSWSFGDHAPITHVEVCQFY---------- 269
Query: 1050 ARPLIYVAAGCNE--VSLWNAENGSCH 1074
             +  + V  G ++  +++WN   G C 
Sbjct: 270  GKNSVIVVGGSSKTFLTIWNFVKGHCQ 296
>pdb|3N0D|A Chain A, Crystal Structure Of Wdr5 Mutant (W330f) Length = 315 Back     alignment and structure
>pdb|3N0E|A Chain A, Crystal Structure Of Wdr5 Mutant (W330y) Length = 315 Back     alignment and structure
>pdb|3MXX|A Chain A, Crystal Structure Of Wdr5 Mutant (S62a) Length = 315 Back     alignment and structure
>pdb|2G9A|A Chain A, Structural Basis For The Specific Recognition Of Methylated Histone H3 Lysine 4 By The Wd-40 Protein Wdr5 Length = 311 Back     alignment and structure
>pdb|2G99|A Chain A, Structural Basis For The Specific Recognition Of Methylated Histone H3 Lysine 4 By The Wd-40 Protein Wdr5 Length = 308 Back     alignment and structure
>pdb|3SMR|A Chain A, Crystal Structure Of Human Wd Repeat Domain 5 With Compound Length = 312 Back     alignment and structure
>pdb|2H13|A Chain A, Crystal Structure Of Wdr5HISTONE H3 COMPLEX Length = 317 Back     alignment and structure
>pdb|2H9L|A Chain A, Wdr5delta23 Length = 329 Back     alignment and structure
>pdb|2H68|A Chain A, Histone H3 Recognition And Presentation By The Wdr5 Module Of The Mll1 Complex Length = 312 Back     alignment and structure
>pdb|3EMH|A Chain A, Structural Basis Of Wdr5-Mll Interaction Length = 318 Back     alignment and structure
>pdb|2H9M|A Chain A, Wdr5 In Complex With Unmodified H3k4 Peptide Length = 313 Back     alignment and structure
>pdb|3PSL|A Chain A, Fine-Tuning The Stimulation Of Mll1 Methyltransferase Activity By A Histone H3 Based Peptide Mimetic Length = 318 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

No hit with probability above 80.00

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 1249
d1vyhc1317 b.69.4.1 (C:92-408) Platelet-activating factor ace 5e-14
d1vyhc1317 b.69.4.1 (C:92-408) Platelet-activating factor ace 2e-07
d1erja_388 b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yea 5e-13
d1erja_388 b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yea 3e-05
d1erja_388 b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yea 7e-05
d1erja_388 b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yea 5e-04
d1erja_388 b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yea 0.002
d1erja_388 b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yea 0.004
d1u6gc_ 1207 a.118.1.2 (C:) Cullin-associated NEDD8-dissociated 2e-12
d1u6gc_1207 a.118.1.2 (C:) Cullin-associated NEDD8-dissociated 5e-09
d1u6gc_ 1207 a.118.1.2 (C:) Cullin-associated NEDD8-dissociated 1e-07
d1u6gc_1207 a.118.1.2 (C:) Cullin-associated NEDD8-dissociated 4e-05
d1tbga_340 b.69.4.1 (A:) beta1-subunit of the signal-transduc 1e-11
d1tbga_340 b.69.4.1 (A:) beta1-subunit of the signal-transduc 7e-10
d1tbga_340 b.69.4.1 (A:) beta1-subunit of the signal-transduc 4e-06
d1tbga_340 b.69.4.1 (A:) beta1-subunit of the signal-transduc 2e-05
d1k8kc_371 b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 1e-11
d1k8kc_371 b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 7e-10
d1k8kc_371 b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 3e-04
d2ovrb2342 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing 9e-11
d1b3ua_588 a.118.1.2 (A:) Constant regulatory domain of prote 1e-09
d1b3ua_588 a.118.1.2 (A:) Constant regulatory domain of prote 2e-09
d1b3ua_588 a.118.1.2 (A:) Constant regulatory domain of prote 2e-07
d1b3ua_588 a.118.1.2 (A:) Constant regulatory domain of prote 2e-07
d1b3ua_588 a.118.1.2 (A:) Constant regulatory domain of prote 2e-04
d1b3ua_588 a.118.1.2 (A:) Constant regulatory domain of prote 4e-04
d1nr0a2299 b.69.4.1 (A:313-611) Actin interacting protein 1 { 1e-09
d1nr0a2299 b.69.4.1 (A:313-611) Actin interacting protein 1 { 6e-05
d1nr0a2299 b.69.4.1 (A:313-611) Actin interacting protein 1 { 4e-04
d1qgra_876 a.118.1.1 (A:) Importin beta {Human (Homo sapiens) 4e-09
d1jmxb_346 b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase 2e-08
d1jmxb_346 b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase 8e-04
d1p22a2293 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (be 2e-08
d1p22a2293 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (be 4e-07
d1p22a2293 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (be 4e-05
d2vgla_584 a.118.1.10 (A:) Adaptin alpha C subunit N-terminal 4e-08
d1yfqa_342 b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Bake 7e-08
d1sq9a_393 b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Bake 2e-07
d1sq9a_393 b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Bake 4e-06
d1sq9a_393 b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Bake 8e-05
d1sq9a_393 b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Bake 5e-04
d1sq9a_ 393 b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Bake 0.001
d1pbyb_337 b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase 8e-07
d1pbyb_337 b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase 7e-04
d1pbyb_337 b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase 0.002
d1gxra_337 b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Hum 8e-07
d1gxra_337 b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Hum 4e-05
d1gxra_337 b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Hum 4e-05
d1gxra_337 b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Hum 6e-05
d1pgua2287 b.69.4.1 (A:327-613) Actin interacting protein 1 { 5e-06
d1pgua2287 b.69.4.1 (A:327-613) Actin interacting protein 1 { 0.003
d1ibrb_458 a.118.1.1 (B:) Importin beta {Human (Homo sapiens) 7e-06
d1ibrb_458 a.118.1.1 (B:) Importin beta {Human (Homo sapiens) 7e-05
d1nexb2355 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker' 1e-05
d1k32a3360 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Ar 2e-05
d1k32a3360 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Ar 3e-05
d1k32a3360 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Ar 0.001
d1nr0a1311 b.69.4.1 (A:2-312) Actin interacting protein 1 {Ne 3e-05
d2bpta1861 a.118.1.1 (A:1-861) Importin beta {Baker's yeast ( 4e-05
d1pgua1325 b.69.4.1 (A:2-326) Actin interacting protein 1 {Ba 3e-04
d1pgua1325 b.69.4.1 (A:2-326) Actin interacting protein 1 {Ba 0.004
d1l0qa2301 b.69.2.3 (A:1-301) Surface layer protein {Archaeon 7e-04
d2bbkh_355 b.69.2.1 (H:) Methylamine dehydrogenase, H-chain { 0.002
d2vglb_579 a.118.1.10 (B:) Adaptin beta subunit N-terminal fr 0.002
d1qbkb_888 a.118.1.1 (B:) Karyopherin beta2 {Human (Homo sapi 0.004
>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Length = 317 Back     information, alignment and structure

class: All beta proteins
fold: 7-bladed beta-propeller
superfamily: WD40 repeat-like
family: WD40-repeat
domain: Platelet-activating factor acetylhydrolase IB subunit alpha
species: Mouse (Mus musculus) [TaxId: 10090]

 Score = 72.1 bits (175), Expect = 5e-14
 Identities = 52/347 (14%), Positives = 103/347 (29%), Gaps = 44/347 (12%)

Query: 821  WRPRGILVAHLQEHCSAVNEIAISHDHSFFVSASDDSTVKVWDSRKLEKDISFRSRLTYH 880
            W PR      L  H S V  +      S  VSAS+D+T+KVWD    +    F   L  H
Sbjct: 3    WIPRPPEKYALSGHRSPVTRVIFHPVFSVMVSASEDATIKVWDYETGD----FERTLKGH 58

Query: 881  LEGSRALCTMMLRHSAQVVVGACDGIIHMFSVDHISRGLGNVEKYSGISDIKKKDTKEGA 940
             +  + +                   +  F      R +   +                 
Sbjct: 59   TDSVQDISFDHSGKLLASCSADMTIKLWDFQGFECIRTMHGHDHN--------------- 103

Query: 941  IVTLVNYNTDNCASHMFMYSTQNCGIHLWDTRSNSNTWTLKAIPEEGYVSSLVTGPCGNW 1000
                V+  +        + ++++  I +W+ ++     T        +V  +     G  
Sbjct: 104  ----VSSVSIMPNGDHIVSASRDKTIKMWEVQTGYCVKTFTG--HREWVRMVRPNQDGTL 157

Query: 1001 FVSGSSRGVLTLWDLRFLVPV-------NSWQYSQVCPIEKMCLFVPPPNAAVSTTARPL 1053
              S S+   + +W +             +  +     P            +    + +P 
Sbjct: 158  IASCSNDQTVRVWVVATKECKAELREHRHVVECISWAPESSYSSISEATGSETKKSGKPG 217

Query: 1054 IYVAAGC--NEVSLWNAENGSCHQVLRTANYDGDTEMSDLPWAFARPS--SRSNPKTDLR 1109
             ++ +G     + +W+   G C   L       D  +  + +        S ++ KT   
Sbjct: 218  PFLLSGSRDKTIKMWDVSTGMCLMTLV----GHDNWVRGVLFHSGGKFILSCADDKTLRV 273

Query: 1110 RNVNQKYRVDELNEPPPRLLGIRSLLPLPGGDLL-TGGTDLKIRRWD 1155
             +   K  +  LN        + SL        + TG  D  ++ W+
Sbjct: 274  WDYKNKRCMKTLNAHEHF---VTSLDFHKTAPYVVTGSVDQTVKVWE 317
>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Length = 317 Back     information, alignment and structure
>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 388 Back     information, alignment and structure
>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 388 Back     information, alignment and structure
>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 388 Back     information, alignment and structure
>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 388 Back     information, alignment and structure
>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 388 Back     information, alignment and structure
>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 388 Back     information, alignment and structure
>d1u6gc_ a.118.1.2 (C:) Cullin-associated NEDD8-dissociated protein 1 (Tip120) {Human (Homo sapiens) [TaxId: 9606]} Length = 1207 Back     information, alignment and structure
>d1u6gc_ a.118.1.2 (C:) Cullin-associated NEDD8-dissociated protein 1 (Tip120) {Human (Homo sapiens) [TaxId: 9606]} Length = 1207 Back     information, alignment and structure
>d1u6gc_ a.118.1.2 (C:) Cullin-associated NEDD8-dissociated protein 1 (Tip120) {Human (Homo sapiens) [TaxId: 9606]} Length = 1207 Back     information, alignment and structure
>d1u6gc_ a.118.1.2 (C:) Cullin-associated NEDD8-dissociated protein 1 (Tip120) {Human (Homo sapiens) [TaxId: 9606]} Length = 1207 Back     information, alignment and structure
>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Length = 340 Back     information, alignment and structure
>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Length = 340 Back     information, alignment and structure
>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Length = 340 Back     information, alignment and structure
>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Length = 340 Back     information, alignment and structure
>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} Length = 371 Back     information, alignment and structure
>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} Length = 371 Back     information, alignment and structure
>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} Length = 371 Back     information, alignment and structure
>d2ovrb2 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Length = 342 Back     information, alignment and structure
>d1b3ua_ a.118.1.2 (A:) Constant regulatory domain of protein phosphatase 2a, pr65alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 588 Back     information, alignment and structure
>d1b3ua_ a.118.1.2 (A:) Constant regulatory domain of protein phosphatase 2a, pr65alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 588 Back     information, alignment and structure
>d1b3ua_ a.118.1.2 (A:) Constant regulatory domain of protein phosphatase 2a, pr65alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 588 Back     information, alignment and structure
>d1b3ua_ a.118.1.2 (A:) Constant regulatory domain of protein phosphatase 2a, pr65alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 588 Back     information, alignment and structure
>d1b3ua_ a.118.1.2 (A:) Constant regulatory domain of protein phosphatase 2a, pr65alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 588 Back     information, alignment and structure
>d1b3ua_ a.118.1.2 (A:) Constant regulatory domain of protein phosphatase 2a, pr65alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 588 Back     information, alignment and structure
>d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 299 Back     information, alignment and structure
>d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 299 Back     information, alignment and structure
>d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 299 Back     information, alignment and structure
>d1qgra_ a.118.1.1 (A:) Importin beta {Human (Homo sapiens) [TaxId: 9606]} Length = 876 Back     information, alignment and structure
>d1jmxb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Pseudomonas putida [TaxId: 303]} Length = 346 Back     information, alignment and structure
>d1jmxb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Pseudomonas putida [TaxId: 303]} Length = 346 Back     information, alignment and structure
>d1p22a2 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} Length = 293 Back     information, alignment and structure
>d1p22a2 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} Length = 293 Back     information, alignment and structure
>d1p22a2 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} Length = 293 Back     information, alignment and structure
>d1yfqa_ b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 342 Back     information, alignment and structure
>d1sq9a_ b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 393 Back     information, alignment and structure
>d1sq9a_ b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 393 Back     information, alignment and structure
>d1sq9a_ b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 393 Back     information, alignment and structure
>d1sq9a_ b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 393 Back     information, alignment and structure
>d1sq9a_ b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 393 Back     information, alignment and structure
>d1pbyb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Paracoccus denitrificans [TaxId: 266]} Length = 337 Back     information, alignment and structure
>d1pbyb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Paracoccus denitrificans [TaxId: 266]} Length = 337 Back     information, alignment and structure
>d1pbyb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Paracoccus denitrificans [TaxId: 266]} Length = 337 Back     information, alignment and structure
>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 337 Back     information, alignment and structure
>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 337 Back     information, alignment and structure
>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 337 Back     information, alignment and structure
>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 337 Back     information, alignment and structure
>d1pgua2 b.69.4.1 (A:327-613) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 287 Back     information, alignment and structure
>d1pgua2 b.69.4.1 (A:327-613) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 287 Back     information, alignment and structure
>d1ibrb_ a.118.1.1 (B:) Importin beta {Human (Homo sapiens) [TaxId: 9606]} Length = 458 Back     information, alignment and structure
>d1ibrb_ a.118.1.1 (B:) Importin beta {Human (Homo sapiens) [TaxId: 9606]} Length = 458 Back     information, alignment and structure
>d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 355 Back     information, alignment and structure
>d1k32a3 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Length = 360 Back     information, alignment and structure
>d1k32a3 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Length = 360 Back     information, alignment and structure
>d1k32a3 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Length = 360 Back     information, alignment and structure
>d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 311 Back     information, alignment and structure
>d2bpta1 a.118.1.1 (A:1-861) Importin beta {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 861 Back     information, alignment and structure
>d1pgua1 b.69.4.1 (A:2-326) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 325 Back     information, alignment and structure
>d1pgua1 b.69.4.1 (A:2-326) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 325 Back     information, alignment and structure
>d1l0qa2 b.69.2.3 (A:1-301) Surface layer protein {Archaeon Methanosarcina mazei [TaxId: 2209]} Length = 301 Back     information, alignment and structure
>d2bbkh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Length = 355 Back     information, alignment and structure
>d1qbkb_ a.118.1.1 (B:) Karyopherin beta2 {Human (Homo sapiens) [TaxId: 9606]} Length = 888 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query1249
d1vyhc1317 Platelet-activating factor acetylhydrolase IB subu 100.0
d1gxra_337 Groucho/tle1, C-terminal domain {Human (Homo sapie 100.0
d1tbga_340 beta1-subunit of the signal-transducing G protein 100.0
d1erja_388 Tup1, C-terminal domain {Baker's yeast (Saccharomy 100.0
d1nr0a1311 Actin interacting protein 1 {Nematode (Caenorhabdi 100.0
d1k8kc_371 Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taur 100.0
d1nr0a2299 Actin interacting protein 1 {Nematode (Caenorhabdi 100.0
d1nr0a1311 Actin interacting protein 1 {Nematode (Caenorhabdi 100.0
d1gxra_337 Groucho/tle1, C-terminal domain {Human (Homo sapie 100.0
d2ovrb2342 F-box/WD repeat-containing protein 7, FBXW7 {Human 100.0
d1erja_388 Tup1, C-terminal domain {Baker's yeast (Saccharomy 100.0
d1b3ua_588 Constant regulatory domain of protein phosphatase 100.0
d1k8kc_371 Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taur 100.0
d1nexb2355 Cdc4 propeller domain {Baker's yeast (Saccharomyce 100.0
d1vyhc1317 Platelet-activating factor acetylhydrolase IB subu 100.0
d1tbga_340 beta1-subunit of the signal-transducing G protein 100.0
d1nexb2355 Cdc4 propeller domain {Baker's yeast (Saccharomyce 100.0
d1pgua1325 Actin interacting protein 1 {Baker's yeast (Saccha 100.0
d1sq9a_393 Antiviral protein Ski8 (Ski8p) {Baker's yeast (Sac 100.0
d1pgua1325 Actin interacting protein 1 {Baker's yeast (Saccha 100.0
d1pgua2287 Actin interacting protein 1 {Baker's yeast (Saccha 100.0
d1p22a2293 F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Hom 100.0
d1nr0a2299 Actin interacting protein 1 {Nematode (Caenorhabdi 100.0
d1yfqa_342 Cell cycle arrest protein BUB3 {Baker's yeast (Sac 100.0
d2ovrb2342 F-box/WD repeat-containing protein 7, FBXW7 {Human 100.0
d1b3ua_588 Constant regulatory domain of protein phosphatase 99.97
d1sq9a_393 Antiviral protein Ski8 (Ski8p) {Baker's yeast (Sac 99.97
d1k32a3360 Tricorn protease domain 2 {Archaeon Thermoplasma a 99.97
d1p22a2293 F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Hom 99.97
d1pgua2287 Actin interacting protein 1 {Baker's yeast (Saccha 99.96
d1k32a3360 Tricorn protease domain 2 {Archaeon Thermoplasma a 99.96
d1yfqa_342 Cell cycle arrest protein BUB3 {Baker's yeast (Sac 99.95
d1hzua2426 C-terminal (heme d1) domain of cytochrome cd1-nitr 99.95
d1qksa2432 C-terminal (heme d1) domain of cytochrome cd1-nitr 99.94
d1hzua2426 C-terminal (heme d1) domain of cytochrome cd1-nitr 99.93
d1l0qa2301 Surface layer protein {Archaeon Methanosarcina maz 99.92
d1qksa2432 C-terminal (heme d1) domain of cytochrome cd1-nitr 99.91
d1l0qa2301 Surface layer protein {Archaeon Methanosarcina maz 99.91
d1pbyb_337 Quinohemoprotein amine dehydrogenase B chain {Para 99.88
d1jmxb_346 Quinohemoprotein amine dehydrogenase B chain {Pseu 99.88
d1pbyb_337 Quinohemoprotein amine dehydrogenase B chain {Para 99.87
d1jmxb_346 Quinohemoprotein amine dehydrogenase B chain {Pseu 99.87
d1ri6a_333 Putative isomerase YbhE {Escherichia coli [TaxId: 99.85
d2madh_373 Methylamine dehydrogenase, H-chain {Gram negative 99.84
d2madh_373 Methylamine dehydrogenase, H-chain {Gram negative 99.82
d1ri6a_333 Putative isomerase YbhE {Escherichia coli [TaxId: 99.79
d2bbkh_355 Methylamine dehydrogenase, H-chain {Paracoccus den 99.77
d2bbkh_355 Methylamine dehydrogenase, H-chain {Paracoccus den 99.72
d1ibrb_458 Importin beta {Human (Homo sapiens) [TaxId: 9606]} 99.66
d1u6gc_1207 Cullin-associated NEDD8-dissociated protein 1 (Tip 99.64
d2vglb_579 Adaptin beta subunit N-terminal fragment {Human (H 99.62
d1mdah_368 Methylamine dehydrogenase, H-chain {Paracoccus den 99.6
d1ibrb_458 Importin beta {Human (Homo sapiens) [TaxId: 9606]} 99.6
d1qbkb_888 Karyopherin beta2 {Human (Homo sapiens) [TaxId: 96 99.59
d1u6gc_1207 Cullin-associated NEDD8-dissociated protein 1 (Tip 99.59
d2bgra1470 Dipeptidyl peptidase IV/CD26, N-terminal domain {P 99.58
d1qbkb_888 Karyopherin beta2 {Human (Homo sapiens) [TaxId: 96 99.57
d2vglb_579 Adaptin beta subunit N-terminal fragment {Human (H 99.53
d1mdah_368 Methylamine dehydrogenase, H-chain {Paracoccus den 99.52
d2bpta1861 Importin beta {Baker's yeast (Saccharomyces cerevi 99.5
d1qnia2441 Nitrous oxide reductase, N-terminal domain {Pseudo 99.49
d2bgra1470 Dipeptidyl peptidase IV/CD26, N-terminal domain {P 99.47
d1qgra_876 Importin beta {Human (Homo sapiens) [TaxId: 9606]} 99.47
d1qgra_876 Importin beta {Human (Homo sapiens) [TaxId: 9606]} 99.42
d2bpta1861 Importin beta {Baker's yeast (Saccharomyces cerevi 99.42
d1q1sc_434 Importin alpha {Mouse (Mus musculus) [TaxId: 10090 99.26
d2vgla_584 Adaptin alpha C subunit N-terminal fragment {Mouse 99.25
d1wa5b_503 Karyopherin alpha {Baker's yeast (Saccharomyces ce 99.22
d1oyza_276 Hypothetical protein YibA {Escherichia coli [TaxId 99.2
d1wa5b_503 Karyopherin alpha {Baker's yeast (Saccharomyces ce 99.19
d1q1sc_434 Importin alpha {Mouse (Mus musculus) [TaxId: 10090 99.16
d1q7fa_279 Brain tumor cg10719-pa {Fruit fly (Drosophila mela 99.15
d1qnia2441 Nitrous oxide reductase, N-terminal domain {Pseudo 99.13
d1oyza_276 Hypothetical protein YibA {Escherichia coli [TaxId 99.1
d2p4oa1302 Hypothetical protein All0351 homologue {Nostoc pun 99.08
d1lrva_233 Leucine-rich repeat variant {Azotobacter vinelandi 99.03
d2vgla_584 Adaptin alpha C subunit N-terminal fragment {Mouse 99.03
d2p4oa1302 Hypothetical protein All0351 homologue {Nostoc pun 99.03
d1lrva_233 Leucine-rich repeat variant {Azotobacter vinelandi 99.01
d1jdha_529 beta-Catenin {Human (Homo sapiens) [TaxId: 9606]} 99.0
d1rwia_260 Serine/threonine-protein kinase PknD {Mycobacteriu 98.99
d1q7fa_279 Brain tumor cg10719-pa {Fruit fly (Drosophila mela 98.99
d1jdha_529 beta-Catenin {Human (Homo sapiens) [TaxId: 9606]} 98.99
d1jofa_365 3-carboxy-cis,cis-mucoante lactonizing enzyme {Neu 98.96
d1pjxa_314 Diisopropylfluorophosphatase (phosphotriesterase, 98.92
d1jofa_365 3-carboxy-cis,cis-mucoante lactonizing enzyme {Neu 98.83
d2hqsa1269 TolB, C-terminal domain {Escherichia coli [TaxId: 98.82
d1rwia_260 Serine/threonine-protein kinase PknD {Mycobacteriu 98.73
d2hqsa1269 TolB, C-terminal domain {Escherichia coli [TaxId: 98.56
d1xm9a1457 Plakophilin 1 {Human (Homo sapiens) [TaxId: 9606]} 98.51
d2dg1a1319 Lactonase Drp35 {Staphylococcus aureus [TaxId: 128 98.45
d1xfda1465 Dipeptidyl aminopeptidase-like protein 6, DPP6, N- 98.41
d1pjxa_314 Diisopropylfluorophosphatase (phosphotriesterase, 98.36
d1wa5c_959 Exportin Cse1p {Baker's yeast (Saccharomyces cerev 98.34
d1wa5c_959 Exportin Cse1p {Baker's yeast (Saccharomyces cerev 98.32
d1te4a_111 MTH187 {Archaeon Methanobacterium thermoautotrophi 98.29
d2dg1a1319 Lactonase Drp35 {Staphylococcus aureus [TaxId: 128 98.27
d1xqra1264 Hsp70-binding protein 1 (HspBP1) {Human (Homo sapi 98.2
d1xqra1264 Hsp70-binding protein 1 (HspBP1) {Human (Homo sapi 98.17
d1te4a_111 MTH187 {Archaeon Methanobacterium thermoautotrophi 97.83
d1xfda1465 Dipeptidyl aminopeptidase-like protein 6, DPP6, N- 97.69
d2ghsa1295 Regucalcin {Agrobacterium tumefaciens [TaxId: 358] 97.48
d1k32a2281 Tricorn protease N-terminal domain {Archaeon Therm 97.35
d1k32a2281 Tricorn protease N-terminal domain {Archaeon Therm 96.72
d2ghsa1295 Regucalcin {Agrobacterium tumefaciens [TaxId: 358] 96.65
d1xm9a1457 Plakophilin 1 {Human (Homo sapiens) [TaxId: 9606]} 96.64
d1fwxa2459 Nitrous oxide reductase, N-terminal domain {Paraco 95.94
d2ad6a1571 Methanol dehydrogenase, heavy chain {Methylophilus 95.58
d1w6sa_596 Methanol dehydrogenase, heavy chain {Methylobacter 95.26
d1ijqa1266 Low density lipoprotein (LDL) receptor {Human (Hom 93.53
d1kv9a2560 Quinoprotein alcohol dehydrogenase, N-terminal dom 93.11
d1npea_263 Nidogen {Mouse (Mus musculus) [TaxId: 10090]} 92.25
d1kb0a2573 Quinoprotein alcohol dehydrogenase, N-terminal dom 91.31
d1npea_263 Nidogen {Mouse (Mus musculus) [TaxId: 10090]} 90.14
d2ad6a1571 Methanol dehydrogenase, heavy chain {Methylophilus 87.53
d1k3ia3387 Galactose oxidase, central domain {Fungi (Fusarium 87.5
d1flga_582 Ethanol dehydrogenase {Pseudomonas aeruginosa [Tax 84.8
>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
class: All beta proteins
fold: 7-bladed beta-propeller
superfamily: WD40 repeat-like
family: WD40-repeat
domain: Platelet-activating factor acetylhydrolase IB subunit alpha
species: Mouse (Mus musculus) [TaxId: 10090]

Probab=100.00  E-value=6.6e-43  Score=294.43  Aligned_cols=305  Identities=18%  Similarity=0.282  Sum_probs=265.7

Q ss_pred             CCCCCCCCEEEEECCCCCCEEEEEECCCCCEEEEEECCCCEEEEECCCCCCCCCCCEEEEEECCCCCEEEEEEECCCCEE
Q ss_conf             86479994899913324755699993899879999789969999789876432100016864169733899993299999
Q 000861          819 SGWRPRGILVAHLQEHCSAVNEIAISHDHSFFVSASDDSTVKVWDSRKLEKDISFRSRLTYHLEGSRALCTMMLRHSAQV  898 (1249)
Q Consensus       819 ~~W~p~G~li~~L~~H~~~V~~ia~spdg~~laTgs~Dg~VkIWD~~~~~~~~~~~~~~t~~~h~~~V~~i~fspdg~~L  898 (1249)
                      +.|.|+.....+|+||.++|++++|+|++++|+||+.||+|++||+.+++      ...++.+|...|.+++|++++..+
T Consensus         1 k~w~p~~~~~~~L~GH~~~I~~l~~sp~~~~l~s~s~Dg~i~iWd~~~~~------~~~~~~~h~~~V~~~~~~~~~~~~   74 (317)
T d1vyhc1           1 KEWIPRPPEKYALSGHRSPVTRVIFHPVFSVMVSASEDATIKVWDYETGD------FERTLKGHTDSVQDISFDHSGKLL   74 (317)
T ss_dssp             CCCCCCSSCSCEEECCSSCEEEEEECSSSSEEEEEESSSCEEEEETTTCC------CCEEECCCSSCEEEEEECTTSSEE
T ss_pred             CCCCCCCCCCEEECCCCCCEEEEEECCCCCEEEEEECCCEEEEEECCCCC------EEEEEECCCCCEEEEEEECCCCCC
T ss_conf             93689898448985888876899993898999999389929999899997------999995788867777630111101


Q ss_pred             EEEECCCEEEEEECCCCCCCCCCCCCCCCCCCEEEECCCCCCEEEEEEECCCCCCCCEEEEEECCCEEEEEECCCCCCCE
Q ss_conf             99958992999984445667896433357421044038999679999814889884399999889949999857996320
Q 000861          899 VVGACDGIIHMFSVDHISRGLGNVEKYSGISDIKKKDTKEGAIVTLVNYNTDNCASHMFMYSTQNCGIHLWDTRSNSNTW  978 (1249)
Q Consensus       899 asas~Dg~I~iwdi~~~~~~~g~~~~~~~~~~i~~~~~h~~~V~~i~~fs~d~~~g~~L~sgs~dg~I~iwDlrt~~~~~  978 (1249)
                      +++..++.+..|+...     .        .....+..|...+.++. |+++   +..+++++.|+.+++||+++++...
T Consensus        75 ~~~~~~~~~~~~~~~~-----~--------~~~~~~~~~~~~~~~~~-~~~~---~~~~~~~~~d~~~~~~~~~~~~~~~  137 (317)
T d1vyhc1          75 ASCSADMTIKLWDFQG-----F--------ECIRTMHGHDHNVSSVS-IMPN---GDHIVSASRDKTIKMWEVQTGYCVK  137 (317)
T ss_dssp             EEEETTSCCCEEETTS-----S--------CEEECCCCCSSCEEEEE-ECSS---SSEEEEEETTSEEEEEETTTCCEEE
T ss_pred             CCCCCCCCCCCCCCCC-----C--------CCCCCCCCCCCCCEEEE-CCCC---CCEEEEECCCCCEEEEECCCCEEEE
T ss_conf             1111111101110011-----1--------11111000000000000-1699---8557765267523575114430346


Q ss_pred             EEECCCCCCCEEEEEECCCCCEEEEEECCCCEEEEECCCCCCCCCCCCCCCCCEEEEEEECCCCCCCC-----------C
Q ss_conf             65137988754999992799999999459919999599998310003578788569999759999766-----------6
Q 000861          979 TLKAIPEEGYVSSLVTGPCGNWFVSGSSRGVLTLWDLRFLVPVNSWQYSQVCPIEKMCLFVPPPNAAV-----------S 1047 (1249)
Q Consensus       979 ~l~~~~h~~~I~si~~spdg~~Lvtgs~dG~I~iWDlr~~~~i~s~~~~~~~~I~~l~~~sp~g~~~~-----------~ 1047 (1249)
                      .+.  .|...+.++++++++.++++++.||.+++|+.+.+..+..+. ++...+..+.+ .|++....           .
T Consensus       138 ~~~--~~~~~~~~~~~~~~~~~l~~~~~d~~v~~~~~~~~~~~~~~~-~~~~~i~~~~~-~~~~~~~~~~~~~~~~~~~~  213 (317)
T d1vyhc1         138 TFT--GHREWVRMVRPNQDGTLIASCSNDQTVRVWVVATKECKAELR-EHRHVVECISW-APESSYSSISEATGSETKKS  213 (317)
T ss_dssp             EEE--CCSSCEEEEEECTTSSEEEEEETTSCEEEEETTTCCEEEEEC-CCSSCEEEEEE-CCSCGGGGGGGCCSCC----
T ss_pred             EEC--CCCCCCEEEECCCCCCEEEEEECCCEEEEEEECCCEEEEEEE-CCCCCCEEEEE-EECCCCCEEECCCCCEEEEE
T ss_conf             871--677763000016679999999279829997512540347882-47787337998-63256411103456303430


Q ss_pred             CCCCCEEEEEECCCEEEEEECCCCCEEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             88998899998799099988799924598761347999876655555569988889985333334654323456899998
Q 000861         1048 TTARPLIYVAAGCNEVSLWNAENGSCHQVLRTANYDGDTEMSDLPWAFARPSSRSNPKTDLRRNVNQKYRVDELNEPPPR 1127 (1249)
Q Consensus      1048 ~~~~~~l~~as~dg~I~iWDi~tg~~~~~l~~~~~~~~~~i~~i~~sp~~~~~~~~~s~dg~~~~~~~~~~~~~~~~~~~ 1127 (1249)
                      ...+.++++++.|+.+++||..++++...+..+..                                             
T Consensus       214 ~~~~~~~~~~~~d~~i~~~~~~~~~~~~~~~~~~~---------------------------------------------  248 (317)
T d1vyhc1         214 GKPGPFLLSGSRDKTIKMWDVSTGMCLMTLVGHDN---------------------------------------------  248 (317)
T ss_dssp             ---CCEEEEEETTSEEEEEETTTTEEEEEEECCSS---------------------------------------------
T ss_pred             CCCCCEEEECCCCCEEEEEECCCCCEEEEEECCCC---------------------------------------------
T ss_conf             25886147516997899988899968899968899---------------------------------------------


Q ss_pred             CCCEEEEEECCCC-EEEEEECCCCEEEEECCCCCCCEEEECCCCCCCCCCCCEEECCCCCEEEEECCCCCCCCCHHHHHH
Q ss_conf             8990797115999-299970898299993999986079709998888898630002577539955154577652024778
Q 000861         1128 LLGIRSLLPLPGG-DLLTGGTDLKIRRWDHCSPGRSYCICGPNLKGVGNDEFYETRSSSGVQVVQERKRQPLTSKLTAKA 1206 (1249)
Q Consensus      1128 ~~~V~sl~~spdg-~Litgs~Dg~IriWDl~~~~~~~~i~g~~~~~~~~~~~y~~~~~~~v~~~~e~~~~~~~~~~~~~~ 1206 (1249)
                        .|.+++++|++ +|++|+.||.|++||+.+++....+.                                        
T Consensus       249 --~v~~~~~~~~~~~l~s~~~dg~i~iwd~~~~~~~~~~~----------------------------------------  286 (317)
T d1vyhc1         249 --WVRGVLFHSGGKFILSCADDKTLRVWDYKNKRCMKTLN----------------------------------------  286 (317)
T ss_dssp             --CEEEEEECSSSSCEEEEETTTEEEEECCTTSCCCEEEE----------------------------------------
T ss_pred             --CEEEEEECCCCCEEEEEECCCEEEEEECCCCCEEEEEC----------------------------------------
T ss_conf             --87999987999999999798949999999991999992----------------------------------------


Q ss_pred             HHHHHCCCCCCCCCCCEEEEEEEECCCCEEEEEECCCEEEECC
Q ss_conf             9864102666774332038874632997899981897089759
Q 000861         1207 VLAAAATDSAGCHRDSILSLGSVKLNQRLLISSSRDGAIKVWK 1249 (1249)
Q Consensus      1207 ~~~~~~~~~~~~H~d~I~sla~~s~dg~~LvSgs~DG~IkIWd 1249 (1249)
                                 +|.+.|++++ |++++++|+||+.||+|+|||
T Consensus       287 -----------~h~~~V~~~~-~s~~~~~l~s~s~Dg~i~iWd  317 (317)
T d1vyhc1         287 -----------AHEHFVTSLD-FHKTAPYVVTGSVDQTVKVWE  317 (317)
T ss_dssp             -----------CCSSCEEEEE-ECSSSSCEEEEETTSEEEEEC
T ss_pred             -----------CCCCCEEEEE-ECCCCCEEEEEECCCEEEEEC
T ss_conf             -----------8999889999-949999999992899499829
>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ovrb2 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1b3ua_ a.118.1.2 (A:) Constant regulatory domain of protein phosphatase 2a, pr65alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1pgua1 b.69.4.1 (A:2-326) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1sq9a_ b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1pgua1 b.69.4.1 (A:2-326) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1pgua2 b.69.4.1 (A:327-613) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1p22a2 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1yfqa_ b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2ovrb2 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1b3ua_ a.118.1.2 (A:) Constant regulatory domain of protein phosphatase 2a, pr65alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sq9a_ b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1k32a3 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1p22a2 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pgua2 b.69.4.1 (A:327-613) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1k32a3 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1yfqa_ b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1hzua2 b.70.2.1 (A:118-543) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1qksa2 b.70.2.1 (A:136-567) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1hzua2 b.70.2.1 (A:118-543) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1l0qa2 b.69.2.3 (A:1-301) Surface layer protein {Archaeon Methanosarcina mazei [TaxId: 2209]} Back     information, alignment and structure
>d1qksa2 b.70.2.1 (A:136-567) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1l0qa2 b.69.2.3 (A:1-301) Surface layer protein {Archaeon Methanosarcina mazei [TaxId: 2209]} Back     information, alignment and structure
>d1pbyb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1jmxb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1pbyb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1jmxb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1ri6a_ b.69.11.1 (A:) Putative isomerase YbhE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2madh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Gram negative methylotrophic bacteria (Thiobacillus versutus) [TaxId: 34007]} Back     information, alignment and structure
>d2madh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Gram negative methylotrophic bacteria (Thiobacillus versutus) [TaxId: 34007]} Back     information, alignment and structure
>d1ri6a_ b.69.11.1 (A:) Putative isomerase YbhE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2bbkh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d2bbkh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1ibrb_ a.118.1.1 (B:) Importin beta {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u6gc_ a.118.1.2 (C:) Cullin-associated NEDD8-dissociated protein 1 (Tip120) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mdah_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1ibrb_ a.118.1.1 (B:) Importin beta {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qbkb_ a.118.1.1 (B:) Karyopherin beta2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u6gc_ a.118.1.2 (C:) Cullin-associated NEDD8-dissociated protein 1 (Tip120) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bgra1 b.70.3.1 (A:39-508) Dipeptidyl peptidase IV/CD26, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1qbkb_ a.118.1.1 (B:) Karyopherin beta2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mdah_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d2bpta1 a.118.1.1 (A:1-861) Importin beta {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1qnia2 b.69.3.1 (A:10-450) Nitrous oxide reductase, N-terminal domain {Pseudomonas nautica [TaxId: 2743]} Back     information, alignment and structure
>d2bgra1 b.70.3.1 (A:39-508) Dipeptidyl peptidase IV/CD26, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1qgra_ a.118.1.1 (A:) Importin beta {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qgra_ a.118.1.1 (A:) Importin beta {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bpta1 a.118.1.1 (A:1-861) Importin beta {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1q1sc_ a.118.1.1 (C:) Importin alpha {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wa5b_ a.118.1.1 (B:) Karyopherin alpha {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1oyza_ a.118.1.16 (A:) Hypothetical protein YibA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1wa5b_ a.118.1.1 (B:) Karyopherin alpha {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1q1sc_ a.118.1.1 (C:) Importin alpha {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1q7fa_ b.68.9.1 (A:) Brain tumor cg10719-pa {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1qnia2 b.69.3.1 (A:10-450) Nitrous oxide reductase, N-terminal domain {Pseudomonas nautica [TaxId: 2743]} Back     information, alignment and structure
>d1oyza_ a.118.1.16 (A:) Hypothetical protein YibA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2p4oa1 b.68.6.3 (A:4-305) Hypothetical protein All0351 homologue {Nostoc punctiforme [TaxId: 272131]} Back     information, alignment and structure
>d1lrva_ a.118.1.5 (A:) Leucine-rich repeat variant {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d2p4oa1 b.68.6.3 (A:4-305) Hypothetical protein All0351 homologue {Nostoc punctiforme [TaxId: 272131]} Back     information, alignment and structure
>d1lrva_ a.118.1.5 (A:) Leucine-rich repeat variant {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d1jdha_ a.118.1.1 (A:) beta-Catenin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rwia_ b.68.9.1 (A:) Serine/threonine-protein kinase PknD {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1q7fa_ b.68.9.1 (A:) Brain tumor cg10719-pa {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1jdha_ a.118.1.1 (A:) beta-Catenin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jofa_ b.69.10.1 (A:) 3-carboxy-cis,cis-mucoante lactonizing enzyme {Neurospora crassa [TaxId: 5141]} Back     information, alignment and structure
>d1pjxa_ b.68.6.1 (A:) Diisopropylfluorophosphatase (phosphotriesterase, DFP) {Squid (Loligo vulgaris) [TaxId: 6622]} Back     information, alignment and structure
>d1jofa_ b.69.10.1 (A:) 3-carboxy-cis,cis-mucoante lactonizing enzyme {Neurospora crassa [TaxId: 5141]} Back     information, alignment and structure
>d2hqsa1 b.68.4.1 (A:163-431) TolB, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1rwia_ b.68.9.1 (A:) Serine/threonine-protein kinase PknD {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2hqsa1 b.68.4.1 (A:163-431) TolB, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xm9a1 a.118.1.24 (A:244-700) Plakophilin 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dg1a1 b.68.6.1 (A:6-324) Lactonase Drp35 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1xfda1 b.70.3.1 (A:127-591) Dipeptidyl aminopeptidase-like protein 6, DPP6, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pjxa_ b.68.6.1 (A:) Diisopropylfluorophosphatase (phosphotriesterase, DFP) {Squid (Loligo vulgaris) [TaxId: 6622]} Back     information, alignment and structure
>d1wa5c_ a.118.1.1 (C:) Exportin Cse1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1wa5c_ a.118.1.1 (C:) Exportin Cse1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1te4a_ a.118.1.16 (A:) MTH187 {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d2dg1a1 b.68.6.1 (A:6-324) Lactonase Drp35 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1xqra1 a.118.1.21 (A:87-350) Hsp70-binding protein 1 (HspBP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xqra1 a.118.1.21 (A:87-350) Hsp70-binding protein 1 (HspBP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1te4a_ a.118.1.16 (A:) MTH187 {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1xfda1 b.70.3.1 (A:127-591) Dipeptidyl aminopeptidase-like protein 6, DPP6, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ghsa1 b.68.6.1 (A:20-314) Regucalcin {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1k32a2 b.68.7.1 (A:39-319) Tricorn protease N-terminal domain {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1k32a2 b.68.7.1 (A:39-319) Tricorn protease N-terminal domain {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d2ghsa1 b.68.6.1 (A:20-314) Regucalcin {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1xm9a1 a.118.1.24 (A:244-700) Plakophilin 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fwxa2 b.69.3.1 (A:8-451) Nitrous oxide reductase, N-terminal domain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d2ad6a1 b.70.1.1 (A:1-571) Methanol dehydrogenase, heavy chain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} Back     information, alignment and structure
>d1w6sa_ b.70.1.1 (A:) Methanol dehydrogenase, heavy chain {Methylobacterium extorquens [TaxId: 408]} Back     information, alignment and structure
>d1ijqa1 b.68.5.1 (A:377-642) Low density lipoprotein (LDL) receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kv9a2 b.70.1.1 (A:1-560) Quinoprotein alcohol dehydrogenase, N-terminal domain {Pseudomonas putida, hk5 [TaxId: 303]} Back     information, alignment and structure
>d1npea_ b.68.5.1 (A:) Nidogen {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1kb0a2 b.70.1.1 (A:1-573) Quinoprotein alcohol dehydrogenase, N-terminal domain {Comamonas testosteroni [TaxId: 285]} Back     information, alignment and structure
>d1npea_ b.68.5.1 (A:) Nidogen {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2ad6a1 b.70.1.1 (A:1-571) Methanol dehydrogenase, heavy chain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} Back     information, alignment and structure
>d1k3ia3 b.69.1.1 (A:151-537) Galactose oxidase, central domain {Fungi (Fusarium sp.) [TaxId: 29916]} Back     information, alignment and structure
>d1flga_ b.70.1.1 (A:) Ethanol dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure