Citrus Sinensis ID: 000907

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820-------830-------840-------850-------860-------870-------880-------890-------900-------910-------920-------930-------940-------950-------960-------970-------980-------990------1000------1010------1020------1030------1040------1050------1060------1070------1080------1090------1100------1110------1120------1130------1140------1150------1160------1170------1180------1190------1200------1210------1220------1230
MLALAGKLDSSLKASGKVTYNGHDMHEFVPQRTAAYISQHDIHIGEMTVRETLAFSARCQGVGSRYDMLVELSRREKAAKIIPDADIDVFMKAVVREGQEANVITDYILKVLDLDVCADTVVGDEMLRGISGGQRKRVTTGEMLVGPAHALFMDEISTGLDSSTTFHIVNSLGQFNHILNGTALISLLQPAPEVYNLFDDIILVSDGQIVYQGPLEHVEQFFISMGFKCPKRKGIADFLQEVTSRKDQEQYWVRNDEPYRFVTVKEFVHAFQSFHVGRKLGDELGIPFDKKNSHPAALTTRKYGVGKKELLKACFSREHLLMKRNSFVYIFRLTQVMFLAVIGMTIFLRTKMHRDSLTDGVIYTGALFFILTTITFNGMAEISMTIAKLPVFYKQRDLRFYPSWAYALPAWILKIPISIVEVSVWVFMTYYVIGFDSNAGRFFKQYLLLLIVNQMSSAMFRLIAAVGRSMVVANTFGSLVLLLLFVLGGFVLSRDDIKKWWKWGYWCSPLMYAQNAIVVNEFLGNSWKKILPNKTKPLGIEVLDSRGFFTDAYWYWLGVGALTGFIILFQFGFTLALSFLNPFGTSKAFISEESQSTEHDSRTGGTVQLSTCANSSSHITRSESRDYVRRRNSSSQSRETTIETDQPKNRGMVLPFEPFSLTFDEITYSVDMPQEMKRRGVHDDKLVLLNGVSGAFRPGVLTALMGVTGSGKTTLMDVLAGRKTRGYITGNITISGYPKNQETFTRISGYCEQNDIHSPYVTVYESLLYSAWLRLSSEVNSKTREMFVEEVMELVELNPLRQALVGLPGVNGLSTEQRKRLTIAVELVANPSIIFMDEPTSGLDARAAAVVMRTVRNTVDTGRTVVCTIHQPSIDIFEAFDAGIPGVSKIRDGYNPATWMLEVTAPSQEIALGVDFAAIYKSSELYRINKALIQELSKPAPGSKELYFANQYPLSFFTQCMACLWKQHWSYSRNPHYTAVRFLFTIFISLIFGTMFWDMGTKTTKQQDLFNTMGFMYVAVYFLGVLNVSSVQPVVDLERSVFYREKGAGMYSPMAYAFAQVLIEIPYIFVQAAPYSLIVYAMIGFEWTAAKFFWFLFFMFFSLLYFTFFGMMLVAWTPNHHIASIVSTLFYGLWNIVSGFIIPRTRIPVWWRWSYWANPIAWTLYGFFASQFGDVQDRLESGETVKQFLRSYYGFKHDFLGAVAAVVFVLPSLFAFVFALGIRVLNFQKR
cccccccccccccEEEEEEEccccccccccccEEEEEcccccccccccHHHHHHHHHHccccccccHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccHHHHHHHHcccccccEEcccccHHHHHHHHHHHHHHHHHHHccccEEEEEccccHHHHHHcccEEEEcccEEEEEccHHHHHHHHHccccccccccccccHHHccccccccHHHccccccccccccHHHHHHHHHccHHHHHHHHHHccccccccccccccccccccccHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHccccccccccccHHHHHHHcHHHHHHHHHHHcccccccccccccccccccccEEEEccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccEEccccccccccccccccccccccccccccccccccHHHHHHcccccccccccccccccccccccccccccEEEEEcEEEEEcccccccccccccccccccccccEEEccccEEEccccccccHHHHHHHHcccccccEEEEEEEEccccccccccccccHHHHHccccccccHHHHHHHHHHHccccccccHHHHHHHHHHHHHHccccccccccccccccccccHHHHccHHHHHHHcccccccccccccccccHHHHHHHHHHHHHHHHcccEEEEccccccHHHHHHHHccccccccccccccHHHHHHHHccccccccccccHHHHHcccHHHHHHHHHHHHHcccccccccccccccccccHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHHHHHHHccccccEEEHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHEEEEcccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHccccccccccccccEEEEcccHHHHHHHHHHHHHcccccccccccccHHHHHHHHccccccccccEEHHHHHHHHHHHHHHHHHHHHHHcccc
ccHHccccccccEEEEEEEEccccccccccccccEEEEHcccccccccHHHHHcccccccccccHHHHHHHHHHHHHHccccccccccEEEEcccccccHccHHHHHHHHHHHHHHHHHHHccHHHHHccccccccEEEHHHHHcccHHHHccccccccccccHHHHHEEEEEEEEEEcccEEEEEEcccccccHHHHHHHHHHccccEEEcccHHHHHHccHHccccccccccccccccccccccHHHHHHHcccccccEEcHHHHHHHHHHccHHHHHHHHccccccccccccHHcccccccccHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHccHHHHHHHHHHccHHHHHHHHcccHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccEEccccccHHEHHHHHHcHHHHHHHHHHHHHHcccccccccccccccEHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccEEEEccHHHHHHccccccEEEEEcccccccccccccccccccccccccccccccccccccccccEEEccccEEEEEccEEEEEccHHHHHHccccccEEEEEccccccEcccEEEEEEccccccHHHHHHHHHccccccEEEEEEEEcccccccccccHEEEEEEccccccccEEEEEHHHHHHHHcccHHccHHHHHHHHHHHHHHHcccHHHHHcccccccccccccccEEEEEEHEEEccccEEEEccccccccHHHHHHHHHHHHHHHccccEEEEEEccccHHHHHHHHHHHccccccccccccHHHHHHHccHHHHHHHcccHHHHHHHcHHHHHHHHHHHHHcccccccccccccccccccHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHccccccccEEEEEccHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHcccEEccccccHHHHHHHEHcHHHHHHHHHHHHHcccccccccccccHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccc
mlalagkldsslkasgkvtynghdmhefvpqrtaAYISQHDIHIGEMTVRETLAFSARCQGVGSRYDMLVELSRREKAakiipdadIDVFMKAVVREGQEANVITDYILKVLdldvcadtvvgdemlrgisggqrkrvttgemlvgpaHALFMDeistgldsstTFHIVNSLGQFNHILNGTALISllqpapevynlfddiilvsdgqivyqgplEHVEQFFISmgfkcpkrkGIADFLQEVTSrkdqeqywvrndepyrfvTVKEFVHAFQSFHVgrklgdelgipfdkknshpaalttrkygvgkKELLKACFSREHLLMKRNSFVYIFRLTQVMFLAVIGMTIFLRTkmhrdsltdgviYTGALFFILTTITFNGMAEISMTIAKlpvfykqrdlrfypswayalpawilkipisiVEVSVWVFMTYYVIgfdsnagrFFKQYLLLLIVNQMSSAMFRLIAAVGRSMVVANTFGSLVLLLLFVLGGFVLSRDDIKKWwkwgywcsplmyaQNAIVVNEFLGnswkkilpnktkplgievldsrgfftdAYWYWLGVGALTGFIILFQFGFTLALsflnpfgtskafiseesqstehdsrtggtvqlstcanssshitrsesrdyvrrrnsssqsrettietdqpknrgmvlpfepfsltfdeitysvdmpqemkrrgvhddklvllngvsgafrpGVLTALMgvtgsgktTLMDVLAgrktrgyitgnitisgypknqetFTRISgyceqndihspyVTVYESLLYSAWLRLSSEVNSKTREMFVEEVMELVELnplrqalvglpgvnglsteQRKRLTIAVELVanpsiifmdeptsgldARAAAVVMRTVRNTVDTGRTVVCtihqpsidifeafdagipgvskirdgynpatwmlevtapsqeiaLGVDFAAIYKSSELYRINKALIQelskpapgskelyfanqyplsfFTQCMACLWKqhwsysrnphytAVRFLFTIFISLIFGtmfwdmgtkttkQQDLFNTMGFMYVAVYFLGVLnvssvqpvvdleRSVFyrekgagmyspMAYAFAQVLIEIPYIFVQAAPYSLIVYAMIGFEWTAAKFFWFLFFMFFSLLYFTFFGMMLVawtpnhhiASIVSTLFYGLWnivsgfiiprtripvwwrwsywanpiaWTLYGFFasqfgdvqdrlesgETVKQFLRSYYGFKHDFLGAVAAVVFVLPSLFAFVFALGIRVLNFQKR
MLALAGkldsslkasGKVTYNGHDMHEFVPQRTAAYISQHDIHIGEMTVRETLAFSARCQGVGSRYDMLVELSRREKaakiipdadiDVFMKAVVREGQEANVITDYILKVLDLDVCADTVVGdemlrgisggqrkrvttGEMLVGPAHALFMDEISTGLDSSTTFHIVNSLGQFNHILNGTALISLLQPAPEVYNLFDDIILVSDGQIVYQGPLEHVEQFFISMGFKCPKRKGIADFLQEvtsrkdqeqywvRNDEPYRFVTVKEFVHAFQSFHVGRKLGDELGipfdkknshpaalttrkygvgkkELLKACFSREHLLMKRNSFVYIFRLTQVMFLAVIGMTIFLRTKMHRDSLTDGVIYTGALFFILTTITFNGMAEISMTIAKLPVFYKQRDLRFYPSWAYALPAWILKIPISIVEVSVWVFMTYYVIGFDSNAGRFFKQYLLLLIVNQMSSAMFRLIAAVGRSMVVANTFGSLVLLLLFVLGGFVLSRDDIKKWWKWGYWCSPLMYAQNAIVVNEFLGNSWKKILPNKTKPLGIEVLDSRGFFTDAYWYWLGVGALTGFIILFQFGFTLALSFLNPFGTSKAFISEESqstehdsrtggtvqlstcanssshitrsesrdyvrrrnsssqsrettietdqpknrgmvLPFEPFSLTFDEITYSVDMPQEMKRRGVHDDKLVLLNGVSGAFRPGVLTALMgvtgsgktTLMDVLAGrktrgyitgnitisgypknQETFTRISGYCEQNDIHSPYVTVYESLLYSAWLRLSSEVNSKTREMFVEEVMELVELNPLRQALVGLPGVNGLSTEQRKRLTIAVELVANPSIIFMDEPTSGLDARAAAVVMRTVrntvdtgrtvVCTIHQPSIDIFEAFDAGIPGVSKIRDGYNPATWMLEVTAPSQEIALGVDFAAIYKSSELYRINKALIQELSKPAPGSKELYFANQYPLSFFTQCMACLWKQHWSYSRNPHYTAVRFLFTIFISLIFGTMFWDMGTKTTKQQDLFNTMGFMYVAVYFLGVLNVSSVQPVVDLERSVFYREKGAGMYSPMAYAFAQVLIEIPYIFVQAAPYSLIVYAMIGFEWTAAKFFWFLFFMFFSLLYFTFFGMMLVAWTPNHHIASIVSTLFYGLWNIVSGFIIPRTRIPVWWRWSYWANPIAWTLYGFFASQFGDVQDRLESGETVKQFLRSYYGFKHDFLGAVAAVVFVLPSLFAFVFALGIRVLNFQKR
MLALAGKLDSSLKASGKVTYNGHDMHEFVPQRTAAYISQHDIHIGEMTVRETLAFSARCQGVGSRYDMLVELSRREKAAKIIPDADIDVFMKAVVREGQEANVITDYILKVLDLDVCADTVVGDEMLRGISGGQRKRVTTGEMLVGPAHALFMDEISTGLDSSTTFHIVNSLGQFNHILNGTALISLLQPAPEVYNLFDDIILVSDGQIVYQGPLEHVEQFFISMGFKCPKRKGIADFLQEVTSRKDQEQYWVRNDEPYRFVTVKEFVHAFQSFHVGRKLGDELGIPFDKKNSHPAALTTRKYGVGKKELLKACFSREHLLMKRNSFVYIFRLTQVMFLAVIGMTIFLRTKMHRDSLTDGVIYTGALFFILTTITFNGMAEISMTIAKLPVFYKQRDLRFYPSWAYALPAWILKIPISIVEVSVWVFMTYYVIGFDSNAGRFFKQYLLLLIVNQMSSAMFRLIAAVGRSMVVANTfgslvllllfvlggfvlsRDDIKKWWKWGYWCSPLMYAQNAIVVNEFLGNSWKKILPNKTKPLGIEVLDSRGFFTDAYWYWLGVGALTGFIILFQFGFTLALSFLNPFGTSKAFISEESQSTEHDSRTGGTVQLSTCANSSSHITRSESRDYVRRRNSSSQSRETTIETDQPKNRGMVLPFEPFSLTFDEITYSVDMPQEMKRRGVHDDKLVLLNGVSGAFRPGVLTALMGVTGSGKTTLMDVLAGRKTRGYITGNITISGYPKNQETFTRISGYCEQNDIHSPYVTVYESLLYSAWLRLSSEVNSKTRemfveevmelvelNPLRQALVGLPGVNGLSTEQRKRLTIAVELVANPSIIFMDEPTSGLDaraaavvmrtvrntvDTGRTVVCTIHQPSIDIFEAFDAGIPGVSKIRDGYNPATWMLEVTAPSQEIALGVDFAAIYKSSELYRINKALIQELSKPAPGSKELYFANQYPLSFFTQCMACLWKQHWSYSRNPHYTAVRFLFTIFISLIFGTMFWDMGTKTTKQQDLFNTMGFMYVAVYFLGVLNVSSVQPVVDLERSVFYREKGAGMYSPMAYAFAQVLIEIPYIFVQAAPYSLIVYAMIGFEWTAAKffwflffmffsllyftffGMMLVAWTPNHHIASIVSTLFYGLWNIVSGFIIPRTRIPVWWRWSYWANPIAWTLYGFFASQFGDVQDRLESGETVKQFLRSYYGFKHDFLGavaavvFVLPSLFAFVFALGIRVLNFQKR
******************TYNGHDMHEFVPQRTAAYISQHDIHIGEMTVRETLAFSARCQGVGSRYDMLVELSRREKAAKIIPDADIDVFMKAVVREGQEANVITDYILKVLDLDVCADTVVGDEMLRGISGGQRKRVTTGEMLVGPAHALFMDEISTGLDSSTTFHIVNSLGQFNHILNGTALISLLQPAPEVYNLFDDIILVSDGQIVYQGPLEHVEQFFISMGFKCPKRKGIADFLQEVTSRKDQEQYWVRNDEPYRFVTVKEFVHAFQSFHVGRKLGDELGIPFDKKNSHPAALTTRKYGVGKKELLKACFSREHLLMKRNSFVYIFRLTQVMFLAVIGMTIFLRTKMHRDSLTDGVIYTGALFFILTTITFNGMAEISMTIAKLPVFYKQRDLRFYPSWAYALPAWILKIPISIVEVSVWVFMTYYVIGFDSNAGRFFKQYLLLLIVNQMSSAMFRLIAAVGRSMVVANTFGSLVLLLLFVLGGFVLSRDDIKKWWKWGYWCSPLMYAQNAIVVNEFLGNSWKKILPNKTKPLGIEVLDSRGFFTDAYWYWLGVGALTGFIILFQFGFTLALSFLNPFGTSKAF***************************************************************VLPFEPFSLTFDEITYSVDMPQEMKRRGVHDDKLVLLNGVSGAFRPGVLTALMGVTGSGKTTLMDVLAGRKTRGYITGNITISGYPKNQETFTRISGYCEQNDIHSPYVTVYESLLYSAWLRLSSEVNSKTREMFVEEVMELVELNPLRQALVGLPGVNGLSTEQRKRLTIAVELVANPSIIFMDEPTSGLDARAAAVVMRTVRNTVDTGRTVVCTIHQPSIDIFEAFDAGIPGVSKIRDGYNPATWMLEVTAPSQEIALGVDFAAIYKSSELYRINKALIQELSKPAPGSKELYFANQYPLSFFTQCMACLWKQHWSYSRNPHYTAVRFLFTIFISLIFGTMFWDMGTKTTKQQDLFNTMGFMYVAVYFLGVLNVSSVQPVVDLERSVFYREKGAGMYSPMAYAFAQVLIEIPYIFVQAAPYSLIVYAMIGFEWTAAKFFWFLFFMFFSLLYFTFFGMMLVAWTPNHHIASIVSTLFYGLWNIVSGFIIPRTRIPVWWRWSYWANPIAWTLYGFFASQFGDVQDRLESGETVKQFLRSYYGFKHDFLGAVAAVVFVLPSLFAFVFALGIRVLNF***
MLALAG*LDSSLKASGKVTYNGHDMHEFVPQRTAAYISQHDIHIGEMTVRETLAFSARCQGVGSRYDMLV********AKIIPDADIDVFMKAVVREGQEANVITDYILKVLDLDVCADTVVGDEMLRGISGGQRKRVTTGEMLVGPAHALFMDEISTGLDSSTTFHIVNSLGQFNHILNGTALISLLQPAPEVYNLFDDIILVSDGQIVYQGPLEHVEQFFISMGFKCPKRKGIADFLQEVTSRKDQEQYWVRNDEPYRFVTVKEFVHAFQSFHVGRKLGD***********************GKKELLKACFSREHLLMKRNSFVYIFRLTQVMFLAVIGMTIFLRTKMHRDSLTDGVIYTGALFFILTTITFNGMAEISMTIAKLPVFYKQRDLRFYPSWAYALPAWILKIPISIVEVSVWVFMTYYVIGFDSNAGRFFKQYLLLLIVNQMSSAMFRLIAAVGRSMVVANTFGSLVLLLLFVLGGFVLSRDDIKKWWKWGYWCSPLMYAQNAIVVNEFLGNSWKKILPNKTKPLGIEVLDSRGFFTDAYWYWLGVGALTGFIILFQFGFTLALSFLNPFGTSKAF******************************************************************FEPFSLTFDEITYSVDMPQEMKR*GVHDDKLVLLNGVSGAFRPGVLTALMGVTGSGKTTLMDVLAGRKTRGYITGNITISGYPKNQETFTRISGYCEQNDIHSPYVTVYESLLYSAWLRLSSEVNSKTREMFVEEVMELVELNPLRQALVGLPGVNGLSTEQRKRLTIAVELVANPSIIFMDEPTSGLDARAAAVVMRTVRNTVDTGRTVVCTIHQPSIDIFEAFDAGIPGVSKIRDGYNPATWMLEVTAPSQEIALGVDFAAIYKSSELYRIN**********************YPLSFFTQCMACLWKQHWSYSRNPHYTAVRFLFTIFISLIFGTMFWDMGTKTTKQQDLFNTMGFMYVAVYFLGVLNVSSVQPVVDLERSVFYREKGAGMYSPMAYAFAQVLIEIPYIFVQAAPYSLIVYAMIGFEWTAAKFFWFLFFMFFSLLYFTFFGMMLVAWTPNHHIASIVSTLFYGLWNIVSGFIIPRTRIPVWWRWSYWANPIAWTLYGFFASQFGDVQDRLESGETVKQFLRSYYGFKHDFLGAVAAVVFVLPSLFAFVFALGIRVLNFQKR
MLALAGKLDSSLKASGKVTYNGHDMHEFVPQRTAAYISQHDIHIGEMTVRETLAFSARCQGVGSRYDMLVELSRREKAAKIIPDADIDVFMKAVVREGQEANVITDYILKVLDLDVCADTVVGDEMLRGISGGQRKRVTTGEMLVGPAHALFMDEISTGLDSSTTFHIVNSLGQFNHILNGTALISLLQPAPEVYNLFDDIILVSDGQIVYQGPLEHVEQFFISMGFKCPKRKGIADFLQEVTSRKDQEQYWVRNDEPYRFVTVKEFVHAFQSFHVGRKLGDELGIPFDKKNSHPAALTTRKYGVGKKELLKACFSREHLLMKRNSFVYIFRLTQVMFLAVIGMTIFLRTKMHRDSLTDGVIYTGALFFILTTITFNGMAEISMTIAKLPVFYKQRDLRFYPSWAYALPAWILKIPISIVEVSVWVFMTYYVIGFDSNAGRFFKQYLLLLIVNQMSSAMFRLIAAVGRSMVVANTFGSLVLLLLFVLGGFVLSRDDIKKWWKWGYWCSPLMYAQNAIVVNEFLGNSWKKILPNKTKPLGIEVLDSRGFFTDAYWYWLGVGALTGFIILFQFGFTLALSFLNPFGTSKAFI***************TVQLS***********************************QPKNRGMVLPFEPFSLTFDEITYSVDMPQEMKRRGVHDDKLVLLNGVSGAFRPGVLTALMGVTGSGKTTLMDVLAGRKTRGYITGNITISGYPKNQETFTRISGYCEQNDIHSPYVTVYESLLYSAWLRLSSEVNSKTREMFVEEVMELVELNPLRQALVGLPGVNGLSTEQRKRLTIAVELVANPSIIFMDEPTSGLDARAAAVVMRTVRNTVDTGRTVVCTIHQPSIDIFEAFDAGIPGVSKIRDGYNPATWMLEVTAPSQEIALGVDFAAIYKSSELYRINKALIQELSKPAPGSKELYFANQYPLSFFTQCMACLWKQHWSYSRNPHYTAVRFLFTIFISLIFGTMFWDMGTKTTKQQDLFNTMGFMYVAVYFLGVLNVSSVQPVVDLERSVFYREKGAGMYSPMAYAFAQVLIEIPYIFVQAAPYSLIVYAMIGFEWTAAKFFWFLFFMFFSLLYFTFFGMMLVAWTPNHHIASIVSTLFYGLWNIVSGFIIPRTRIPVWWRWSYWANPIAWTLYGFFASQFGDVQDRLESGETVKQFLRSYYGFKHDFLGAVAAVVFVLPSLFAFVFALGIRVLNFQKR
MLALAGKLDSSLKASGKVTYNGHDMHEFVPQRTAAYISQHDIHIGEMTVRETLAFSARCQGVGSRYDMLVELSRREKAAKIIPDADIDVFMKAVVREGQEANVITDYILKVLDLDVCADTVVGDEMLRGISGGQRKRVTTGEMLVGPAHALFMDEISTGLDSSTTFHIVNSLGQFNHILNGTALISLLQPAPEVYNLFDDIILVSDGQIVYQGPLEHVEQFFISMGFKCPKRKGIADFLQEVTSRKDQEQYWVRNDEPYRFVTVKEFVHAFQSFHVGRKLGDELGIPFDKKNSHPAALTTRKYGVGKKELLKACFSREHLLMKRNSFVYIFRLTQVMFLAVIGMTIFLRTKMHRDSLTDGVIYTGALFFILTTITFNGMAEISMTIAKLPVFYKQRDLRFYPSWAYALPAWILKIPISIVEVSVWVFMTYYVIGFDSNAGRFFKQYLLLLIVNQMSSAMFRLIAAVGRSMVVANTFGSLVLLLLFVLGGFVLSRDDIKKWWKWGYWCSPLMYAQNAIVVNEFLGNSWKKILPNKTKPLGIEVLDSRGFFTDAYWYWLGVGALTGFIILFQFGFTLALSFLNPFGTSKAFISEESQSTEH*****GTVQL****************************************RGMVLPFEPFSLTFDEITYSVDMPQEMKRRGVHDDKLVLLNGVSGAFRPGVLTALMGVTGSGKTTLMDVLAGRKTRGYITGNITISGYPKNQETFTRISGYCEQNDIHSPYVTVYESLLYSAWLRLSSEVNSKTREMFVEEVMELVELNPLRQALVGLPGVNGLSTEQRKRLTIAVELVANPSIIFMDEPTSGLDARAAAVVMRTVRNTVDTGRTVVCTIHQPSIDIFEAFDAGIPGVSKIRDGYNPATWMLEVTAPSQEIALGVDFAAIYKSSELYRINKALIQELSKPAPGSKELYFANQYPLSFFTQCMACLWKQHWSYSRNPHYTAVRFLFTIFISLIFGTMFWDMGTKTTKQQDLFNTMGFMYVAVYFLGVLNVSSVQPVVDLERSVFYREKGAGMYSPMAYAFAQVLIEIPYIFVQAAPYSLIVYAMIGFEWTAAKFFWFLFFMFFSLLYFTFFGMMLVAWTPNHHIASIVSTLFYGLWNIVSGFIIPRTRIPVWWRWSYWANPIAWTLYGFFASQFGDVQDRLESGETVKQFLRSYYGFKHDFLGAVAAVVFVLPSLFAFVFALGIRVLNFQKR
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHoooooooooooHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHoooooooHHHHHHHHHHHHHHHHHHHHHHHHiiHHHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHoooooooooooooHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHooooooooHHHHHHHHHHHHHHHHHHHHHiiHHHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHHHoooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHoooooooooHHHHHHHHHHHHHHHHHHHHHHHHHHiiiHHHHHHHHHHHHHHHHHHHHHHoooooooooooooHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHoooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHoooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHoooooHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHHHiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MLALAGKLDSSLKASGKVTYNGHDMHEFVPQRTAAYISQHDIHIGEMTVRETLAFSARCQGVGSRYDMLVELSRREKAAKIIPDADIDVFMKAVVREGQEANVITDYILKVLDLDVCADTVVGDEMLRGISGGQRKRVTTGEMLVGPAHALFMDEISTGLDSSTTFHIVNSLGQFNHILNGTALISLLQPAPEVYNLFDDIILVSDGQIVYQGPLEHVEQFFISMGFKCPKRKGIADFLQEVTSRKDQEQYWVRNDEPYRFVTVKEFVHAFQSFHVGRKLGDELGIPFDKKNSHPAALTTRKYGVGKKELLKACFSREHLLMKRNSFVYIFRLTQVMFLAVIGMTIFLRTKMHRDSLTDGVIYTGALFFILTTITFNGMAEISMTIAKLPVFYKQRDLRFYPSWAYALPAWILKIPISIVEVSVWVFMTYYVIGFDSNAGRFFKQYLLLLIVNQMSSAMFRLIAAVGRSMVVANTFGSLVLLLLFVLGGFVLSRDDIKKWWKWGYWCSPLMYAQNAIVVNEFLGNSWKKILPNKTKPLGIEVLDSRGFFTDAYWYWLGVGALTGFIILFQFGFTLALSFLNPFGTSKAFISEESQSTEHDSRTGGTVQLSTCANSSSHITRSESRDYVRRRNSSSQSRETTIETDQPKNRGMVLPFEPFSLTFDEITYSVDMPQEMKRRGVHDDKLVLLNGVSGAFRPGVLTALMGVTGSGKTTLMDVLAGRKTRGYITGNITISGYPKNQETFTRISGYCEQNDIHSPYVTVYESLLYSAWLRLSSEVNSKTREMFVEEVMELVELNPLRQALVGLPGVNGLSTEQRKRLTIAVELVANPSIIFMDEPTSGLDARAAAVVMRTVRNTVDTGRTVVCTIHQPSIDIFEAFDAGIPGVSKIRDGYNPATWMLEVTAPSQEIALGVDFAAIYKSSELYRINKALIQELSKPAPGSKELYFANQYPLSFFTQCMACLWKQHWSYSRNPHYTAVRFLFTIFISLIFGTMFWDMGTKTTKQQDLFNTMGFMYVAVYFLGVLNVSSVQPVVDLERSVFYREKGAGMYSPMAYAFAQVLIEIPYIFVQAAPYSLIVYAMIGFEWTAAKFFWFLFFMFFSLLYFTFFGMMLVAWTPNHHIASIVSTLFYGLWNIVSGFIIPRTRIPVWWRWSYWANPIAWTLYGFFASQFGDVQDRLESGETVKQFLRSYYGFKHDFLGAVAAVVFVLPSLFAFVFALGIRVLNFQKR
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query1230 2.2.26 [Sep-21-2011]
Q76CU21434 Pleiotropic drug resistan N/A no 0.978 0.838 0.689 0.0
Q9M9E11423 ABC transporter G family yes no 0.973 0.841 0.672 0.0
Q0JLC51457 Pleiotropic drug resistan yes no 0.982 0.829 0.679 0.0
A2WSH01457 Pleiotropic drug resistan N/A no 0.982 0.829 0.678 0.0
Q949G31436 Pleiotropic drug resistan N/A no 0.975 0.835 0.691 0.0
Q8GU891450 Pleiotropic drug resistan no no 0.992 0.842 0.660 0.0
Q8GU881444 Putative pleiotropic drug no no 0.989 0.842 0.670 0.0
Q8GU921464 Probable pleiotropic drug no no 0.982 0.825 0.670 0.0
Q7PC801468 Probable pleiotropic drug no no 0.990 0.829 0.654 0.0
O243671441 Pleiotropic drug resistan N/A no 0.985 0.841 0.662 0.0
>sp|Q76CU2|PDR1_TOBAC Pleiotropic drug resistance protein 1 OS=Nicotiana tabacum GN=PDR1 PE=2 SV=1 Back     alignment and function desciption
 Score = 1816 bits (4703), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 867/1258 (68%), Positives = 1010/1258 (80%), Gaps = 55/1258 (4%)

Query: 1    MLALAGKLDSSLKASGKVTYNGHDMHEFVPQRTAAYISQHDIHIGEMTVRETLAFSARCQ 60
            +LALAGKLD +LK +GKV+YNGH++HEFVPQRTAAYISQHD+HIGEMTVRETL FSARCQ
Sbjct: 204  LLALAGKLDPALKVTGKVSYNGHELHEFVPQRTAAYISQHDLHIGEMTVRETLEFSARCQ 263

Query: 61   GVGSRYDMLVELSRREKAAKIIPDADIDVFMKAVVREGQEANVITDYILKVLDLDVCADT 120
            GVGSR++ML ELSRREKAA I PDADID++MKA   EGQEANV+TDY+LK+L LD+CADT
Sbjct: 264  GVGSRFEMLAELSRREKAANIKPDADIDIYMKAAATEGQEANVVTDYVLKILGLDICADT 323

Query: 121  VVGDEMLRGISGGQRKRVTTGEMLVGPAHALFMDEISTGLDSSTTFHIVNSLGQFNHILN 180
            +VGD+M+RGISGGQ+KRVTTGEMLVGP+ ALFMDEISTGLDSSTT+ IVNSL Q   IL 
Sbjct: 324  MVGDDMIRGISGGQKKRVTTGEMLVGPSKALFMDEISTGLDSSTTYSIVNSLRQSVQILK 383

Query: 181  GTALISLLQPAPEVYNLFDDIILVSDGQIVYQGPLEHVEQFFISMGFKCPKRKGIADFLQ 240
            GTA+ISLLQPAPE YNLFDDIIL+SDG IVYQGP + V +FF SMGFKCP+RKG+ADFLQ
Sbjct: 384  GTAVISLLQPAPETYNLFDDIILLSDGYIVYQGPRDDVLEFFESMGFKCPQRKGVADFLQ 443

Query: 241  EVTSRKDQEQYWVRNDEPYRFVTVKEFVHAFQSFHVGRKLGDELGIPFDKKNSHPAALTT 300
            EVTS+KDQ+QYW + +EPYRF+T KEF  A+QSFHVGRKLGDEL  PFDK   HPAALT 
Sbjct: 444  EVTSKKDQQQYWSKRNEPYRFITSKEFAEAYQSFHVGRKLGDELATPFDKTKCHPAALTN 503

Query: 301  RKYGVGKKELLKACFSREHLLMKRNSFVYIFRLTQVMFLAVIGMTIFLRTKMHRDSLTDG 360
             KYG+GKKELLK C  RE LLMKRNSFVY+F+ +Q+  +A+I MT+F RT+M RD+  DG
Sbjct: 504  EKYGIGKKELLKVCTERELLLMKRNSFVYMFKFSQLTIMALITMTLFFRTEMPRDTTDDG 563

Query: 361  VIYTGALFFILTTITFNGMAEISMTIAKLPVFYKQRDLRFYPSWAYALPAWILKIPISIV 420
             IY GALFF++  I FNGM+E++MTI KLPVFYKQRDL F+PSWAYA+P+WILKIP+++V
Sbjct: 564  GIYAGALFFVVIMIMFNGMSELAMTIFKLPVFYKQRDLLFFPSWAYAIPSWILKIPVTLV 623

Query: 421  EVSVWVFMTYYVIGFDSNAGRFFKQYLLLLIVNQMSSAMFRLIAAVGRSMVVANTFGSLV 480
            EV +WV +TYYVIGFD N  RF KQ+LLL++VNQM+S MFR I AVGR+M VA+TFGS  
Sbjct: 624  EVGLWVILTYYVIGFDPNITRFLKQFLLLIVVNQMASGMFRFIGAVGRTMGVASTFGSFA 683

Query: 481  LLLLFVLGGFVLSRDDIKKWWKWGYWCSPLMYAQNAIVVNEFLGNSWKKILPNKTKPLGI 540
            LLL F LGGFVLSRDD+K WW WGYW SP+MY+ N+I+VNEF G  W  I+P   + LG 
Sbjct: 684  LLLQFALGGFVLSRDDVKSWWIWGYWISPMMYSVNSILVNEFDGKKWNHIVPGGNETLGS 743

Query: 541  EVLDSRGFFTDAYWYWLGVGALTGFIILFQFGFTLALSFLNPFGTSKAFISEESQSTEHD 600
             V+ SRGFF +AYWYW+GVGAL GF ++F F ++LAL++LNPF   +A + E+ ++ E+ 
Sbjct: 744  TVVKSRGFFPEAYWYWIGVGALVGFTVVFNFCYSLALAYLNPFDKPQAVLPEDGENAEN- 802

Query: 601  SRTGGTVQLSTCANSSSHITRSESRDYVRRRNSSSQSRETTIETDQPKNRGMVLPFEPFS 660
                           SS IT ++  D              +I   Q   +GMVLPFEP S
Sbjct: 803  ------------GEVSSQITSTDGGD--------------SISESQNNKKGMVLPFEPHS 836

Query: 661  LTFDEITYSVDMPQEMKRRGVHDDKLVLLNGVSGAFRPGVLTALMGVTGSGKTTLMDVLA 720
            +TFD++ YSVDMPQEMK +G  +D+LVLL GVSGAFRPGVLTALMGV+G+GKTTLMDVLA
Sbjct: 837  ITFDDVVYSVDMPQEMKEQGAGEDRLVLLKGVSGAFRPGVLTALMGVSGAGKTTLMDVLA 896

Query: 721  GRKTRGYITGNITISGYPKNQETFTRISGYCEQNDIHSPYVTVYESLLYSAWLRLSSEVN 780
            GRKT GYI G I ISGYPK QETF RISGYCEQNDIHSPYVTVYESL+YSAWLRL  +V+
Sbjct: 897  GRKTGGYIDGEIKISGYPKKQETFARISGYCEQNDIHSPYVTVYESLVYSAWLRLPQDVD 956

Query: 781  SKTREMFVEEVMELVELNPLRQALVGLPGVNGLSTEQRKRLTIAVELVANPSIIFMDEPT 840
             KTR+MFV+EVMELVEL PLR ALVGLPGVNGLSTEQRKRLTIAVELVANPSIIFMDEPT
Sbjct: 957  EKTRKMFVDEVMELVELGPLRSALVGLPGVNGLSTEQRKRLTIAVELVANPSIIFMDEPT 1016

Query: 841  SGLDARAAAVVMRTVRNTVDTGRTVVCTIHQPSIDIFEAFDA------------------ 882
            SGLDARAAA+VMRTVRNTVDTGRTVVCTIHQPSIDIFEAFD                   
Sbjct: 1017 SGLDARAAAIVMRTVRNTVDTGRTVVCTIHQPSIDIFEAFDELFLMKRGGQEIYVGPLGR 1076

Query: 883  ----------GIPGVSKIRDGYNPATWMLEVTAPSQEIALGVDFAAIYKSSELYRINKAL 932
                        PGV+KI++GYNPATWMLEVTA +QE+ LG+DF  +YK+S+LYR NKAL
Sbjct: 1077 HSCHLIKYFESNPGVAKIKEGYNPATWMLEVTASAQEMMLGIDFTEVYKNSDLYRRNKAL 1136

Query: 933  IQELSKPAPGSKELYFANQYPLSFFTQCMACLWKQHWSYSRNPHYTAVRFLFTIFISLIF 992
            I EL  P PGSK+L+F  QY  SF+TQC+ACLWKQHWSY RNP YTAVRF+FT FI+LIF
Sbjct: 1137 ISELGVPRPGSKDLHFETQYSQSFWTQCVACLWKQHWSYWRNPAYTAVRFIFTTFIALIF 1196

Query: 993  GTMFWDMGTKTTKQQDLFNTMGFMYVAVYFLGVLNVSSVQPVVDLERSVFYREKGAGMYS 1052
            GTMFWD+GTK +K QDL N MG MY AV FLGV N SSVQPVV +ER+VFYRE+ AGMYS
Sbjct: 1197 GTMFWDLGTKVSKSQDLLNAMGSMYAAVLFLGVQNASSVQPVVAIERTVFYRERAAGMYS 1256

Query: 1053 PMAYAFAQVLIEIPYIFVQAAPYSLIVYAMIGFEWTAAKFFWFLFFMFFSLLYFTFFGMM 1112
             + YAF QV IEIPYIFVQ+  Y +IVYAMIGFEW   KFFW+LF MFF+LLYFTF+GMM
Sbjct: 1257 AIPYAFGQVSIEIPYIFVQSVFYGIIVYAMIGFEWDVGKFFWYLFIMFFTLLYFTFYGMM 1316

Query: 1113 LVAWTPNHHIASIVSTLFYGLWNIVSGFIIPRTRIPVWWRWSYWANPIAWTLYGFFASQF 1172
             VA TPN ++ASIV+  FYG+WN+ SGFIIPR R+PVWWRW YWANP+AWTLYG  ASQF
Sbjct: 1317 GVAVTPNQNVASIVAAFFYGVWNLFSGFIIPRPRMPVWWRWYYWANPVAWTLYGLVASQF 1376

Query: 1173 GDVQDRLESGETVKQFLRSYYGFKHDFLGAVAAVVFVLPSLFAFVFALGIRVLNFQKR 1230
            GD+Q +L   ETV+QFLR Y+GFKHDFLG VAAV+     +FAF FA  I+  NFQ+R
Sbjct: 1377 GDIQTKLSDNETVEQFLRRYFGFKHDFLGVVAAVLTAYVFMFAFTFAFAIKAFNFQRR 1434
May be a general defense protein.
Nicotiana tabacum (taxid: 4097)
>sp|Q9M9E1|AB40G_ARATH ABC transporter G family member 40 OS=Arabidopsis thaliana GN=ABCG40 PE=1 SV=1 Back     alignment and function description
>sp|Q0JLC5|PDR3_ORYSJ Pleiotropic drug resistance protein 3 OS=Oryza sativa subsp. japonica GN=PDR3 PE=2 SV=1 Back     alignment and function description
>sp|A2WSH0|PDR3_ORYSI Pleiotropic drug resistance protein 3 OS=Oryza sativa subsp. indica GN=PDR3 PE=2 SV=1 Back     alignment and function description
>sp|Q949G3|PDR1_NICPL Pleiotropic drug resistance protein 1 OS=Nicotiana plumbaginifolia GN=PDR1 PE=1 SV=1 Back     alignment and function description
>sp|Q8GU89|PDR4_ORYSJ Pleiotropic drug resistance protein 4 OS=Oryza sativa subsp. japonica GN=PDR4 PE=2 SV=1 Back     alignment and function description
>sp|Q8GU88|PDR7_ORYSJ Putative pleiotropic drug resistance protein 7 OS=Oryza sativa subsp. japonica GN=PDR7 PE=3 SV=1 Back     alignment and function description
>sp|Q8GU92|PDR2_ORYSJ Probable pleiotropic drug resistance protein 2 OS=Oryza sativa subsp. japonica GN=PDR2 PE=3 SV=1 Back     alignment and function description
>sp|Q7PC80|PDR1_ORYSJ Probable pleiotropic drug resistance protein 1 OS=Oryza sativa subsp. japonica GN=PDR1 PE=3 SV=1 Back     alignment and function description
>sp|O24367|TUR2_SPIPO Pleiotropic drug resistance protein TUR2 OS=Spirodela polyrrhiza GN=TUR2 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query1230
255543331 1429 ATP-binding cassette transporter, putati 0.979 0.843 0.713 0.0
255572799 1443 ATP-binding cassette transporter, putati 0.987 0.841 0.705 0.0
297743362 3142 unnamed protein product [Vitis vinifera] 0.996 0.390 0.728 0.0
224054164 1424 pleiotropic drug resistance, ABC transpo 0.972 0.839 0.718 0.0
255546581 1449 ATP-binding cassette transporter, putati 0.993 0.843 0.698 0.0
297743360 1451 unnamed protein product [Vitis vinifera] 0.995 0.843 0.722 0.0
147816688 1471 hypothetical protein VITISV_022715 [Viti 0.996 0.833 0.715 0.0
359482652 1426 PREDICTED: pleiotropic drug resistance p 0.977 0.842 0.722 0.0
356555825 1427 PREDICTED: pleiotropic drug resistance p 0.978 0.843 0.688 0.0
2555465791309 ATP-binding cassette transporter, putati 0.985 0.925 0.688 0.0
>gi|255543331|ref|XP_002512728.1| ATP-binding cassette transporter, putative [Ricinus communis] gi|223547739|gb|EEF49231.1| ATP-binding cassette transporter, putative [Ricinus communis] Back     alignment and taxonomy information
 Score = 1864 bits (4828), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 897/1258 (71%), Positives = 1035/1258 (82%), Gaps = 53/1258 (4%)

Query: 1    MLALAGKLDSSLKASGKVTYNGHDMHEFVPQRTAAYISQHDIHIGEMTVRETLAFSARCQ 60
            +LALAGKLD  LK SG+VTYNGH+M+EFVPQRTAAYISQHD HIGEMTVRETLAF+ARCQ
Sbjct: 197  LLALAGKLDPKLKFSGRVTYNGHEMNEFVPQRTAAYISQHDTHIGEMTVRETLAFAARCQ 256

Query: 61   GVGSRYDMLVELSRREKAAKIIPDADIDVFMKAVVREGQEANVITDYILKVLDLDVCADT 120
            GVG RY+M+ EL RREKA+ I PD DIDVFMKA+  EGQEANV+TDYILK+L L+VCAD 
Sbjct: 257  GVGHRYEMISELLRREKASNIKPDPDIDVFMKAMATEGQEANVVTDYILKILGLEVCADI 316

Query: 121  VVGDEMLRGISGGQRKRVTTGEMLVGPAHALFMDEISTGLDSSTTFHIVNSLGQFNHILN 180
            +VG+EMLRG+SGGQRKRVTTGEMLVGPA ALFMDEISTGLDSSTT+ IVNS+ Q+ HILN
Sbjct: 317  MVGNEMLRGVSGGQRKRVTTGEMLVGPAKALFMDEISTGLDSSTTYQIVNSIKQYIHILN 376

Query: 181  GTALISLLQPAPEVYNLFDDIILVSDGQIVYQGPLEHVEQFFISMGFKCPKRKGIADFLQ 240
            GTA+ISLLQP PE YNLFDDIIL+SDGQIVYQGP E+V +FF  MGFKCP+RKG+ADFLQ
Sbjct: 377  GTAVISLLQPPPETYNLFDDIILLSDGQIVYQGPRENVLEFFEYMGFKCPERKGVADFLQ 436

Query: 241  EVTSRKDQEQYWVRNDEPYRFVTVKEFVHAFQSFHVGRKLGDELGIPFDKKNSHPAALTT 300
            EVTSRKDQ QYW   D+PY FVTV+EF  AFQSF VGR+L  EL  PFDK  SHPAALTT
Sbjct: 437  EVTSRKDQAQYWADKDKPYSFVTVREFAEAFQSFLVGRRLEAELSTPFDKSKSHPAALTT 496

Query: 301  RKYGVGKKELLKACFSREHLLMKRNSFVYIFRLTQVMFLAVIGMTIFLRTKMHRDSLTDG 360
            +KYGVGK ELLKACFSRE LLMKRNSFVYIF+LTQ+  +A++ MT+FLRT+MHRDS+T+G
Sbjct: 497  KKYGVGKMELLKACFSREILLMKRNSFVYIFKLTQLTIMAMVAMTLFLRTEMHRDSVTNG 556

Query: 361  VIYTGALFFILTTITFNGMAEISMTIAKLPVFYKQRDLRFYPSWAYALPAWILKIPISIV 420
             IY GALFF +  I FNG++EIS+TIAKLPVFYKQR L FYP WA++LP WI KIPI++V
Sbjct: 557  GIYVGALFFSVVFIMFNGLSEISLTIAKLPVFYKQRSLLFYPPWAFSLPPWITKIPITLV 616

Query: 421  EVSVWVFMTYYVIGFDSNAGRFFKQYLLLLIVNQMSSAMFRLIAAVGRSMVVANTFGSLV 480
            +V++WVF+TYYVIGFD N GRFFKQYLLL +V+QM+S +FR IAA GR+M+VANTFGS  
Sbjct: 617  QVAIWVFLTYYVIGFDPNVGRFFKQYLLLALVSQMASGLFRFIAAAGRNMIVANTFGSFA 676

Query: 481  LLLLFVLGGFVLSRDDIKKWWKWGYWCSPLMYAQNAIVVNEFLGNSWKKILPNKTKPLGI 540
            LL LF LGGF+LSRD+IKKWW WGYW SPLMY QNAIVVNEFLGNSW K+LP+ T+ LGI
Sbjct: 677  LLALFALGGFILSRDNIKKWWIWGYWISPLMYGQNAIVVNEFLGNSWNKVLPDTTETLGI 736

Query: 541  EVLDSRGFFTDAYWYWLGVGALTGFIILFQFGFTLALSFLNPFGTSKAFISEESQSTEHD 600
            +VL+SRGFFT AYWYW+GVGAL GF +L+ F FTLAL+FL P    +A ISE+S S    
Sbjct: 737  QVLESRGFFTHAYWYWIGVGALVGFTLLYNFFFTLALTFLGPLQKPQAVISEDSASNT-S 795

Query: 601  SRTGGTVQLSTCANSSSHITRSESRDYVRRRNSSSQSRETTIETDQPKNRGMVLPFEPFS 660
             +TG  +QLS+                           E  +E +  K +GMVLPFEP S
Sbjct: 796  GKTGEVIQLSSVRT------------------------ELIVEENHQKQKGMVLPFEPHS 831

Query: 661  LTFDEITYSVDMPQEMKRRGVHDDKLVLLNGVSGAFRPGVLTALMGVTGSGKTTLMDVLA 720
            +TF++I YSVDMPQEMKR+G  +D+L LL GVSGAFRPGVLTALMGV+G+GKTTLMDVLA
Sbjct: 832  ITFNDIRYSVDMPQEMKRQGATEDRLELLRGVSGAFRPGVLTALMGVSGAGKTTLMDVLA 891

Query: 721  GRKTRGYITGNITISGYPKNQETFTRISGYCEQNDIHSPYVTVYESLLYSAWLRLSSEVN 780
            GRKT GYI G+I ISG+PK QETF RISGYCEQNDIHSP+VTVYESLLYS+WLRL  EVN
Sbjct: 892  GRKTGGYIEGDIRISGFPKKQETFARISGYCEQNDIHSPHVTVYESLLYSSWLRLPPEVN 951

Query: 781  SKTREMFVEEVMELVELNPLRQALVGLPGVNGLSTEQRKRLTIAVELVANPSIIFMDEPT 840
            S+TR+MF+EEVMELVEL PLRQALVGLPGV+GLSTEQRKRLTIAVELVANPSIIFMDEPT
Sbjct: 952  SETRKMFIEEVMELVELTPLRQALVGLPGVSGLSTEQRKRLTIAVELVANPSIIFMDEPT 1011

Query: 841  SGLDARAAAVVMRTVRNTVDTGRTVVCTIHQPSIDIFEAFDA------------------ 882
            SGLDARAAA+VMRTVRNTVDTGRTVVCTIHQPSIDIFEAFD                   
Sbjct: 1012 SGLDARAAAIVMRTVRNTVDTGRTVVCTIHQPSIDIFEAFDELLLMKRGGQEIYVGPLGR 1071

Query: 883  ----------GIPGVSKIRDGYNPATWMLEVTAPSQEIALGVDFAAIYKSSELYRINKAL 932
                       I GV  I+DGYNPATWMLEV++ +QE+ LG+DFAAIYK+SELYR NKAL
Sbjct: 1072 HSCQLIKYFEAIEGVPDIKDGYNPATWMLEVSSSAQEMVLGLDFAAIYKNSELYRRNKAL 1131

Query: 933  IQELSKPAPGSKELYFANQYPLSFFTQCMACLWKQHWSYSRNPHYTAVRFLFTIFISLIF 992
            I+ELS P  GS +LYF  QY  SFFTQCMACLWKQHWSY RNP YTAVRFLFT  I+L+F
Sbjct: 1132 IEELSTPPLGSNDLYFPTQYSQSFFTQCMACLWKQHWSYWRNPPYTAVRFLFTTVIALMF 1191

Query: 993  GTMFWDMGTKTTKQQDLFNTMGFMYVAVYFLGVLNVSSVQPVVDLERSVFYREKGAGMYS 1052
            GTMFWD+G+KTTK+QDLFN MG MY A+ FLG+ N SSVQPVV +ER+VFYRE+ AGMYS
Sbjct: 1192 GTMFWDLGSKTTKRQDLFNAMGSMYAAIVFLGIQNASSVQPVVAVERTVFYRERAAGMYS 1251

Query: 1053 PMAYAFAQVLIEIPYIFVQAAPYSLIVYAMIGFEWTAAKFFWFLFFMFFSLLYFTFFGMM 1112
            P+ YAFAQV+IE+PYIF+QAA Y LIVYAMIGFEW+AAKFFW+LFFM+F+LL++T++GMM
Sbjct: 1252 PLPYAFAQVVIELPYIFLQAAVYGLIVYAMIGFEWSAAKFFWYLFFMYFTLLFYTYYGMM 1311

Query: 1113 LVAWTPNHHIASIVSTLFYGLWNIVSGFIIPRTRIPVWWRWSYWANPIAWTLYGFFASQF 1172
             VA TPN  +ASIVS+ FY +WN+ SGFIIPR RIPVWWRW  W  P+A+TLYG  +SQF
Sbjct: 1312 AVAVTPNQQVASIVSSAFYSIWNLFSGFIIPRPRIPVWWRWYAWTCPVAYTLYGLVSSQF 1371

Query: 1173 GDVQDRLESGETVKQFLRSYYGFKHDFLGAVAAVVFVLPSLFAFVFALGIRVLNFQKR 1230
            GD++  LESGETV+ F+RSY+ FKH+ LGAVAA VF   +LFAF FA  I+  NFQ+R
Sbjct: 1372 GDIKHTLESGETVEDFVRSYFDFKHELLGAVAAAVFGFATLFAFTFAFSIKFFNFQRR 1429

Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|255572799|ref|XP_002527332.1| ATP-binding cassette transporter, putative [Ricinus communis] gi|223533332|gb|EEF35084.1| ATP-binding cassette transporter, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|297743362|emb|CBI36229.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|224054164|ref|XP_002298123.1| pleiotropic drug resistance, ABC transporter family protein [Populus trichocarpa] gi|222845381|gb|EEE82928.1| pleiotropic drug resistance, ABC transporter family protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|255546581|ref|XP_002514350.1| ATP-binding cassette transporter, putative [Ricinus communis] gi|223546806|gb|EEF48304.1| ATP-binding cassette transporter, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|297743360|emb|CBI36227.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|147816688|emb|CAN77690.1| hypothetical protein VITISV_022715 [Vitis vinifera] Back     alignment and taxonomy information
>gi|359482652|ref|XP_003632801.1| PREDICTED: pleiotropic drug resistance protein 1-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|356555825|ref|XP_003546230.1| PREDICTED: pleiotropic drug resistance protein 1-like [Glycine max] Back     alignment and taxonomy information
>gi|255546579|ref|XP_002514349.1| ATP-binding cassette transporter, putative [Ricinus communis] gi|223546805|gb|EEF48303.1| ATP-binding cassette transporter, putative [Ricinus communis] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query1230
TAIR|locus:20259311469 PEN3 "PENETRATION 3" [Arabidop 0.707 0.592 0.554 0.0
TAIR|locus:21965931423 ABCG40 "ATP-binding cassette G 0.494 0.427 0.662 0.0
TAIR|locus:20448931453 ABCG34 "ATP-binding cassette G 0.497 0.421 0.559 0.0
TAIR|locus:20196931454 ABCG39 "ATP-binding cassette G 0.495 0.419 0.548 0.0
TAIR|locus:20377031442 ABCG35 "ATP-binding cassette G 0.490 0.418 0.558 0.0
TAIR|locus:20395231420 ABCG32 "ATP-binding cassette G 0.491 0.425 0.537 0.0
TAIR|locus:20949521416 ABCG29 "ATP-binding cassette G 0.491 0.426 0.537 0.0
TAIR|locus:20498671413 ABCG33 "ATP-binding cassette G 0.564 0.491 0.456 0.0
TAIR|locus:20456831426 ABCG31 "ATP-binding cassette G 0.482 0.415 0.491 0.0
TAIR|locus:20840811450 ABCG37 "ATP-binding cassette G 0.565 0.479 0.465 2.2e-244
TAIR|locus:2025931 PEN3 "PENETRATION 3" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 2521 (892.5 bits), Expect = 0., Sum P(2) = 0.
 Identities = 491/885 (55%), Positives = 621/885 (70%)

Query:     1 MLALAGKLDSSLKASGKVTYNGHDMHEFVPQRTAAYISQHDIHIGEMTVRETLAFSARCQ 60
             +LALAGKLD SL+ SG +TYNG+ + EFVP++T+AYISQ+D+H+G MTV+ETL FSARCQ
Sbjct:   214 LLALAGKLDKSLQVSGDITYNGYQLDEFVPRKTSAYISQNDLHVGIMTVKETLDFSARCQ 273

Query:    61 GVGSRYDMLVELSRREKAAKIIPDADIDVFMKAVVREGQEANVITDYILKVLDLDVCADT 120
             GVG+RYD+L EL+RREK A I P+AD+D+FMKA   +G + +++TDY LK+L LD+C DT
Sbjct:   274 GVGTRYDLLNELARREKDAGIFPEADVDLFMKASAAQGVKNSLVTDYTLKILGLDICKDT 333

Query:   121 VVGDEMLRGISGGQRKRVTTGEMLVGPAHALFMDEISTGLDSSTTFHIVNSLGQFNHILN 180
             +VGD+M+RGISGGQ+KRVTTGEM+VGP   LFMDEISTGLDSSTTF IV  L Q  H+  
Sbjct:   334 IVGDDMMRGISGGQKKRVTTGEMIVGPTKTLFMDEISTGLDSSTTFQIVKCLQQIVHLNE 393

Query:   181 GTALISLLQPAPEVYNLFDDIILVSDGQIVYQGPLEHVEQFFISMGFKCPKRKGIADFLQ 240
              T L+SLLQPAPE ++LFDDIILVS+GQIVYQGP +++ +FF S GFKCP+RKG ADFLQ
Sbjct:   394 ATVLMSLLQPAPETFDLFDDIILVSEGQIVYQGPRDNILEFFESFGFKCPERKGTADFLQ 453

Query:   241 EVTSRKDQEQYWVRNDEPYRFVTVKEFVHAFQSFHVGRKLGDELGIPFDKKNSHPAALTT 300
             EVTS+KDQEQYWV  + PY ++ V EF   ++SFHVG K+ +EL +PFDK   H AAL  
Sbjct:   454 EVTSKKDQEQYWVNPNRPYHYIPVSEFASRYKSFHVGTKMSNELAVPFDKSRGHKAALVF 513

Query:   301 RKYGVGKKELLKACFSREHLLMKRNSFVYIFRLTQVMFLAVIGMTIFLRTKMHRDSLTDG 360
              KY V K+ELLK+C+ +E LLM+RN+F Y+F+  Q++ +A I  T+FLRT+M+  +  D 
Sbjct:   514 DKYSVSKRELLKSCWDKEWLLMQRNAFFYVFKTVQIVIIAAITSTLFLRTEMNTRNEGDA 573

Query:   361 VIYTGALFFILTTITFNGMAEISMTIAKLPVFYKQRDLRFYPSWAYALPAWILKIPISIV 420
              +Y GAL F +    FNG AE++M +++LPVFYKQRDL FYPSW ++LP ++L IP SI+
Sbjct:   574 NLYIGALLFGMIINMFNGFAEMAMMVSRLPVFYKQRDLLFYPSWTFSLPTFLLGIPSSIL 633

Query:   421 EVSVWVFMTYYVIGFDSNAGRFFKQYLLLLIVNQMSSAMFRLIAAVGRSMVVANTXXXXX 480
             E + W+ +TYY IGF  +A RFFKQ+LL+ ++ QM++++FRLIA+V R+M++ANT     
Sbjct:   634 ESTAWMVVTYYSIGFAPDASRFFKQFLLVFLIQQMAASLFRLIASVCRTMMIANTGGALT 693

Query:   481 XXXXXXXXXXXXXRDDIKKWWKWGYWCSPLMYAQNAIVVNEFLGNSW--KKILPNKTKPL 538
                          +  I  WW W YW SPL YA N +VVNE     W  K    N T  L
Sbjct:   694 LLLVFLLGGFLLPKGKIPDWWGWAYWVSPLTYAFNGLVVNEMFAPRWMNKMASSNSTIKL 753

Query:   539 GIEVLDSRGFFTDAYWYWLGVGALTGFIILFQFGFTLALSFLNPFGTSKAFISEESQSTE 598
             G  VL++   +    WYW+ VGAL  F  LF   FTLAL++LNP G     + EE     
Sbjct:   754 GTMVLNTWDVYHQKNWYWISVGALLCFTALFNILFTLALTYLNPLGKKAGLLPEEENEDA 813

Query:   599 HDSRTGGTVQLSTC-ANSSSHITRSE-SRDYVRRRNSSSQSRETTIETDQPKNRGMVLPF 656
                +      LST   N    +     SRD     +  + ++           +GMVLPF
Sbjct:   814 DQGKDPMRRSLSTADGNRRGEVAMGRMSRDSAAEASGGAGNK-----------KGMVLPF 862

Query:   657 EPFSLTFDEITYSVDMPQEMKRRGVHDDKLVLLNGVSGAFRPGVLTALMGVTGSGKTTLM 716
              P +++FD++ Y VDMP EM+ +GV + +L LL GV+GAFRPGVLTALMGV+G+GKTTLM
Sbjct:   863 TPLAMSFDDVKYFVDMPGEMRDQGVTETRLQLLKGVTGAFRPGVLTALMGVSGAGKTTLM 922

Query:   717 DVLAGRKTRGYITGNITISGYPKNQETFTRISGYCEQNDIHSPYVTVYESLLYSAWLRLS 776
             DVLAGRKT GYI G++ ISG+PK QETF RISGYCEQ DIHSP VTV ESL++SA+LRL 
Sbjct:   923 DVLAGRKTGGYIEGDVRISGFPKVQETFARISGYCEQTDIHSPQVTVRESLIFSAFLRLP 982

Query:   777 SEVNSKTRXXXXXXXXXXXXXNPLRQALVGLPGVNGLSTEQRKRLTIAVELVANPSIIFM 836
              EV    +             + LR ++VGLPGV GLSTEQRKRLTIAVELVANPSIIFM
Sbjct:   983 KEVGKDEKMMFVDQVMELVELDSLRDSIVGLPGVTGLSTEQRKRLTIAVELVANPSIIFM 1042

Query:   837 DEPTSGLDXXXXXXXXXXXXXXXDTGRTVVCTIHQPSIDIFEAFD 881
             DEPTSGLD               DTGRTVVCTIHQPSIDIFEAFD
Sbjct:  1043 DEPTSGLDARAAAIVMRAVRNTVDTGRTVVCTIHQPSIDIFEAFD 1087
GO:0000166 "nucleotide binding" evidence=IEA
GO:0005524 "ATP binding" evidence=IEA
GO:0016887 "ATPase activity" evidence=IEA
GO:0017111 "nucleoside-triphosphatase activity" evidence=IEA
GO:0042626 "ATPase activity, coupled to transmembrane movement of substances" evidence=ISS
GO:0009941 "chloroplast envelope" evidence=IDA
GO:0005886 "plasma membrane" evidence=IDA
GO:0009507 "chloroplast" evidence=IDA
GO:0005739 "mitochondrion" evidence=IDA
GO:0009627 "systemic acquired resistance" evidence=RCA;IMP
GO:0009817 "defense response to fungus, incompatible interaction" evidence=IMP
GO:0006855 "drug transmembrane transport" evidence=ISS
GO:0031348 "negative regulation of defense response" evidence=RCA;IMP
GO:0005774 "vacuolar membrane" evidence=IDA
GO:0015086 "cadmium ion transmembrane transporter activity" evidence=IDA
GO:0015691 "cadmium ion transport" evidence=IMP
GO:0016020 "membrane" evidence=IDA
GO:0042344 "indole glucosinolate catabolic process" evidence=IMP
GO:0042742 "defense response to bacterium" evidence=RCA;IMP
GO:0052544 "defense response by callose deposition in cell wall" evidence=IMP
GO:0071366 "cellular response to indolebutyric acid stimulus" evidence=IMP
GO:0009737 "response to abscisic acid stimulus" evidence=IDA
GO:0000165 "MAPK cascade" evidence=RCA
GO:0006612 "protein targeting to membrane" evidence=RCA
GO:0006995 "cellular response to nitrogen starvation" evidence=RCA
GO:0009595 "detection of biotic stimulus" evidence=RCA
GO:0009697 "salicylic acid biosynthetic process" evidence=RCA
GO:0009862 "systemic acquired resistance, salicylic acid mediated signaling pathway" evidence=RCA
GO:0009867 "jasmonic acid mediated signaling pathway" evidence=RCA
GO:0009963 "positive regulation of flavonoid biosynthetic process" evidence=RCA
GO:0010200 "response to chitin" evidence=RCA
GO:0010310 "regulation of hydrogen peroxide metabolic process" evidence=RCA
GO:0010363 "regulation of plant-type hypersensitive response" evidence=RCA
GO:0030003 "cellular cation homeostasis" evidence=RCA
GO:0031347 "regulation of defense response" evidence=RCA
GO:0043900 "regulation of multi-organism process" evidence=RCA
GO:0050832 "defense response to fungus" evidence=RCA
GO:0070838 "divalent metal ion transport" evidence=RCA
TAIR|locus:2196593 ABCG40 "ATP-binding cassette G40" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2044893 ABCG34 "ATP-binding cassette G34" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2019693 ABCG39 "ATP-binding cassette G39" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2037703 ABCG35 "ATP-binding cassette G35" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2039523 ABCG32 "ATP-binding cassette G32" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2094952 ABCG29 "ATP-binding cassette G29" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2049867 ABCG33 "ATP-binding cassette G33" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2045683 ABCG31 "ATP-binding cassette G31" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2084081 ABCG37 "ATP-binding cassette G37" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q2PCF1PDR2_NICPLNo assigned EC number0.58690.97720.8227N/Ano
Q0JLC5PDR3_ORYSJNo assigned EC number0.67920.98290.8297yesno
Q9M9E1AB40G_ARATHNo assigned EC number0.67270.97390.8418yesno
O24367TUR2_SPIPONo assigned EC number0.66240.98530.8410N/Ano
Q76CU2PDR1_TOBACNo assigned EC number0.68910.97800.8389N/Ano
Q949G3PDR1_NICPLNo assigned EC number0.69180.97560.8356N/Ano
A2WSH0PDR3_ORYSINo assigned EC number0.67840.98290.8297N/Ano
Q5W274PDR3_TOBACNo assigned EC number0.52260.97560.8293N/Ano

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
PtrPDR12
pleiotropic drug resistance, ABC transporter family protein (1424 aa)
(Populus trichocarpa)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query1230
PLN031401470 PLN03140, PLN03140, ABC transporter G family membe 0.0
TIGR009561394 TIGR00956, 3a01205, Pleiotropic Drug Resistance (P 0.0
TIGR00955617 TIGR00955, 3a01204, The Eye Pigment Precursor Tran 1e-90
cd03232192 cd03232, ABCG_PDR_domain2, Second domain of the pl 2e-89
cd03213194 cd03213, ABCG_EPDR, Eye pigment and drug resistanc 7e-69
TIGR00955617 TIGR00955, 3a01204, The Eye Pigment Precursor Tran 8e-61
TIGR00956 1394 TIGR00956, 3a01205, Pleiotropic Drug Resistance (P 2e-57
cd03234226 cd03234, ABCG_White, White pigment protein homolog 1e-52
pfam01061210 pfam01061, ABC2_membrane, ABC-2 type transporter 2e-52
pfam01061210 pfam01061, ABC2_membrane, ABC-2 type transporter 1e-43
COG1131293 COG1131, CcmA, ABC-type multidrug transport system 9e-40
cd03233202 cd03233, ABCG_PDR_domain1, First domain of the ple 1e-37
PLN03211659 PLN03211, PLN03211, ABC transporter G-25; Provisio 2e-36
PLN03140 1470 PLN03140, PLN03140, ABC transporter G family membe 2e-32
cd03234226 cd03234, ABCG_White, White pigment protein homolog 6e-32
cd03233202 cd03233, ABCG_PDR_domain1, First domain of the ple 3e-30
cd03263220 cd03263, ABC_subfamily_A, ATP-binding cassette dom 1e-29
cd03264211 cd03264, ABC_drug_resistance_like, ABC-type multid 4e-28
PLN03211659 PLN03211, PLN03211, ABC transporter G-25; Provisio 3e-27
pfam0837065 pfam08370, PDR_assoc, Plant PDR ABC transporter as 3e-27
cd03225211 cd03225, ABC_cobalt_CbiO_domain1, First domain of 6e-26
COG1131293 COG1131, CcmA, ABC-type multidrug transport system 2e-22
cd03255218 cd03255, ABC_MJ0796_LolCDE_FtsE, ATP-binding casse 4e-22
cd03235213 cd03235, ABC_Metallic_Cations, ATP-binding cassett 9e-22
COG1120258 COG1120, FepC, ABC-type cobalamin/Fe3+-siderophore 1e-21
COG1121254 COG1121, ZnuC, ABC-type Mn/Zn transport systems, A 2e-21
cd03213194 cd03213, ABCG_EPDR, Eye pigment and drug resistanc 3e-21
cd03230173 cd03230, ABC_DR_subfamily_A, ATP-binding cassette 5e-21
cd03259213 cd03259, ABC_Carb_Solutes_like, ATP-binding casset 1e-20
cd03226205 cd03226, ABC_cobalt_CbiO_domain2, Second domain of 2e-20
COG1136226 COG1136, SalX, ABC-type antimicrobial peptide tran 4e-20
cd03229178 cd03229, ABC_Class3, ATP-binding cassette domain o 1e-19
cd03219236 cd03219, ABC_Mj1267_LivG_branched, ATP-binding cas 3e-19
COG1122235 COG1122, CbiO, ABC-type cobalt transport system, A 5e-19
TIGR01188302 TIGR01188, drrA, daunorubicin resistance ABC trans 7e-19
cd03266218 cd03266, ABC_NatA_sodium_exporter, ATP-binding cas 2e-18
TIGR01166190 TIGR01166, cbiO, cobalt transport protein ATP-bind 4e-18
cd03268208 cd03268, ABC_BcrA_bacitracin_resist, ATP-binding c 4e-18
cd03214180 cd03214, ABC_Iron-Siderophores_B12_Hemin, ATP-bind 6e-18
COG4988559 COG4988, CydD, ABC-type transport system involved 6e-18
cd03292214 cd03292, ABC_FtsE_transporter, ATP-binding cassett 2e-17
cd03260227 cd03260, ABC_PstB_phosphate_transporter, ATP-bindi 3e-17
cd03233202 cd03233, ABCG_PDR_domain1, First domain of the ple 5e-17
TIGR02868530 TIGR02868, CydC, thiol reductant ABC exporter, Cyd 6e-17
COG0411250 COG0411, LivG, ABC-type branched-chain amino acid 7e-17
PRK13539207 PRK13539, PRK13539, cytochrome c biogenesis protei 1e-16
cd03265220 cd03265, ABC_DrrA, Daunorubicin/doxorubicin resist 1e-16
COG2274709 COG2274, SunT, ABC-type bacteriocin/lantibiotic ex 2e-16
cd03261235 cd03261, ABC_Org_Solvent_Resistant, ATP-binding ca 3e-16
TIGR02857529 TIGR02857, CydD, thiol reductant ABC exporter, Cyd 6e-16
cd03245220 cd03245, ABCC_bacteriocin_exporters, ATP-binding c 6e-16
PRK13537306 PRK13537, PRK13537, nodulation ABC transporter Nod 8e-16
cd03228171 cd03228, ABCC_MRP_Like, ATP-binding cassette domai 8e-16
COG4555245 COG4555, NatA, ABC-type Na+ transport system, ATPa 1e-15
cd03256241 cd03256, ABC_PhnC_transporter, ATP-binding cassett 2e-15
cd00267157 cd00267, ABC_ATPase, ATP-binding cassette transpor 2e-15
cd03297214 cd03297, ABC_ModC_molybdenum_transporter, ATP-bind 4e-15
COG3842352 COG3842, PotA, ABC-type spermidine/putrescine tran 4e-15
TIGR03873256 TIGR03873, F420-0_ABC_ATP, proposed F420-0 ABC tra 5e-15
COG1123539 COG1123, COG1123, ATPase components of various ABC 8e-15
TIGR03608206 TIGR03608, L_ocin_972_ABC, putative bacteriocin ex 1e-14
TIGR03864236 TIGR03864, PQQ_ABC_ATP, ABC transporter, ATP-bindi 1e-14
PRK13536340 PRK13536, PRK13536, nodulation factor exporter sub 1e-14
COG1118345 COG1118, CysA, ABC-type sulfate/molybdate transpor 1e-14
COG4133209 COG4133, CcmA, ABC-type transport system involved 1e-14
TIGR02315243 TIGR02315, ABC_phnC, phosphonate ABC transporter, 2e-14
COG3638258 COG3638, COG3638, ABC-type phosphate/phosphonate t 3e-14
cd03293220 cd03293, ABC_NrtD_SsuB_transporters, ATP-binding c 4e-14
COG0396251 COG0396, sufC, Cysteine desulfurase activator ATPa 5e-14
COG3839338 COG3839, MalK, ABC-type sugar transport systems, A 5e-14
cd03257228 cd03257, ABC_NikE_OppD_transporters, ATP-binding c 6e-14
cd03252237 cd03252, ABCC_Hemolysin, ATP-binding cassette doma 8e-14
COG1124252 COG1124, DppF, ABC-type dipeptide/oligopeptide/nic 1e-13
COG1127263 COG1127, Ttg2A, ABC-type transport system involved 1e-13
cd03246173 cd03246, ABCC_Protease_Secretion, ATP-binding cass 1e-13
COG4559259 COG4559, COG4559, ABC-type hemin transport system, 2e-13
TIGR01189198 TIGR01189, ccmA, heme ABC exporter, ATP-binding pr 2e-13
COG1116248 COG1116, TauB, ABC-type nitrate/sulfonate/bicarbon 2e-13
COG4604252 COG4604, CeuD, ABC-type enterochelin transport sys 2e-13
cd03254229 cd03254, ABCC_Glucan_exporter_like, ATP-binding ca 2e-13
TIGR01288303 TIGR01288, nodI, ATP-binding ABC transporter famil 5e-13
cd03263220 cd03263, ABC_subfamily_A, ATP-binding cassette dom 6e-13
cd03296239 cd03296, ABC_CysA_sulfate_importer, ATP-binding ca 6e-13
TIGR00968237 TIGR00968, 3a0106s01, sulfate ABC transporter, ATP 7e-13
cd03299235 cd03299, ABC_ModC_like, ATP-binding cassette domai 9e-13
cd03213194 cd03213, ABCG_EPDR, Eye pigment and drug resistanc 1e-12
COG1129500 COG1129, MglA, ABC-type sugar transport system, AT 1e-12
cd03224222 cd03224, ABC_TM1139_LivF_branched, ATP-binding cas 1e-12
PRK10895241 PRK10895, PRK10895, lipopolysaccharide ABC transpo 1e-12
cd03300232 cd03300, ABC_PotA_N, ATP-binding cassette domain o 2e-12
PRK11264250 PRK11264, PRK11264, putative amino-acid ABC transp 2e-12
cd03269210 cd03269, ABC_putative_ATPase, ATP-binding cassette 3e-12
TIGR012572272 TIGR01257, rim_protein, retinal-specific rim ABC t 3e-12
PRK15056272 PRK15056, PRK15056, manganese/iron transporter ATP 4e-12
PRK11231255 PRK11231, fecE, iron-dicitrate transporter ATP-bin 5e-12
COG4674249 COG4674, COG4674, Uncharacterized ABC-type transpo 5e-12
TIGR03522301 TIGR03522, GldA_ABC_ATP, gliding motility-associat 5e-12
PRK10575265 PRK10575, PRK10575, iron-hydroxamate transporter A 6e-12
COG4525259 COG4525, TauB, ABC-type taurine transport system, 1e-11
TIGR02142354 TIGR02142, modC_ABC, molybdenum ABC transporter, A 1e-11
cd03218232 cd03218, ABC_YhbG, ATP-binding cassette component 2e-11
TIGR03265353 TIGR03265, PhnT2, putative 2-aminoethylphosphonate 2e-11
cd03251234 cd03251, ABCC_MsbA, ATP-binding cassette domain of 3e-11
COG1132567 COG1132, MdlB, ABC-type multidrug transport system 3e-11
pfam00005119 pfam00005, ABC_tran, ABC transporter 3e-11
cd03232192 cd03232, ABCG_PDR_domain2, Second domain of the pl 4e-11
COG2884223 COG2884, FtsE, Predicted ATPase involved in cell d 5e-11
cd03249238 cd03249, ABC_MTABC3_MDL1_MDL2, ATP-binding cassett 5e-11
TIGR03411242 TIGR03411, urea_trans_UrtD, urea ABC transporter, 5e-11
COG0444316 COG0444, DppD, ABC-type dipeptide/oligopeptide/nic 6e-11
cd03231201 cd03231, ABC_CcmA_heme_exporter, Cytochrome c biog 6e-11
TIGR03740223 TIGR03740, galliderm_ABC, gallidermin-class lantib 6e-11
COG4148352 COG4148, ModC, ABC-type molybdate transport system 6e-11
TIGR02982220 TIGR02982, heterocyst_DevA, ABC exporter ATP-bindi 6e-11
PRK11248255 PRK11248, tauB, taurine transporter ATP-binding su 8e-11
COG4987573 COG4987, CydC, ABC-type transport system involved 9e-11
COG1125309 COG1125, OpuBA, ABC-type proline/glycine betaine t 1e-10
TIGR02673214 TIGR02673, FtsE, cell division ATP-binding protein 1e-10
PRK10584228 PRK10584, PRK10584, putative ABC transporter ATP-b 1e-10
TIGR03258362 TIGR03258, PhnT, 2-aminoethylphosphonate ABC trans 1e-10
PRK13548258 PRK13548, hmuV, hemin importer ATP-binding subunit 1e-10
PRK13639275 PRK13639, cbiO, cobalt transporter ATP-binding sub 1e-10
TIGR01842544 TIGR01842, type_I_sec_PrtD, type I secretion syste 1e-10
COG1117253 COG1117, PstB, ABC-type phosphate transport system 2e-10
PRK14239252 PRK14239, PRK14239, phosphate transporter ATP-bind 2e-10
TIGR01846694 TIGR01846, type_I_sec_HlyB, type I secretion syste 2e-10
TIGR02211221 TIGR02211, LolD_lipo_ex, lipoprotein releasing sys 2e-10
cd03267236 cd03267, ABC_NatA_like, ATP-binding cassette domai 2e-10
COG4152300 COG4152, COG4152, ABC-type uncharacterized transpo 2e-10
COG0488530 COG0488, Uup, ATPase components of ABC transporter 2e-10
cd03253236 cd03253, ABCC_ATM1_transporter, ATP-binding casset 3e-10
TIGR02323253 TIGR02323, CP_lyasePhnK, phosphonate C-P lyase sys 3e-10
PRK11629233 PRK11629, lolD, lipoprotein transporter ATP-bindin 3e-10
COG4181228 COG4181, COG4181, Predicted ABC-type transport sys 3e-10
COG1119257 COG1119, ModF, ABC-type molybdenum transport syste 4e-10
PRK09984262 PRK09984, PRK09984, phosphonate/organophosphate es 4e-10
PRK11288501 PRK11288, araG, L-arabinose transporter ATP-bindin 4e-10
COG4107258 COG4107, PhnK, ABC-type phosphonate transport syst 5e-10
cd03295242 cd03295, ABC_OpuCA_Osmoprotection, ATP-binding cas 7e-10
cd03301213 cd03301, ABC_MalK_N, The N-terminal ATPase domain 7e-10
COG0488530 COG0488, Uup, ATPase components of ABC transporter 8e-10
TIGR01978243 TIGR01978, sufC, FeS assembly ATPase SufC 8e-10
COG0410237 COG0410, LivF, ABC-type branched-chain amino acid 8e-10
TIGR00972247 TIGR00972, 3a0107s01c2, phosphate ABC transporter, 8e-10
PRK13636283 PRK13636, cbiO, cobalt transporter ATP-binding sub 9e-10
COG1120258 COG1120, FepC, ABC-type cobalamin/Fe3+-siderophore 2e-09
COG1135339 COG1135, AbcC, ABC-type metal ion transport system 2e-09
PRK14247250 PRK14247, PRK14247, phosphate ABC transporter ATP- 2e-09
PRK14272252 PRK14272, PRK14272, phosphate ABC transporter ATP- 2e-09
PRK13643288 PRK13643, cbiO, cobalt transporter ATP-binding sub 2e-09
PRK13638271 PRK13638, cbiO, cobalt transporter ATP-binding sub 2e-09
TIGR03797686 TIGR03797, NHLM_micro_ABC2, NHLM bacteriocin syste 2e-09
PRK13635279 PRK13635, cbiO, cobalt transporter ATP-binding sub 2e-09
PRK13647274 PRK13647, cbiO, cobalt transporter ATP-binding sub 2e-09
COG1101263 COG1101, PhnK, ABC-type uncharacterized transport 3e-09
TIGR03410230 TIGR03410, urea_trans_UrtE, urea ABC transporter, 3e-09
COG3845501 COG3845, COG3845, ABC-type uncharacterized transpo 4e-09
cd03248226 cd03248, ABCC_TAP, ATP-binding cassette domain of 5e-09
COG4136213 COG4136, COG4136, ABC-type uncharacterized transpo 5e-09
COG4618580 COG4618, ArpD, ABC-type protease/lipase transport 6e-09
PRK13657588 PRK13657, PRK13657, cyclic beta-1,2-glucan ABC tra 6e-09
PRK09536402 PRK09536, btuD, corrinoid ABC transporter ATPase; 8e-09
PRK13646286 PRK13646, cbiO, cobalt transporter ATP-binding sub 1e-08
COG4586325 COG4586, COG4586, ABC-type uncharacterized transpo 1e-08
COG1137243 COG1137, YhbG, ABC-type (unclassified) transport s 2e-08
TIGR03375694 TIGR03375, type_I_sec_LssB, type I secretion syste 2e-08
cd03262213 cd03262, ABC_HisP_GlnQ, ATP-binding cassette domai 2e-08
COG1126240 COG1126, GlnQ, ABC-type polar amino acid transport 2e-08
TIGR03796710 TIGR03796, NHLM_micro_ABC1, NHLM bacteriocin syste 2e-08
PRK14261253 PRK14261, PRK14261, phosphate ABC transporter ATP- 2e-08
COG4175386 COG4175, ProV, ABC-type proline/glycine betaine tr 2e-08
TIGR01187325 TIGR01187, potA, spermidine/putrescine ABC transpo 3e-08
cd03258233 cd03258, ABC_MetN_methionine_transporter, ATP-bind 3e-08
PRK11160574 PRK11160, PRK11160, cysteine/glutathione ABC trans 4e-08
cd00267157 cd00267, ABC_ATPase, ATP-binding cassette transpor 5e-08
PRK13652277 PRK13652, cbiO, cobalt transporter ATP-binding sub 5e-08
TIGR03771223 TIGR03771, anch_rpt_ABC, anchored repeat-type ABC 5e-08
COG0842286 COG0842, COG0842, ABC-type multidrug transport sys 5e-08
COG1123539 COG1123, COG1123, ATPase components of various ABC 6e-08
PRK13641287 PRK13641, cbiO, cobalt transporter ATP-binding sub 6e-08
cd03297214 cd03297, ABC_ModC_molybdenum_transporter, ATP-bind 7e-08
TIGR01257 2272 TIGR01257, rim_protein, retinal-specific rim ABC t 8e-08
TIGR01186363 TIGR01186, proV, glycine betaine/L-proline transpo 8e-08
TIGR01184230 TIGR01184, ntrCD, nitrate transport ATP-binding su 8e-08
cd03236255 cd03236, ABC_RNaseL_inhibitor_domain1, The ATP-bin 1e-07
PRK13540200 PRK13540, PRK13540, cytochrome c biogenesis protei 1e-07
cd03217200 cd03217, ABC_FeS_Assembly, ABC-type transport syst 1e-07
PRK14255252 PRK14255, PRK14255, phosphate ABC transporter ATP- 2e-07
PRK14253249 PRK14253, PRK14253, phosphate ABC transporter ATP- 2e-07
cd03250204 cd03250, ABCC_MRP_domain1, ATP-binding cassette do 2e-07
PRK14241258 PRK14241, PRK14241, phosphate transporter ATP-bind 2e-07
COG1245591 COG1245, COG1245, Predicted ATPase, RNase L inhibi 2e-07
PRK15134529 PRK15134, PRK15134, microcin C ABC transporter ATP 3e-07
PRK13549506 PRK13549, PRK13549, xylose transporter ATP-binding 3e-07
PRK10419268 PRK10419, nikE, nickel transporter ATP-binding pro 3e-07
PRK10619257 PRK10619, PRK10619, histidine/lysine/arginine/orni 3e-07
cd03294269 cd03294, ABC_Pro_Gly_Betaine, ATP-binding cassette 3e-07
COG4172534 COG4172, COG4172, ABC-type uncharacterized transpo 3e-07
TIGR02203571 TIGR02203, MsbA_lipidA, lipid A export permease/AT 4e-07
PRK14245250 PRK14245, PRK14245, phosphate ABC transporter ATP- 4e-07
TIGR02769265 TIGR02769, nickel_nikE, nickel import ATP-binding 4e-07
TIGR02770230 TIGR02770, nickel_nikD, nickel import ATP-binding 4e-07
TIGR01277213 TIGR01277, thiQ, thiamine ABC transporter, ATP-bin 6e-07
PRK14271276 PRK14271, PRK14271, phosphate ABC transporter ATP- 6e-07
COG3840231 COG3840, ThiQ, ABC-type thiamine transport system, 7e-07
PRK14235267 PRK14235, PRK14235, phosphate transporter ATP-bind 8e-07
pfam12698278 pfam12698, ABC2_membrane_3, ABC-2 family transport 9e-07
PRK13631320 PRK13631, cbiO, cobalt transporter ATP-binding sub 9e-07
COG4555245 COG4555, NatA, ABC-type Na+ transport system, ATPa 1e-06
cd03251234 cd03251, ABCC_MsbA, ATP-binding cassette domain of 1e-06
PRK14269246 PRK14269, PRK14269, phosphate ABC transporter ATP- 1e-06
cd03288257 cd03288, ABCC_SUR2, ATP-binding cassette domain 2 1e-06
COG5265497 COG5265, ATM1, ABC-type transport system involved 1e-06
CHL00131252 CHL00131, ycf16, sulfate ABC transporter protein; 1e-06
COG4619223 COG4619, COG4619, ABC-type uncharacterized transpo 1e-06
PRK14246257 PRK14246, PRK14246, phosphate ABC transporter ATP- 1e-06
PRK14256252 PRK14256, PRK14256, phosphate ABC transporter ATP- 1e-06
cd03244221 cd03244, ABCC_MRP_domain2, ATP-binding cassette do 1e-06
PRK11000369 PRK11000, PRK11000, maltose/maltodextrin transport 1e-06
COG4161242 COG4161, ArtP, ABC-type arginine transport system, 1e-06
cd03253236 cd03253, ABCC_ATM1_transporter, ATP-binding casset 2e-06
cd03216163 cd03216, ABC_Carb_Monos_I, First domain of the ATP 2e-06
PRK13547272 PRK13547, hmuV, hemin importer ATP-binding subunit 2e-06
cd03298211 cd03298, ABC_ThiQ_thiamine_transporter, ATP-bindin 2e-06
PRK13634290 PRK13634, cbiO, cobalt transporter ATP-binding sub 2e-06
TIGR02204576 TIGR02204, MsbA_rel, ABC transporter, permease/ATP 2e-06
COG4178604 COG4178, COG4178, ABC-type uncharacterized transpo 2e-06
PRK09580248 PRK09580, sufC, cysteine desulfurase ATPase compon 2e-06
PRK13649280 PRK13649, cbiO, cobalt transporter ATP-binding sub 2e-06
PRK14270251 PRK14270, PRK14270, phosphate ABC transporter ATP- 2e-06
PRK09700510 PRK09700, PRK09700, D-allose transporter ATP-bindi 2e-06
cd00267157 cd00267, ABC_ATPase, ATP-binding cassette transpor 3e-06
PRK11701258 PRK11701, phnK, phosphonate C-P lyase system prote 3e-06
PRK13648269 PRK13648, cbiO, cobalt transporter ATP-binding sub 4e-06
PRK10762501 PRK10762, PRK10762, D-ribose transporter ATP bindi 4e-06
PRK14257329 PRK14257, PRK14257, phosphate ABC transporter ATP- 4e-06
PRK14267253 PRK14267, PRK14267, phosphate ABC transporter ATP- 4e-06
PRK11176582 PRK11176, PRK11176, lipid transporter ATP-binding/ 4e-06
PRK13538204 PRK13538, PRK13538, cytochrome c biogenesis protei 5e-06
COG4598256 COG4598, HisP, ABC-type histidine transport system 5e-06
TIGR02324224 TIGR02324, CP_lyasePhnL, phosphonate C-P lyase sys 5e-06
PRK14273254 PRK14273, PRK14273, phosphate ABC transporter ATP- 5e-06
PRK14240250 PRK14240, PRK14240, phosphate transporter ATP-bind 5e-06
PRK14251251 PRK14251, PRK14251, phosphate ABC transporter ATP- 6e-06
TIGR00958711 TIGR00958, 3a01208, Conjugate Transporter-2 (CT2) 6e-06
PRK14242253 PRK14242, PRK14242, phosphate transporter ATP-bind 6e-06
PRK14262250 PRK14262, PRK14262, phosphate ABC transporter ATP- 6e-06
TIGR02633500 TIGR02633, xylG, D-xylose ABC transporter, ATP-bin 6e-06
cd03369207 cd03369, ABCC_NFT1, ATP-binding cassette domain 2 7e-06
cd03290218 cd03290, ABCC_SUR1_N, ATP-binding cassette domain 7e-06
COG4167267 COG4167, SapF, ABC-type antimicrobial peptide tran 7e-06
PRK09452375 PRK09452, potA, putrescine/spermidine ABC transpor 7e-06
cd03225211 cd03225, ABC_cobalt_CbiO_domain1, First domain of 8e-06
TIGR01192585 TIGR01192, chvA, glucan exporter ATP-binding prote 8e-06
PRK11144352 PRK11144, modC, molybdate transporter ATP-binding 8e-06
PRK11300255 PRK11300, livG, leucine/isoleucine/valine transpor 8e-06
PRK11432351 PRK11432, fbpC, ferric transporter ATP-binding sub 8e-06
cd03245220 cd03245, ABCC_bacteriocin_exporters, ATP-binding c 9e-06
cd03255218 cd03255, ABC_MJ0796_LolCDE_FtsE, ATP-binding casse 1e-05
COG4586325 COG4586, COG4586, ABC-type uncharacterized transpo 1e-05
TIGR03375694 TIGR03375, type_I_sec_LssB, type I secretion syste 1e-05
TIGR02203571 TIGR02203, MsbA_lipidA, lipid A export permease/AT 1e-05
PRK09700510 PRK09700, PRK09700, D-allose transporter ATP-bindi 1e-05
cd03238176 cd03238, ABC_UvrA, ATP-binding cassette domain of 1e-05
PRK10982491 PRK10982, PRK10982, galactose/methyl galaxtoside t 1e-05
PRK11174588 PRK11174, PRK11174, cysteine/glutathione ABC trans 1e-05
PRK14250241 PRK14250, PRK14250, phosphate ABC transporter ATP- 1e-05
PLN03211659 PLN03211, PLN03211, ABC transporter G-25; Provisio 2e-05
cd03249238 cd03249, ABC_MTABC3_MDL1_MDL2, ATP-binding cassett 2e-05
COG1135339 COG1135, AbcC, ABC-type metal ion transport system 2e-05
PRK11614237 PRK11614, livF, leucine/isoleucine/valine transpor 2e-05
COG4608268 COG4608, AppF, ABC-type oligopeptide transport sys 2e-05
cd03232192 cd03232, ABCG_PDR_domain2, Second domain of the pl 3e-05
cd03299235 cd03299, ABC_ModC_like, ATP-binding cassette domai 3e-05
COG4138248 COG4138, BtuD, ABC-type cobalamin transport system 3e-05
PRK13637287 PRK13637, cbiO, cobalt transporter ATP-binding sub 3e-05
TIGR02314343 TIGR02314, ABC_MetN, D-methionine ABC transporter, 3e-05
PRK14236272 PRK14236, PRK14236, phosphate transporter ATP-bind 4e-05
PRK03695248 PRK03695, PRK03695, vitamin B12-transporter ATPase 4e-05
PTZ00243 1560 PTZ00243, PTZ00243, ABC transporter; Provisional 4e-05
TIGR03522301 TIGR03522, GldA_ABC_ATP, gliding motility-associat 5e-05
cd03216163 cd03216, ABC_Carb_Monos_I, First domain of the ATP 5e-05
PRK13632271 PRK13632, cbiO, cobalt transporter ATP-binding sub 5e-05
PRK13543214 PRK13543, PRK13543, cytochrome c biogenesis protei 5e-05
PRK14266250 PRK14266, PRK14266, phosphate ABC transporter ATP- 5e-05
TIGR03269520 TIGR03269, met_CoM_red_A2, methyl coenzyme M reduc 5e-05
PRK10535648 PRK10535, PRK10535, macrolide transporter ATP-bind 6e-05
cd03247178 cd03247, ABCC_cytochrome_bd, ATP-binding cassette 6e-05
PRK10851353 PRK10851, PRK10851, sulfate/thiosulfate transporte 7e-05
TIGR03719552 TIGR03719, ABC_ABC_ChvD, ATP-binding cassette prot 7e-05
COG1129500 COG1129, MglA, ABC-type sugar transport system, AT 8e-05
COG3845501 COG3845, COG3845, ABC-type uncharacterized transpo 9e-05
COG4172534 COG4172, COG4172, ABC-type uncharacterized transpo 9e-05
PRK14274259 PRK14274, PRK14274, phosphate ABC transporter ATP- 9e-05
PRK13640282 PRK13640, cbiO, cobalt transporter ATP-binding sub 9e-05
TIGR01188302 TIGR01188, drrA, daunorubicin resistance ABC trans 1e-04
COG4988559 COG4988, CydD, ABC-type transport system involved 1e-04
cd03265220 cd03265, ABC_DrrA, Daunorubicin/doxorubicin resist 1e-04
COG2274709 COG2274, SunT, ABC-type bacteriocin/lantibiotic ex 1e-04
cd03223166 cd03223, ABCD_peroxisomal_ALDP, ATP-binding casset 1e-04
PRK15439510 PRK15439, PRK15439, autoinducer 2 ABC transporter 1e-04
PRK14259269 PRK14259, PRK14259, phosphate ABC transporter ATP- 1e-04
PRK11650356 PRK11650, ugpC, glycerol-3-phosphate transporter A 1e-04
PRK14252265 PRK14252, PRK14252, phosphate ABC transporter ATP- 1e-04
cd03264211 cd03264, ABC_drug_resistance_like, ABC-type multid 2e-04
cd03256241 cd03256, ABC_PhnC_transporter, ATP-binding cassett 2e-04
TIGR02633500 TIGR02633, xylG, D-xylose ABC transporter, ATP-bin 2e-04
PRK13651305 PRK13651, PRK13651, cobalt transporter ATP-binding 2e-04
PRK14238271 PRK14238, PRK14238, phosphate transporter ATP-bind 2e-04
PRK09493240 PRK09493, glnQ, glutamine ABC transporter ATP-bind 2e-04
PRK14258261 PRK14258, PRK14258, phosphate ABC transporter ATP- 2e-04
PRK14275286 PRK14275, PRK14275, phosphate ABC transporter ATP- 2e-04
PLN032321495 PLN03232, PLN03232, ABC transporter C family membe 2e-04
PRK14237267 PRK14237, PRK14237, phosphate transporter ATP-bind 2e-04
PRK14264305 PRK14264, PRK14264, phosphate ABC transporter ATP- 2e-04
PRK10790592 PRK10790, PRK10790, putative multidrug transporter 2e-04
cd03214180 cd03214, ABC_Iron-Siderophores_B12_Hemin, ATP-bind 3e-04
COG3638258 COG3638, COG3638, ABC-type phosphate/phosphonate t 3e-04
cd03252237 cd03252, ABCC_Hemolysin, ATP-binding cassette doma 3e-04
TIGR03005252 TIGR03005, ectoine_ehuA, ectoine/hydroxyectoine AB 3e-04
TIGR00957 1522 TIGR00957, MRP_assoc_pro, multi drug resistance-as 3e-04
PRK14254285 PRK14254, PRK14254, phosphate ABC transporter ATP- 3e-04
TIGR03415382 TIGR03415, ABC_choXWV_ATP, choline ABC transporter 3e-04
PRK10253265 PRK10253, PRK10253, iron-enterobactin transporter 3e-04
COG1136226 COG1136, SalX, ABC-type antimicrobial peptide tran 4e-04
COG1119257 COG1119, ModF, ABC-type molybdenum transport syste 4e-04
PRK14248268 PRK14248, PRK14248, phosphate ABC transporter ATP- 4e-04
PRK10908222 PRK10908, PRK10908, cell division protein FtsE; Pr 4e-04
COG1134249 COG1134, TagH, ABC-type polysaccharide/polyol phos 4e-04
PRK11607377 PRK11607, potG, putrescine transporter ATP-binding 4e-04
PRK15439510 PRK15439, PRK15439, autoinducer 2 ABC transporter 5e-04
PRK14260259 PRK14260, PRK14260, phosphate ABC transporter ATP- 5e-04
PTZ00265 1466 PTZ00265, PTZ00265, multidrug resistance protein ( 5e-04
COG3839338 COG3839, MalK, ABC-type sugar transport systems, A 7e-04
TIGR00968237 TIGR00968, 3a0106s01, sulfate ABC transporter, ATP 7e-04
PRK13409590 PRK13409, PRK13409, putative ATPase RIL; Provision 7e-04
smart00382148 smart00382, AAA, ATPases associated with a variety 7e-04
TIGR01193708 TIGR01193, bacteriocin_ABC, ABC-type bacteriocin t 7e-04
TIGR03269520 TIGR03269, met_CoM_red_A2, methyl coenzyme M reduc 8e-04
cd03235213 cd03235, ABC_Metallic_Cations, ATP-binding cassett 0.001
COG1121254 COG1121, ZnuC, ABC-type Mn/Zn transport systems, A 0.001
cd03266218 cd03266, ABC_NatA_sodium_exporter, ATP-binding cas 0.001
COG0411250 COG0411, LivG, ABC-type branched-chain amino acid 0.001
COG1127263 COG1127, Ttg2A, ABC-type transport system involved 0.001
COG0444316 COG0444, DppD, ABC-type dipeptide/oligopeptide/nic 0.001
TIGR03797686 TIGR03797, NHLM_micro_ABC2, NHLM bacteriocin syste 0.001
COG1245591 COG1245, COG1245, Predicted ATPase, RNase L inhibi 0.001
TIGR01193708 TIGR01193, bacteriocin_ABC, ABC-type bacteriocin t 0.001
PRK14244251 PRK14244, PRK14244, phosphate ABC transporter ATP- 0.001
PRK13642277 PRK13642, cbiO, cobalt transporter ATP-binding sub 0.001
cd03289275 cd03289, ABCC_CFTR2, ATP-binding cassette domain 2 0.001
TIGR02868530 TIGR02868, CydC, thiol reductant ABC exporter, Cyd 0.002
COG1123539 COG1123, COG1123, ATPase components of various ABC 0.002
TIGR01846694 TIGR01846, type_I_sec_HlyB, type I secretion syste 0.002
cd03258233 cd03258, ABC_MetN_methionine_transporter, ATP-bind 0.002
PRK10247225 PRK10247, PRK10247, putative ABC transporter ATP-b 0.002
PRK15112267 PRK15112, PRK15112, antimicrobial peptide ABC syst 0.002
PRK14243264 PRK14243, PRK14243, phosphate transporter ATP-bind 0.002
PRK14249251 PRK14249, PRK14249, phosphate ABC transporter ATP- 0.002
PRK10418254 PRK10418, nikD, nickel transporter ATP-binding pro 0.002
cd03220224 cd03220, ABC_KpsT_Wzt, ATP-binding cassette compon 0.002
cd03229178 cd03229, ABC_Class3, ATP-binding cassette domain o 0.003
COG1122235 COG1122, CbiO, ABC-type cobalt transport system, A 0.003
TIGR02857529 TIGR02857, CydD, thiol reductant ABC exporter, Cyd 0.003
PTZ002651466 PTZ00265, PTZ00265, multidrug resistance protein ( 0.003
cd03215182 cd03215, ABC_Carb_Monos_II, Second domain of the A 0.003
PRK14268258 PRK14268, PRK14268, phosphate ABC transporter ATP- 0.003
PRK11124242 PRK11124, artP, arginine transporter ATP-binding s 0.003
cd03237246 cd03237, ABC_RNaseL_inhibitor_domain2, The ATP-bin 0.003
TIGR03864236 TIGR03864, PQQ_ABC_ATP, ABC transporter, ATP-bindi 0.004
pfam13304256 pfam13304, AAA_21, AAA domain 0.004
>gnl|CDD|215599 PLN03140, PLN03140, ABC transporter G family member; Provisional Back     alignment and domain information 
 Score = 1748 bits (4530), Expect = 0.0
 Identities = 741/1264 (58%), Positives = 932/1264 (73%), Gaps = 35/1264 (2%)

Query: 1    MLALAGKLDSSLKASGKVTYNGHDMHEFVPQRTAAYISQHDIHIGEMTVRETLAFSARCQ 60
            +LALAGKLD SLK SG++TYNG+ ++EFVP++T+AYISQ+D+H+G MTV+ETL FSARCQ
Sbjct: 208  LLALAGKLDPSLKVSGEITYNGYRLNEFVPRKTSAYISQNDVHVGVMTVKETLDFSARCQ 267

Query: 61   GVGSRYDMLVELSRREKAAKIIPDADIDVFMKAVVREGQEANVITDYILKVLDLDVCADT 120
            GVG+RYD+L EL+RREK A I P+A++D+FMKA   EG ++++ITDY LK+L LD+C DT
Sbjct: 268  GVGTRYDLLSELARREKDAGIFPEAEVDLFMKATAMEGVKSSLITDYTLKILGLDICKDT 327

Query: 121  VVGDEMLRGISGGQRKRVTTGEMLVGPAHALFMDEISTGLDSSTTFHIVNSLGQFNHILN 180
            +VGDEM+RGISGGQ+KRVTTGEM+VGP   LFMDEISTGLDSSTT+ IV  L Q  H+  
Sbjct: 328  IVGDEMIRGISGGQKKRVTTGEMIVGPTKTLFMDEISTGLDSSTTYQIVKCLQQIVHLTE 387

Query: 181  GTALISLLQPAPEVYNLFDDIILVSDGQIVYQGPLEHVEQFFISMGFKCPKRKGIADFLQ 240
             T L+SLLQPAPE ++LFDDIIL+S+GQIVYQGP +H+ +FF S GFKCP+RKG ADFLQ
Sbjct: 388  ATVLMSLLQPAPETFDLFDDIILLSEGQIVYQGPRDHILEFFESCGFKCPERKGTADFLQ 447

Query: 241  EVTSRKDQEQYWVRNDEPYRFVTVKEFVHAFQSFHVGRKLGDELGIPFDKKNSHPAALTT 300
            EVTS+KDQEQYW   ++PYR+++V EF   F+SFHVG +L +EL +PFDK  SH AAL  
Sbjct: 448  EVTSKKDQEQYWADRNKPYRYISVSEFAERFKSFHVGMQLENELSVPFDKSQSHKAALVF 507

Query: 301  RKYGVGKKELLKACFSREHLLMKRNSFVYIFRLTQVMFLAVIGMTIFLRTKMHRDSLTDG 360
             KY V K ELLKAC+ +E LLMKRN+FVY+F+  Q++ +A I  T+FLRT+MH  +  DG
Sbjct: 508  SKYSVPKMELLKACWDKEWLLMKRNAFVYVFKTVQIIIVAAIASTVFLRTEMHTRNEEDG 567

Query: 361  VIYTGALFFILTTITFNGMAEISMTIAKLPVFYKQRDLRFYPSWAYALPAWILKIPISIV 420
             +Y GAL F +    FNG AE+++ I +LPVFYKQRDL F+P W + LP ++L IPISI+
Sbjct: 568  ALYIGALLFSMIINMFNGFAELALMIQRLPVFYKQRDLLFHPPWTFTLPTFLLGIPISII 627

Query: 421  EVSVWVFMTYYVIGFDSNAGRFFKQYLLLLIVNQMSSAMFRLIAAVGRSMVVANTFGSLV 480
            E  VWV +TYY IGF   A RFFKQ LL+ ++ QM++ +FRLIA+V R+M++ANT G+LV
Sbjct: 628  ESVVWVVITYYSIGFAPEASRFFKQLLLVFLIQQMAAGIFRLIASVCRTMIIANTGGALV 687

Query: 481  LLLLFVLGGFVLSRDDIKKWWKWGYWCSPLMYAQNAIVVNEFLGNSW-KKILPNKTKPLG 539
            LLL+F+LGGF+L + +I  WW+W YW SPL Y  NA+ VNE     W  K+  + +  LG
Sbjct: 688  LLLVFLLGGFILPKGEIPNWWEWAYWVSPLSYGFNALAVNEMFAPRWMNKMASDNSTRLG 747

Query: 540  IEVLDSRGFFTDAYWYWLGVGALTGFIILFQFGFTLALSFLNPFGTSKAFISEESQSTEH 599
              VL+    FTD  WYW+GVGAL GF ILF   FTLAL++LNP G  +A ISEE+     
Sbjct: 748  TAVLNIFDVFTDKNWYWIGVGALLGFTILFNVLFTLALTYLNPLGKKQAIISEETAEEME 807

Query: 600  DSRTGGTVQLSTCANSSSHITRSESRDYVRRRNSSSQSRETTIETDQPKNRGMVLPFEPF 659
                     LS+   +++     +        + +  S         PK RGMVLPF P 
Sbjct: 808  GEEDSIPRSLSSADGNNTREVAIQRMSNPEGLSKNRDSSLEAANGVAPK-RGMVLPFTPL 866

Query: 660  SLTFDEITYSVDMPQEMKRRGVHDDKLVLLNGVSGAFRPGVLTALMGVTGSGKTTLMDVL 719
            +++FD++ Y VDMP EMK +GV +D+L LL  V+GAFRPGVLTALMGV+G+GKTTLMDVL
Sbjct: 867  AMSFDDVNYFVDMPAEMKEQGVTEDRLQLLREVTGAFRPGVLTALMGVSGAGKTTLMDVL 926

Query: 720  AGRKTRGYITGNITISGYPKNQETFTRISGYCEQNDIHSPYVTVYESLLYSAWLRLSSEV 779
            AGRKT GYI G+I ISG+PK QETF RISGYCEQNDIHSP VTV ESL+YSA+LRL  EV
Sbjct: 927  AGRKTGGYIEGDIRISGFPKKQETFARISGYCEQNDIHSPQVTVRESLIYSAFLRLPKEV 986

Query: 780  NSKTREMFVEEVMELVELNPLRQALVGLPGVNGLSTEQRKRLTIAVELVANPSIIFMDEP 839
            + + + MFV+EVMELVEL+ L+ A+VGLPGV GLSTEQRKRLTIAVELVANPSIIFMDEP
Sbjct: 987  SKEEKMMFVDEVMELVELDNLKDAIVGLPGVTGLSTEQRKRLTIAVELVANPSIIFMDEP 1046

Query: 840  TSGLDARAAAVVMRTVRNTVDTGRTVVCTIHQPSIDIFEAFD------------------ 881
            TSGLDARAAA+VMRTVRNTVDTGRTVVCTIHQPSIDIFEAFD                  
Sbjct: 1047 TSGLDARAAAIVMRTVRNTVDTGRTVVCTIHQPSIDIFEAFDELLLMKRGGQVIYSGPLG 1106

Query: 882  ----------AGIPGVSKIRDGYNPATWMLEVTAPSQEIALGVDFAAIYKSSELYRINKA 931
                        IPGV KI++ YNPATWMLEV++ + E+ LG+DFA  YKSS LY+ NKA
Sbjct: 1107 RNSHKIIEYFEAIPGVPKIKEKYNPATWMLEVSSLAAEVKLGIDFAEHYKSSSLYQRNKA 1166

Query: 932  LIQELSKPAPGSKELYFANQYPLSFFTQCMACLWKQHWSYSRNPHYTAVRFLFTIFISLI 991
            L++ELS P PG+ +LYFA QY  S + Q  +CLWKQ W+Y R+P Y  VRF FT+  +L+
Sbjct: 1167 LVKELSTPPPGASDLYFATQYSQSTWGQFKSCLWKQWWTYWRSPDYNLVRFFFTLAAALM 1226

Query: 992  FGTMFWDMGTKTTKQQDLFNTMGFMYVAVYFLGVLNVSSVQPVVDLERSVFYREKGAGMY 1051
             GT+FW +GTK +   DL   +G MY AV F+G+ N S+VQP+V +ER+VFYRE+ AGMY
Sbjct: 1227 VGTIFWKVGTKRSNANDLTMVIGAMYAAVLFVGINNCSTVQPMVAVERTVFYRERAAGMY 1286

Query: 1052 SPMAYAFAQVLIEIPYIFVQAAPYSLIVYAMIGFEWTAAKFFWFLFFMFFSLLYFTFFGM 1111
            S + YA AQV+ EIPY+ +Q   Y+LIVYAM+ FEWTAAKFFWF F  FFS LYFT++GM
Sbjct: 1287 SALPYAIAQVVCEIPYVLIQTTYYTLIVYAMVAFEWTAAKFFWFYFISFFSFLYFTYYGM 1346

Query: 1112 MLVAWTPNHHIASIVSTLFYGLWNIVSGFIIPRTRIPVWWRWSYWANPIAWTLYGFFASQ 1171
            M V+ TPN  +A+I +  FYGL+N+ SGF IPR +IP WW W YW  P+AWT+YG   SQ
Sbjct: 1347 MTVSLTPNQQVAAIFAAAFYGLFNLFSGFFIPRPKIPKWWVWYYWICPVAWTVYGLIVSQ 1406

Query: 1172 FGDVQDRLE-----SGETVKQFLRSYYGFKHDFLGAVAAVVFVLPSLFAFVFALGIRVLN 1226
            +GDV+D ++        T+K +++ +YG+  DF+G VAAV+      FAF+FA  IR LN
Sbjct: 1407 YGDVEDTIKVPGGAPDPTIKWYIQDHYGYDPDFMGPVAAVLVGFTVFFAFIFAFCIRTLN 1466

Query: 1227 FQKR 1230
            FQ R
Sbjct: 1467 FQTR 1470

Length = 1470
>gnl|CDD|233208 TIGR00956, 3a01205, Pleiotropic Drug Resistance (PDR) Family protein Back     alignment and domain information
>gnl|CDD|233207 TIGR00955, 3a01204, The Eye Pigment Precursor Transporter (EPP) Family protein Back     alignment and domain information
>gnl|CDD|213199 cd03232, ABCG_PDR_domain2, Second domain of the pleiotropic drug resistance-like (PDR) subfamily G of ATP-binding cassette transporters Back     alignment and domain information
>gnl|CDD|213180 cd03213, ABCG_EPDR, Eye pigment and drug resistance transporter subfamily G of the ATP-binding cassette superfamily Back     alignment and domain information
>gnl|CDD|233207 TIGR00955, 3a01204, The Eye Pigment Precursor Transporter (EPP) Family protein Back     alignment and domain information
>gnl|CDD|233208 TIGR00956, 3a01205, Pleiotropic Drug Resistance (PDR) Family protein Back     alignment and domain information
>gnl|CDD|213201 cd03234, ABCG_White, White pigment protein homolog of ABCG transporter subfamily Back     alignment and domain information
>gnl|CDD|216273 pfam01061, ABC2_membrane, ABC-2 type transporter Back     alignment and domain information
>gnl|CDD|216273 pfam01061, ABC2_membrane, ABC-2 type transporter Back     alignment and domain information
>gnl|CDD|224054 COG1131, CcmA, ABC-type multidrug transport system, ATPase component [Defense mechanisms] Back     alignment and domain information
>gnl|CDD|213200 cd03233, ABCG_PDR_domain1, First domain of the pleiotropic drug resistance-like subfamily G of ATP-binding cassette transporters Back     alignment and domain information
>gnl|CDD|215634 PLN03211, PLN03211, ABC transporter G-25; Provisional Back     alignment and domain information
>gnl|CDD|215599 PLN03140, PLN03140, ABC transporter G family member; Provisional Back     alignment and domain information
>gnl|CDD|213201 cd03234, ABCG_White, White pigment protein homolog of ABCG transporter subfamily Back     alignment and domain information
>gnl|CDD|213200 cd03233, ABCG_PDR_domain1, First domain of the pleiotropic drug resistance-like subfamily G of ATP-binding cassette transporters Back     alignment and domain information
>gnl|CDD|213230 cd03263, ABC_subfamily_A, ATP-binding cassette domain of the lipid transporters, subfamily A Back     alignment and domain information
>gnl|CDD|213231 cd03264, ABC_drug_resistance_like, ABC-type multidrug transport system, ATPase component Back     alignment and domain information
>gnl|CDD|215634 PLN03211, PLN03211, ABC transporter G-25; Provisional Back     alignment and domain information
>gnl|CDD|219810 pfam08370, PDR_assoc, Plant PDR ABC transporter associated Back     alignment and domain information
>gnl|CDD|213192 cd03225, ABC_cobalt_CbiO_domain1, First domain of the ATP-binding cassette component of cobalt transport system Back     alignment and domain information
>gnl|CDD|224054 COG1131, CcmA, ABC-type multidrug transport system, ATPase component [Defense mechanisms] Back     alignment and domain information
>gnl|CDD|213222 cd03255, ABC_MJ0796_LolCDE_FtsE, ATP-binding cassette domain of the transporters involved in export of lipoprotein and macrolide, and cell division protein Back     alignment and domain information
>gnl|CDD|213202 cd03235, ABC_Metallic_Cations, ATP-binding cassette domain of the metal-type transporters Back     alignment and domain information
>gnl|CDD|224045 COG1120, FepC, ABC-type cobalamin/Fe3+-siderophores transport systems, ATPase components [Inorganic ion transport and metabolism / Coenzyme metabolism] Back     alignment and domain information
>gnl|CDD|224046 COG1121, ZnuC, ABC-type Mn/Zn transport systems, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|213180 cd03213, ABCG_EPDR, Eye pigment and drug resistance transporter subfamily G of the ATP-binding cassette superfamily Back     alignment and domain information
>gnl|CDD|213197 cd03230, ABC_DR_subfamily_A, ATP-binding cassette domain of the drug resistance transporter and related proteins, subfamily A Back     alignment and domain information
>gnl|CDD|213226 cd03259, ABC_Carb_Solutes_like, ATP-binding cassette domain of the carbohydrate and solute transporters-like Back     alignment and domain information
>gnl|CDD|213193 cd03226, ABC_cobalt_CbiO_domain2, Second domain of the ATP-binding cassette component of cobalt transport system Back     alignment and domain information
>gnl|CDD|224059 COG1136, SalX, ABC-type antimicrobial peptide transport system, ATPase component [Defense mechanisms] Back     alignment and domain information
>gnl|CDD|213196 cd03229, ABC_Class3, ATP-binding cassette domain of the binding protein-dependent transport systems Back     alignment and domain information
>gnl|CDD|213186 cd03219, ABC_Mj1267_LivG_branched, ATP-binding cassette component of branched chain amino acids transport system Back     alignment and domain information
>gnl|CDD|224047 COG1122, CbiO, ABC-type cobalt transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|130256 TIGR01188, drrA, daunorubicin resistance ABC transporter ATP-binding subunit Back     alignment and domain information
>gnl|CDD|213233 cd03266, ABC_NatA_sodium_exporter, ATP-binding cassette domain of the Na+ transporter Back     alignment and domain information
>gnl|CDD|130234 TIGR01166, cbiO, cobalt transport protein ATP-binding subunit Back     alignment and domain information
>gnl|CDD|213235 cd03268, ABC_BcrA_bacitracin_resist, ATP-binding cassette domain of the bacitracin-resistance transporter Back     alignment and domain information
>gnl|CDD|213181 cd03214, ABC_Iron-Siderophores_B12_Hemin, ATP-binding component of iron-siderophores, vitamin B12 and hemin transporters and related proteins Back     alignment and domain information
>gnl|CDD|227321 COG4988, CydD, ABC-type transport system involved in cytochrome bd biosynthesis, ATPase and permease components [Energy production and conversion / Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|213259 cd03292, ABC_FtsE_transporter, ATP-binding cassette domain of the cell division transporter Back     alignment and domain information
>gnl|CDD|213227 cd03260, ABC_PstB_phosphate_transporter, ATP-binding cassette domain of the phosphate transport system Back     alignment and domain information
>gnl|CDD|213200 cd03233, ABCG_PDR_domain1, First domain of the pleiotropic drug resistance-like subfamily G of ATP-binding cassette transporters Back     alignment and domain information
>gnl|CDD|234041 TIGR02868, CydC, thiol reductant ABC exporter, CydC subunit Back     alignment and domain information
>gnl|CDD|223488 COG0411, LivG, ABC-type branched-chain amino acid transport systems, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|237421 PRK13539, PRK13539, cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>gnl|CDD|213232 cd03265, ABC_DrrA, Daunorubicin/doxorubicin resistance ATP-binding protein Back     alignment and domain information
>gnl|CDD|225183 COG2274, SunT, ABC-type bacteriocin/lantibiotic exporters, contain an N-terminal double-glycine peptidase domain [Defense mechanisms] Back     alignment and domain information
>gnl|CDD|213228 cd03261, ABC_Org_Solvent_Resistant, ATP-binding cassette transport system involved in resistant to organic solvents Back     alignment and domain information
>gnl|CDD|234033 TIGR02857, CydD, thiol reductant ABC exporter, CydD subunit Back     alignment and domain information
>gnl|CDD|213212 cd03245, ABCC_bacteriocin_exporters, ATP-binding cassette domain of bacteriocin exporters, subfamily C Back     alignment and domain information
>gnl|CDD|237420 PRK13537, PRK13537, nodulation ABC transporter NodI; Provisional Back     alignment and domain information
>gnl|CDD|213195 cd03228, ABCC_MRP_Like, ATP-binding cassette domain of multidrug resistance protein-like transporters Back     alignment and domain information
>gnl|CDD|226927 COG4555, NatA, ABC-type Na+ transport system, ATPase component [Energy production and conversion / Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|213223 cd03256, ABC_PhnC_transporter, ATP-binding cassette domain of the binding protein-dependent phosphonate transport system Back     alignment and domain information
>gnl|CDD|213179 cd00267, ABC_ATPase, ATP-binding cassette transporter nucleotide-binding domain Back     alignment and domain information
>gnl|CDD|213264 cd03297, ABC_ModC_molybdenum_transporter, ATP-binding cassette domain of the molybdenum transport system Back     alignment and domain information
>gnl|CDD|226361 COG3842, PotA, ABC-type spermidine/putrescine transport systems, ATPase components [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|163585 TIGR03873, F420-0_ABC_ATP, proposed F420-0 ABC transporter, ATP-binding protein Back     alignment and domain information
>gnl|CDD|224048 COG1123, COG1123, ATPase components of various ABC-type transport systems, contain duplicated ATPase [General function prediction only] Back     alignment and domain information
>gnl|CDD|188353 TIGR03608, L_ocin_972_ABC, putative bacteriocin export ABC transporter, lactococcin 972 group Back     alignment and domain information
>gnl|CDD|188394 TIGR03864, PQQ_ABC_ATP, ABC transporter, ATP-binding subunit, PQQ-dependent alcohol dehydrogenase system Back     alignment and domain information
>gnl|CDD|237419 PRK13536, PRK13536, nodulation factor exporter subunit NodI; Provisional Back     alignment and domain information
>gnl|CDD|224043 COG1118, CysA, ABC-type sulfate/molybdate transport systems, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|226617 COG4133, CcmA, ABC-type transport system involved in cytochrome c biogenesis, ATPase component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|131368 TIGR02315, ABC_phnC, phosphonate ABC transporter, ATP-binding protein Back     alignment and domain information
>gnl|CDD|226164 COG3638, COG3638, ABC-type phosphate/phosphonate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|213260 cd03293, ABC_NrtD_SsuB_transporters, ATP-binding cassette domain of the nitrate and sulfonate transporters Back     alignment and domain information
>gnl|CDD|223473 COG0396, sufC, Cysteine desulfurase activator ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|226359 COG3839, MalK, ABC-type sugar transport systems, ATPase components [Carbohydrate transport and metabolism] Back     alignment and domain information
>gnl|CDD|213224 cd03257, ABC_NikE_OppD_transporters, ATP-binding cassette domain of nickel/oligopeptides specific transporters Back     alignment and domain information
>gnl|CDD|213219 cd03252, ABCC_Hemolysin, ATP-binding cassette domain of hemolysin B, subfamily C Back     alignment and domain information
>gnl|CDD|224049 COG1124, DppF, ABC-type dipeptide/oligopeptide/nickel transport system, ATPase component [Amino acid transport and metabolism / Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|224052 COG1127, Ttg2A, ABC-type transport system involved in resistance to organic solvents, ATPase component [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>gnl|CDD|213213 cd03246, ABCC_Protease_Secretion, ATP-binding cassette domain of PrtD, subfamily C Back     alignment and domain information
>gnl|CDD|226929 COG4559, COG4559, ABC-type hemin transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|233305 TIGR01189, ccmA, heme ABC exporter, ATP-binding protein CcmA Back     alignment and domain information
>gnl|CDD|224041 COG1116, TauB, ABC-type nitrate/sulfonate/bicarbonate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|226963 COG4604, CeuD, ABC-type enterochelin transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|213221 cd03254, ABCC_Glucan_exporter_like, ATP-binding cassette domain of glucan transporter and related proteins, subfamily C Back     alignment and domain information
>gnl|CDD|130355 TIGR01288, nodI, ATP-binding ABC transporter family nodulation protein NodI Back     alignment and domain information
>gnl|CDD|213230 cd03263, ABC_subfamily_A, ATP-binding cassette domain of the lipid transporters, subfamily A Back     alignment and domain information
>gnl|CDD|213263 cd03296, ABC_CysA_sulfate_importer, ATP-binding cassette domain of the sulfate transporter Back     alignment and domain information
>gnl|CDD|130041 TIGR00968, 3a0106s01, sulfate ABC transporter, ATP-binding protein Back     alignment and domain information
>gnl|CDD|213266 cd03299, ABC_ModC_like, ATP-binding cassette domain similar to the molybdate transporter Back     alignment and domain information
>gnl|CDD|213180 cd03213, ABCG_EPDR, Eye pigment and drug resistance transporter subfamily G of the ATP-binding cassette superfamily Back     alignment and domain information
>gnl|CDD|224053 COG1129, MglA, ABC-type sugar transport system, ATPase component [Carbohydrate transport and metabolism] Back     alignment and domain information
>gnl|CDD|213191 cd03224, ABC_TM1139_LivF_branched, ATP-binding cassette domain of branched-chain amino acid transporter Back     alignment and domain information
>gnl|CDD|182817 PRK10895, PRK10895, lipopolysaccharide ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|213267 cd03300, ABC_PotA_N, ATP-binding cassette domain of the polyamine transporter Back     alignment and domain information
>gnl|CDD|183063 PRK11264, PRK11264, putative amino-acid ABC transporter ATP-binding protein YecC; Provisional Back     alignment and domain information
>gnl|CDD|213236 cd03269, ABC_putative_ATPase, ATP-binding cassette domain of an uncharacterized transporter Back     alignment and domain information
>gnl|CDD|130324 TIGR01257, rim_protein, retinal-specific rim ABC transporter Back     alignment and domain information
>gnl|CDD|185016 PRK15056, PRK15056, manganese/iron transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|183044 PRK11231, fecE, iron-dicitrate transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|227019 COG4674, COG4674, Uncharacterized ABC-type transport system, ATPase component [General function prediction only] Back     alignment and domain information
>gnl|CDD|132561 TIGR03522, GldA_ABC_ATP, gliding motility-associated ABC transporter ATP-binding subunit GldA Back     alignment and domain information
>gnl|CDD|182561 PRK10575, PRK10575, iron-hydroxamate transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|226905 COG4525, TauB, ABC-type taurine transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|131197 TIGR02142, modC_ABC, molybdenum ABC transporter, ATP-binding protein Back     alignment and domain information
>gnl|CDD|213185 cd03218, ABC_YhbG, ATP-binding cassette component of YhbG transport system Back     alignment and domain information
>gnl|CDD|234152 TIGR03265, PhnT2, putative 2-aminoethylphosphonate ABC transporter, ATP-binding protein Back     alignment and domain information
>gnl|CDD|213218 cd03251, ABCC_MsbA, ATP-binding cassette domain of the bacterial lipid flippase and related proteins, subfamily C Back     alignment and domain information
>gnl|CDD|224055 COG1132, MdlB, ABC-type multidrug transport system, ATPase and permease components [Defense mechanisms] Back     alignment and domain information
>gnl|CDD|215650 pfam00005, ABC_tran, ABC transporter Back     alignment and domain information
>gnl|CDD|213199 cd03232, ABCG_PDR_domain2, Second domain of the pleiotropic drug resistance-like (PDR) subfamily G of ATP-binding cassette transporters Back     alignment and domain information
>gnl|CDD|225438 COG2884, FtsE, Predicted ATPase involved in cell division [Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|213216 cd03249, ABC_MTABC3_MDL1_MDL2, ATP-binding cassette domain of a mitochondrial protein MTABC3 and related proteins Back     alignment and domain information
>gnl|CDD|234200 TIGR03411, urea_trans_UrtD, urea ABC transporter, ATP-binding protein UrtD Back     alignment and domain information
>gnl|CDD|223521 COG0444, DppD, ABC-type dipeptide/oligopeptide/nickel transport system, ATPase component [Amino acid transport and metabolism / Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|213198 cd03231, ABC_CcmA_heme_exporter, Cytochrome c biogenesis ATP-binding export protein Back     alignment and domain information
>gnl|CDD|163452 TIGR03740, galliderm_ABC, gallidermin-class lantibiotic protection ABC transporter, ATP-binding subunit Back     alignment and domain information
>gnl|CDD|226628 COG4148, ModC, ABC-type molybdate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|132027 TIGR02982, heterocyst_DevA, ABC exporter ATP-binding subunit, DevA family Back     alignment and domain information
>gnl|CDD|183056 PRK11248, tauB, taurine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|227320 COG4987, CydC, ABC-type transport system involved in cytochrome bd biosynthesis, fused ATPase and permease components [Energy production and conversion / Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|224050 COG1125, OpuBA, ABC-type proline/glycine betaine transport systems, ATPase components [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|131721 TIGR02673, FtsE, cell division ATP-binding protein FtsE Back     alignment and domain information
>gnl|CDD|182569 PRK10584, PRK10584, putative ABC transporter ATP-binding protein YbbA; Provisional Back     alignment and domain information
>gnl|CDD|132302 TIGR03258, PhnT, 2-aminoethylphosphonate ABC transport system, ATP-binding component PhnT Back     alignment and domain information
>gnl|CDD|237422 PRK13548, hmuV, hemin importer ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|184199 PRK13639, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|200134 TIGR01842, type_I_sec_PrtD, type I secretion system ABC transporter, PrtD family Back     alignment and domain information
>gnl|CDD|224042 COG1117, PstB, ABC-type phosphate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|184585 PRK14239, PRK14239, phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|233596 TIGR01846, type_I_sec_HlyB, type I secretion system ABC transporter, HlyB family Back     alignment and domain information
>gnl|CDD|131266 TIGR02211, LolD_lipo_ex, lipoprotein releasing system, ATP-binding protein Back     alignment and domain information
>gnl|CDD|213234 cd03267, ABC_NatA_like, ATP-binding cassette domain of an uncharacterized transporter similar in sequence to NatA Back     alignment and domain information
>gnl|CDD|226631 COG4152, COG4152, ABC-type uncharacterized transport system, ATPase component [General function prediction only] Back     alignment and domain information
>gnl|CDD|223562 COG0488, Uup, ATPase components of ABC transporters with duplicated ATPase domains [General function prediction only] Back     alignment and domain information
>gnl|CDD|213220 cd03253, ABCC_ATM1_transporter, ATP-binding cassette domain of iron-sulfur clusters transporter, subfamily C Back     alignment and domain information
>gnl|CDD|188208 TIGR02323, CP_lyasePhnK, phosphonate C-P lyase system protein PhnK Back     alignment and domain information
>gnl|CDD|183244 PRK11629, lolD, lipoprotein transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|226647 COG4181, COG4181, Predicted ABC-type transport system involved in lysophospholipase L1 biosynthesis, ATPase component [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>gnl|CDD|224044 COG1119, ModF, ABC-type molybdenum transport system, ATPase component/photorepair protein PhrA [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|182182 PRK09984, PRK09984, phosphonate/organophosphate ester transporter subunit; Provisional Back     alignment and domain information
>gnl|CDD|183077 PRK11288, araG, L-arabinose transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|226592 COG4107, PhnK, ABC-type phosphonate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|213262 cd03295, ABC_OpuCA_Osmoprotection, ATP-binding cassette domain of the osmoprotectant transporter Back     alignment and domain information
>gnl|CDD|213268 cd03301, ABC_MalK_N, The N-terminal ATPase domain of the maltose transporter, MalK Back     alignment and domain information
>gnl|CDD|223562 COG0488, Uup, ATPase components of ABC transporters with duplicated ATPase domains [General function prediction only] Back     alignment and domain information
>gnl|CDD|233665 TIGR01978, sufC, FeS assembly ATPase SufC Back     alignment and domain information
>gnl|CDD|223487 COG0410, LivF, ABC-type branched-chain amino acid transport systems, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|188099 TIGR00972, 3a0107s01c2, phosphate ABC transporter, ATP-binding protein Back     alignment and domain information
>gnl|CDD|184196 PRK13636, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|224045 COG1120, FepC, ABC-type cobalamin/Fe3+-siderophores transport systems, ATPase components [Inorganic ion transport and metabolism / Coenzyme metabolism] Back     alignment and domain information
>gnl|CDD|224058 COG1135, AbcC, ABC-type metal ion transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|172735 PRK14247, PRK14247, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|172760 PRK14272, PRK14272, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|184203 PRK13643, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|184198 PRK13638, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|234357 TIGR03797, NHLM_micro_ABC2, NHLM bacteriocin system ABC transporter, ATP-binding protein Back     alignment and domain information
>gnl|CDD|184195 PRK13635, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|237457 PRK13647, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|224026 COG1101, PhnK, ABC-type uncharacterized transport system, ATPase component [General function prediction only] Back     alignment and domain information
>gnl|CDD|234199 TIGR03410, urea_trans_UrtE, urea ABC transporter, ATP-binding protein UrtE Back     alignment and domain information
>gnl|CDD|226364 COG3845, COG3845, ABC-type uncharacterized transport systems, ATPase components [General function prediction only] Back     alignment and domain information
>gnl|CDD|213215 cd03248, ABCC_TAP, ATP-binding cassette domain of the Transporter Associated with Antigen Processing, subfamily C Back     alignment and domain information
>gnl|CDD|226620 COG4136, COG4136, ABC-type uncharacterized transport system, ATPase component [General function prediction only] Back     alignment and domain information
>gnl|CDD|226969 COG4618, ArpD, ABC-type protease/lipase transport system, ATPase and permease components [General function prediction only] Back     alignment and domain information
>gnl|CDD|184214 PRK13657, PRK13657, cyclic beta-1,2-glucan ABC transporter; Provisional Back     alignment and domain information
>gnl|CDD|236554 PRK09536, btuD, corrinoid ABC transporter ATPase; Reviewed Back     alignment and domain information
>gnl|CDD|184205 PRK13646, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|226952 COG4586, COG4586, ABC-type uncharacterized transport system, ATPase component [General function prediction only] Back     alignment and domain information
>gnl|CDD|224060 COG1137, YhbG, ABC-type (unclassified) transport system, ATPase component [General function prediction only] Back     alignment and domain information
>gnl|CDD|234189 TIGR03375, type_I_sec_LssB, type I secretion system ATPase, LssB family Back     alignment and domain information
>gnl|CDD|213229 cd03262, ABC_HisP_GlnQ, ATP-binding cassette domain of the histidine and glutamine transporters Back     alignment and domain information
>gnl|CDD|224051 COG1126, GlnQ, ABC-type polar amino acid transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|163508 TIGR03796, NHLM_micro_ABC1, NHLM bacteriocin system ABC transporter, peptidase/ATP-binding protein Back     alignment and domain information
>gnl|CDD|172749 PRK14261, PRK14261, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|226643 COG4175, ProV, ABC-type proline/glycine betaine transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|162242 TIGR01187, potA, spermidine/putrescine ABC transporter ATP-binding subunit Back     alignment and domain information
>gnl|CDD|213225 cd03258, ABC_MetN_methionine_transporter, ATP-binding cassette domain of methionine transporter Back     alignment and domain information
>gnl|CDD|236865 PRK11160, PRK11160, cysteine/glutathione ABC transporter membrane/ATP-binding component; Reviewed Back     alignment and domain information
>gnl|CDD|213179 cd00267, ABC_ATPase, ATP-binding cassette transporter nucleotide-binding domain Back     alignment and domain information
>gnl|CDD|172200 PRK13652, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|163483 TIGR03771, anch_rpt_ABC, anchored repeat-type ABC transporter, ATP-binding subunit Back     alignment and domain information
>gnl|CDD|223912 COG0842, COG0842, ABC-type multidrug transport system, permease component [Defense mechanisms] Back     alignment and domain information
>gnl|CDD|224048 COG1123, COG1123, ATPase components of various ABC-type transport systems, contain duplicated ATPase [General function prediction only] Back     alignment and domain information
>gnl|CDD|237456 PRK13641, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|213264 cd03297, ABC_ModC_molybdenum_transporter, ATP-binding cassette domain of the molybdenum transport system Back     alignment and domain information
>gnl|CDD|130324 TIGR01257, rim_protein, retinal-specific rim ABC transporter Back     alignment and domain information
>gnl|CDD|130254 TIGR01186, proV, glycine betaine/L-proline transport ATP binding subunit Back     alignment and domain information
>gnl|CDD|130252 TIGR01184, ntrCD, nitrate transport ATP-binding subunits C and D Back     alignment and domain information
>gnl|CDD|213203 cd03236, ABC_RNaseL_inhibitor_domain1, The ATP-binding cassette domain 1 of RNase L inhibitor Back     alignment and domain information
>gnl|CDD|184127 PRK13540, PRK13540, cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>gnl|CDD|213184 cd03217, ABC_FeS_Assembly, ABC-type transport system involved in Fe-S cluster assembly, ATPase component Back     alignment and domain information
>gnl|CDD|172743 PRK14255, PRK14255, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|172741 PRK14253, PRK14253, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|213217 cd03250, ABCC_MRP_domain1, ATP-binding cassette domain 1 of multidrug resistance-associated protein, subfamily C Back     alignment and domain information
>gnl|CDD|184587 PRK14241, PRK14241, phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|224166 COG1245, COG1245, Predicted ATPase, RNase L inhibitor (RLI) homolog [General function prediction only] Back     alignment and domain information
>gnl|CDD|237917 PRK15134, PRK15134, microcin C ABC transporter ATP-binding protein YejF; Provisional Back     alignment and domain information
>gnl|CDD|184134 PRK13549, PRK13549, xylose transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|236689 PRK10419, nikE, nickel transporter ATP-binding protein NikE; Provisional Back     alignment and domain information
>gnl|CDD|182592 PRK10619, PRK10619, histidine/lysine/arginine/ornithine transporter subunit; Provisional Back     alignment and domain information
>gnl|CDD|213261 cd03294, ABC_Pro_Gly_Betaine, ATP-binding cassette domain of the osmoprotectant proline/glycine betaine uptake system Back     alignment and domain information
>gnl|CDD|226641 COG4172, COG4172, ABC-type uncharacterized transport system, duplicated ATPase component [General function prediction only] Back     alignment and domain information
>gnl|CDD|131258 TIGR02203, MsbA_lipidA, lipid A export permease/ATP-binding protein MsbA Back     alignment and domain information
>gnl|CDD|172733 PRK14245, PRK14245, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|131816 TIGR02769, nickel_nikE, nickel import ATP-binding protein NikE Back     alignment and domain information
>gnl|CDD|131817 TIGR02770, nickel_nikD, nickel import ATP-binding protein NikD Back     alignment and domain information
>gnl|CDD|130344 TIGR01277, thiQ, thiamine ABC transporter, ATP-binding protein Back     alignment and domain information
>gnl|CDD|172759 PRK14271, PRK14271, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|226360 COG3840, ThiQ, ABC-type thiamine transport system, ATPase component [Coenzyme metabolism] Back     alignment and domain information
>gnl|CDD|237645 PRK14235, PRK14235, phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|221721 pfam12698, ABC2_membrane_3, ABC-2 family transporter protein Back     alignment and domain information
>gnl|CDD|237451 PRK13631, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|226927 COG4555, NatA, ABC-type Na+ transport system, ATPase component [Energy production and conversion / Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|213218 cd03251, ABCC_MsbA, ATP-binding cassette domain of the bacterial lipid flippase and related proteins, subfamily C Back     alignment and domain information
>gnl|CDD|172757 PRK14269, PRK14269, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|213255 cd03288, ABCC_SUR2, ATP-binding cassette domain 2 of the sulfonylurea receptor SUR Back     alignment and domain information
>gnl|CDD|227590 COG5265, ATM1, ABC-type transport system involved in Fe-S cluster assembly, permease and ATPase components [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|214372 CHL00131, ycf16, sulfate ABC transporter protein; Validated Back     alignment and domain information
>gnl|CDD|226970 COG4619, COG4619, ABC-type uncharacterized transport system, ATPase component [General function prediction only] Back     alignment and domain information
>gnl|CDD|172734 PRK14246, PRK14246, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|172744 PRK14256, PRK14256, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|213211 cd03244, ABCC_MRP_domain2, ATP-binding cassette domain 2 of multidrug resistance-associated protein Back     alignment and domain information
>gnl|CDD|182893 PRK11000, PRK11000, maltose/maltodextrin transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|226635 COG4161, ArtP, ABC-type arginine transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|213220 cd03253, ABCC_ATM1_transporter, ATP-binding cassette domain of iron-sulfur clusters transporter, subfamily C Back     alignment and domain information
>gnl|CDD|213183 cd03216, ABC_Carb_Monos_I, First domain of the ATP-binding cassette component of monosaccharide transport system Back     alignment and domain information
>gnl|CDD|184132 PRK13547, hmuV, hemin importer ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|213265 cd03298, ABC_ThiQ_thiamine_transporter, ATP-binding cassette domain of the thiamine transport system Back     alignment and domain information
>gnl|CDD|237454 PRK13634, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|131259 TIGR02204, MsbA_rel, ABC transporter, permease/ATP-binding protein Back     alignment and domain information
>gnl|CDD|226646 COG4178, COG4178, ABC-type uncharacterized transport system, permease and ATPase components [General function prediction only] Back     alignment and domain information
>gnl|CDD|181965 PRK09580, sufC, cysteine desulfurase ATPase component; Reviewed Back     alignment and domain information
>gnl|CDD|184208 PRK13649, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|184597 PRK14270, PRK14270, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|182036 PRK09700, PRK09700, D-allose transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|213179 cd00267, ABC_ATPase, ATP-binding cassette transporter nucleotide-binding domain Back     alignment and domain information
>gnl|CDD|183280 PRK11701, phnK, phosphonate C-P lyase system protein PhnK; Provisional Back     alignment and domain information
>gnl|CDD|184207 PRK13648, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|236755 PRK10762, PRK10762, D-ribose transporter ATP binding protein; Provisional Back     alignment and domain information
>gnl|CDD|172745 PRK14257, PRK14257, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|184596 PRK14267, PRK14267, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|183016 PRK11176, PRK11176, lipid transporter ATP-binding/permease protein; Provisional Back     alignment and domain information
>gnl|CDD|184125 PRK13538, PRK13538, cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>gnl|CDD|226961 COG4598, HisP, ABC-type histidine transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|131377 TIGR02324, CP_lyasePhnL, phosphonate C-P lyase system protein PhnL Back     alignment and domain information
>gnl|CDD|172761 PRK14273, PRK14273, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|184586 PRK14240, PRK14240, phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|172739 PRK14251, PRK14251, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|233209 TIGR00958, 3a01208, Conjugate Transporter-2 (CT2) Family protein Back     alignment and domain information
>gnl|CDD|172730 PRK14242, PRK14242, phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|172750 PRK14262, PRK14262, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|131681 TIGR02633, xylG, D-xylose ABC transporter, ATP-binding protein Back     alignment and domain information
>gnl|CDD|213269 cd03369, ABCC_NFT1, ATP-binding cassette domain 2 of NFT1, subfamily C Back     alignment and domain information
>gnl|CDD|213257 cd03290, ABCC_SUR1_N, ATP-binding cassette domain of the sulfonylurea receptor, subfamily C Back     alignment and domain information
>gnl|CDD|226637 COG4167, SapF, ABC-type antimicrobial peptide transport system, ATPase component [Defense mechanisms] Back     alignment and domain information
>gnl|CDD|236523 PRK09452, potA, putrescine/spermidine ABC transporter ATPase protein; Reviewed Back     alignment and domain information
>gnl|CDD|213192 cd03225, ABC_cobalt_CbiO_domain1, First domain of the ATP-binding cassette component of cobalt transport system Back     alignment and domain information
>gnl|CDD|130260 TIGR01192, chvA, glucan exporter ATP-binding protein Back     alignment and domain information
>gnl|CDD|182993 PRK11144, modC, molybdate transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|183080 PRK11300, livG, leucine/isoleucine/valine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|183133 PRK11432, fbpC, ferric transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|213212 cd03245, ABCC_bacteriocin_exporters, ATP-binding cassette domain of bacteriocin exporters, subfamily C Back     alignment and domain information
>gnl|CDD|213222 cd03255, ABC_MJ0796_LolCDE_FtsE, ATP-binding cassette domain of the transporters involved in export of lipoprotein and macrolide, and cell division protein Back     alignment and domain information
>gnl|CDD|226952 COG4586, COG4586, ABC-type uncharacterized transport system, ATPase component [General function prediction only] Back     alignment and domain information
>gnl|CDD|234189 TIGR03375, type_I_sec_LssB, type I secretion system ATPase, LssB family Back     alignment and domain information
>gnl|CDD|131258 TIGR02203, MsbA_lipidA, lipid A export permease/ATP-binding protein MsbA Back     alignment and domain information
>gnl|CDD|182036 PRK09700, PRK09700, D-allose transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|213205 cd03238, ABC_UvrA, ATP-binding cassette domain of the excision repair protein UvrA Back     alignment and domain information
>gnl|CDD|182880 PRK10982, PRK10982, galactose/methyl galaxtoside transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|236870 PRK11174, PRK11174, cysteine/glutathione ABC transporter membrane/ATP-binding component; Reviewed Back     alignment and domain information
>gnl|CDD|237648 PRK14250, PRK14250, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|215634 PLN03211, PLN03211, ABC transporter G-25; Provisional Back     alignment and domain information
>gnl|CDD|213216 cd03249, ABC_MTABC3_MDL1_MDL2, ATP-binding cassette domain of a mitochondrial protein MTABC3 and related proteins Back     alignment and domain information
>gnl|CDD|224058 COG1135, AbcC, ABC-type metal ion transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|183231 PRK11614, livF, leucine/isoleucine/valine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|226967 COG4608, AppF, ABC-type oligopeptide transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|213199 cd03232, ABCG_PDR_domain2, Second domain of the pleiotropic drug resistance-like (PDR) subfamily G of ATP-binding cassette transporters Back     alignment and domain information
>gnl|CDD|213266 cd03299, ABC_ModC_like, ATP-binding cassette domain similar to the molybdate transporter Back     alignment and domain information
>gnl|CDD|226622 COG4138, BtuD, ABC-type cobalamin transport system, ATPase component [Coenzyme metabolism] Back     alignment and domain information
>gnl|CDD|237455 PRK13637, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|131367 TIGR02314, ABC_MetN, D-methionine ABC transporter, ATP-binding protein Back     alignment and domain information
>gnl|CDD|184582 PRK14236, PRK14236, phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|235150 PRK03695, PRK03695, vitamin B12-transporter ATPase; Provisional Back     alignment and domain information
>gnl|CDD|240327 PTZ00243, PTZ00243, ABC transporter; Provisional Back     alignment and domain information
>gnl|CDD|132561 TIGR03522, GldA_ABC_ATP, gliding motility-associated ABC transporter ATP-binding subunit GldA Back     alignment and domain information
>gnl|CDD|213183 cd03216, ABC_Carb_Monos_I, First domain of the ATP-binding cassette component of monosaccharide transport system Back     alignment and domain information
>gnl|CDD|237452 PRK13632, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|184129 PRK13543, PRK13543, cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>gnl|CDD|237651 PRK14266, PRK14266, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|132313 TIGR03269, met_CoM_red_A2, methyl coenzyme M reductase system, component A2 Back     alignment and domain information
>gnl|CDD|182528 PRK10535, PRK10535, macrolide transporter ATP-binding /permease protein; Provisional Back     alignment and domain information
>gnl|CDD|213214 cd03247, ABCC_cytochrome_bd, ATP-binding cassette domain of CydCD, subfamily C Back     alignment and domain information
>gnl|CDD|182778 PRK10851, PRK10851, sulfate/thiosulfate transporter subunit; Provisional Back     alignment and domain information
>gnl|CDD|163431 TIGR03719, ABC_ABC_ChvD, ATP-binding cassette protein, ChvD family Back     alignment and domain information
>gnl|CDD|224053 COG1129, MglA, ABC-type sugar transport system, ATPase component [Carbohydrate transport and metabolism] Back     alignment and domain information
>gnl|CDD|226364 COG3845, COG3845, ABC-type uncharacterized transport systems, ATPase components [General function prediction only] Back     alignment and domain information
>gnl|CDD|226641 COG4172, COG4172, ABC-type uncharacterized transport system, duplicated ATPase component [General function prediction only] Back     alignment and domain information
>gnl|CDD|172762 PRK14274, PRK14274, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|184200 PRK13640, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|130256 TIGR01188, drrA, daunorubicin resistance ABC transporter ATP-binding subunit Back     alignment and domain information
>gnl|CDD|227321 COG4988, CydD, ABC-type transport system involved in cytochrome bd biosynthesis, ATPase and permease components [Energy production and conversion / Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|213232 cd03265, ABC_DrrA, Daunorubicin/doxorubicin resistance ATP-binding protein Back     alignment and domain information
>gnl|CDD|225183 COG2274, SunT, ABC-type bacteriocin/lantibiotic exporters, contain an N-terminal double-glycine peptidase domain [Defense mechanisms] Back     alignment and domain information
>gnl|CDD|213190 cd03223, ABCD_peroxisomal_ALDP, ATP-binding cassette domain of peroxisomal transporter, subfamily D Back     alignment and domain information
>gnl|CDD|185336 PRK15439, PRK15439, autoinducer 2 ABC transporter ATP-binding protein LsrA; Provisional Back     alignment and domain information
>gnl|CDD|172747 PRK14259, PRK14259, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|236947 PRK11650, ugpC, glycerol-3-phosphate transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|172740 PRK14252, PRK14252, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|213231 cd03264, ABC_drug_resistance_like, ABC-type multidrug transport system, ATPase component Back     alignment and domain information
>gnl|CDD|213223 cd03256, ABC_PhnC_transporter, ATP-binding cassette domain of the binding protein-dependent phosphonate transport system Back     alignment and domain information
>gnl|CDD|131681 TIGR02633, xylG, D-xylose ABC transporter, ATP-binding protein Back     alignment and domain information
>gnl|CDD|184210 PRK13651, PRK13651, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|184584 PRK14238, PRK14238, phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|181906 PRK09493, glnQ, glutamine ABC transporter ATP-binding protein; Reviewed Back     alignment and domain information
>gnl|CDD|184593 PRK14258, PRK14258, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|237652 PRK14275, PRK14275, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|215640 PLN03232, PLN03232, ABC transporter C family member; Provisional Back     alignment and domain information
>gnl|CDD|237646 PRK14237, PRK14237, phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|184594 PRK14264, PRK14264, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|182733 PRK10790, PRK10790, putative multidrug transporter membrane\ATP-binding components; Provisional Back     alignment and domain information
>gnl|CDD|213181 cd03214, ABC_Iron-Siderophores_B12_Hemin, ATP-binding component of iron-siderophores, vitamin B12 and hemin transporters and related proteins Back     alignment and domain information
>gnl|CDD|226164 COG3638, COG3638, ABC-type phosphate/phosphonate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|213219 cd03252, ABCC_Hemolysin, ATP-binding cassette domain of hemolysin B, subfamily C Back     alignment and domain information
>gnl|CDD|132050 TIGR03005, ectoine_ehuA, ectoine/hydroxyectoine ABC transporter, ATP-binding protein Back     alignment and domain information
>gnl|CDD|188098 TIGR00957, MRP_assoc_pro, multi drug resistance-associated protein (MRP) Back     alignment and domain information
>gnl|CDD|237649 PRK14254, PRK14254, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|188317 TIGR03415, ABC_choXWV_ATP, choline ABC transporter, ATP-binding protein Back     alignment and domain information
>gnl|CDD|182336 PRK10253, PRK10253, iron-enterobactin transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|224059 COG1136, SalX, ABC-type antimicrobial peptide transport system, ATPase component [Defense mechanisms] Back     alignment and domain information
>gnl|CDD|224044 COG1119, ModF, ABC-type molybdenum transport system, ATPase component/photorepair protein PhrA [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|237647 PRK14248, PRK14248, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|182829 PRK10908, PRK10908, cell division protein FtsE; Provisional Back     alignment and domain information
>gnl|CDD|224057 COG1134, TagH, ABC-type polysaccharide/polyol phosphate transport system, ATPase component [Carbohydrate transport and metabolism / Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>gnl|CDD|183226 PRK11607, potG, putrescine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|185336 PRK15439, PRK15439, autoinducer 2 ABC transporter ATP-binding protein LsrA; Provisional Back     alignment and domain information
>gnl|CDD|172748 PRK14260, PRK14260, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|240339 PTZ00265, PTZ00265, multidrug resistance protein (mdr1); Provisional Back     alignment and domain information
>gnl|CDD|226359 COG3839, MalK, ABC-type sugar transport systems, ATPase components [Carbohydrate transport and metabolism] Back     alignment and domain information
>gnl|CDD|130041 TIGR00968, 3a0106s01, sulfate ABC transporter, ATP-binding protein Back     alignment and domain information
>gnl|CDD|184037 PRK13409, PRK13409, putative ATPase RIL; Provisional Back     alignment and domain information
>gnl|CDD|214640 smart00382, AAA, ATPases associated with a variety of cellular activities Back     alignment and domain information
>gnl|CDD|130261 TIGR01193, bacteriocin_ABC, ABC-type bacteriocin transporter Back     alignment and domain information
>gnl|CDD|132313 TIGR03269, met_CoM_red_A2, methyl coenzyme M reductase system, component A2 Back     alignment and domain information
>gnl|CDD|213202 cd03235, ABC_Metallic_Cations, ATP-binding cassette domain of the metal-type transporters Back     alignment and domain information
>gnl|CDD|224046 COG1121, ZnuC, ABC-type Mn/Zn transport systems, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|213233 cd03266, ABC_NatA_sodium_exporter, ATP-binding cassette domain of the Na+ transporter Back     alignment and domain information
>gnl|CDD|223488 COG0411, LivG, ABC-type branched-chain amino acid transport systems, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|224052 COG1127, Ttg2A, ABC-type transport system involved in resistance to organic solvents, ATPase component [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>gnl|CDD|223521 COG0444, DppD, ABC-type dipeptide/oligopeptide/nickel transport system, ATPase component [Amino acid transport and metabolism / Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|234357 TIGR03797, NHLM_micro_ABC2, NHLM bacteriocin system ABC transporter, ATP-binding protein Back     alignment and domain information
>gnl|CDD|224166 COG1245, COG1245, Predicted ATPase, RNase L inhibitor (RLI) homolog [General function prediction only] Back     alignment and domain information
>gnl|CDD|130261 TIGR01193, bacteriocin_ABC, ABC-type bacteriocin transporter Back     alignment and domain information
>gnl|CDD|172732 PRK14244, PRK14244, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|184202 PRK13642, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|213256 cd03289, ABCC_CFTR2, ATP-binding cassette domain 2 of CFTR,subfamily C Back     alignment and domain information
>gnl|CDD|234041 TIGR02868, CydC, thiol reductant ABC exporter, CydC subunit Back     alignment and domain information
>gnl|CDD|224048 COG1123, COG1123, ATPase components of various ABC-type transport systems, contain duplicated ATPase [General function prediction only] Back     alignment and domain information
>gnl|CDD|233596 TIGR01846, type_I_sec_HlyB, type I secretion system ABC transporter, HlyB family Back     alignment and domain information
>gnl|CDD|213225 cd03258, ABC_MetN_methionine_transporter, ATP-binding cassette domain of methionine transporter Back     alignment and domain information
>gnl|CDD|182331 PRK10247, PRK10247, putative ABC transporter ATP-binding protein YbbL; Provisional Back     alignment and domain information
>gnl|CDD|185067 PRK15112, PRK15112, antimicrobial peptide ABC system ATP-binding protein SapF; Provisional Back     alignment and domain information
>gnl|CDD|184588 PRK14243, PRK14243, phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|184590 PRK14249, PRK14249, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|236688 PRK10418, nikD, nickel transporter ATP-binding protein NikD; Provisional Back     alignment and domain information
>gnl|CDD|213187 cd03220, ABC_KpsT_Wzt, ATP-binding cassette component of polysaccharide transport system Back     alignment and domain information
>gnl|CDD|213196 cd03229, ABC_Class3, ATP-binding cassette domain of the binding protein-dependent transport systems Back     alignment and domain information
>gnl|CDD|224047 COG1122, CbiO, ABC-type cobalt transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|234033 TIGR02857, CydD, thiol reductant ABC exporter, CydD subunit Back     alignment and domain information
>gnl|CDD|240339 PTZ00265, PTZ00265, multidrug resistance protein (mdr1); Provisional Back     alignment and domain information
>gnl|CDD|213182 cd03215, ABC_Carb_Monos_II, Second domain of the ATP-binding cassette component of monosaccharide transport system Back     alignment and domain information
>gnl|CDD|172756 PRK14268, PRK14268, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|182980 PRK11124, artP, arginine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|213204 cd03237, ABC_RNaseL_inhibitor_domain2, The ATP-binding cassette domain 2 of RNase L inhibitor Back     alignment and domain information
>gnl|CDD|188394 TIGR03864, PQQ_ABC_ATP, ABC transporter, ATP-binding subunit, PQQ-dependent alcohol dehydrogenase system Back     alignment and domain information
>gnl|CDD|222036 pfam13304, AAA_21, AAA domain Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 1230
KOG00651391 consensus Pleiotropic drug resistance proteins (PD 100.0
PLN031401470 ABC transporter G family member; Provisional 100.0
TIGR009561394 3a01205 Pleiotropic Drug Resistance (PDR) Family p 100.0
KOG0061613 consensus Transporter, ABC superfamily (Breast can 100.0
PLN03211659 ABC transporter G-25; Provisional 100.0
TIGR00955617 3a01204 The Eye Pigment Precursor Transporter (EPP 100.0
TIGR00956 1394 3a01205 Pleiotropic Drug Resistance (PDR) Family p 100.0
PLN03140 1470 ABC transporter G family member; Provisional 100.0
KOG0065 1391 consensus Pleiotropic drug resistance proteins (PD 100.0
KOG0061613 consensus Transporter, ABC superfamily (Breast can 100.0
TIGR00955617 3a01204 The Eye Pigment Precursor Transporter (EPP 100.0
PLN03211659 ABC transporter G-25; Provisional 100.0
KOG00551228 consensus Multidrug/pheromone exporter, ABC superf 100.0
TIGR012572272 rim_protein retinal-specific rim ABC transporter. 100.0
KOG00541381 consensus Multidrug resistance-associated protein/ 100.0
PLN031301622 ABC transporter C family member; Provisional 100.0
PLN032321495 ABC transporter C family member; Provisional 100.0
PTZ002651466 multidrug resistance protein (mdr1); Provisional 100.0
TIGR009571522 MRP_assoc_pro multi drug resistance-associated pro 100.0
COG1123539 ATPase components of various ABC-type transport sy 100.0
PTZ002431560 ABC transporter; Provisional 100.0
TIGR012711490 CFTR_protein cystic fibrosis transmembrane conduct 100.0
PRK13549506 xylose transporter ATP-binding subunit; Provisiona 100.0
PRK09700510 D-allose transporter ATP-binding protein; Provisio 100.0
PRK10261623 glutathione transporter ATP-binding protein; Provi 100.0
PRK10762501 D-ribose transporter ATP binding protein; Provisio 100.0
TIGR03269520 met_CoM_red_A2 methyl coenzyme M reductase system, 100.0
PRK15134529 microcin C ABC transporter ATP-binding protein Yej 100.0
TIGR02633500 xylG D-xylose ABC transporter, ATP-binding protein 100.0
PRK15439510 autoinducer 2 ABC transporter ATP-binding protein 100.0
PRK11288501 araG L-arabinose transporter ATP-binding protein; 100.0
PRK10982491 galactose/methyl galaxtoside transporter ATP-bindi 100.0
PRK10938490 putative molybdenum transport ATP-binding protein 100.0
COG4172534 ABC-type uncharacterized transport system, duplica 100.0
PRK11819556 putative ABC transporter ATP-binding protein; Revi 100.0
PRK15064530 ABC transporter ATP-binding protein; Provisional 100.0
TIGR03719552 ABC_ABC_ChvD ATP-binding cassette protein, ChvD fa 100.0
PRK13409590 putative ATPase RIL; Provisional 100.0
COG1126240 GlnQ ABC-type polar amino acid transport system, A 100.0
PRK11147635 ABC transporter ATPase component; Reviewed 100.0
PRK10636638 putative ABC transporter ATP-binding protein; Prov 100.0
COG1116248 TauB ABC-type nitrate/sulfonate/bicarbonate transp 100.0
COG1136226 SalX ABC-type antimicrobial peptide transport syst 100.0
COG1121254 ZnuC ABC-type Mn/Zn transport systems, ATPase comp 100.0
COG1135339 AbcC ABC-type metal ion transport system, ATPase c 100.0
COG2884223 FtsE Predicted ATPase involved in cell division [C 100.0
COG1127263 Ttg2A ABC-type transport system involved in resist 100.0
COG1125309 OpuBA ABC-type proline/glycine betaine transport s 100.0
COG1131293 CcmA ABC-type multidrug transport system, ATPase c 100.0
COG1129500 MglA ABC-type sugar transport system, ATPase compo 100.0
COG1117253 PstB ABC-type phosphate transport system, ATPase c 100.0
COG3839338 MalK ABC-type sugar transport systems, ATPase comp 100.0
COG3842352 PotA ABC-type spermidine/putrescine transport syst 100.0
COG1120258 FepC ABC-type cobalamin/Fe3+-siderophores transpor 100.0
COG1118345 CysA ABC-type sulfate/molybdate transport systems, 100.0
TIGR01257 2272 rim_protein retinal-specific rim ABC transporter. 100.0
COG3638258 ABC-type phosphate/phosphonate transport system, A 100.0
PLN03073718 ABC transporter F family; Provisional 100.0
COG4555245 NatA ABC-type Na+ transport system, ATPase compone 100.0
PRK13537306 nodulation ABC transporter NodI; Provisional 100.0
COG0488530 Uup ATPase components of ABC transporters with dup 100.0
PRK11650356 ugpC glycerol-3-phosphate transporter ATP-binding 100.0
TIGR00960216 3a0501s02 Type II (General) Secretory Pathway (IIS 100.0
TIGR02314343 ABC_MetN D-methionine ABC transporter, ATP-binding 100.0
PRK11432351 fbpC ferric transporter ATP-binding subunit; Provi 100.0
TIGR03265353 PhnT2 putative 2-aminoethylphosphonate ABC transpo 100.0
TIGR03258362 PhnT 2-aminoethylphosphonate ABC transport system, 100.0
cd03261235 ABC_Org_Solvent_Resistant ABC (ATP-binding cassett 100.0
COG3840231 ThiQ ABC-type thiamine transport system, ATPase co 100.0
COG1137243 YhbG ABC-type (unclassified) transport system, ATP 100.0
cd03259213 ABC_Carb_Solutes_like ABC Carbohydrate and Solute 100.0
cd03255218 ABC_MJ0796_Lo1CDE_FtsE This family is comprised of 100.0
PRK09452375 potA putrescine/spermidine ABC transporter ATPase 100.0
PRK13536340 nodulation factor exporter subunit NodI; Provision 100.0
cd03293220 ABC_NrtD_SsuB_transporters NrtD and SsuB are the A 100.0
PRK10851353 sulfate/thiosulfate transporter subunit; Provision 100.0
cd03269210 ABC_putative_ATPase This subfamily is involved in 100.0
COG1124252 DppF ABC-type dipeptide/oligopeptide/nickel transp 100.0
PRK11607377 potG putrescine transporter ATP-binding subunit; P 100.0
TIGR02673214 FtsE cell division ATP-binding protein FtsE. This 100.0
cd03234226 ABCG_White The White subfamily represents ABC tran 100.0
cd03265220 ABC_DrrA DrrA is the ATP-binding protein component 100.0
cd03292214 ABC_FtsE_transporter FtsE is a hydrophilic nucleot 100.0
TIGR01188302 drrA daunorubicin resistance ABC transporter ATP-b 100.0
cd03301213 ABC_MalK_N The N-terminal ATPase domain of the mal 100.0
PRK11000369 maltose/maltodextrin transporter ATP-binding prote 100.0
TIGR01288303 nodI ATP-binding ABC transporter family nodulation 100.0
cd03266218 ABC_NatA_sodium_exporter NatA is the ATPase compon 100.0
TIGR01186363 proV glycine betaine/L-proline transport ATP bindi 100.0
COG4525259 TauB ABC-type taurine transport system, ATPase com 100.0
cd03219236 ABC_Mj1267_LivG_branched The Mj1267/LivG ABC trans 100.0
PRK11153343 metN DL-methionine transporter ATP-binding subunit 100.0
cd03296239 ABC_CysA_sulfate_importer Part of the ABC transpor 100.0
cd03226205 ABC_cobalt_CbiO_domain2 Domain II of the ABC compo 100.0
cd03218232 ABC_YhbG The ABC transporters belonging to the Yhb 100.0
cd03294269 ABC_Pro_Gly_Bertaine This family comprises the gly 100.0
COG1122235 CbiO ABC-type cobalt transport system, ATPase comp 100.0
cd03262213 ABC_HisP_GlnQ_permeases HisP and GlnQ are the ATP- 100.0
COG4181228 Predicted ABC-type transport system involved in ly 100.0
cd03268208 ABC_BcrA_bacitracin_resist The BcrA subfamily repr 100.0
COG3845501 ABC-type uncharacterized transport systems, ATPase 100.0
PRK09536402 btuD corrinoid ABC transporter ATPase; Reviewed 100.0
PRK11629233 lolD lipoprotein transporter ATP-binding subunit; 100.0
cd03225211 ABC_cobalt_CbiO_domain1 Domain I of the ABC compon 100.0
TIGR03522301 GldA_ABC_ATP gliding motility-associated ABC trans 100.0
cd03258233 ABC_MetN_methionine_transporter MetN (also known a 100.0
PRK10908222 cell division protein FtsE; Provisional 100.0
PRK11248255 tauB taurine transporter ATP-binding subunit; Prov 100.0
cd03256241 ABC_PhnC_transporter ABC-type phosphate/phosphonat 100.0
cd03260227 ABC_PstB_phosphate_transporter Phosphate uptake is 100.0
cd03263220 ABC_subfamily_A The ABCA subfamily mediates the tr 100.0
TIGR01166190 cbiO cobalt transport protein ATP-binding subunit. 100.0
TIGR02211221 LolD_lipo_ex lipoprotein releasing system, ATP-bin 100.0
TIGR03608206 L_ocin_972_ABC putative bacteriocin export ABC tra 100.0
cd03224222 ABC_TM1139_LivF_branched LivF (TM1139) is part of 100.0
cd03295242 ABC_OpuCA_Osmoprotection OpuCA is a the ATP bindin 100.0
PRK09493240 glnQ glutamine ABC transporter ATP-binding protein 100.0
PRK11264250 putative amino-acid ABC transporter ATP-binding pr 100.0
cd03235213 ABC_Metallic_Cations ABC component of the metal-ty 100.0
PRK13637287 cbiO cobalt transporter ATP-binding subunit; Provi 100.0
TIGR02315243 ABC_phnC phosphonate ABC transporter, ATP-binding 100.0
COG0411250 LivG ABC-type branched-chain amino acid transport 100.0
PRK11831269 putative ABC transporter ATP-binding protein YrbF; 100.0
PRK13538204 cytochrome c biogenesis protein CcmA; Provisional 100.0
cd03264211 ABC_drug_resistance_like ABC-type multidrug transp 100.0
KOG0058716 consensus Peptide exporter, ABC superfamily [Intra 100.0
PRK13647274 cbiO cobalt transporter ATP-binding subunit; Provi 100.0
PRK11247257 ssuB aliphatic sulfonates transport ATP-binding su 100.0
PRK10070400 glycine betaine transporter ATP-binding subunit; P 100.0
COG0410237 LivF ABC-type branched-chain amino acid transport 100.0
PRK10895241 lipopolysaccharide ABC transporter ATP-binding pro 100.0
cd03257228 ABC_NikE_OppD_transporters The ABC transporter sub 100.0
TIGR03864236 PQQ_ABC_ATP ABC transporter, ATP-binding subunit, 100.0
PRK13634290 cbiO cobalt transporter ATP-binding subunit; Provi 100.0
PRK10619257 histidine/lysine/arginine/ornithine transporter su 100.0
TIGR01189198 ccmA heme ABC exporter, ATP-binding protein CcmA. 100.0
PRK13651305 cobalt transporter ATP-binding subunit; Provisiona 100.0
PRK13650279 cbiO cobalt transporter ATP-binding subunit; Provi 100.0
TIGR00972247 3a0107s01c2 phosphate ABC transporter, ATP-binding 100.0
PRK11124242 artP arginine transporter ATP-binding subunit; Pro 100.0
cd03231201 ABC_CcmA_heme_exporter CcmA, the ATP-binding compo 100.0
PRK13643288 cbiO cobalt transporter ATP-binding subunit; Provi 100.0
PRK15079331 oligopeptide ABC transporter ATP-binding protein O 100.0
PRK13631320 cbiO cobalt transporter ATP-binding subunit; Provi 100.0
PRK13543214 cytochrome c biogenesis protein CcmA; Provisional 100.0
PRK13646286 cbiO cobalt transporter ATP-binding subunit; Provi 100.0
PRK10584228 putative ABC transporter ATP-binding protein YbbA; 100.0
PRK14247250 phosphate ABC transporter ATP-binding protein; Pro 100.0
TIGR03005252 ectoine_ehuA ectoine/hydroxyectoine ABC transporte 100.0
PRK14273254 phosphate ABC transporter ATP-binding protein; Pro 100.0
PRK13539207 cytochrome c biogenesis protein CcmA; Provisional 100.0
PRK11614237 livF leucine/isoleucine/valine transporter ATP-bin 100.0
PRK13636283 cbiO cobalt transporter ATP-binding subunit; Provi 100.0
cd03233202 ABC_PDR_domain1 The pleiotropic drug resistance (P 100.0
cd03298211 ABC_ThiQ_thiamine_transporter ABC-type thiamine tr 100.0
TIGR01978243 sufC FeS assembly ATPase SufC. SufC is part of the 100.0
PRK13540200 cytochrome c biogenesis protein CcmA; Provisional 100.0
PRK13641287 cbiO cobalt transporter ATP-binding subunit; Provi 100.0
TIGR03415382 ABC_choXWV_ATP choline ABC transporter, ATP-bindin 100.0
COG4152300 ABC-type uncharacterized transport system, ATPase 100.0
PRK13644274 cbiO cobalt transporter ATP-binding subunit; Provi 100.0
cd03267236 ABC_NatA_like Similar in sequence to NatA, this is 100.0
PRK11231255 fecE iron-dicitrate transporter ATP-binding subuni 100.0
PRK13548258 hmuV hemin importer ATP-binding subunit; Provision 100.0
PRK13635279 cbiO cobalt transporter ATP-binding subunit; Provi 100.0
PRK14268258 phosphate ABC transporter ATP-binding protein; Pro 100.0
TIGR03740223 galliderm_ABC gallidermin-class lantibiotic protec 100.0
PRK14267253 phosphate ABC transporter ATP-binding protein; Pro 100.0
PRK11300255 livG leucine/isoleucine/valine transporter ATP-bin 100.0
TIGR03411242 urea_trans_UrtD urea ABC transporter, ATP-binding 100.0
PRK13652277 cbiO cobalt transporter ATP-binding subunit; Provi 100.0
cd03300232 ABC_PotA_N PotA is an ABC-type transporter and the 100.0
PRK14242253 phosphate transporter ATP-binding protein; Provisi 100.0
PRK14241258 phosphate transporter ATP-binding protein; Provisi 100.0
PRK13632271 cbiO cobalt transporter ATP-binding subunit; Provi 100.0
PRK13638271 cbiO cobalt transporter ATP-binding subunit; Provi 100.0
PRK10575265 iron-hydroxamate transporter ATP-binding subunit; 100.0
KOG0057591 consensus Mitochondrial Fe/S cluster exporter, ABC 100.0
TIGR01277213 thiQ thiamine ABC transporter, ATP-binding protein 100.0
PRK13649280 cbiO cobalt transporter ATP-binding subunit; Provi 100.0
TIGR02982220 heterocyst_DevA ABC exporter ATP-binding subunit, 100.0
PRK10744260 pstB phosphate transporter ATP-binding protein; Pr 100.0
PRK09984262 phosphonate/organophosphate ester transporter subu 100.0
cd03232192 ABC_PDR_domain2 The pleiotropic drug resistance-li 100.0
TIGR02769265 nickel_nikE nickel import ATP-binding protein NikE 100.0
PRK14245250 phosphate ABC transporter ATP-binding protein; Pro 100.0
COG4598256 HisP ABC-type histidine transport system, ATPase c 100.0
PRK10253265 iron-enterobactin transporter ATP-binding protein; 100.0
PRK13639275 cbiO cobalt transporter ATP-binding subunit; Provi 100.0
TIGR03410230 urea_trans_UrtE urea ABC transporter, ATP-binding 100.0
COG4988559 CydD ABC-type transport system involved in cytochr 100.0
cd03213194 ABCG_EPDR ABCG transporters are involved in eye pi 100.0
PRK14237267 phosphate transporter ATP-binding protein; Provisi 100.0
TIGR03873256 F420-0_ABC_ATP proposed F420-0 ABC transporter, AT 100.0
PRK14235267 phosphate transporter ATP-binding protein; Provisi 100.0
TIGR00968237 3a0106s01 sulfate ABC transporter, ATP-binding pro 100.0
COG2274709 SunT ABC-type bacteriocin/lantibiotic exporters, c 100.0
PRK11022326 dppD dipeptide transporter ATP-binding subunit; Pr 100.0
COG4559259 ABC-type hemin transport system, ATPase component 100.0
TIGR01184230 ntrCD nitrate transport ATP-binding subunits C and 100.0
PRK11308327 dppF dipeptide transporter ATP-binding subunit; Pr 100.0
PRK14259269 phosphate ABC transporter ATP-binding protein; Pro 100.0
PRK09473330 oppD oligopeptide transporter ATP-binding componen 100.0
PRK14269246 phosphate ABC transporter ATP-binding protein; Pro 100.0
PRK14250241 phosphate ABC transporter ATP-binding protein; Pro 100.0
cd03299235 ABC_ModC_like Archeal protein closely related to M 100.0
PRK14256252 phosphate ABC transporter ATP-binding protein; Pro 100.0
TIGR02868529 CydC thiol reductant ABC exporter, CydC subunit. T 100.0
PRK13547272 hmuV hemin importer ATP-binding subunit; Provision 100.0
PRK13640282 cbiO cobalt transporter ATP-binding subunit; Provi 100.0
PRK13645289 cbiO cobalt transporter ATP-binding subunit; Provi 100.0
PRK13549506 xylose transporter ATP-binding subunit; Provisiona 100.0
TIGR02142354 modC_ABC molybdenum ABC transporter, ATP-binding p 100.0
PRK13648269 cbiO cobalt transporter ATP-binding subunit; Provi 100.0
cd03297214 ABC_ModC_molybdenum_transporter ModC is an ABC-typ 100.0
PRK10247225 putative ABC transporter ATP-binding protein YbbL; 100.0
cd03230173 ABC_DR_subfamily_A This family of ATP-binding prot 100.0
TIGR02324224 CP_lyasePhnL phosphonate C-P lyase system protein 100.0
PRK15093330 antimicrobial peptide ABC transporter ATP-binding 100.0
COG0444316 DppD ABC-type dipeptide/oligopeptide/nickel transp 100.0
PRK15112267 antimicrobial peptide ABC system ATP-binding prote 100.0
PRK11144352 modC molybdate transporter ATP-binding protein; Pr 100.0
PRK13633280 cobalt transporter ATP-binding subunit; Provisiona 100.0
KOG0055 1228 consensus Multidrug/pheromone exporter, ABC superf 100.0
PRK14260259 phosphate ABC transporter ATP-binding protein; Pro 100.0
PRK10771232 thiQ thiamine transporter ATP-binding subunit; Pro 100.0
PRK14240250 phosphate transporter ATP-binding protein; Provisi 100.0
PRK14274259 phosphate ABC transporter ATP-binding protein; Pro 100.0
PRK14270251 phosphate ABC transporter ATP-binding protein; Pro 100.0
PRK14239252 phosphate transporter ATP-binding protein; Provisi 100.0
PRK14262250 phosphate ABC transporter ATP-binding protein; Pro 100.0
cd03220224 ABC_KpsT_Wzt ABC_KpsT_Wzt The KpsT/Wzt ABC transpo 100.0
PRK13642277 cbiO cobalt transporter ATP-binding subunit; Provi 100.0
COG4175386 ProV ABC-type proline/glycine betaine transport sy 100.0
PRK13541195 cytochrome c biogenesis protein CcmA; Provisional 100.0
PRK14244251 phosphate ABC transporter ATP-binding protein; Pro 100.0
PRK14253249 phosphate ABC transporter ATP-binding protein; Pro 100.0
PRK10762501 D-ribose transporter ATP binding protein; Provisio 100.0
PRK15056272 manganese/iron transporter ATP-binding protein; Pr 100.0
PRK14236272 phosphate transporter ATP-binding protein; Provisi 100.0
COG4619223 ABC-type uncharacterized transport system, ATPase 100.0
PRK14254285 phosphate ABC transporter ATP-binding protein; Pro 100.0
PRK14249251 phosphate ABC transporter ATP-binding protein; Pro 100.0
PRK14271276 phosphate ABC transporter ATP-binding protein; Pro 100.0
cd03229178 ABC_Class3 This class is comprised of all BPD (Bin 100.0
PRK14258261 phosphate ABC transporter ATP-binding protein; Pro 100.0
PRK14272252 phosphate ABC transporter ATP-binding protein; Pro 100.0
TIGR02770230 nickel_nikD nickel import ATP-binding protein NikD 100.0
PRK14261253 phosphate ABC transporter ATP-binding protein; Pro 100.0
PRK14263261 phosphate ABC transporter ATP-binding protein; Pro 100.0
PRK10418254 nikD nickel transporter ATP-binding protein NikD; 100.0
PRK14257329 phosphate ABC transporter ATP-binding protein; Pro 100.0
PRK14251251 phosphate ABC transporter ATP-binding protein; Pro 100.0
PRK11701258 phnK phosphonate C-P lyase system protein PhnK; Pr 100.0
PRK11174588 cysteine/glutathione ABC transporter membrane/ATP- 100.0
PRK09700510 D-allose transporter ATP-binding protein; Provisio 100.0
PRK14248268 phosphate ABC transporter ATP-binding protein; Pro 100.0
PRK14275286 phosphate ABC transporter ATP-binding protein; Pro 100.0
COG4987573 CydC ABC-type transport system involved in cytochr 100.0
PRK14255252 phosphate ABC transporter ATP-binding protein; Pro 100.0
COG4161242 ArtP ABC-type arginine transport system, ATPase co 100.0
TIGR02633500 xylG D-xylose ABC transporter, ATP-binding protein 100.0
PRK11288501 araG L-arabinose transporter ATP-binding protein; 100.0
PRK15439510 autoinducer 2 ABC transporter ATP-binding protein 100.0
cd03215182 ABC_Carb_Monos_II This family represents domain II 100.0
PRK14265274 phosphate ABC transporter ATP-binding protein; Pro 100.0
PRK10419268 nikE nickel transporter ATP-binding protein NikE; 100.0
cd03245220 ABCC_bacteriocin_exporters ABC-type bacteriocin ex 100.0
PRK14238271 phosphate transporter ATP-binding protein; Provisi 100.0
PRK14243264 phosphate transporter ATP-binding protein; Provisi 100.0
cd03252237 ABCC_Hemolysin The ABC-transporter hemolysin B is 100.0
PRK14246257 phosphate ABC transporter ATP-binding protein; Pro 100.0
CHL00131252 ycf16 sulfate ABC transporter protein; Validated 100.0
PRK14266250 phosphate ABC transporter ATP-binding protein; Pro 99.98
TIGR02323253 CP_lyasePhnK phosphonate C-P lyase system protein 99.98
cd03246173 ABCC_Protease_Secretion This family represents the 99.98
PRK09544251 znuC high-affinity zinc transporter ATPase; Review 99.98
PRK10982491 galactose/methyl galaxtoside transporter ATP-bindi 99.98
cd03248226 ABCC_TAP TAP, the Transporter Associated with Anti 99.98
cd03251234 ABCC_MsbA MsbA is an essential ABC transporter, cl 99.98
PRK11176582 lipid transporter ATP-binding/permease protein; Pr 99.98
PRK14264305 phosphate ABC transporter ATP-binding protein; Pro 99.98
TIGR03797686 NHPM_micro_ABC2 NHPM bacteriocin system ABC transp 99.98
PRK09580248 sufC cysteine desulfurase ATPase component; Review 99.98
PRK10790592 putative multidrug transporter membrane\ATP-bindin 99.98
PRK03695248 vitamin B12-transporter ATPase; Provisional 99.98
COG1129500 MglA ABC-type sugar transport system, ATPase compo 99.98
PRK14252265 phosphate ABC transporter ATP-binding protein; Pro 99.98
PRK11160574 cysteine/glutathione ABC transporter membrane/ATP- 99.98
COG1123539 ATPase components of various ABC-type transport sy 99.98
cd03254229 ABCC_Glucan_exporter_like Glucan exporter ATP-bind 99.98
cd03249238 ABC_MTABC3_MDL1_MDL2 MTABC3 (also known as ABCB6) 99.98
TIGR02857529 CydD thiol reductant ABC exporter, CydD subunit. U 99.97
TIGR03269520 met_CoM_red_A2 methyl coenzyme M reductase system, 99.97
PRK13545549 tagH teichoic acids export protein ATP-binding sub 99.97
cd03289275 ABCC_CFTR2 The CFTR subfamily domain 2. The cystic 99.97
COG4136213 ABC-type uncharacterized transport system, ATPase 99.97
COG4618580 ArpD ABC-type protease/lipase transport system, AT 99.97
PRK13546264 teichoic acids export protein ATP-binding subunit; 99.97
COG1132567 MdlB ABC-type multidrug transport system, ATPase a 99.97
cd03217200 ABC_FeS_Assembly ABC-type transport system involve 99.97
TIGR03796710 NHPM_micro_ABC1 NHPM bacteriocin system ABC transp 99.97
cd03247178 ABCC_cytochrome_bd The CYD subfamily implicated in 99.97
cd03253236 ABCC_ATM1_transporter ATM1 is an ABC transporter t 99.97
COG1119257 ModF ABC-type molybdenum transport system, ATPase 99.97
PRK10261623 glutathione transporter ATP-binding protein; Provi 99.97
cd03223166 ABCD_peroxisomal_ALDP Peroxisomal ATP-binding cass 99.97
TIGR01193708 bacteriocin_ABC ABC-type bacteriocin transporter. 99.97
COG4604252 CeuD ABC-type enterochelin transport system, ATPas 99.97
PRK15134529 microcin C ABC transporter ATP-binding protein Yej 99.97
TIGR00958711 3a01208 Conjugate Transporter-2 (CT2) Family prote 99.97
COG3845501 ABC-type uncharacterized transport systems, ATPase 99.97
TIGR03375694 type_I_sec_LssB type I secretion system ATPase, Ls 99.97
TIGR01842544 type_I_sec_PrtD type I secretion system ABC transp 99.97
cd03244221 ABCC_MRP_domain2 Domain 2 of the ABC subfamily C. 99.97
PRK00349943 uvrA excinuclease ABC subunit A; Reviewed 99.97
cd03290218 ABCC_SUR1_N The SUR domain 1. The sulfonylurea rec 99.97
PRK13657588 cyclic beta-1,2-glucan ABC transporter; Provisiona 99.97
cd03214180 ABC_Iron-Siderophores_B12_Hemin ABC transporters, 99.97
cd03250204 ABCC_MRP_domain1 Domain 1 of the ABC subfamily C. 99.97
KOG0056790 consensus Heavy metal exporter HMT1, ABC superfami 99.97
PRK00635 1809 excinuclease ABC subunit A; Provisional 99.97
TIGR02203571 MsbA_lipidA lipid A export permease/ATP-binding pr 99.97
cd03228171 ABCC_MRP_Like The MRP (Mutidrug Resistance Protein 99.97
cd03216163 ABC_Carb_Monos_I This family represents the domain 99.97
KOG0058716 consensus Peptide exporter, ABC superfamily [Intra 99.97
TIGR03771223 anch_rpt_ABC anchored repeat-type ABC transporter, 99.97
COG4133209 CcmA ABC-type transport system involved in cytochr 99.97
COG0396251 sufC Cysteine desulfurase activator ATPase [Posttr 99.97
TIGR01846694 type_I_sec_HlyB type I secretion system ABC transp 99.97
cd03369207 ABCC_NFT1 Domain 2 of NFT1 (New full-length MRP-ty 99.97
COG4148352 ModC ABC-type molybdate transport system, ATPase c 99.97
PRK10789569 putative multidrug transporter membrane\ATP-bindin 99.97
TIGR02204576 MsbA_rel ABC transporter, permease/ATP-binding pro 99.97
PRK10938490 putative molybdenum transport ATP-binding protein 99.97
TIGR01192585 chvA glucan exporter ATP-binding protein. This mod 99.97
PRK10535648 macrolide transporter ATP-binding /permease protei 99.97
cd03288257 ABCC_SUR2 The SUR domain 2. The sulfonylurea recep 99.97
cd03237246 ABC_RNaseL_inhibitor_domain2 The ATPase domain 2 o 99.97
PRK10522547 multidrug transporter membrane component/ATP-bindi 99.97
TIGR00630924 uvra excinuclease ABC, A subunit. This family is b 99.97
COG1135339 AbcC ABC-type metal ion transport system, ATPase c 99.97
TIGR01187325 potA spermidine/putrescine ABC transporter ATP-bin 99.97
KOG0059885 consensus Lipid exporter ABCA1 and related protein 99.97
COG4674249 Uncharacterized ABC-type transport system, ATPase 99.97
COG1126240 GlnQ ABC-type polar amino acid transport system, A 99.96
cd03291282 ABCC_CFTR1 The CFTR subfamily domain 1. The cystic 99.96
TIGR01194555 cyc_pep_trnsptr cyclic peptide transporter. This m 99.96
COG1131293 CcmA ABC-type multidrug transport system, ATPase c 99.96
PTZ00265 1466 multidrug resistance protein (mdr1); Provisional 99.96
PRK15064530 ABC transporter ATP-binding protein; Provisional 99.96
PRK11819556 putative ABC transporter ATP-binding protein; Revi 99.96
cd03236255 ABC_RNaseL_inhibitor_domain1 The ATPase domain 1 o 99.96
PRK15177213 Vi polysaccharide export ATP-binding protein VexC; 99.96
TIGR00954659 3a01203 Peroxysomal Fatty Acyl CoA Transporter (FA 99.96
cd03221144 ABCF_EF-3 ABCF_EF-3 Elongation factor 3 (EF-3) is 99.96
COG1125309 OpuBA ABC-type proline/glycine betaine transport s 99.96
cd03238176 ABC_UvrA The excision repair protein UvrA; Nucleot 99.96
cd03222177 ABC_RNaseL_inhibitor The ABC ATPase RNase L inhibi 99.96
TIGR03719552 ABC_ABC_ChvD ATP-binding cassette protein, ChvD fa 99.96
KOG0927614 consensus Predicted transporter (ABC superfamily) 99.96
COG1101263 PhnK ABC-type uncharacterized transport system, AT 99.96
COG4608268 AppF ABC-type oligopeptide transport system, ATPas 99.96
KOG0057591 consensus Mitochondrial Fe/S cluster exporter, ABC 99.96
COG5265497 ATM1 ABC-type transport system involved in Fe-S cl 99.95
COG4586325 ABC-type uncharacterized transport system, ATPase 99.95
COG4172534 ABC-type uncharacterized transport system, duplica 99.95
COG3839338 MalK ABC-type sugar transport systems, ATPase comp 99.95
COG2274709 SunT ABC-type bacteriocin/lantibiotic exporters, c 99.95
COG4555245 NatA ABC-type Na+ transport system, ATPase compone 99.95
COG1118345 CysA ABC-type sulfate/molybdate transport systems, 99.95
cd00267157 ABC_ATPase ABC (ATP-binding cassette) transporter 99.95
COG1127263 Ttg2A ABC-type transport system involved in resist 99.95
PRK13409590 putative ATPase RIL; Provisional 99.95
PRK10636638 putative ABC transporter ATP-binding protein; Prov 99.95
PLN03232 1495 ABC transporter C family member; Provisional 99.95
PLN03130 1622 ABC transporter C family member; Provisional 99.94
COG3638258 ABC-type phosphate/phosphonate transport system, A 99.94
COG1116248 TauB ABC-type nitrate/sulfonate/bicarbonate transp 99.94
PF00005137 ABC_tran: ABC transporter This structure is on hol 99.94
COG3842352 PotA ABC-type spermidine/putrescine transport syst 99.94
COG1134249 TagH ABC-type polysaccharide/polyol phosphate tran 99.94
COG4778235 PhnL ABC-type phosphonate transport system, ATPase 99.94
KOG0056790 consensus Heavy metal exporter HMT1, ABC superfami 99.94
COG5265497 ATM1 ABC-type transport system involved in Fe-S cl 99.94
PRK11147635 ABC transporter ATPase component; Reviewed 99.94
COG1120258 FepC ABC-type cobalamin/Fe3+-siderophores transpor 99.94
COG0488530 Uup ATPase components of ABC transporters with dup 99.94
PRK11174588 cysteine/glutathione ABC transporter membrane/ATP- 99.94
COG1117253 PstB ABC-type phosphate transport system, ATPase c 99.94
TIGR01186363 proV glycine betaine/L-proline transport ATP bindi 99.94
COG4988559 CydD ABC-type transport system involved in cytochr 99.94
PRK11650356 ugpC glycerol-3-phosphate transporter ATP-binding 99.94
COG4107258 PhnK ABC-type phosphonate transport system, ATPase 99.94
TIGR03265353 PhnT2 putative 2-aminoethylphosphonate ABC transpo 99.94
COG3840231 ThiQ ABC-type thiamine transport system, ATPase co 99.94
COG1132567 MdlB ABC-type multidrug transport system, ATPase a 99.94
TIGR02314343 ABC_MetN D-methionine ABC transporter, ATP-binding 99.94
PRK11432351 fbpC ferric transporter ATP-binding subunit; Provi 99.93
COG1121254 ZnuC ABC-type Mn/Zn transport systems, ATPase comp 99.93
PRK13537306 nodulation ABC transporter NodI; Provisional 99.93
TIGR03258362 PhnT 2-aminoethylphosphonate ABC transport system, 99.93
PRK09452375 potA putrescine/spermidine ABC transporter ATPase 99.93
TIGR00957 1522 MRP_assoc_pro multi drug resistance-associated pro 99.93
PRK11607377 potG putrescine transporter ATP-binding subunit; P 99.93
PRK10851353 sulfate/thiosulfate transporter subunit; Provision 99.93
TIGR01188302 drrA daunorubicin resistance ABC transporter ATP-b 99.93
COG1136226 SalX ABC-type antimicrobial peptide transport syst 99.93
TIGR01271 1490 CFTR_protein cystic fibrosis transmembrane conduct 99.93
TIGR03797686 NHPM_micro_ABC2 NHPM bacteriocin system ABC transp 99.92
COG1245591 Predicted ATPase, RNase L inhibitor (RLI) homolog 99.92
cd03261235 ABC_Org_Solvent_Resistant ABC (ATP-binding cassett 99.92
COG1122235 CbiO ABC-type cobalt transport system, ATPase comp 99.92
PRK13536340 nodulation factor exporter subunit NodI; Provision 99.92
PRK10790592 putative multidrug transporter membrane\ATP-bindin 99.92
PRK11000369 maltose/maltodextrin transporter ATP-binding prote 99.92
COG0410237 LivF ABC-type branched-chain amino acid transport 99.92
COG1124252 DppF ABC-type dipeptide/oligopeptide/nickel transp 99.92
cd03270226 ABC_UvrA_I The excision repair protein UvrA domain 99.92
PRK11153343 metN DL-methionine transporter ATP-binding subunit 99.92
cd03234226 ABCG_White The White subfamily represents ABC tran 99.92
COG4167267 SapF ABC-type antimicrobial peptide transport syst 99.92
TIGR01187325 potA spermidine/putrescine ABC transporter ATP-bin 99.92
TIGR03796710 NHPM_micro_ABC1 NHPM bacteriocin system ABC transp 99.92
TIGR03375694 type_I_sec_LssB type I secretion system ATPase, Ls 99.92
PRK11176582 lipid transporter ATP-binding/permease protein; Pr 99.92
COG4148352 ModC ABC-type molybdate transport system, ATPase c 99.92
PLN03073718 ABC transporter F family; Provisional 99.92
PRK10070400 glycine betaine transporter ATP-binding subunit; P 99.92
TIGR03522301 GldA_ABC_ATP gliding motility-associated ABC trans 99.92
PRK11144352 modC molybdate transporter ATP-binding protein; Pr 99.91
PRK11160574 cysteine/glutathione ABC transporter membrane/ATP- 99.91
COG1137243 YhbG ABC-type (unclassified) transport system, ATP 99.91
TIGR01288303 nodI ATP-binding ABC transporter family nodulation 99.91
cd03296239 ABC_CysA_sulfate_importer Part of the ABC transpor 99.91
PTZ00243 1560 ABC transporter; Provisional 99.91
COG4175386 ProV ABC-type proline/glycine betaine transport sy 99.91
cd03294269 ABC_Pro_Gly_Bertaine This family comprises the gly 99.91
cd03278197 ABC_SMC_barmotin Barmotin is a tight junction-asso 99.91
cd03265220 ABC_DrrA DrrA is the ATP-binding protein component 99.91
COG4618580 ArpD ABC-type protease/lipase transport system, AT 99.91
TIGR00958711 3a01208 Conjugate Transporter-2 (CT2) Family prote 99.91
TIGR01193708 bacteriocin_ABC ABC-type bacteriocin transporter. 99.91
cd03218232 ABC_YhbG The ABC transporters belonging to the Yhb 99.91
cd03219236 ABC_Mj1267_LivG_branched The Mj1267/LivG ABC trans 99.91
cd03259213 ABC_Carb_Solutes_like ABC Carbohydrate and Solute 99.91
TIGR02142354 modC_ABC molybdenum ABC transporter, ATP-binding p 99.91
TIGR03415382 ABC_choXWV_ATP choline ABC transporter, ATP-bindin 99.91
cd03301213 ABC_MalK_N The N-terminal ATPase domain of the mal 99.91
cd03258233 ABC_MetN_methionine_transporter MetN (also known a 99.91
PRK13637287 cbiO cobalt transporter ATP-binding subunit; Provi 99.91
cd03293220 ABC_NrtD_SsuB_transporters NrtD and SsuB are the A 99.91
cd03260227 ABC_PstB_phosphate_transporter Phosphate uptake is 99.91
cd03256241 ABC_PhnC_transporter ABC-type phosphate/phosphonat 99.91
PRK09473330 oppD oligopeptide transporter ATP-binding componen 99.91
KOG0054 1381 consensus Multidrug resistance-associated protein/ 99.91
PRK15079331 oligopeptide ABC transporter ATP-binding protein O 99.91
COG0411250 LivG ABC-type branched-chain amino acid transport 99.91
PRK13634290 cbiO cobalt transporter ATP-binding subunit; Provi 99.91
PRK13643288 cbiO cobalt transporter ATP-binding subunit; Provi 99.91
cd03295242 ABC_OpuCA_Osmoprotection OpuCA is a the ATP bindin 99.91
PRK13631320 cbiO cobalt transporter ATP-binding subunit; Provi 99.9
PRK14257329 phosphate ABC transporter ATP-binding protein; Pro 99.9
cd03263220 ABC_subfamily_A The ABCA subfamily mediates the tr 99.9
cd03269210 ABC_putative_ATPase This subfamily is involved in 99.9
PRK09536402 btuD corrinoid ABC transporter ATPase; Reviewed 99.9
cd03224222 ABC_TM1139_LivF_branched LivF (TM1139) is part of 99.9
cd03264211 ABC_drug_resistance_like ABC-type multidrug transp 99.9
cd03268208 ABC_BcrA_bacitracin_resist The BcrA subfamily repr 99.9
TIGR00960216 3a0501s02 Type II (General) Secretory Pathway (IIS 99.9
cd03266218 ABC_NatA_sodium_exporter NatA is the ATPase compon 99.9
TIGR00972247 3a0107s01c2 phosphate ABC transporter, ATP-binding 99.9
PRK11629233 lolD lipoprotein transporter ATP-binding subunit; 99.9
COG2884223 FtsE Predicted ATPase involved in cell division [C 99.9
cd03271261 ABC_UvrA_II The excision repair protein UvrA domai 99.9
PRK13657588 cyclic beta-1,2-glucan ABC transporter; Provisiona 99.9
PRK13647274 cbiO cobalt transporter ATP-binding subunit; Provi 99.9
PRK11264250 putative amino-acid ABC transporter ATP-binding pr 99.9
cd03233202 ABC_PDR_domain1 The pleiotropic drug resistance (P 99.9
PRK11831269 putative ABC transporter ATP-binding protein YrbF; 99.9
cd03255218 ABC_MJ0796_Lo1CDE_FtsE This family is comprised of 99.9
TIGR01846694 type_I_sec_HlyB type I secretion system ABC transp 99.9
KOG0059885 consensus Lipid exporter ABCA1 and related protein 99.9
TIGR02315243 ABC_phnC phosphonate ABC transporter, ATP-binding 99.9
cd03299235 ABC_ModC_like Archeal protein closely related to M 99.9
TIGR02203571 MsbA_lipidA lipid A export permease/ATP-binding pr 99.9
TIGR01842544 type_I_sec_PrtD type I secretion system ABC transp 99.9
PRK09493240 glnQ glutamine ABC transporter ATP-binding protein 99.9
cd03298211 ABC_ThiQ_thiamine_transporter ABC-type thiamine tr 99.9
TIGR01184230 ntrCD nitrate transport ATP-binding subunits C and 99.9
TIGR03864236 PQQ_ABC_ATP ABC transporter, ATP-binding subunit, 99.9
PRK13650279 cbiO cobalt transporter ATP-binding subunit; Provi 99.9
COG0444316 DppD ABC-type dipeptide/oligopeptide/nickel transp 99.9
PRK13646286 cbiO cobalt transporter ATP-binding subunit; Provi 99.9
PRK13635279 cbiO cobalt transporter ATP-binding subunit; Provi 99.9
PRK11308327 dppF dipeptide transporter ATP-binding subunit; Pr 99.9
PRK13636283 cbiO cobalt transporter ATP-binding subunit; Provi 99.9
TIGR02770230 nickel_nikD nickel import ATP-binding protein NikD 99.9
PRK11022326 dppD dipeptide transporter ATP-binding subunit; Pr 99.9
cd03226205 ABC_cobalt_CbiO_domain2 Domain II of the ABC compo 99.9
>KOG0065 consensus Pleiotropic drug resistance proteins (PDR1-15), ABC superfamily [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information 
Probab=100.00  E-value=2.2e-196  Score=1775.19  Aligned_cols=1166  Identities=52%  Similarity=0.903  Sum_probs=1066.0

Q ss_pred             CccccCCcCCCCceeEEEEECCccCCCCcccceEEEecccccccCCCCHHHHHHHHhhccCCCCccchhhhhhHHHHhhc
Q 000907            1 MLALAGKLDSSLKASGKVTYNGHDMHEFVPQRTAAYISQHDIHIGEMTVRETLAFSARCQGVGSRYDMLVELSRREKAAK   80 (1230)
Q Consensus         1 l~~Lag~~~~~~~~~G~V~vnG~~~~~~~~~~~~~yV~Q~d~l~~~lTVrEtL~f~a~l~~~~~~~~~~~~~~~~e~~~~   80 (1230)
                      ||+|+|.+++....+|+|++||++.++...++.++|++|+|+|+|.|||||||.|+++|++++.||+   +.+++|++. 
T Consensus       158 lkal~g~~~~~~~~~~~isy~G~~~~e~~~~~~~aY~~e~DvH~p~lTVreTldFa~rck~~~~r~~---~~~R~e~~~-  233 (1391)
T KOG0065|consen  158 LKALAGKLDNFLKSSGEITYNGHDLKEFVPKKTVAYNSEQDVHFPELTVRETLDFAARCKGPGSRYD---EVSRREKLA-  233 (1391)
T ss_pred             HHHHhCCCcccccCCCceeECCCcccccccCceEEeccccccccceeEEeehhhHHHhccCCccccc---cccHHHHHH-
Confidence            5899999998888899999999999998888999999999999999999999999999999999987   455555541 


Q ss_pred             cCCCchhhHHHHHHHhhccchhhHHHHHHHHcCCcccccccccCCccccCcccccchhHHHHHHhcCCceeeeeCCCccc
Q 000907           81 IIPDADIDVFMKAVVREGQEANVITDYILKVLDLDVCADTVVGDEMLRGISGGQRKRVTTGEMLVGPAHALFMDEISTGL  160 (1230)
Q Consensus        81 ~~~~~~~~~~~~~~~~~~~~~~~~vd~il~~lgL~~~~dT~VG~~~~rgLSGGqKrRvsIA~aL~~~p~ILlLDEPTSGL  160 (1230)
                                            +++|.+++++||.+|+||+||++++||+|||||||||+|++++++++++|+||+|+||
T Consensus       234 ----------------------~~~d~~lkilGL~~~~dT~VGnd~~RGvSGGerKRvsi~E~~v~~~~~~~~De~t~GL  291 (1391)
T KOG0065|consen  234 ----------------------AMTDYLLKILGLDHCADTLVGNDMVRGVSGGERKRVSIGEMLVGPASILFWDEITRGL  291 (1391)
T ss_pred             ----------------------HHHHHHHHHhCchhhccceecccccccccCcccceeeeeeeeecCcceeeeecccccc
Confidence                                  2589999999999999999999999999999999999999999999999999999999


Q ss_pred             chHHHHHHHHHHHHHhhhcCCEEEEEecCCChhHHhhccceEEecCCeEEEEcChhhHHHHHHhcCCCCCCCCCchhhhh
Q 000907          161 DSSTTFHIVNSLGQFNHILNGTALISLLQPAPEVYNLFDDIILVSDGQIVYQGPLEHVEQFFISMGFKCPKRKGIADFLQ  240 (1230)
Q Consensus       161 Ds~sa~~I~~~L~~la~~~~~t~iiti~qp~~~i~~lfD~I~vL~~G~vv~~G~~~~l~~~f~~~G~~~p~~~n~ad~l~  240 (1230)
                      ||.|+.+++++||++++..+.|.+++|+||+++++++||+|++|++|+++|+||.+++++||+++||.||+++++|||++
T Consensus       292 DSsTal~iik~lr~~a~~~~~t~~vsi~Q~s~~~~~lFD~v~lL~eG~~iy~Gp~d~~~~yFe~~Gf~cP~r~~~ADfLt  371 (1391)
T KOG0065|consen  292 DSSTAFQIIKALRQLAHITGATALVSILQPSPEIYDLFDDVILLSEGYQIYQGPRDEVLPYFEDMGFKCPPRKGTADFLT  371 (1391)
T ss_pred             cHHHHHHHHHHHHHHHhhhcceEEEEeccCChHHHHhhhheeeeeccceEEeccHHHHHHHHHhcCccCCCccCHHHHHH
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             hhcCchhhhhhhhcCCCCCccCCHHHHHHHHHhchhhhhHhhhhCCCCCCCCCCCcccccCCcccCHHHHHHHHHHHHHH
Q 000907          241 EVTSRKDQEQYWVRNDEPYRFVTVKEFVHAFQSFHVGRKLGDELGIPFDKKNSHPAALTTRKYGVGKKELLKACFSREHL  320 (1230)
Q Consensus       241 ~~~s~~~~~~~~~~~~~~~~~~~~~~~~~~~~~s~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~R~~~  320 (1230)
                      ++++..++.+.+.....++...+.+|+.+.|.+++.+.++..+++.+.++.+.++.......+..+.|+|++.|+.|.+.
T Consensus       372 ~vts~k~~~~~~~~~~~~~~~~~~~ef~~~~~~s~~~~~l~~~l~~~~~~~k~~~~al~s~~y~v~~~~qvk~c~~R~f~  451 (1391)
T KOG0065|consen  372 EVTSKKDQEQYWNKRSKPYPYTSVSEFAEYFLNSEDYAKLKKELSKPYDKSKKHKAALVSSKYSVPYWEQVKACTIREFL  451 (1391)
T ss_pred             HhhcCccccccccccCCCcccCCHHHHHHHHhcchhhHHHHHHhcchhhhhhccchhhcCCceeccHHHHHHHHHHHHHH
Confidence            99998777777777666777777899999999999999999999999998888888888899999999999999999999


Q ss_pred             HhhcChHHHHHHHHHHHHHHHHHHHHhccccCCCCCcccccchhhHHHHHHHHHHHHHHHHHHHHhccchhHHHhhhCCC
Q 000907          321 LMKRNSFVYIFRLTQVMFLAVIGMTIFLRTKMHRDSLTDGVIYTGALFFILTTITFNGMAEISMTIAKLPVFYKQRDLRF  400 (1230)
Q Consensus       321 ~~~r~~~~~~~~~~~~~~~~li~g~if~~~~~~~~~~~~~~~~~g~lf~~~~~~~~~~~~~~~~~~~~~~v~~rer~~~~  400 (1230)
                      .++||...+...+.+.+++++++|++|++.+.  .+..+...+.|++||.+.+.+++++++++.+++++||++|||+..+
T Consensus       452 l~k~n~~~~~~~~~~~~i~ali~gslF~~~~~--~t~~~~~~~~~~lffsll~~~f~~laEi~~~~~~~pv~~Khr~~~f  529 (1391)
T KOG0065|consen  452 LMKRNYFYYVFKTVQLVIQALITGSLFYRTPM--STTSGGYSRGGALFFALLFNLFNGLAEIALTFQRLPVFYKHRDLSF  529 (1391)
T ss_pred             HHhCCceEEEhHHHHHHHHHHHHhhheeeccC--cccccchhhhhHHHHHHHHHHHHhHHHHHHHHhhcchHHHhhcccc
Confidence            99999999999999999999999999999873  4444566679999999999999999999999999999999999999


Q ss_pred             CcchHHHHhHHHHhhhHHHHHHHHHHhhhhhccccccchhhHHHHHHHHHHHHHHHHHHHHHHHHhcCCHHHHHHHHHHH
Q 000907          401 YPSWAYALPAWILKIPISIVEVSVWVFMTYYVIGFDSNAGRFFKQYLLLLIVNQMSSAMFRLIAAVGRSMVVANTFGSLV  480 (1230)
Q Consensus       401 y~~~~y~la~~i~~~p~~~~~~~i~~~i~Y~~~gl~~~~~~f~~~~~~~~l~~~~~~~l~~~i~~~~~~~~ia~~~~~~~  480 (1230)
                      |++|++.++..++++|..++...+|.+|+||++|+.+++++||.++++.++++.+++++|++++++++++.+|+.++++.
T Consensus       530 Y~p~A~al~s~l~~~P~~~i~~~vf~iI~Yfl~gl~~~A~rFF~~fL~lf~~~~~~s~lFr~ia~l~~t~~~An~~g~~~  609 (1391)
T KOG0065|consen  530 YPPWAEALASTLLKIPSSFIESVVFVIITYFLIGLKRNAGRFFIQFLFLFLCQFCMSGLFRFIASLSRTLSIANLIGGIL  609 (1391)
T ss_pred             cChHHHHHHHHHHhCcHHHHHHHHHHHHHHHHhcCCcchHHHHHHHHHHHHHHHHHHHHHHHHHHhcchHHHHhhHhHHH
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHHhccccCcCCcccccchhhhhcHHHHHHHHHHHhhcCCCcccccCCC---------------CCCcchHHHHhh
Q 000907          481 LLLLFVLGGFVLSRDDIKKWWKWGYWCSPLMYAQNAIVVNEFLGNSWKKILPN---------------KTKPLGIEVLDS  545 (1230)
Q Consensus       481 ~~~~~l~~Gf~i~~~~ip~~~~w~~yisp~~y~~~al~~nef~~~~~~~~~~~---------------~~~~~g~~~l~~  545 (1230)
                      ++++.+++||+||..+||+||+|++|++|+.|++++++.|||++..|.|.+.+               ...+.|.++++.
T Consensus       610 ~L~i~m~~Gf~Ip~~~m~~W~~Wi~yinPl~Y~fesl~~NEF~~~~~~c~p~gp~y~n~~~~~~~c~~~~~~~G~~~v~g  689 (1391)
T KOG0065|consen  610 LLVLFMYGGFVIPKKDMPPWFRWIAYINPLMYAFESLMSNEFHGRRWPCSPSGPAYDNISIENKVCAATGATLGNDYVSG  689 (1391)
T ss_pred             HHHHHHHcceeeeccccchHHHHHHHHCHHHHHHHHHHHhhhhcccCCCCCCCCcccccccccccchhhccccCceEEec
Confidence            99999999999999999999999999999999999999999999999887322               124568888888


Q ss_pred             cCcc-----cCCcchhHHHHHHHHHHHHHHHHHHHHHHhcCCCCCCccccccccccccccccCCCccccccccCCCCccc
Q 000907          546 RGFF-----TDAYWYWLGVGALTGFIILFQFGFTLALSFLNPFGTSKAFISEESQSTEHDSRTGGTVQLSTCANSSSHIT  620 (1230)
Q Consensus       546 ~~~~-----~~~~~~w~~~~~l~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  620 (1230)
                      +++.     ....|+|+++++++++.++|.+...+++.|+++....+.....++............              
T Consensus       690 ~~~l~~~~~y~~~~~Wr~~gillgf~v~f~~~~~ia~~yl~p~~~~~~~l~~~~~~~~~~~~~~~~--------------  755 (1391)
T KOG0065|consen  690 RDYLKVQYQYEYKWYWRNFGILLGFTVFFNFVFLIALEYLKPLKKSGAILVFKKGKEKKKVKSAGS--------------  755 (1391)
T ss_pred             ccccccccccccceeEeehhHHHHHHHHHHHHHHHHHHhcCccccccceeeeccchhhhcchhccc--------------
Confidence            8777     667899999999999999999999999999998877766655544322211000000              


Q ss_pred             cccchhhhhhccCCCccccccccCCCCCCCCcccCCCCceeEEeeeEEEEecCcccccccccCCceeEeeceEEEEeCCe
Q 000907          621 RSESRDYVRRRNSSSQSRETTIETDQPKNRGMVLPFEPFSLTFDEITYSVDMPQEMKRRGVHDDKLVLLNGVSGAFRPGV  700 (1230)
Q Consensus       621 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~iL~~vs~~i~~Ge  700 (1230)
                                  ....  +...+....+++++..|..+..++++||.+.++++-+++..+   +++++|+|||+.++||.
T Consensus       756 ------------~~~~--~~~~~s~~~~~~~~~~~~~~~~~~~~~V~~w~dl~~~~~~qG---~~~qLL~~V~G~~kPG~  818 (1391)
T KOG0065|consen  756 ------------SSEI--EKLDDSSHQEKNKMVLPFTPLSLTFKDVFYWVDLPYEMPIQG---GTRQLLNNVSGAFKPGV  818 (1391)
T ss_pred             ------------cccc--cccccccccccccccCCCccccccccceEEEEeCCccccccc---cceEhhhcCceEecCCc
Confidence                        0000  000000000234556677788889999998888876665544   67889999999999999


Q ss_pred             EEEEEcCCCCcHHHHHHHHhCCCCCCeEEEEEEECCeecChhcccceEEEEccCCccCCCCCHHHHHHHHHHhcCCCCCC
Q 000907          701 LTALMGVTGSGKTTLMDVLAGRKTRGYITGNITISGYPKNQETFTRISGYCEQNDIHSPYVTVYESLLYSAWLRLSSEVN  780 (1230)
Q Consensus       701 ~~~i~G~sGsGKSTLl~~l~g~~~~~~~~G~i~~~g~~~~~~~~~~~~~~v~q~~~~~~~ltv~e~l~~~~~~~~~~~~~  780 (1230)
                      ++||||+||||||||||+|+||.+.|.++|+|.+||.|.+++.++|.+|||.|+|.|.|.+||+|.|.|+|.||+|.+.+
T Consensus       819 LTALMG~SGAGKTTLLdvLA~R~t~G~I~Gdi~i~G~p~~q~tF~R~~GYvqQ~DiH~~~~TVrESL~fSA~LRlp~~v~  898 (1391)
T KOG0065|consen  819 LTALMGESGAGKTTLLDVLAGRKTGGYIEGDILISGFPKDQETFARVSGYVEQQDIHSPELTVRESLRFSAALRLPKEVS  898 (1391)
T ss_pred             eeehhcCCCCchHHHHHHHhcCcccceEEeEEEECCeeCchhhhccccceeecccccCcccchHHHHHHHHHHcCCCcCC
Confidence            99999999999999999999999999999999999999988899999999999999999999999999999999999999


Q ss_pred             HHHHHHHHHHHHHHcCCCccccccccCCCCCCCCHHHHHHHHHHHHHhhCC-CEeEEeCCCCCCCHHHHHHHHHHHHHHH
Q 000907          781 SKTREMFVEEVMELVELNPLRQALVGLPGVNGLSTEQRKRLTIAVELVANP-SIIFMDEPTSGLDARAAAVVMRTVRNTV  859 (1230)
Q Consensus       781 ~~~~~~~~~~~l~~l~l~~~~~~~~~~~~~~~lSgGqrqrl~ia~al~~~p-~illlDEPtsgLD~~~~~~i~~~l~~~~  859 (1230)
                      .+++.++||++++.++|++++|.+||.|+ +|||.+|||||+||.+|+.|| .||||||||||||+.++..|++.+|+++
T Consensus       899 ~~ek~~yVe~Vi~lleL~~~~daiVG~~G-~GLs~eQRKrLTIgVELvA~P~~ilFLDEPTSGLDsqaA~~i~~~lrkla  977 (1391)
T KOG0065|consen  899 DEEKYEYVEEVIELLELKEYADALVGLPG-SGLSTEQRKRLTIGVELVANPSSILFLDEPTSGLDSQAAAIVMRFLRKLA  977 (1391)
T ss_pred             HHHHHHHHHHHHHHhCchhhhhhhccCCC-CCCCHHHhceeeEEEEEecCCceeEEecCCCCCccHHHHHHHHHHHHHHH
Confidence            99999999999999999999999999999 999999999999999999999 8999999999999999999999999999


Q ss_pred             hCCCEEEEEecCCCHHHHHHHhc----------------------------CCCCCccCCCCCCCCccccccCCchhhhh
Q 000907          860 DTGRTVVCTIHQPSIDIFEAFDA----------------------------GIPGVSKIRDGYNPATWMLEVTAPSQEIA  911 (1230)
Q Consensus       860 ~~g~tvi~~~H~~~~~i~~~fd~----------------------------~~~~~~~~~~~~npad~~l~~~~~~~~~~  911 (1230)
                      ++|+||+||+||||.+||+.||+                            ..+|. .|++..|||||++|+++...+.+
T Consensus       978 ~tGqtIlCTIHQPS~~ife~FD~LLLLkrGGqtVY~G~lG~~s~~li~YFes~~~~-~~~~~~NPA~~mLevi~~~~~~~ 1056 (1391)
T KOG0065|consen  978 DTGQTILCTIHQPSIDIFEAFDELLLLKRGGQTVYFGPLGENSSKLIEYFESIGGV-KCISDENPAEWMLEVIGAGAEAS 1056 (1391)
T ss_pred             hcCCeEEEEecCCcHHHHHHHhHHHHHhcCCeEEEecCcccccHHHHHHHHhcCCc-cCCCCCChHHHHHhhcccccccc
Confidence            99999999999999999999998                            11223 46666699999999999887777


Q ss_pred             hhhcHHHHHHhhHHHHHHHHHHHHhcCCCCC-CccccccCCCCchhHHHHHHHHHHHHHHhhcChHHHHHHHHHHHHHHH
Q 000907          912 LGVDFAAIYKSSELYRINKALIQELSKPAPG-SKELYFANQYPLSFFTQCMACLWKQHWSYSRNPHYTAVRFLFTIFISL  990 (1230)
Q Consensus       912 ~~~~~~~~~~~s~~~~~~~~~~~~~~~~~~~-~~~~~~~~~~~~~~~~q~~~l~~R~~~~~~R~~~~~~~~~~~~~~~~l  990 (1230)
                      ...||++.|++|++++++++.++++++++++ ..+..+.++|+.|+|.|++.++||+++.+||+|.++++|++..++.|+
T Consensus      1057 ~~~D~a~~w~~S~e~k~~~e~v~~l~~~~~~~~~~~~~~~~fa~s~~~Q~k~~l~Rq~~syWRsp~y~~ar~~~~i~~gl 1136 (1391)
T KOG0065|consen 1057 LSVDFAEIWKNSEEYKRNKELVKELSQPPPGFSTDLEFKTRFAQSLWYQFKLCLWRQFLSYWRSPDYLMARFALTIVAGL 1136 (1391)
T ss_pred             cCccHHHHHhccHHHHHHHHHHHHHhcCCccCCcccccccccchhHHHHHHHHHHHHHHHHhCCcHHHHHHHHHHHHHHH
Confidence            7889999999999999999999999988887 666677788999999999999999999999999999999999999999


Q ss_pred             HHHHHhccCCCCCCchhhhHhHHHHHHHHHHHHHHHhhhhhhhhhhhhhhHHHhhhcCCCCChHHHHHHHHHHHHHHHHH
Q 000907          991 IFGTMFWDMGTKTTKQQDLFNTMGFMYVAVYFLGVLNVSSVQPVVDLERSVFYREKGAGMYSPMAYAFAQVLIEIPYIFV 1070 (1230)
Q Consensus       991 ~~G~~f~~~~~~~~~~~~~~~~~g~~f~~~~~~~~~~~~~~~~~~~~er~v~~rE~~~~~Y~~~~y~~a~~l~~~p~~~~ 1070 (1230)
                      ++|++||++|+   ++++++|.+|++|+++++.+..+.....+.+..||.+++||+++|+||+.+|++|++++|+|+.++
T Consensus      1137 ~iGf~F~~~g~---~~q~lqn~m~a~yma~v~~~~~~~~~~~~~v~~e~~y~~RE~~s~mYs~~~~~~aq~~vEiP~~l~ 1213 (1391)
T KOG0065|consen 1137 FIGFTFWKVGH---NVQGLQNAMGAAYMATVFSGPNNNQLQQPAVATERLYEYRERASNMYSWTPFALAQVLVEIPYNLL 1213 (1391)
T ss_pred             hheeeeeecCC---cHHHHHHHHHHHHHHHHHhhhhhhhhhhhHHhhhhhheeeecccCcccHHHHHHHHHHHHHHHHHH
Confidence            99999999995   689999999999999999888877777787888999999999999999999999999999999999


Q ss_pred             HHhhHhhhhhcccccccCHHHHHHHHHHHHHHHHHHHHHHHHHHHhcccHHHHHHHHHHHHHHHHHhhccccCCCCCchh
Q 000907         1071 QAAPYSLIVYAMIGFEWTAAKFFWFLFFMFFSLLYFTFFGMMLVAWTPNHHIASIVSTLFYGLWNIVSGFIIPRTRIPVW 1150 (1230)
Q Consensus      1071 ~~~~~~~i~Y~~~gl~~~~~~f~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~a~~~~~~~~~~~~l~~G~~i~~~~ip~~ 1150 (1230)
                      ++++|.+++|+|+||.+++.+|++|++.+++..++.+.+|+++.+++||.++|+.+.+++++++.+|||+++|++.||.|
T Consensus      1214 ~stl~~~~~Y~~iGF~~~a~~~~~f~~~~~~f~lYf~~~Gmm~~s~tPn~~~Aav~~s~~~s~~~~F~G~l~p~~~iP~f 1293 (1391)
T KOG0065|consen 1214 QSTLFFLITYYPIGFYWTASKFFWFLLFMFIFFLYFTTLGMMLVSLTPNLQTAAVIASLFFSFWNLFSGFLQPRSLIPKF 1293 (1391)
T ss_pred             HHHHhheeeeeeccchhhHHHHHHHHHHHHHHHHHHHHHHHHHHHhCCChhHHHHHHHHHHHHHHHhcccccccccccce
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             hHHHHhhcHHHHHHHHHHHHhhCCCccccC----------CCCcHHHHHHhhhC----CCccchhHHHHHHHHHHHHHHH
Q 000907         1151 WRWSYWANPIAWTLYGFFASQFGDVQDRLE----------SGETVKQFLRSYYG----FKHDFLGAVAAVVFVLPSLFAF 1216 (1230)
Q Consensus      1151 ~~w~~~~sp~~y~~~~l~~nef~~~~~~~~----------~~~~~~~~~~~~~~----~~~~~~~~~~~il~~~~~~~~~ 1216 (1230)
                      |+|+||+||+.|.+++++..+++|.+..|.          +|.++|+|+..++|    +.++.......+.++|.+++.+
T Consensus      1294 W~wmy~lsP~ty~l~gli~~~~~d~~v~c~~~e~~~~~pp~g~tcge~m~~~~~~~~Gy~~n~~a~~~c~~c~y~v~~~~ 1373 (1391)
T KOG0065|consen 1294 WIWMYYLSPVTYTLEGLISSQLGDVEVTCEDSEMNYFDPPSGQTCGEFMEDFFGEGTGYLHNPLATTACVYCAYTVADAF 1373 (1391)
T ss_pred             eeeeeecCcHHHHHHHHHHHHhCCCceeeecCCccccCCCCCcCHHHHHHHHhccCcceeccCcceeEEEEeeeehHHHH
Confidence            999999999999999999999999988874          24589999999999    7777766777788899999999


Q ss_pred             HHHHHHHhhccccC
Q 000907         1217 VFALGIRVLNFQKR 1230 (1230)
Q Consensus      1217 ~~~~~l~~~~~~~r 1230 (1230)
                      ++.+..++.+++||
T Consensus      1374 l~~f~~~y~~~wrn 1387 (1391)
T KOG0065|consen 1374 LAAFNIKYLNFWRN 1387 (1391)
T ss_pred             HHHHHHHHHHHHHh
Confidence            99999999999886

>PLN03140 ABC transporter G family member; Provisional Back     alignment and domain information
>TIGR00956 3a01205 Pleiotropic Drug Resistance (PDR) Family protein Back     alignment and domain information
>KOG0061 consensus Transporter, ABC superfamily (Breast cancer resistance protein) [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PLN03211 ABC transporter G-25; Provisional Back     alignment and domain information
>TIGR00955 3a01204 The Eye Pigment Precursor Transporter (EPP) Family protein Back     alignment and domain information
>TIGR00956 3a01205 Pleiotropic Drug Resistance (PDR) Family protein Back     alignment and domain information
>PLN03140 ABC transporter G family member; Provisional Back     alignment and domain information
>KOG0065 consensus Pleiotropic drug resistance proteins (PDR1-15), ABC superfamily [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>KOG0061 consensus Transporter, ABC superfamily (Breast cancer resistance protein) [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>TIGR00955 3a01204 The Eye Pigment Precursor Transporter (EPP) Family protein Back     alignment and domain information
>PLN03211 ABC transporter G-25; Provisional Back     alignment and domain information
>KOG0055 consensus Multidrug/pheromone exporter, ABC superfamily [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>TIGR01257 rim_protein retinal-specific rim ABC transporter Back     alignment and domain information
>KOG0054 consensus Multidrug resistance-associated protein/mitoxantrone resistance protein, ABC superfamily [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PLN03130 ABC transporter C family member; Provisional Back     alignment and domain information
>PLN03232 ABC transporter C family member; Provisional Back     alignment and domain information
>PTZ00265 multidrug resistance protein (mdr1); Provisional Back     alignment and domain information
>TIGR00957 MRP_assoc_pro multi drug resistance-associated protein (MRP) Back     alignment and domain information
>COG1123 ATPase components of various ABC-type transport systems, contain duplicated ATPase [General function prediction only] Back     alignment and domain information
>PTZ00243 ABC transporter; Provisional Back     alignment and domain information
>TIGR01271 CFTR_protein cystic fibrosis transmembrane conductor regulator (CFTR) Back     alignment and domain information
>PRK13549 xylose transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK09700 D-allose transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK10261 glutathione transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK10762 D-ribose transporter ATP binding protein; Provisional Back     alignment and domain information
>TIGR03269 met_CoM_red_A2 methyl coenzyme M reductase system, component A2 Back     alignment and domain information
>PRK15134 microcin C ABC transporter ATP-binding protein YejF; Provisional Back     alignment and domain information
>TIGR02633 xylG D-xylose ABC transporter, ATP-binding protein Back     alignment and domain information
>PRK15439 autoinducer 2 ABC transporter ATP-binding protein LsrA; Provisional Back     alignment and domain information
>PRK11288 araG L-arabinose transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK10982 galactose/methyl galaxtoside transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK10938 putative molybdenum transport ATP-binding protein ModF; Provisional Back     alignment and domain information
>COG4172 ABC-type uncharacterized transport system, duplicated ATPase component [General function prediction only] Back     alignment and domain information
>PRK11819 putative ABC transporter ATP-binding protein; Reviewed Back     alignment and domain information
>PRK15064 ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR03719 ABC_ABC_ChvD ATP-binding cassette protein, ChvD family Back     alignment and domain information
>PRK13409 putative ATPase RIL; Provisional Back     alignment and domain information
>COG1126 GlnQ ABC-type polar amino acid transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>PRK11147 ABC transporter ATPase component; Reviewed Back     alignment and domain information
>PRK10636 putative ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>COG1116 TauB ABC-type nitrate/sulfonate/bicarbonate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>COG1136 SalX ABC-type antimicrobial peptide transport system, ATPase component [Defense mechanisms] Back     alignment and domain information
>COG1121 ZnuC ABC-type Mn/Zn transport systems, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>COG1135 AbcC ABC-type metal ion transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>COG2884 FtsE Predicted ATPase involved in cell division [Cell division and chromosome partitioning] Back     alignment and domain information
>COG1127 Ttg2A ABC-type transport system involved in resistance to organic solvents, ATPase component [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>COG1125 OpuBA ABC-type proline/glycine betaine transport systems, ATPase components [Amino acid transport and metabolism] Back     alignment and domain information
>COG1131 CcmA ABC-type multidrug transport system, ATPase component [Defense mechanisms] Back     alignment and domain information
>COG1129 MglA ABC-type sugar transport system, ATPase component [Carbohydrate transport and metabolism] Back     alignment and domain information
>COG1117 PstB ABC-type phosphate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>COG3839 MalK ABC-type sugar transport systems, ATPase components [Carbohydrate transport and metabolism] Back     alignment and domain information
>COG3842 PotA ABC-type spermidine/putrescine transport systems, ATPase components [Amino acid transport and metabolism] Back     alignment and domain information
>COG1120 FepC ABC-type cobalamin/Fe3+-siderophores transport systems, ATPase components [Inorganic ion transport and metabolism / Coenzyme metabolism] Back     alignment and domain information
>COG1118 CysA ABC-type sulfate/molybdate transport systems, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>TIGR01257 rim_protein retinal-specific rim ABC transporter Back     alignment and domain information
>COG3638 ABC-type phosphate/phosphonate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>PLN03073 ABC transporter F family; Provisional Back     alignment and domain information
>COG4555 NatA ABC-type Na+ transport system, ATPase component [Energy production and conversion / Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK13537 nodulation ABC transporter NodI; Provisional Back     alignment and domain information
>COG0488 Uup ATPase components of ABC transporters with duplicated ATPase domains [General function prediction only] Back     alignment and domain information
>PRK11650 ugpC glycerol-3-phosphate transporter ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR00960 3a0501s02 Type II (General) Secretory Pathway (IISP) Family protein Back     alignment and domain information
>TIGR02314 ABC_MetN D-methionine ABC transporter, ATP-binding protein Back     alignment and domain information
>PRK11432 fbpC ferric transporter ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR03265 PhnT2 putative 2-aminoethylphosphonate ABC transporter, ATP-binding protein Back     alignment and domain information
>TIGR03258 PhnT 2-aminoethylphosphonate ABC transport system, ATP-binding component PhnT Back     alignment and domain information
>cd03261 ABC_Org_Solvent_Resistant ABC (ATP-binding cassette) transport system involved in resistant to organic solvents; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules Back     alignment and domain information
>COG3840 ThiQ ABC-type thiamine transport system, ATPase component [Coenzyme metabolism] Back     alignment and domain information
>COG1137 YhbG ABC-type (unclassified) transport system, ATPase component [General function prediction only] Back     alignment and domain information
>cd03259 ABC_Carb_Solutes_like ABC Carbohydrate and Solute Transporters-like subgroup Back     alignment and domain information
>cd03255 ABC_MJ0796_Lo1CDE_FtsE This family is comprised of MJ0796 ATP-binding cassette, macrolide-specific ABC-type efflux carrier (MacAB), and proteins involved in cell division (FtsE), and release of liporoteins from the cytoplasmic membrane (LolCDE) Back     alignment and domain information
>PRK09452 potA putrescine/spermidine ABC transporter ATPase protein; Reviewed Back     alignment and domain information
>PRK13536 nodulation factor exporter subunit NodI; Provisional Back     alignment and domain information
>cd03293 ABC_NrtD_SsuB_transporters NrtD and SsuB are the ATP-binding subunits of the bacterial ABC-type nitrate and sulfonate transport systems, respectively Back     alignment and domain information
>PRK10851 sulfate/thiosulfate transporter subunit; Provisional Back     alignment and domain information
>cd03269 ABC_putative_ATPase This subfamily is involved in drug resistance, nodulation, lipid transport, and bacteriocin and lantibiotic immunity Back     alignment and domain information
>COG1124 DppF ABC-type dipeptide/oligopeptide/nickel transport system, ATPase component [Amino acid transport and metabolism / Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK11607 potG putrescine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR02673 FtsE cell division ATP-binding protein FtsE Back     alignment and domain information
>cd03234 ABCG_White The White subfamily represents ABC transporters homologous to the Drosophila white gene, which acts as a dimeric importer for eye pigment precursors Back     alignment and domain information
>cd03265 ABC_DrrA DrrA is the ATP-binding protein component of a bacterial exporter complex that confers resistance to the antibiotics daunorubicin and doxorubicin Back     alignment and domain information
>cd03292 ABC_FtsE_transporter FtsE is a hydrophilic nucleotide-binding protein that binds FtsX to form a heterodimeric ATP-binding cassette (ABC)-type transporter that associates with the bacterial inner membrane Back     alignment and domain information
>TIGR01188 drrA daunorubicin resistance ABC transporter ATP-binding subunit Back     alignment and domain information
>cd03301 ABC_MalK_N The N-terminal ATPase domain of the maltose transporter, MalK Back     alignment and domain information
>PRK11000 maltose/maltodextrin transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR01288 nodI ATP-binding ABC transporter family nodulation protein NodI Back     alignment and domain information
>cd03266 ABC_NatA_sodium_exporter NatA is the ATPase component of a bacterial ABC-type Na+ transport system called NatAB, which catalyzes ATP-dependent electrogenic Na+ extrusion without mechanically coupled proton or K+ uptake Back     alignment and domain information
>TIGR01186 proV glycine betaine/L-proline transport ATP binding subunit Back     alignment and domain information
>COG4525 TauB ABC-type taurine transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>cd03219 ABC_Mj1267_LivG_branched The Mj1267/LivG ABC transporter subfamily is involved in the transport of the hydrophobic amino acids leucine, isoleucine and valine Back     alignment and domain information
>PRK11153 metN DL-methionine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03296 ABC_CysA_sulfate_importer Part of the ABC transporter complex cysAWTP involved in sulfate import Back     alignment and domain information
>cd03226 ABC_cobalt_CbiO_domain2 Domain II of the ABC component of a cobalt transport family found in bacteria, archaea, and eukaryota Back     alignment and domain information
>cd03218 ABC_YhbG The ABC transporters belonging to the YhbG family are similar to members of the Mj1267_LivG family, which is involved in the transport of branched-chain amino acids Back     alignment and domain information
>cd03294 ABC_Pro_Gly_Bertaine This family comprises the glycine betaine/L-proline ATP binding subunit in bacteria and its equivalents in archaea Back     alignment and domain information
>COG1122 CbiO ABC-type cobalt transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>cd03262 ABC_HisP_GlnQ_permeases HisP and GlnQ are the ATP-binding components of the bacterial periplasmic histidine and glutamine permeases, repectively Back     alignment and domain information
>COG4181 Predicted ABC-type transport system involved in lysophospholipase L1 biosynthesis, ATPase component [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>cd03268 ABC_BcrA_bacitracin_resist The BcrA subfamily represents ABC transporters involved in peptide antibiotic resistance Back     alignment and domain information
>COG3845 ABC-type uncharacterized transport systems, ATPase components [General function prediction only] Back     alignment and domain information
>PRK09536 btuD corrinoid ABC transporter ATPase; Reviewed Back     alignment and domain information
>PRK11629 lolD lipoprotein transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03225 ABC_cobalt_CbiO_domain1 Domain I of the ABC component of a cobalt transport family found in bacteria, archaea, and eukaryota Back     alignment and domain information
>TIGR03522 GldA_ABC_ATP gliding motility-associated ABC transporter ATP-binding subunit GldA Back     alignment and domain information
>cd03258 ABC_MetN_methionine_transporter MetN (also known as YusC) is an ABC-type transporter encoded by metN of the metNPQ operon in Bacillus subtilis that is involved in methionine transport Back     alignment and domain information
>PRK10908 cell division protein FtsE; Provisional Back     alignment and domain information
>PRK11248 tauB taurine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03256 ABC_PhnC_transporter ABC-type phosphate/phosphonate transport system Back     alignment and domain information
>cd03260 ABC_PstB_phosphate_transporter Phosphate uptake is of fundamental importance in the cell physiology of bacteria because phosphate is required as a nutrient Back     alignment and domain information
>cd03263 ABC_subfamily_A The ABCA subfamily mediates the transport of a variety of lipid compounds Back     alignment and domain information
>TIGR01166 cbiO cobalt transport protein ATP-binding subunit Back     alignment and domain information
>TIGR02211 LolD_lipo_ex lipoprotein releasing system, ATP-binding protein Back     alignment and domain information
>TIGR03608 L_ocin_972_ABC putative bacteriocin export ABC transporter, lactococcin 972 group Back     alignment and domain information
>cd03224 ABC_TM1139_LivF_branched LivF (TM1139) is part of the LIV-I bacterial ABC-type two-component transport system that imports neutral, branched-chain amino acids Back     alignment and domain information
>cd03295 ABC_OpuCA_Osmoprotection OpuCA is a the ATP binding component of a bacterial solute transporter that serves a protective role to cells growing in a hyperosmolar environment Back     alignment and domain information
>PRK09493 glnQ glutamine ABC transporter ATP-binding protein; Reviewed Back     alignment and domain information
>PRK11264 putative amino-acid ABC transporter ATP-binding protein YecC; Provisional Back     alignment and domain information
>cd03235 ABC_Metallic_Cations ABC component of the metal-type transporters Back     alignment and domain information
>PRK13637 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR02315 ABC_phnC phosphonate ABC transporter, ATP-binding protein Back     alignment and domain information
>COG0411 LivG ABC-type branched-chain amino acid transport systems, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>PRK11831 putative ABC transporter ATP-binding protein YrbF; Provisional Back     alignment and domain information
>PRK13538 cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>cd03264 ABC_drug_resistance_like ABC-type multidrug transport system, ATPase component Back     alignment and domain information
>KOG0058 consensus Peptide exporter, ABC superfamily [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PRK13647 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK11247 ssuB aliphatic sulfonates transport ATP-binding subunit; Provisional Back     alignment and domain information
>PRK10070 glycine betaine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>COG0410 LivF ABC-type branched-chain amino acid transport systems, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>PRK10895 lipopolysaccharide ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03257 ABC_NikE_OppD_transporters The ABC transporter subfamily specific for the transport of dipeptides, oligopeptides (OppD), and nickel (NikDE) Back     alignment and domain information
>TIGR03864 PQQ_ABC_ATP ABC transporter, ATP-binding subunit, PQQ-dependent alcohol dehydrogenase system Back     alignment and domain information
>PRK13634 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK10619 histidine/lysine/arginine/ornithine transporter subunit; Provisional Back     alignment and domain information
>TIGR01189 ccmA heme ABC exporter, ATP-binding protein CcmA Back     alignment and domain information
>PRK13651 cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13650 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR00972 3a0107s01c2 phosphate ABC transporter, ATP-binding protein Back     alignment and domain information
>PRK11124 artP arginine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03231 ABC_CcmA_heme_exporter CcmA, the ATP-binding component of the bacterial CcmAB transporter Back     alignment and domain information
>PRK13643 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK15079 oligopeptide ABC transporter ATP-binding protein OppF; Provisional Back     alignment and domain information
>PRK13631 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13543 cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>PRK13646 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK10584 putative ABC transporter ATP-binding protein YbbA; Provisional Back     alignment and domain information
>PRK14247 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR03005 ectoine_ehuA ectoine/hydroxyectoine ABC transporter, ATP-binding protein Back     alignment and domain information
>PRK14273 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK13539 cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>PRK11614 livF leucine/isoleucine/valine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13636 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03233 ABC_PDR_domain1 The pleiotropic drug resistance (PDR) family of ATP-binding cassette (ABC) transporters Back     alignment and domain information
>cd03298 ABC_ThiQ_thiamine_transporter ABC-type thiamine tranport system; part of the binding-protein-dependent transport system tbpA-thiPQ for thiamine and TPP Back     alignment and domain information
>TIGR01978 sufC FeS assembly ATPase SufC Back     alignment and domain information
>PRK13540 cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>PRK13641 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR03415 ABC_choXWV_ATP choline ABC transporter, ATP-binding protein Back     alignment and domain information
>COG4152 ABC-type uncharacterized transport system, ATPase component [General function prediction only] Back     alignment and domain information
>PRK13644 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03267 ABC_NatA_like Similar in sequence to NatA, this is the ATPase component of a bacterial ABC-type Na+ transport system called NatAB, which catalyzes ATP-dependent electrogenic Na+ extrusion without mechanically coupled to proton or K+ uptake Back     alignment and domain information
>PRK11231 fecE iron-dicitrate transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13548 hmuV hemin importer ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13635 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK14268 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR03740 galliderm_ABC gallidermin-class lantibiotic protection ABC transporter, ATP-binding subunit Back     alignment and domain information
>PRK14267 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK11300 livG leucine/isoleucine/valine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR03411 urea_trans_UrtD urea ABC transporter, ATP-binding protein UrtD Back     alignment and domain information
>PRK13652 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03300 ABC_PotA_N PotA is an ABC-type transporter and the ATPase component of the spermidine/putrescine-preferential uptake system consisting of PotA, -B, -C, and -D Back     alignment and domain information
>PRK14242 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14241 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK13632 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13638 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK10575 iron-hydroxamate transporter ATP-binding subunit; Provisional Back     alignment and domain information
>KOG0057 consensus Mitochondrial Fe/S cluster exporter, ABC superfamily [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>TIGR01277 thiQ thiamine ABC transporter, ATP-binding protein Back     alignment and domain information
>PRK13649 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR02982 heterocyst_DevA ABC exporter ATP-binding subunit, DevA family Back     alignment and domain information
>PRK10744 pstB phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK09984 phosphonate/organophosphate ester transporter subunit; Provisional Back     alignment and domain information
>cd03232 ABC_PDR_domain2 The pleiotropic drug resistance-like (PDR) family of ATP-binding cassette (ABC) transporters Back     alignment and domain information
>TIGR02769 nickel_nikE nickel import ATP-binding protein NikE Back     alignment and domain information
>PRK14245 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>COG4598 HisP ABC-type histidine transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>PRK10253 iron-enterobactin transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK13639 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR03410 urea_trans_UrtE urea ABC transporter, ATP-binding protein UrtE Back     alignment and domain information
>COG4988 CydD ABC-type transport system involved in cytochrome bd biosynthesis, ATPase and permease components [Energy production and conversion / Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd03213 ABCG_EPDR ABCG transporters are involved in eye pigment (EP) precursor transport, regulation of lipid-trafficking mechanisms, and pleiotropic drug resistance (DR) Back     alignment and domain information
>PRK14237 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR03873 F420-0_ABC_ATP proposed F420-0 ABC transporter, ATP-binding protein Back     alignment and domain information
>PRK14235 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR00968 3a0106s01 sulfate ABC transporter, ATP-binding protein Back     alignment and domain information
>COG2274 SunT ABC-type bacteriocin/lantibiotic exporters, contain an N-terminal double-glycine peptidase domain [Defense mechanisms] Back     alignment and domain information
>PRK11022 dppD dipeptide transporter ATP-binding subunit; Provisional Back     alignment and domain information
>COG4559 ABC-type hemin transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>TIGR01184 ntrCD nitrate transport ATP-binding subunits C and D Back     alignment and domain information
>PRK11308 dppF dipeptide transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK14259 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK09473 oppD oligopeptide transporter ATP-binding component; Provisional Back     alignment and domain information
>PRK14269 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14250 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03299 ABC_ModC_like Archeal protein closely related to ModC Back     alignment and domain information
>PRK14256 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR02868 CydC thiol reductant ABC exporter, CydC subunit Back     alignment and domain information
>PRK13547 hmuV hemin importer ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13640 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13645 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13549 xylose transporter ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR02142 modC_ABC molybdenum ABC transporter, ATP-binding protein Back     alignment and domain information
>PRK13648 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03297 ABC_ModC_molybdenum_transporter ModC is an ABC-type transporter and the ATPase component of a molybdate transport system that also includes the periplasmic binding protein ModA and the membrane protein ModB Back     alignment and domain information
>PRK10247 putative ABC transporter ATP-binding protein YbbL; Provisional Back     alignment and domain information
>cd03230 ABC_DR_subfamily_A This family of ATP-binding proteins belongs to a multisubunit transporter involved in drug resistance (BcrA and DrrA), nodulation, lipid transport, and lantibiotic immunity Back     alignment and domain information
>TIGR02324 CP_lyasePhnL phosphonate C-P lyase system protein PhnL Back     alignment and domain information
>PRK15093 antimicrobial peptide ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>COG0444 DppD ABC-type dipeptide/oligopeptide/nickel transport system, ATPase component [Amino acid transport and metabolism / Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK15112 antimicrobial peptide ABC system ATP-binding protein SapF; Provisional Back     alignment and domain information
>PRK11144 modC molybdate transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK13633 cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>KOG0055 consensus Multidrug/pheromone exporter, ABC superfamily [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PRK14260 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK10771 thiQ thiamine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK14240 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14274 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14270 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14239 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14262 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03220 ABC_KpsT_Wzt ABC_KpsT_Wzt The KpsT/Wzt ABC transporter subfamily is involved in extracellular polysaccharide export Back     alignment and domain information
>PRK13642 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>COG4175 ProV ABC-type proline/glycine betaine transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>PRK13541 cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>PRK14244 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14253 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK10762 D-ribose transporter ATP binding protein; Provisional Back     alignment and domain information
>PRK15056 manganese/iron transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14236 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>COG4619 ABC-type uncharacterized transport system, ATPase component [General function prediction only] Back     alignment and domain information
>PRK14254 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14249 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14271 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03229 ABC_Class3 This class is comprised of all BPD (Binding Protein Dependent) systems that are largely represented in archaea and eubacteria and are primarily involved in scavenging solutes from the environment Back     alignment and domain information
>PRK14258 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14272 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR02770 nickel_nikD nickel import ATP-binding protein NikD Back     alignment and domain information
>PRK14261 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14263 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK10418 nikD nickel transporter ATP-binding protein NikD; Provisional Back     alignment and domain information
>PRK14257 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14251 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK11701 phnK phosphonate C-P lyase system protein PhnK; Provisional Back     alignment and domain information
>PRK11174 cysteine/glutathione ABC transporter membrane/ATP-binding component; Reviewed Back     alignment and domain information
>PRK09700 D-allose transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14248 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14275 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>COG4987 CydC ABC-type transport system involved in cytochrome bd biosynthesis, fused ATPase and permease components [Energy production and conversion / Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK14255 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>COG4161 ArtP ABC-type arginine transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR02633 xylG D-xylose ABC transporter, ATP-binding protein Back     alignment and domain information
>PRK11288 araG L-arabinose transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK15439 autoinducer 2 ABC transporter ATP-binding protein LsrA; Provisional Back     alignment and domain information
>cd03215 ABC_Carb_Monos_II This family represents domain II of the carbohydrate uptake proteins that transport only monosaccharides (Monos) Back     alignment and domain information
>PRK14265 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK10419 nikE nickel transporter ATP-binding protein NikE; Provisional Back     alignment and domain information
>cd03245 ABCC_bacteriocin_exporters ABC-type bacteriocin exporters Back     alignment and domain information
>PRK14238 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14243 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03252 ABCC_Hemolysin The ABC-transporter hemolysin B is a central component of the secretion machinery that translocates the toxin, hemolysin A, in a Sec-independent fashion across both membranes of E Back     alignment and domain information
>PRK14246 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>CHL00131 ycf16 sulfate ABC transporter protein; Validated Back     alignment and domain information
>PRK14266 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR02323 CP_lyasePhnK phosphonate C-P lyase system protein PhnK Back     alignment and domain information
>cd03246 ABCC_Protease_Secretion This family represents the ABC component of the protease secretion system PrtD, a 60-kDa integral membrane protein sharing 37% identity with HlyB, the ABC component of the alpha-hemolysin secretion pathway, in the C-terminal domain Back     alignment and domain information
>PRK09544 znuC high-affinity zinc transporter ATPase; Reviewed Back     alignment and domain information
>PRK10982 galactose/methyl galaxtoside transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03248 ABCC_TAP TAP, the Transporter Associated with Antigen Processing; TAP is essential for peptide delivery from the cytosol into the lumen of the endoplasmic reticulum (ER), where these peptides are loaded on major histocompatibility complex (MHC) I molecules Back     alignment and domain information
>cd03251 ABCC_MsbA MsbA is an essential ABC transporter, closely related to eukaryotic MDR proteins Back     alignment and domain information
>PRK11176 lipid transporter ATP-binding/permease protein; Provisional Back     alignment and domain information
>PRK14264 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR03797 NHPM_micro_ABC2 NHPM bacteriocin system ABC transporter, ATP-binding protein Back     alignment and domain information
>PRK09580 sufC cysteine desulfurase ATPase component; Reviewed Back     alignment and domain information
>PRK10790 putative multidrug transporter membrane\ATP-binding components; Provisional Back     alignment and domain information
>PRK03695 vitamin B12-transporter ATPase; Provisional Back     alignment and domain information
>COG1129 MglA ABC-type sugar transport system, ATPase component [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK14252 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK11160 cysteine/glutathione ABC transporter membrane/ATP-binding component; Reviewed Back     alignment and domain information
>COG1123 ATPase components of various ABC-type transport systems, contain duplicated ATPase [General function prediction only] Back     alignment and domain information
>cd03254 ABCC_Glucan_exporter_like Glucan exporter ATP-binding protein Back     alignment and domain information
>cd03249 ABC_MTABC3_MDL1_MDL2 MTABC3 (also known as ABCB6) is a mitochondrial ATP-binding cassette protein involved in iron homeostasis and one of four ABC transporters expressed in the mitochondrial inner membrane, the other three being MDL1(ABC7), MDL2, and ATM1 Back     alignment and domain information
>TIGR02857 CydD thiol reductant ABC exporter, CydD subunit Back     alignment and domain information
>TIGR03269 met_CoM_red_A2 methyl coenzyme M reductase system, component A2 Back     alignment and domain information
>PRK13545 tagH teichoic acids export protein ATP-binding subunit; Provisional Back     alignment and domain information
>cd03289 ABCC_CFTR2 The CFTR subfamily domain 2 Back     alignment and domain information
>COG4136 ABC-type uncharacterized transport system, ATPase component [General function prediction only] Back     alignment and domain information
>COG4618 ArpD ABC-type protease/lipase transport system, ATPase and permease components [General function prediction only] Back     alignment and domain information
>PRK13546 teichoic acids export protein ATP-binding subunit; Provisional Back     alignment and domain information
>COG1132 MdlB ABC-type multidrug transport system, ATPase and permease components [Defense mechanisms] Back     alignment and domain information
>cd03217 ABC_FeS_Assembly ABC-type transport system involved in Fe-S cluster assembly, ATPase component Back     alignment and domain information
>TIGR03796 NHPM_micro_ABC1 NHPM bacteriocin system ABC transporter, peptidase/ATP-binding protein Back     alignment and domain information
>cd03247 ABCC_cytochrome_bd The CYD subfamily implicated in cytochrome bd biogenesis Back     alignment and domain information
>cd03253 ABCC_ATM1_transporter ATM1 is an ABC transporter that is expressed in the mitochondria Back     alignment and domain information
>COG1119 ModF ABC-type molybdenum transport system, ATPase component/photorepair protein PhrA [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK10261 glutathione transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03223 ABCD_peroxisomal_ALDP Peroxisomal ATP-binding cassette transporter (Pat) is involved in the import of very long-chain fatty acids (VLCFA) into the peroxisome Back     alignment and domain information
>TIGR01193 bacteriocin_ABC ABC-type bacteriocin transporter Back     alignment and domain information
>COG4604 CeuD ABC-type enterochelin transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK15134 microcin C ABC transporter ATP-binding protein YejF; Provisional Back     alignment and domain information
>TIGR00958 3a01208 Conjugate Transporter-2 (CT2) Family protein Back     alignment and domain information
>COG3845 ABC-type uncharacterized transport systems, ATPase components [General function prediction only] Back     alignment and domain information
>TIGR03375 type_I_sec_LssB type I secretion system ATPase, LssB family Back     alignment and domain information
>TIGR01842 type_I_sec_PrtD type I secretion system ABC transporter, PrtD family Back     alignment and domain information
>cd03244 ABCC_MRP_domain2 Domain 2 of the ABC subfamily C Back     alignment and domain information
>PRK00349 uvrA excinuclease ABC subunit A; Reviewed Back     alignment and domain information
>cd03290 ABCC_SUR1_N The SUR domain 1 Back     alignment and domain information
>PRK13657 cyclic beta-1,2-glucan ABC transporter; Provisional Back     alignment and domain information
>cd03214 ABC_Iron-Siderophores_B12_Hemin ABC transporters, involved in the uptake of siderophores, heme, and vitamin B12, are widely conserved in bacteria and archaea Back     alignment and domain information
>cd03250 ABCC_MRP_domain1 Domain 1 of the ABC subfamily C Back     alignment and domain information
>KOG0056 consensus Heavy metal exporter HMT1, ABC superfamily [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK00635 excinuclease ABC subunit A; Provisional Back     alignment and domain information
>TIGR02203 MsbA_lipidA lipid A export permease/ATP-binding protein MsbA Back     alignment and domain information
>cd03228 ABCC_MRP_Like The MRP (Mutidrug Resistance Protein)-like transporters are involved in drug, peptide, and lipid export Back     alignment and domain information
>cd03216 ABC_Carb_Monos_I This family represents the domain I of the carbohydrate uptake proteins that transport only monosaccharides (Monos) Back     alignment and domain information
>KOG0058 consensus Peptide exporter, ABC superfamily [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>TIGR03771 anch_rpt_ABC anchored repeat-type ABC transporter, ATP-binding subunit Back     alignment and domain information
>COG4133 CcmA ABC-type transport system involved in cytochrome c biogenesis, ATPase component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG0396 sufC Cysteine desulfurase activator ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR01846 type_I_sec_HlyB type I secretion system ABC transporter, HlyB family Back     alignment and domain information
>cd03369 ABCC_NFT1 Domain 2 of NFT1 (New full-length MRP-type transporter 1) Back     alignment and domain information
>COG4148 ModC ABC-type molybdate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK10789 putative multidrug transporter membrane\ATP-binding components; Provisional Back     alignment and domain information
>TIGR02204 MsbA_rel ABC transporter, permease/ATP-binding protein Back     alignment and domain information
>PRK10938 putative molybdenum transport ATP-binding protein ModF; Provisional Back     alignment and domain information
>TIGR01192 chvA glucan exporter ATP-binding protein Back     alignment and domain information
>PRK10535 macrolide transporter ATP-binding /permease protein; Provisional Back     alignment and domain information
>cd03288 ABCC_SUR2 The SUR domain 2 Back     alignment and domain information
>cd03237 ABC_RNaseL_inhibitor_domain2 The ATPase domain 2 of RNase L inhibitor Back     alignment and domain information
>PRK10522 multidrug transporter membrane component/ATP-binding component; Provisional Back     alignment and domain information
>TIGR00630 uvra excinuclease ABC, A subunit Back     alignment and domain information
>COG1135 AbcC ABC-type metal ion transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>TIGR01187 potA spermidine/putrescine ABC transporter ATP-binding subunit Back     alignment and domain information
>KOG0059 consensus Lipid exporter ABCA1 and related proteins, ABC superfamily [Lipid transport and metabolism; General function prediction only] Back     alignment and domain information
>COG4674 Uncharacterized ABC-type transport system, ATPase component [General function prediction only] Back     alignment and domain information
>COG1126 GlnQ ABC-type polar amino acid transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>cd03291 ABCC_CFTR1 The CFTR subfamily domain 1 Back     alignment and domain information
>TIGR01194 cyc_pep_trnsptr cyclic peptide transporter Back     alignment and domain information
>COG1131 CcmA ABC-type multidrug transport system, ATPase component [Defense mechanisms] Back     alignment and domain information
>PTZ00265 multidrug resistance protein (mdr1); Provisional Back     alignment and domain information
>PRK15064 ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK11819 putative ABC transporter ATP-binding protein; Reviewed Back     alignment and domain information
>cd03236 ABC_RNaseL_inhibitor_domain1 The ATPase domain 1 of RNase L inhibitor Back     alignment and domain information
>PRK15177 Vi polysaccharide export ATP-binding protein VexC; Provisional Back     alignment and domain information
>TIGR00954 3a01203 Peroxysomal Fatty Acyl CoA Transporter (FAT) Family protei Back     alignment and domain information
>cd03221 ABCF_EF-3 ABCF_EF-3 Elongation factor 3 (EF-3) is a cytosolic protein required by fungal ribosomes for in vitro protein synthesis and for in vivo growth Back     alignment and domain information
>COG1125 OpuBA ABC-type proline/glycine betaine transport systems, ATPase components [Amino acid transport and metabolism] Back     alignment and domain information
>cd03238 ABC_UvrA The excision repair protein UvrA; Nucleotide excision repair in eubacteria is a process that repairs DNA damage by the removal of a 12-13-mer oligonucleotide containing the lesion Back     alignment and domain information
>cd03222 ABC_RNaseL_inhibitor The ABC ATPase RNase L inhibitor (RLI) is a key enzyme in ribosomal biogenesis, formation of translation preinitiation complexes, and assembly of HIV capsids Back     alignment and domain information
>TIGR03719 ABC_ABC_ChvD ATP-binding cassette protein, ChvD family Back     alignment and domain information
>KOG0927 consensus Predicted transporter (ABC superfamily) [General function prediction only] Back     alignment and domain information
>COG1101 PhnK ABC-type uncharacterized transport system, ATPase component [General function prediction only] Back     alignment and domain information
>COG4608 AppF ABC-type oligopeptide transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>KOG0057 consensus Mitochondrial Fe/S cluster exporter, ABC superfamily [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>COG5265 ATM1 ABC-type transport system involved in Fe-S cluster assembly, permease and ATPase components [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG4586 ABC-type uncharacterized transport system, ATPase component [General function prediction only] Back     alignment and domain information
>COG4172 ABC-type uncharacterized transport system, duplicated ATPase component [General function prediction only] Back     alignment and domain information
>COG3839 MalK ABC-type sugar transport systems, ATPase components [Carbohydrate transport and metabolism] Back     alignment and domain information
>COG2274 SunT ABC-type bacteriocin/lantibiotic exporters, contain an N-terminal double-glycine peptidase domain [Defense mechanisms] Back     alignment and domain information
>COG4555 NatA ABC-type Na+ transport system, ATPase component [Energy production and conversion / Inorganic ion transport and metabolism] Back     alignment and domain information
>COG1118 CysA ABC-type sulfate/molybdate transport systems, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>cd00267 ABC_ATPase ABC (ATP-binding cassette) transporter nucleotide-binding domain; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules Back     alignment and domain information
>COG1127 Ttg2A ABC-type transport system involved in resistance to organic solvents, ATPase component [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>PRK13409 putative ATPase RIL; Provisional Back     alignment and domain information
>PRK10636 putative ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PLN03232 ABC transporter C family member; Provisional Back     alignment and domain information
>PLN03130 ABC transporter C family member; Provisional Back     alignment and domain information
>COG3638 ABC-type phosphate/phosphonate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>COG1116 TauB ABC-type nitrate/sulfonate/bicarbonate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>PF00005 ABC_tran: ABC transporter This structure is on hold until Dec 1999; InterPro: IPR003439 ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energise diverse biological systems Back     alignment and domain information
>COG3842 PotA ABC-type spermidine/putrescine transport systems, ATPase components [Amino acid transport and metabolism] Back     alignment and domain information
>COG1134 TagH ABC-type polysaccharide/polyol phosphate transport system, ATPase component [Carbohydrate transport and metabolism / Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>COG4778 PhnL ABC-type phosphonate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>KOG0056 consensus Heavy metal exporter HMT1, ABC superfamily [Inorganic ion transport and metabolism] Back     alignment and domain information
>COG5265 ATM1 ABC-type transport system involved in Fe-S cluster assembly, permease and ATPase components [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK11147 ABC transporter ATPase component; Reviewed Back     alignment and domain information
>COG1120 FepC ABC-type cobalamin/Fe3+-siderophores transport systems, ATPase components [Inorganic ion transport and metabolism / Coenzyme metabolism] Back     alignment and domain information
>COG0488 Uup ATPase components of ABC transporters with duplicated ATPase domains [General function prediction only] Back     alignment and domain information
>PRK11174 cysteine/glutathione ABC transporter membrane/ATP-binding component; Reviewed Back     alignment and domain information
>COG1117 PstB ABC-type phosphate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>TIGR01186 proV glycine betaine/L-proline transport ATP binding subunit Back     alignment and domain information
>COG4988 CydD ABC-type transport system involved in cytochrome bd biosynthesis, ATPase and permease components [Energy production and conversion / Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK11650 ugpC glycerol-3-phosphate transporter ATP-binding subunit; Provisional Back     alignment and domain information
>COG4107 PhnK ABC-type phosphonate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>TIGR03265 PhnT2 putative 2-aminoethylphosphonate ABC transporter, ATP-binding protein Back     alignment and domain information
>COG3840 ThiQ ABC-type thiamine transport system, ATPase component [Coenzyme metabolism] Back     alignment and domain information
>COG1132 MdlB ABC-type multidrug transport system, ATPase and permease components [Defense mechanisms] Back     alignment and domain information
>TIGR02314 ABC_MetN D-methionine ABC transporter, ATP-binding protein Back     alignment and domain information
>PRK11432 fbpC ferric transporter ATP-binding subunit; Provisional Back     alignment and domain information
>COG1121 ZnuC ABC-type Mn/Zn transport systems, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK13537 nodulation ABC transporter NodI; Provisional Back     alignment and domain information
>TIGR03258 PhnT 2-aminoethylphosphonate ABC transport system, ATP-binding component PhnT Back     alignment and domain information
>PRK09452 potA putrescine/spermidine ABC transporter ATPase protein; Reviewed Back     alignment and domain information
>TIGR00957 MRP_assoc_pro multi drug resistance-associated protein (MRP) Back     alignment and domain information
>PRK11607 potG putrescine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK10851 sulfate/thiosulfate transporter subunit; Provisional Back     alignment and domain information
>TIGR01188 drrA daunorubicin resistance ABC transporter ATP-binding subunit Back     alignment and domain information
>COG1136 SalX ABC-type antimicrobial peptide transport system, ATPase component [Defense mechanisms] Back     alignment and domain information
>TIGR01271 CFTR_protein cystic fibrosis transmembrane conductor regulator (CFTR) Back     alignment and domain information
>TIGR03797 NHPM_micro_ABC2 NHPM bacteriocin system ABC transporter, ATP-binding protein Back     alignment and domain information
>COG1245 Predicted ATPase, RNase L inhibitor (RLI) homolog [General function prediction only] Back     alignment and domain information
>cd03261 ABC_Org_Solvent_Resistant ABC (ATP-binding cassette) transport system involved in resistant to organic solvents; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules Back     alignment and domain information
>COG1122 CbiO ABC-type cobalt transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK13536 nodulation factor exporter subunit NodI; Provisional Back     alignment and domain information
>PRK10790 putative multidrug transporter membrane\ATP-binding components; Provisional Back     alignment and domain information
>PRK11000 maltose/maltodextrin transporter ATP-binding protein; Provisional Back     alignment and domain information
>COG0410 LivF ABC-type branched-chain amino acid transport systems, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>COG1124 DppF ABC-type dipeptide/oligopeptide/nickel transport system, ATPase component [Amino acid transport and metabolism / Inorganic ion transport and metabolism] Back     alignment and domain information
>cd03270 ABC_UvrA_I The excision repair protein UvrA domain I; Nucleotide excision repair in eubacteria is a process that repairs DNA damage by the removal of a 12-13-mer oligonucleotide containing the lesion Back     alignment and domain information
>PRK11153 metN DL-methionine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03234 ABCG_White The White subfamily represents ABC transporters homologous to the Drosophila white gene, which acts as a dimeric importer for eye pigment precursors Back     alignment and domain information
>COG4167 SapF ABC-type antimicrobial peptide transport system, ATPase component [Defense mechanisms] Back     alignment and domain information
>TIGR01187 potA spermidine/putrescine ABC transporter ATP-binding subunit Back     alignment and domain information
>TIGR03796 NHPM_micro_ABC1 NHPM bacteriocin system ABC transporter, peptidase/ATP-binding protein Back     alignment and domain information
>TIGR03375 type_I_sec_LssB type I secretion system ATPase, LssB family Back     alignment and domain information
>PRK11176 lipid transporter ATP-binding/permease protein; Provisional Back     alignment and domain information
>COG4148 ModC ABC-type molybdate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>PLN03073 ABC transporter F family; Provisional Back     alignment and domain information
>PRK10070 glycine betaine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR03522 GldA_ABC_ATP gliding motility-associated ABC transporter ATP-binding subunit GldA Back     alignment and domain information
>PRK11144 modC molybdate transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK11160 cysteine/glutathione ABC transporter membrane/ATP-binding component; Reviewed Back     alignment and domain information
>COG1137 YhbG ABC-type (unclassified) transport system, ATPase component [General function prediction only] Back     alignment and domain information
>TIGR01288 nodI ATP-binding ABC transporter family nodulation protein NodI Back     alignment and domain information
>cd03296 ABC_CysA_sulfate_importer Part of the ABC transporter complex cysAWTP involved in sulfate import Back     alignment and domain information
>PTZ00243 ABC transporter; Provisional Back     alignment and domain information
>COG4175 ProV ABC-type proline/glycine betaine transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>cd03294 ABC_Pro_Gly_Bertaine This family comprises the glycine betaine/L-proline ATP binding subunit in bacteria and its equivalents in archaea Back     alignment and domain information
>cd03278 ABC_SMC_barmotin Barmotin is a tight junction-associated protein expressed in rat epithelial cells which is thought to have an important regulatory role in tight junction barrier function Back     alignment and domain information
>cd03265 ABC_DrrA DrrA is the ATP-binding protein component of a bacterial exporter complex that confers resistance to the antibiotics daunorubicin and doxorubicin Back     alignment and domain information
>COG4618 ArpD ABC-type protease/lipase transport system, ATPase and permease components [General function prediction only] Back     alignment and domain information
>TIGR00958 3a01208 Conjugate Transporter-2 (CT2) Family protein Back     alignment and domain information
>TIGR01193 bacteriocin_ABC ABC-type bacteriocin transporter Back     alignment and domain information
>cd03218 ABC_YhbG The ABC transporters belonging to the YhbG family are similar to members of the Mj1267_LivG family, which is involved in the transport of branched-chain amino acids Back     alignment and domain information
>cd03219 ABC_Mj1267_LivG_branched The Mj1267/LivG ABC transporter subfamily is involved in the transport of the hydrophobic amino acids leucine, isoleucine and valine Back     alignment and domain information
>cd03259 ABC_Carb_Solutes_like ABC Carbohydrate and Solute Transporters-like subgroup Back     alignment and domain information
>TIGR02142 modC_ABC molybdenum ABC transporter, ATP-binding protein Back     alignment and domain information
>TIGR03415 ABC_choXWV_ATP choline ABC transporter, ATP-binding protein Back     alignment and domain information
>cd03301 ABC_MalK_N The N-terminal ATPase domain of the maltose transporter, MalK Back     alignment and domain information
>cd03258 ABC_MetN_methionine_transporter MetN (also known as YusC) is an ABC-type transporter encoded by metN of the metNPQ operon in Bacillus subtilis that is involved in methionine transport Back     alignment and domain information
>PRK13637 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03293 ABC_NrtD_SsuB_transporters NrtD and SsuB are the ATP-binding subunits of the bacterial ABC-type nitrate and sulfonate transport systems, respectively Back     alignment and domain information
>cd03260 ABC_PstB_phosphate_transporter Phosphate uptake is of fundamental importance in the cell physiology of bacteria because phosphate is required as a nutrient Back     alignment and domain information
>cd03256 ABC_PhnC_transporter ABC-type phosphate/phosphonate transport system Back     alignment and domain information
>PRK09473 oppD oligopeptide transporter ATP-binding component; Provisional Back     alignment and domain information
>KOG0054 consensus Multidrug resistance-associated protein/mitoxantrone resistance protein, ABC superfamily [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PRK15079 oligopeptide ABC transporter ATP-binding protein OppF; Provisional Back     alignment and domain information
>COG0411 LivG ABC-type branched-chain amino acid transport systems, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>PRK13634 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13643 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03295 ABC_OpuCA_Osmoprotection OpuCA is a the ATP binding component of a bacterial solute transporter that serves a protective role to cells growing in a hyperosmolar environment Back     alignment and domain information
>PRK13631 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK14257 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03263 ABC_subfamily_A The ABCA subfamily mediates the transport of a variety of lipid compounds Back     alignment and domain information
>cd03269 ABC_putative_ATPase This subfamily is involved in drug resistance, nodulation, lipid transport, and bacteriocin and lantibiotic immunity Back     alignment and domain information
>PRK09536 btuD corrinoid ABC transporter ATPase; Reviewed Back     alignment and domain information
>cd03224 ABC_TM1139_LivF_branched LivF (TM1139) is part of the LIV-I bacterial ABC-type two-component transport system that imports neutral, branched-chain amino acids Back     alignment and domain information
>cd03264 ABC_drug_resistance_like ABC-type multidrug transport system, ATPase component Back     alignment and domain information
>cd03268 ABC_BcrA_bacitracin_resist The BcrA subfamily represents ABC transporters involved in peptide antibiotic resistance Back     alignment and domain information
>TIGR00960 3a0501s02 Type II (General) Secretory Pathway (IISP) Family protein Back     alignment and domain information
>cd03266 ABC_NatA_sodium_exporter NatA is the ATPase component of a bacterial ABC-type Na+ transport system called NatAB, which catalyzes ATP-dependent electrogenic Na+ extrusion without mechanically coupled proton or K+ uptake Back     alignment and domain information
>TIGR00972 3a0107s01c2 phosphate ABC transporter, ATP-binding protein Back     alignment and domain information
>PRK11629 lolD lipoprotein transporter ATP-binding subunit; Provisional Back     alignment and domain information
>COG2884 FtsE Predicted ATPase involved in cell division [Cell division and chromosome partitioning] Back     alignment and domain information
>cd03271 ABC_UvrA_II The excision repair protein UvrA domain II; Nucleotide excision repair in eubacteria is a process that repairs DNA damage by the removal of a 12-13-mer oligonucleotide containing the lesion Back     alignment and domain information
>PRK13657 cyclic beta-1,2-glucan ABC transporter; Provisional Back     alignment and domain information
>PRK13647 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK11264 putative amino-acid ABC transporter ATP-binding protein YecC; Provisional Back     alignment and domain information
>cd03233 ABC_PDR_domain1 The pleiotropic drug resistance (PDR) family of ATP-binding cassette (ABC) transporters Back     alignment and domain information
>PRK11831 putative ABC transporter ATP-binding protein YrbF; Provisional Back     alignment and domain information
>cd03255 ABC_MJ0796_Lo1CDE_FtsE This family is comprised of MJ0796 ATP-binding cassette, macrolide-specific ABC-type efflux carrier (MacAB), and proteins involved in cell division (FtsE), and release of liporoteins from the cytoplasmic membrane (LolCDE) Back     alignment and domain information
>TIGR01846 type_I_sec_HlyB type I secretion system ABC transporter, HlyB family Back     alignment and domain information
>KOG0059 consensus Lipid exporter ABCA1 and related proteins, ABC superfamily [Lipid transport and metabolism; General function prediction only] Back     alignment and domain information
>TIGR02315 ABC_phnC phosphonate ABC transporter, ATP-binding protein Back     alignment and domain information
>cd03299 ABC_ModC_like Archeal protein closely related to ModC Back     alignment and domain information
>TIGR02203 MsbA_lipidA lipid A export permease/ATP-binding protein MsbA Back     alignment and domain information
>TIGR01842 type_I_sec_PrtD type I secretion system ABC transporter, PrtD family Back     alignment and domain information
>PRK09493 glnQ glutamine ABC transporter ATP-binding protein; Reviewed Back     alignment and domain information
>cd03298 ABC_ThiQ_thiamine_transporter ABC-type thiamine tranport system; part of the binding-protein-dependent transport system tbpA-thiPQ for thiamine and TPP Back     alignment and domain information
>TIGR01184 ntrCD nitrate transport ATP-binding subunits C and D Back     alignment and domain information
>TIGR03864 PQQ_ABC_ATP ABC transporter, ATP-binding subunit, PQQ-dependent alcohol dehydrogenase system Back     alignment and domain information
>PRK13650 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>COG0444 DppD ABC-type dipeptide/oligopeptide/nickel transport system, ATPase component [Amino acid transport and metabolism / Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK13646 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13635 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK11308 dppF dipeptide transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13636 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR02770 nickel_nikD nickel import ATP-binding protein NikD Back     alignment and domain information
>PRK11022 dppD dipeptide transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03226 ABC_cobalt_CbiO_domain2 Domain II of the ABC component of a cobalt transport family found in bacteria, archaea, and eukaryota Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query1230
2it1_A362 Structure Of Ph0203 Protein From Pyrococcus Horikos 3e-07
4hlu_D268 Structure Of The Ecfa-a' Heterodimer Bound To Adp L 4e-07
2pmk_A243 Crystal Structures Of An Isolated Abc-Atpase In Com 2e-06
1mt0_A241 Atp-Binding Domain Of Haemolysin B From Escherichia 2e-06
2ff7_A247 The Abc-Atpase Of The Abc-Transporter Hlyb In The A 2e-06
3b5j_A243 Crystal Structures Of The S504a Mutant Of An Isolat 3e-06
3b5w_A582 Crystal Structure Of Eschericia Coli Msba Length = 3e-06
3b5w_A582 Crystal Structure Of Eschericia Coli Msba Length = 9e-04
2yyz_A359 Crystal Structure Of Sugar Abc Transporter, Atp-Bin 3e-06
3fvq_A359 Crystal Structure Of The Nucleotide Binding Domain 5e-06
2ffb_A247 The Crystal Structure Of The Hlyb-Nbd E631q Mutant 6e-06
3b5y_A582 Crystal Structure Of Msba From Salmonella Typhimuri 6e-06
3g5u_A 1284 Structure Of P-Glycoprotein Reveals A Molecular Bas 6e-06
1xef_A241 Crystal Structure Of The AtpMG2+ BOUND COMPOSITE DI 6e-06
2ffa_A247 Crystal Structure Of Abc-Atpase H662a Of The Abc-Tr 6e-06
3g60_A 1284 Structure Of P-Glycoprotein Reveals A Molecular Bas 7e-06
4ayt_A595 Structure Of The Human Mitochondrial Abc Transporte 3e-05
4ayw_A619 Structure Of The Human Mitochondrial Abc Transporte 3e-05
3b5x_A582 Crystal Structure Of Msba From Vibrio Cholerae Leng 4e-05
3b5x_A582 Crystal Structure Of Msba From Vibrio Cholerae Leng 4e-04
1v43_A372 Crystal Structure Of Atpase Subunit Of Abc Sugar Tr 4e-05
1vci_A373 Crystal Structure Of The Atp-binding Cassette Of Mu 4e-05
3dhw_C343 Crystal Structure Of Methionine Importer Metni Leng 6e-05
1z47_A355 Structure Of The Atpase Subunit Cysa Of The Putativ 6e-05
1mv5_A243 Crystal Structure Of Lmra Atp-Binding Domain Length 1e-04
1g29_1372 Malk Length = 372 1e-04
3qf4_A587 Crystal Structure Of A Heterodimeric Abc Transporte 2e-04
3tui_C366 Inward Facing Conformations Of The Metni Methionine 2e-04
3tuj_C366 Inward Facing Conformations Of The Metni Methionine 2e-04
2ghi_A260 Crystal Structure Of Plasmodium Yoelii Multidrug Re 3e-04
3c41_J242 Abc Protein Artp In Complex With Amp-PnpMG2+ Length 5e-04
2d62_A375 Crystal Structure Of Multiple Sugar Binding Transpo 6e-04
3qf4_B598 Crystal Structure Of A Heterodimeric Abc Transporte 7e-04
2hyd_A578 Multidrug Abc Transporter Sav1866 Length = 578 8e-04
>pdb|2IT1|A Chain A, Structure Of Ph0203 Protein From Pyrococcus Horikoshii Length = 362 Back     alignment and structure 
Iteration: 1

 Score = 55.1 bits (131), Expect = 3e-07,   Method: Composition-based stats.
 Identities = 48/162 (29%), Positives = 76/162 (46%), Gaps = 21/162 (12%)
Query: 689 LNGVSGAFRPGVLTALMGVTGSGKTTLMDVLAG--RKTRG--YITGNITISGYPKNQETF 744
           LN ++   + G   AL+G +GSGK+TL+  +AG  + T G  Y          PK++   
Sbjct: 19  LNNINLKIKDGEFMALLGPSGSGKSTLLYTIAGIYKPTSGKIYFDEKDVTELPPKDRNV- 77
Query: 745 TRISGYCEQNDIHSPYVTVYESLLYSAWLRLS--SEVNSKTRXXXXXXXXXXXXXNPLRQ 802
               G   QN    P++TVY+++ +   LR +   E++ K R               + +
Sbjct: 78  ----GLVFQNWALYPHMTVYKNIAFPLELRKAPREEIDKKVREVAKMLH--------IDK 125
Query: 803 ALVGLPGVNGLSTEQRKRLTIAVELVANPSIIFMDEPTSGLD 844
            L   P    LS  Q++R+ IA  LV  P ++ +DEP S LD
Sbjct: 126 LLNRYPW--QLSGGQQQRVAIARALVKEPEVLLLDEPLSNLD 165
>pdb|4HLU|D Chain D, Structure Of The Ecfa-a' Heterodimer Bound To Adp Length = 268 Back     alignment and structure
>pdb|2PMK|A Chain A, Crystal Structures Of An Isolated Abc-Atpase In Complex With Tnp-Adp Length = 243 Back     alignment and structure
>pdb|1MT0|A Chain A, Atp-Binding Domain Of Haemolysin B From Escherichia Coli Length = 241 Back     alignment and structure
>pdb|2FF7|A Chain A, The Abc-Atpase Of The Abc-Transporter Hlyb In The Adp Bound State Length = 247 Back     alignment and structure
>pdb|3B5J|A Chain A, Crystal Structures Of The S504a Mutant Of An Isolated Abc-atpase In Complex With Tnp-adp Length = 243 Back     alignment and structure
>pdb|3B5W|A Chain A, Crystal Structure Of Eschericia Coli Msba Length = 582 Back     alignment and structure
>pdb|3B5W|A Chain A, Crystal Structure Of Eschericia Coli Msba Length = 582 Back     alignment and structure
>pdb|2YYZ|A Chain A, Crystal Structure Of Sugar Abc Transporter, Atp-Binding Protein Length = 359 Back     alignment and structure
>pdb|3FVQ|A Chain A, Crystal Structure Of The Nucleotide Binding Domain Fbpc Complexed With Atp Length = 359 Back     alignment and structure
>pdb|2FFB|A Chain A, The Crystal Structure Of The Hlyb-Nbd E631q Mutant In Complex With Adp Length = 247 Back     alignment and structure
>pdb|3B5Y|A Chain A, Crystal Structure Of Msba From Salmonella Typhimurium With Amppnp Length = 582 Back     alignment and structure
>pdb|3G5U|A Chain A, Structure Of P-Glycoprotein Reveals A Molecular Basis For Poly-Specific Drug Binding Length = 1284 Back     alignment and structure
>pdb|1XEF|A Chain A, Crystal Structure Of The AtpMG2+ BOUND COMPOSITE DIMER OF HLYB-Nbd Length = 241 Back     alignment and structure
>pdb|2FFA|A Chain A, Crystal Structure Of Abc-Atpase H662a Of The Abc-Transporter Hlyb In Complex With Adp Length = 247 Back     alignment and structure
>pdb|3G60|A Chain A, Structure Of P-Glycoprotein Reveals A Molecular Basis For Poly-Specific Drug Binding Length = 1284 Back     alignment and structure
>pdb|4AYT|A Chain A, Structure Of The Human Mitochondrial Abc Transporter, Abcb10 Length = 595 Back     alignment and structure
>pdb|4AYW|A Chain A, Structure Of The Human Mitochondrial Abc Transporter, Abcb10 (plate Form) Length = 619 Back     alignment and structure
>pdb|3B5X|A Chain A, Crystal Structure Of Msba From Vibrio Cholerae Length = 582 Back     alignment and structure
>pdb|3B5X|A Chain A, Crystal Structure Of Msba From Vibrio Cholerae Length = 582 Back     alignment and structure
>pdb|1V43|A Chain A, Crystal Structure Of Atpase Subunit Of Abc Sugar Transporter Length = 372 Back     alignment and structure
>pdb|1VCI|A Chain A, Crystal Structure Of The Atp-binding Cassette Of Multisugar Transporter From Pyrococcus Horikoshii Ot3 Complexed With Atp Length = 373 Back     alignment and structure
>pdb|3DHW|C Chain C, Crystal Structure Of Methionine Importer Metni Length = 343 Back     alignment and structure
>pdb|1Z47|A Chain A, Structure Of The Atpase Subunit Cysa Of The Putative Sulfate Atp-Binding Cassette (Abc) Transporter From Alicyclobacillus Acidocaldarius Length = 355 Back     alignment and structure
>pdb|1MV5|A Chain A, Crystal Structure Of Lmra Atp-Binding Domain Length = 243 Back     alignment and structure
>pdb|1G29|1 Chain 1, Malk Length = 372 Back     alignment and structure
>pdb|3QF4|A Chain A, Crystal Structure Of A Heterodimeric Abc Transporter In Its Inward- Facing Conformation Length = 587 Back     alignment and structure
>pdb|3TUI|C Chain C, Inward Facing Conformations Of The Metni Methionine Abc Transporter: Cy5 Native Crystal Form Length = 366 Back     alignment and structure
>pdb|3TUJ|C Chain C, Inward Facing Conformations Of The Metni Methionine Abc Transporter: Dm Crystal Form Length = 366 Back     alignment and structure
>pdb|2GHI|A Chain A, Crystal Structure Of Plasmodium Yoelii Multidrug Resistance Protein 2 Length = 260 Back     alignment and structure
>pdb|3C41|J Chain J, Abc Protein Artp In Complex With Amp-PnpMG2+ Length = 242 Back     alignment and structure
>pdb|2D62|A Chain A, Crystal Structure Of Multiple Sugar Binding Transport Atp- Binding Protein Length = 375 Back     alignment and structure
>pdb|3QF4|B Chain B, Crystal Structure Of A Heterodimeric Abc Transporter In Its Inward- Facing Conformation Length = 598 Back     alignment and structure
>pdb|2HYD|A Chain A, Multidrug Abc Transporter Sav1866 Length = 578 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query1230
1vpl_A256 ABC transporter, ATP-binding protein; TM0544, stru 2e-24
1vpl_A256 ABC transporter, ATP-binding protein; TM0544, stru 2e-09
2nq2_C253 Hypothetical ABC transporter ATP-binding protein H 1e-21
2nq2_C253 Hypothetical ABC transporter ATP-binding protein H 3e-05
1sgw_A214 Putative ABC transporter; structural genomics, P p 2e-21
1sgw_A214 Putative ABC transporter; structural genomics, P p 5e-08
2qi9_C249 Vitamin B12 import ATP-binding protein BTUD; inner 1e-20
2qi9_C249 Vitamin B12 import ATP-binding protein BTUD; inner 3e-04
3j16_B608 RLI1P; ribosome recycling, translation, eukarya, r 4e-20
3j16_B608 RLI1P; ribosome recycling, translation, eukarya, r 3e-12
3j16_B608 RLI1P; ribosome recycling, translation, eukarya, r 1e-04
3bk7_A607 ABC transporter ATP-binding protein; ABC ATPase, i 2e-18
3bk7_A607 ABC transporter ATP-binding protein; ABC ATPase, i 2e-13
3bk7_A607 ABC transporter ATP-binding protein; ABC ATPase, i 3e-06
1yqt_A538 RNAse L inhibitor; ATP-binding cassette, ribosome 1e-17
1yqt_A538 RNAse L inhibitor; ATP-binding cassette, ribosome 1e-12
1yqt_A538 RNAse L inhibitor; ATP-binding cassette, ribosome 5e-05
3ozx_A538 RNAse L inhibitor; ATP binding cassette protein, h 2e-17
3ozx_A538 RNAse L inhibitor; ATP binding cassette protein, h 4e-10
3ozx_A538 RNAse L inhibitor; ATP binding cassette protein, h 1e-05
2ihy_A279 ABC transporter, ATP-binding protein; ATPase, ABC 2e-17
2ihy_A279 ABC transporter, ATP-binding protein; ATPase, ABC 7e-08
2pjz_A263 Hypothetical protein ST1066; ATP binding protein, 3e-16
2yz2_A266 Putative ABC transporter ATP-binding protein TM_0; 7e-16
2pcj_A224 ABC transporter, lipoprotein-releasing system ATP- 1e-15
3tif_A235 Uncharacterized ABC transporter ATP-binding prote; 2e-15
3gfo_A275 Cobalt import ATP-binding protein CBIO 1; structur 5e-15
3gfo_A275 Cobalt import ATP-binding protein CBIO 1; structur 2e-04
1g6h_A257 High-affinity branched-chain amino acid transport 2e-14
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 7e-12
1vt4_I1221 APAF-1 related killer DARK; drosophila apoptosome, 8e-10
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 7e-09
1vt4_I1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-05
2ghi_A260 Transport protein; multidrug resistance protein, M 8e-10
2ghi_A260 Transport protein; multidrug resistance protein, M 9e-04
3nh6_A306 ATP-binding cassette SUB-family B member 6, mitoc; 1e-09
2iw3_A986 Elongation factor 3A; acetylation, ATP-binding, pr 2e-09
3g5u_A 1284 MCG1178, multidrug resistance protein 1A; P-glycop 5e-09
3g5u_A1284 MCG1178, multidrug resistance protein 1A; P-glycop 1e-07
2onk_A240 Molybdate/tungstate ABC transporter, ATP-binding p 7e-09
1mv5_A243 LMRA, multidrug resistance ABC transporter ATP-bin 9e-09
3b5x_A582 Lipid A export ATP-binding/permease protein MSBA; 6e-08
1z47_A355 CYSA, putative ABC-transporter ATP-binding protein 6e-08
3b60_A582 Lipid A export ATP-binding/permease protein MSBA; 9e-08
1oxx_K353 GLCV, glucose, ABC transporter, ATP binding protei 3e-07
3qkt_A339 DNA double-strand break repair RAD50 ATPase; RECA- 3e-07
3fvq_A359 Fe(3+) IONS import ATP-binding protein FBPC; nucle 8e-07
2d2e_A250 SUFC protein; ABC-ATPase, SUF protein, 310-helix, 2e-06
3gd7_A390 Fusion complex of cystic fibrosis transmembrane co 4e-06
2bbs_A290 Cystic fibrosis transmembrane conductance regulato 5e-06
3d31_A348 Sulfate/molybdate ABC transporter, ATP-binding pro 5e-06
2pze_A229 Cystic fibrosis transmembrane conductance regulat; 9e-06
2ff7_A247 Alpha-hemolysin translocation ATP-binding protein 9e-06
2it1_A362 362AA long hypothetical maltose/maltodextrin trans 1e-05
2zu0_C267 Probable ATP-dependent transporter SUFC; iron-sulf 1e-05
1ji0_A240 ABC transporter; ATP binding protein, structural g 2e-05
2ixe_A271 Antigen peptide transporter 1; ABC ATPase, hydrola 4e-05
2cbz_A237 Multidrug resistance-associated protein 1; ABC pro 4e-05
1v43_A372 Sugar-binding transport ATP-binding protein; ATPas 6e-05
2yyz_A359 Sugar ABC transporter, ATP-binding protein; sugar 1e-04
1g29_1372 MALK, maltose transport protein MALK; ATPase, acti 3e-04
3tui_C366 Methionine import ATP-binding protein METN; ABC-tr 4e-04
2yl4_A595 ATP-binding cassette SUB-family B member 10, mitoc 4e-04
1f2t_B148 RAD50 ABC-ATPase; DNA double-strand break repair, 5e-04
4a82_A578 Cystic fibrosis transmembrane conductance regulat; 5e-04
>1vpl_A ABC transporter, ATP-binding protein; TM0544, structural GENO joint center for structural genomics, JCSG, protein structu initiative, PSI; 2.10A {Thermotoga maritima} SCOP: c.37.1.12 Length = 256 Back     alignment and structure
 Score =  103 bits (259), Expect = 2e-24
 Identities = 45/186 (24%), Positives = 78/186 (41%), Gaps = 16/186 (8%)

Query: 689 LNGVSGAFRPGVLTALMGVTGSGKTTLMDVLAG--RKTRGYITGNITISGYP--KNQETF 744
           L G+S     G +  L+G  G+GKTT + +++   + +    +G +T+ G    +     
Sbjct: 31  LKGISFEIEEGEIFGLIGPNGAGKTTTLRIISTLIKPS----SGIVTVFGKNVVEEPHEV 86

Query: 745 TRISGYCEQNDIHSPYVTVYESLLYSAWLRLSSEVNSKTREMFVEEVMELVELNPLRQAL 804
            ++  Y  +       +   E L + A        +S   E  VE   E+  L    +  
Sbjct: 87  RKLISYLPEEAGAYRNMQGIEYLRFVAGFY---ASSSSEIEEMVERATEIAGLGEKIKDR 143

Query: 805 VGLPGVNGLSTEQRKRLTIAVELVANPSIIFMDEPTSGLDARAAAVVMRTVRNTVDTGRT 864
           V        S    ++L IA  L+ NP +  +DEPTSGLD   A  V + ++     G T
Sbjct: 144 VS-----TYSKGMVRKLLIARALMVNPRLAILDEPTSGLDVLNAREVRKILKQASQEGLT 198

Query: 865 VVCTIH 870
           ++ + H
Sbjct: 199 ILVSSH 204
>1vpl_A ABC transporter, ATP-binding protein; TM0544, structural GENO joint center for structural genomics, JCSG, protein structu initiative, PSI; 2.10A {Thermotoga maritima} SCOP: c.37.1.12 Length = 256 Back     alignment and structure
>2nq2_C Hypothetical ABC transporter ATP-binding protein HI1470; putative iron chelatin ABC transporter, nucleotide binding domain; 2.40A {Haemophilus influenzae} Length = 253 Back     alignment and structure
>2nq2_C Hypothetical ABC transporter ATP-binding protein HI1470; putative iron chelatin ABC transporter, nucleotide binding domain; 2.40A {Haemophilus influenzae} Length = 253 Back     alignment and structure
>1sgw_A Putative ABC transporter; structural genomics, P protein structure initiative, southeast collaboratory for S genomics, secsg; 1.70A {Pyrococcus furiosus} SCOP: c.37.1.12 Length = 214 Back     alignment and structure
>1sgw_A Putative ABC transporter; structural genomics, P protein structure initiative, southeast collaboratory for S genomics, secsg; 1.70A {Pyrococcus furiosus} SCOP: c.37.1.12 Length = 214 Back     alignment and structure
>2qi9_C Vitamin B12 import ATP-binding protein BTUD; inner membrane, membrane, transmembrane, transport, ATP- binding, hydrolase, nucleotide-binding, periplasm; HET: 1PE; 2.60A {Escherichia coli} PDB: 1l7v_C* 4dbl_C Length = 249 Back     alignment and structure
>2qi9_C Vitamin B12 import ATP-binding protein BTUD; inner membrane, membrane, transmembrane, transport, ATP- binding, hydrolase, nucleotide-binding, periplasm; HET: 1PE; 2.60A {Escherichia coli} PDB: 1l7v_C* 4dbl_C Length = 249 Back     alignment and structure
>3j16_B RLI1P; ribosome recycling, translation, eukarya, ribosome; HET: ATP; NMR {Saccharomyces cerevisiae} Length = 608 Back     alignment and structure
>3j16_B RLI1P; ribosome recycling, translation, eukarya, ribosome; HET: ATP; NMR {Saccharomyces cerevisiae} Length = 608 Back     alignment and structure
>3j16_B RLI1P; ribosome recycling, translation, eukarya, ribosome; HET: ATP; NMR {Saccharomyces cerevisiae} Length = 608 Back     alignment and structure
>3bk7_A ABC transporter ATP-binding protein; ABC ATPase, iron-sulfur cluster, adenosine diphosphate, nucleotide-binding; HET: ADP; 2.80A {Pyrococcus abyssi} PDB: 3j15_B* Length = 607 Back     alignment and structure
>3bk7_A ABC transporter ATP-binding protein; ABC ATPase, iron-sulfur cluster, adenosine diphosphate, nucleotide-binding; HET: ADP; 2.80A {Pyrococcus abyssi} PDB: 3j15_B* Length = 607 Back     alignment and structure
>3bk7_A ABC transporter ATP-binding protein; ABC ATPase, iron-sulfur cluster, adenosine diphosphate, nucleotide-binding; HET: ADP; 2.80A {Pyrococcus abyssi} PDB: 3j15_B* Length = 607 Back     alignment and structure
>1yqt_A RNAse L inhibitor; ATP-binding cassette, ribosome biogenesis, hydrolyase/translation complex; HET: ADP; 1.90A {Pyrococcus furiosus} Length = 538 Back     alignment and structure
>1yqt_A RNAse L inhibitor; ATP-binding cassette, ribosome biogenesis, hydrolyase/translation complex; HET: ADP; 1.90A {Pyrococcus furiosus} Length = 538 Back     alignment and structure
>1yqt_A RNAse L inhibitor; ATP-binding cassette, ribosome biogenesis, hydrolyase/translation complex; HET: ADP; 1.90A {Pyrococcus furiosus} Length = 538 Back     alignment and structure
>3ozx_A RNAse L inhibitor; ATP binding cassette protein, hydrolase, translation; HET: ADP; 2.05A {Sulfolobus solfataricus} Length = 538 Back     alignment and structure
>3ozx_A RNAse L inhibitor; ATP binding cassette protein, hydrolase, translation; HET: ADP; 2.05A {Sulfolobus solfataricus} Length = 538 Back     alignment and structure
>3ozx_A RNAse L inhibitor; ATP binding cassette protein, hydrolase, translation; HET: ADP; 2.05A {Sulfolobus solfataricus} Length = 538 Back     alignment and structure
>2ihy_A ABC transporter, ATP-binding protein; ATPase, ABC cassette, hydrolase; HET: MSE; 1.90A {Staphylococcus aureus} Length = 279 Back     alignment and structure
>2ihy_A ABC transporter, ATP-binding protein; ATPase, ABC cassette, hydrolase; HET: MSE; 1.90A {Staphylococcus aureus} Length = 279 Back     alignment and structure
>2pjz_A Hypothetical protein ST1066; ATP binding protein, structural genomics, NPPSFA; 1.90A {Sulfolobus tokodaii} Length = 263 Back     alignment and structure
>2yz2_A Putative ABC transporter ATP-binding protein TM_0; cobalt transport, TM02 hydrolase, inner membrane, membrane, nucleotide-binding; 2.30A {Thermotoga maritima} Length = 266 Back     alignment and structure
>2pcj_A ABC transporter, lipoprotein-releasing system ATP-binding protein; structural genomics; 1.70A {Aquifex aeolicus} PDB: 2pcl_A Length = 224 Back     alignment and structure
>3tif_A Uncharacterized ABC transporter ATP-binding prote; nucleotide-binding domain, ABC transporter ATPase; HET: ADP; 1.80A {Methanocaldococcus jannaschii dsm 2661ORGANISM_TAXID} PDB: 1l2t_A* 1f3o_A* Length = 235 Back     alignment and structure
>3gfo_A Cobalt import ATP-binding protein CBIO 1; structural genomics, cell membrane, cobalt transport, hydrolase, ION transport; 2.30A {Clostridium perfringens atcc 13124} Length = 275 Back     alignment and structure
>3gfo_A Cobalt import ATP-binding protein CBIO 1; structural genomics, cell membrane, cobalt transport, hydrolase, ION transport; 2.30A {Clostridium perfringens atcc 13124} Length = 275 Back     alignment and structure
>1g6h_A High-affinity branched-chain amino acid transport ATP-binding protein; beta-core domain; HET: ADP; 1.60A {Methanocaldococcus jannaschii} SCOP: c.37.1.12 PDB: 1gaj_A 1g9x_A* Length = 257 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>2ghi_A Transport protein; multidrug resistance protein, MDR, structural genomics, structural genomics consortium, SGC; 2.20A {Plasmodium yoelii yoelii str} Length = 260 Back     alignment and structure
>2ghi_A Transport protein; multidrug resistance protein, MDR, structural genomics, structural genomics consortium, SGC; 2.20A {Plasmodium yoelii yoelii str} Length = 260 Back     alignment and structure
>3nh6_A ATP-binding cassette SUB-family B member 6, mitoc; ABC-transporter, ABCB6, nucleotide binding domain, heme BIOS transport protein; 2.00A {Homo sapiens} PDB: 3nh9_A* 3nha_A* 3nhb_A* Length = 306 Back     alignment and structure
>2iw3_A Elongation factor 3A; acetylation, ATP-binding, protein biosynthesis, nucleotide-binding, phosphorylation, RNA- binding, rRNA-binding; HET: ADP; 2.4A {Saccharomyces cerevisiae} PDB: 2iwh_A* 2ix3_A 2ix8_A Length = 986 Back     alignment and structure
>3g5u_A MCG1178, multidrug resistance protein 1A; P-glycoprotein, PGP, cyclic peptide, membrane protein; 3.80A {Mus musculus} PDB: 3g61_A* 3g60_A* Length = 1284 Back     alignment and structure
>3g5u_A MCG1178, multidrug resistance protein 1A; P-glycoprotein, PGP, cyclic peptide, membrane protein; 3.80A {Mus musculus} PDB: 3g61_A* 3g60_A* Length = 1284 Back     alignment and structure
>2onk_A Molybdate/tungstate ABC transporter, ATP-binding protein; membrane protein; 3.10A {Archaeoglobus fulgidus} SCOP: c.37.1.12 Length = 240 Back     alignment and structure
>1mv5_A LMRA, multidrug resistance ABC transporter ATP-binding and permease protein; asymmetric dimer, tetramer, P-glycoprotein; HET: ATP ADP; 3.10A {Lactococcus lactis} SCOP: c.37.1.12 Length = 243 Back     alignment and structure
>3b5x_A Lipid A export ATP-binding/permease protein MSBA; ABC transporter, lipid flippase, hydrolase, inner membrane, lipid transport, membrane; 5.50A {Vibrio cholerae} Length = 582 Back     alignment and structure
>1z47_A CYSA, putative ABC-transporter ATP-binding protein; alpha/beta motif, beta sandwich, ligand binding protein; 1.90A {Alicyclobacillus acidocaldarius} Length = 355 Back     alignment and structure
>3b60_A Lipid A export ATP-binding/permease protein MSBA; ABC transporter, lipid flippase, hydrolase, inner membrane, lipid transport, membrane; HET: ANP; 3.70A {Salmonella typhimurium} SCOP: c.37.1.12 f.37.1.1 PDB: 3b5y_A* 3b5z_A* 3b5w_A Length = 582 Back     alignment and structure
>1oxx_K GLCV, glucose, ABC transporter, ATP binding protein; ABC-ATPase, ATP-binding cassette, ATPase, transport protein; 1.45A {Sulfolobus solfataricus} SCOP: b.40.6.3 c.37.1.12 PDB: 1oxs_C 1oxt_A 1oxu_A* 1oxv_A* Length = 353 Back     alignment and structure
>3qkt_A DNA double-strand break repair RAD50 ATPase; RECA-like fold, coiled-coils, ATP binding, DNA bindi MRE11, replication; HET: DNA ANP; 1.90A {Pyrococcus furiosus} PDB: 3qku_A* 1ii8_A 3qks_B* 3qkr_B* 1ii8_B Length = 339 Back     alignment and structure
>3fvq_A Fe(3+) IONS import ATP-binding protein FBPC; nucleotide binding domain, ABC motor domain, ferric iron transport, cell inner membrane; HET: ATP; 1.90A {Neisseria gonorrhoeae} Length = 359 Back     alignment and structure
>2d2e_A SUFC protein; ABC-ATPase, SUF protein, 310-helix, riken structural genomics/proteomics initiative, RSGI, structural genomics, binding; 1.70A {Thermus thermophilus} PDB: 2d2f_A* Length = 250 Back     alignment and structure
>3gd7_A Fusion complex of cystic fibrosis transmembrane conductance regulator, residues 1193-1427...; CFTR, ABC transporter, nucleotide binding domain, NBD; HET: B44; 2.70A {Homo sapiens} Length = 390 Back     alignment and structure
>2bbs_A Cystic fibrosis transmembrane conductance regulator; ATP binding cassette, transport protein; HET: ATP; 2.05A {Homo sapiens} PDB: 2bbt_A* 1xmi_A* 1xmj_A* 2bbo_A* 3si7_A* 1r0w_A 1q3h_A 1r0x_A* 1r0y_A* 1r0z_A* 1r10_A* 1xf9_A* 1xfa_A* Length = 290 Back     alignment and structure
>3d31_A Sulfate/molybdate ABC transporter, ATP-binding protein; ATP-binding, nucleotide-binding, membrane, transmembrane, transport protein; 3.00A {Methanosarcina acetivorans} SCOP: b.40.6.3 c.37.1.12 Length = 348 Back     alignment and structure
>2pze_A Cystic fibrosis transmembrane conductance regulat; NBD, ABC transporter, CFTR, hydrolase; HET: ATP; 1.70A {Homo sapiens} PDB: 2pzg_A* 2pzf_A* 1ckx_A 1cky_A 1ckw_A 1ckz_A Length = 229 Back     alignment and structure
>2ff7_A Alpha-hemolysin translocation ATP-binding protein HLYB; ABC-transporter, transport protein; HET: ADP; 1.60A {Escherichia coli} SCOP: c.37.1.12 PDB: 2ffb_A* 2fgk_A* 2ffa_A* 2fgj_A* 2pmk_A* 3b5j_A* 1mt0_A 1xef_A* Length = 247 Back     alignment and structure
>2it1_A 362AA long hypothetical maltose/maltodextrin transport ATP-binding protein; structural genomics, NPPSFA; 1.94A {Pyrococcus horikoshii} Length = 362 Back     alignment and structure
>2zu0_C Probable ATP-dependent transporter SUFC; iron-sulfur cluster, ABC-ATPase, ATP-binding, cytoplasm, nucleotide-binding; HET: MES; 2.20A {Escherichia coli} PDB: 2d3w_A Length = 267 Back     alignment and structure
>1ji0_A ABC transporter; ATP binding protein, structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; HET: ATP; 2.00A {Thermotoga maritima} SCOP: c.37.1.12 Length = 240 Back     alignment and structure
>2ixe_A Antigen peptide transporter 1; ABC ATPase, hydrolase; HET: ATP; 2.0A {Rattus norvegicus} PDB: 2ixg_A* 2ixf_A* 1jj7_A* Length = 271 Back     alignment and structure
>2cbz_A Multidrug resistance-associated protein 1; ABC proteins, MRP1/ABCC1, nucleotide-binding domain, ATP- binding, hydrolysis, transport; HET: ATP; 1.5A {Homo sapiens} Length = 237 Back     alignment and structure
>1v43_A Sugar-binding transport ATP-binding protein; ATPase, active transport, sugar uptake and regulation, transport protein; 2.20A {Pyrococcus horikoshii} SCOP: b.40.6.3 b.40.6.3 c.37.1.12 PDB: 1vci_A* Length = 372 Back     alignment and structure
>2yyz_A Sugar ABC transporter, ATP-binding protein; sugar transport, alpha and beta proteins (A/B) TM0421, structural genomics, NPPSFA; 2.11A {Thermotoga maritima} Length = 359 Back     alignment and structure
>1g29_1 MALK, maltose transport protein MALK; ATPase, active transport, maltose uptake and regulation, sugar binding protein; 1.90A {Thermococcus litoralis} SCOP: b.40.6.3 b.40.6.3 c.37.1.12 PDB: 2d62_A Length = 372 Back     alignment and structure
>3tui_C Methionine import ATP-binding protein METN; ABC-transporter, type I ABC type importer, methionine uptake transporter, membrane protein; HET: ADP; 2.90A {Escherichia coli} PDB: 3tuj_C 3tuz_C* 3dhw_C Length = 366 Back     alignment and structure
>1f2t_B RAD50 ABC-ATPase; DNA double-strand break repair, replication; 1.60A {Pyrococcus furiosus} SCOP: c.37.1.12 PDB: 1f2u_B* 1us8_B* Length = 148 Back     alignment and structure
>4a82_A Cystic fibrosis transmembrane conductance regulat; CFTR, ION channel, transport protein, casse protein; 2.00A {Homo sapiens} PDB: 2onj_A* 2hyd_A Length = 578 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

No hit with probability above 80.00

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 1230
d1l2ta_230 c.37.1.12 (A:) MJ0796 {Archaeon Methanococcus jann 2e-27
d1l2ta_230 c.37.1.12 (A:) MJ0796 {Archaeon Methanococcus jann 2e-09
d1ji0a_240 c.37.1.12 (A:) Branched chain aminoacid ABC transp 7e-26
d1ji0a_240 c.37.1.12 (A:) Branched chain aminoacid ABC transp 1e-06
d1g6ha_254 c.37.1.12 (A:) MJ1267 {Archaeon Methanococcus jann 1e-25
d1g6ha_254 c.37.1.12 (A:) MJ1267 {Archaeon Methanococcus jann 5e-13
d1v43a3239 c.37.1.12 (A:7-245) Hypothetical protein PH0022, N 2e-25
d1v43a3239 c.37.1.12 (A:7-245) Hypothetical protein PH0022, N 8e-15
d1sgwa_200 c.37.1.12 (A:) Putative ABC transporter PF0895 {Py 6e-24
d1sgwa_200 c.37.1.12 (A:) Putative ABC transporter PF0895 {Py 3e-04
d1b0ua_258 c.37.1.12 (A:) ATP-binding subunit of the histidin 2e-23
d1b0ua_258 c.37.1.12 (A:) ATP-binding subunit of the histidin 1e-06
d1r0wa_281 c.37.1.12 (A:) Cystic fibrosis transmembrane condu 3e-23
d1r0wa_281 c.37.1.12 (A:) Cystic fibrosis transmembrane condu 8e-08
d3dhwc1240 c.37.1.12 (C:1-240) Methionine import ATP-binding 4e-23
d3dhwc1240 c.37.1.12 (C:1-240) Methionine import ATP-binding 1e-10
d1vpla_238 c.37.1.12 (A:) Putative ABC transporter TM0544 {Th 1e-22
d1vpla_238 c.37.1.12 (A:) Putative ABC transporter TM0544 {Th 3e-09
d3b60a1253 c.37.1.12 (A:329-581) Multidrug resistance ABC tra 9e-22
d3b60a1253 c.37.1.12 (A:329-581) Multidrug resistance ABC tra 1e-07
d2pmka1241 c.37.1.12 (A:467-707) Haemolysin B ATP-binding pro 2e-21
d2pmka1241 c.37.1.12 (A:467-707) Haemolysin B ATP-binding pro 6e-07
d2hyda1255 c.37.1.12 (A:324-578) Putative multidrug export AT 1e-20
d2hyda1255 c.37.1.12 (A:324-578) Putative multidrug export AT 2e-10
d1l7vc_231 c.37.1.12 (C:) ABC transporter involved in vitamin 1e-20
d1l7vc_231 c.37.1.12 (C:) ABC transporter involved in vitamin 2e-05
d2awna2232 c.37.1.12 (A:4-235) Maltose transport protein MalK 1e-19
d2awna2232 c.37.1.12 (A:4-235) Maltose transport protein MalK 2e-08
d1jj7a_251 c.37.1.12 (A:) Peptide transporter Tap1, C-termina 9e-19
d1jj7a_251 c.37.1.12 (A:) Peptide transporter Tap1, C-termina 2e-08
d1mv5a_242 c.37.1.12 (A:) Multidrug resistance ABC transporte 3e-18
d1mv5a_242 c.37.1.12 (A:) Multidrug resistance ABC transporte 2e-05
d1g2912240 c.37.1.12 (1:1-240) Maltose transport protein MalK 9e-18
d1g2912240 c.37.1.12 (1:1-240) Maltose transport protein MalK 3e-08
d1oxxk2242 c.37.1.12 (K:1-242) Glucose transport protein GlcV 3e-17
d1oxxk2242 c.37.1.12 (K:1-242) Glucose transport protein GlcV 3e-07
d3d31a2229 c.37.1.12 (A:1-229) Sulfate/molybdate ABC transpor 3e-14
d3d31a2229 c.37.1.12 (A:1-229) Sulfate/molybdate ABC transpor 8e-06
d2onka1240 c.37.1.12 (A:1-240) Molybdate/tungstate import ATP 6e-12
d2onka1240 c.37.1.12 (A:1-240) Molybdate/tungstate import ATP 4e-05
g1ii8.1369 c.37.1.12 (A:,B:) Rad50 {Archaeon Pyrococcus furio 5e-07
g1f2t.1292 c.37.1.12 (A:,B:) Rad50 {Archaeon Pyrococcus furio 5e-06
g1f2t.1292 c.37.1.12 (A:,B:) Rad50 {Archaeon Pyrococcus furio 0.004
d1ye8a1178 c.37.1.11 (A:1-178) Hypothetical kinase-like prote 1e-04
d1w1wa_427 c.37.1.12 (A:) Smc head domain {Baker's yeast (Sac 0.003
>d1l2ta_ c.37.1.12 (A:) MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Length = 230 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: ABC transporter ATPase domain-like
domain: MJ0796
species: Archaeon Methanococcus jannaschii [TaxId: 2190]

 Score =  109 bits (275), Expect = 2e-27
 Identities = 50/204 (24%), Positives = 96/204 (47%), Gaps = 10/204 (4%)

Query: 677 KRRGVHDDKLVLLNGVSGAFRPGVLTALMGVTGSGKTTLMDVLAG--RKTRGYIT-GNIT 733
           K   + ++ +  L  V+   + G   ++MG +GSGK+T+++++    + T G +   NI 
Sbjct: 9   KTYKMGEEIIYALKNVNLNIKEGEFVSIMGPSGSGKSTMLNIIGCLDKPTEGEVYIDNIK 68

Query: 734 ISGYPKNQETFTRIS--GYCEQNDIHSPYVTVYESLLYSAWLRLSSEVNSKTREMFVEEV 791
            +    ++ T  R    G+  Q     P +T  E++      +    ++ + R     E 
Sbjct: 69  TNDLDDDELTKIRRDKIGFVFQQFNLIPLLTALENVELPLIFKYRGAMSGEERRKRALEC 128

Query: 792 MELVELNPLRQALVGLPGVNGLSTEQRKRLTIAVELVANPSIIFMDEPTSGLDARAAAVV 851
           +++ EL    +     P  N LS  Q++R+ IA  L  NP II  D+PT  LD++    +
Sbjct: 129 LKMAEL--EERFANHKP--NQLSGGQQQRVAIARALANNPPIILADQPTGALDSKTGEKI 184

Query: 852 MRTVRNTVD-TGRTVVCTIHQPSI 874
           M+ ++   +  G+TVV   H  ++
Sbjct: 185 MQLLKKLNEEDGKTVVVVTHDINV 208
>d1l2ta_ c.37.1.12 (A:) MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Length = 230 Back     information, alignment and structure
>d1ji0a_ c.37.1.12 (A:) Branched chain aminoacid ABC transporter {Thermotoga maritima, TM1139 [TaxId: 2336]} Length = 240 Back     information, alignment and structure
>d1ji0a_ c.37.1.12 (A:) Branched chain aminoacid ABC transporter {Thermotoga maritima, TM1139 [TaxId: 2336]} Length = 240 Back     information, alignment and structure
>d1g6ha_ c.37.1.12 (A:) MJ1267 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Length = 254 Back     information, alignment and structure
>d1g6ha_ c.37.1.12 (A:) MJ1267 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Length = 254 Back     information, alignment and structure
>d1v43a3 c.37.1.12 (A:7-245) Hypothetical protein PH0022, N-terminal domain {Pyrococcus horikoshii [TaxId: 53953]} Length = 239 Back     information, alignment and structure
>d1v43a3 c.37.1.12 (A:7-245) Hypothetical protein PH0022, N-terminal domain {Pyrococcus horikoshii [TaxId: 53953]} Length = 239 Back     information, alignment and structure
>d1sgwa_ c.37.1.12 (A:) Putative ABC transporter PF0895 {Pyrococcus furiosus [TaxId: 2261]} Length = 200 Back     information, alignment and structure
>d1sgwa_ c.37.1.12 (A:) Putative ABC transporter PF0895 {Pyrococcus furiosus [TaxId: 2261]} Length = 200 Back     information, alignment and structure
>d1b0ua_ c.37.1.12 (A:) ATP-binding subunit of the histidine permease {Salmonella typhimurium [TaxId: 90371]} Length = 258 Back     information, alignment and structure
>d1b0ua_ c.37.1.12 (A:) ATP-binding subunit of the histidine permease {Salmonella typhimurium [TaxId: 90371]} Length = 258 Back     information, alignment and structure
>d1r0wa_ c.37.1.12 (A:) Cystic fibrosis transmembrane conductance regulator, CFTR, nucleotide-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 281 Back     information, alignment and structure
>d1r0wa_ c.37.1.12 (A:) Cystic fibrosis transmembrane conductance regulator, CFTR, nucleotide-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 281 Back     information, alignment and structure
>d3dhwc1 c.37.1.12 (C:1-240) Methionine import ATP-binding protein MetN {Escherichia coli [TaxId: 562]} Length = 240 Back     information, alignment and structure
>d3dhwc1 c.37.1.12 (C:1-240) Methionine import ATP-binding protein MetN {Escherichia coli [TaxId: 562]} Length = 240 Back     information, alignment and structure
>d1vpla_ c.37.1.12 (A:) Putative ABC transporter TM0544 {Thermotoga maritima [TaxId: 2336]} Length = 238 Back     information, alignment and structure
>d1vpla_ c.37.1.12 (A:) Putative ABC transporter TM0544 {Thermotoga maritima [TaxId: 2336]} Length = 238 Back     information, alignment and structure
>d3b60a1 c.37.1.12 (A:329-581) Multidrug resistance ABC transporter MsbA, C-terminal domain {Salmonella typhimurium [TaxId: 90371]} Length = 253 Back     information, alignment and structure
>d3b60a1 c.37.1.12 (A:329-581) Multidrug resistance ABC transporter MsbA, C-terminal domain {Salmonella typhimurium [TaxId: 90371]} Length = 253 Back     information, alignment and structure
>d2pmka1 c.37.1.12 (A:467-707) Haemolysin B ATP-binding protein {Escherichia coli [TaxId: 562]} Length = 241 Back     information, alignment and structure
>d2pmka1 c.37.1.12 (A:467-707) Haemolysin B ATP-binding protein {Escherichia coli [TaxId: 562]} Length = 241 Back     information, alignment and structure
>d2hyda1 c.37.1.12 (A:324-578) Putative multidrug export ATP-binding/permease protein SAV1866 {Staphylococcus aureus [TaxId: 1280]} Length = 255 Back     information, alignment and structure
>d2hyda1 c.37.1.12 (A:324-578) Putative multidrug export ATP-binding/permease protein SAV1866 {Staphylococcus aureus [TaxId: 1280]} Length = 255 Back     information, alignment and structure
>d1l7vc_ c.37.1.12 (C:) ABC transporter involved in vitamin B12 uptake, BtuD {Escherichia coli [TaxId: 562]} Length = 231 Back     information, alignment and structure
>d1l7vc_ c.37.1.12 (C:) ABC transporter involved in vitamin B12 uptake, BtuD {Escherichia coli [TaxId: 562]} Length = 231 Back     information, alignment and structure
>d2awna2 c.37.1.12 (A:4-235) Maltose transport protein MalK, N-terminal domain {Escherichia coli [TaxId: 562]} Length = 232 Back     information, alignment and structure
>d2awna2 c.37.1.12 (A:4-235) Maltose transport protein MalK, N-terminal domain {Escherichia coli [TaxId: 562]} Length = 232 Back     information, alignment and structure
>d1jj7a_ c.37.1.12 (A:) Peptide transporter Tap1, C-terminal ABC domain {Human (Homo sapiens) [TaxId: 9606]} Length = 251 Back     information, alignment and structure
>d1jj7a_ c.37.1.12 (A:) Peptide transporter Tap1, C-terminal ABC domain {Human (Homo sapiens) [TaxId: 9606]} Length = 251 Back     information, alignment and structure
>d1mv5a_ c.37.1.12 (A:) Multidrug resistance ABC transporter LmrA, C-terminal domain {Lactococcus lactis [TaxId: 1358]} Length = 242 Back     information, alignment and structure
>d1mv5a_ c.37.1.12 (A:) Multidrug resistance ABC transporter LmrA, C-terminal domain {Lactococcus lactis [TaxId: 1358]} Length = 242 Back     information, alignment and structure
>d1g2912 c.37.1.12 (1:1-240) Maltose transport protein MalK, N-terminal domain {Archaeon Thermococcus litoralis [TaxId: 2265]} Length = 240 Back     information, alignment and structure
>d1g2912 c.37.1.12 (1:1-240) Maltose transport protein MalK, N-terminal domain {Archaeon Thermococcus litoralis [TaxId: 2265]} Length = 240 Back     information, alignment and structure
>d1oxxk2 c.37.1.12 (K:1-242) Glucose transport protein GlcV, N-terminal domain {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Length = 242 Back     information, alignment and structure
>d1oxxk2 c.37.1.12 (K:1-242) Glucose transport protein GlcV, N-terminal domain {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Length = 242 Back     information, alignment and structure
>d3d31a2 c.37.1.12 (A:1-229) Sulfate/molybdate ABC transporter, ATP-binding protein {Methanosarcina acetivorans [TaxId: 2214]} Length = 229 Back     information, alignment and structure
>d3d31a2 c.37.1.12 (A:1-229) Sulfate/molybdate ABC transporter, ATP-binding protein {Methanosarcina acetivorans [TaxId: 2214]} Length = 229 Back     information, alignment and structure
>d2onka1 c.37.1.12 (A:1-240) Molybdate/tungstate import ATP-binding protein WtpC (ModC) {Archaeoglobus fulgidus [TaxId: 2234]} Length = 240 Back     information, alignment and structure
>d2onka1 c.37.1.12 (A:1-240) Molybdate/tungstate import ATP-binding protein WtpC (ModC) {Archaeoglobus fulgidus [TaxId: 2234]} Length = 240 Back     information, alignment and structure
>d1ye8a1 c.37.1.11 (A:1-178) Hypothetical kinase-like protein Aq_1292 {Aquifex aeolicus [TaxId: 63363]} Length = 178 Back     information, alignment and structure
>d1w1wa_ c.37.1.12 (A:) Smc head domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 427 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query1230
d1g2912240 Maltose transport protein MalK, N-terminal domain 100.0
d1v43a3239 Hypothetical protein PH0022, N-terminal domain {Py 100.0
d2awna2232 Maltose transport protein MalK, N-terminal domain 100.0
d1oxxk2242 Glucose transport protein GlcV, N-terminal domain 100.0
d1l2ta_230 MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 100.0
d3dhwc1240 Methionine import ATP-binding protein MetN {Escher 100.0
d3d31a2229 Sulfate/molybdate ABC transporter, ATP-binding pro 100.0
d1vpla_238 Putative ABC transporter TM0544 {Thermotoga mariti 100.0
d1b0ua_258 ATP-binding subunit of the histidine permease {Sal 100.0
d1ji0a_240 Branched chain aminoacid ABC transporter {Thermoto 100.0
d1g6ha_254 MJ1267 {Archaeon Methanococcus jannaschii [TaxId: 100.0
d2pmka1241 Haemolysin B ATP-binding protein {Escherichia coli 100.0
d2onka1240 Molybdate/tungstate import ATP-binding protein Wtp 100.0
d2hyda1255 Putative multidrug export ATP-binding/permease pro 100.0
d1jj7a_251 Peptide transporter Tap1, C-terminal ABC domain {H 100.0
d1mv5a_242 Multidrug resistance ABC transporter LmrA, C-termi 100.0
d3b60a1253 Multidrug resistance ABC transporter MsbA, C-termi 100.0
d1sgwa_200 Putative ABC transporter PF0895 {Pyrococcus furios 100.0
d1l7vc_231 ABC transporter involved in vitamin B12 uptake, Bt 100.0
d1r0wa_281 Cystic fibrosis transmembrane conductance regulato 100.0
d2awna2232 Maltose transport protein MalK, N-terminal domain 100.0
d1v43a3239 Hypothetical protein PH0022, N-terminal domain {Py 100.0
d3d31a2229 Sulfate/molybdate ABC transporter, ATP-binding pro 100.0
d1g2912240 Maltose transport protein MalK, N-terminal domain 100.0
d2onka1240 Molybdate/tungstate import ATP-binding protein Wtp 100.0
d3dhwc1240 Methionine import ATP-binding protein MetN {Escher 100.0
d1oxxk2242 Glucose transport protein GlcV, N-terminal domain 100.0
d1l2ta_230 MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 100.0
d1jj7a_251 Peptide transporter Tap1, C-terminal ABC domain {H 100.0
d2hyda1255 Putative multidrug export ATP-binding/permease pro 100.0
d2pmka1241 Haemolysin B ATP-binding protein {Escherichia coli 100.0
d1vpla_238 Putative ABC transporter TM0544 {Thermotoga mariti 100.0
d3b60a1253 Multidrug resistance ABC transporter MsbA, C-termi 100.0
d1g6ha_254 MJ1267 {Archaeon Methanococcus jannaschii [TaxId: 100.0
d1ji0a_240 Branched chain aminoacid ABC transporter {Thermoto 100.0
d1b0ua_258 ATP-binding subunit of the histidine permease {Sal 100.0
d1mv5a_242 Multidrug resistance ABC transporter LmrA, C-termi 100.0
d1r0wa_281 Cystic fibrosis transmembrane conductance regulato 99.97
d1l7vc_231 ABC transporter involved in vitamin B12 uptake, Bt 99.95
d1sgwa_200 Putative ABC transporter PF0895 {Pyrococcus furios 99.93
g1f2t.1292 Rad50 {Archaeon Pyrococcus furiosus [TaxId: 2261]} 99.79
g1ii8.1369 Rad50 {Archaeon Pyrococcus furiosus [TaxId: 2261]} 99.55
g1f2t.1292 Rad50 {Archaeon Pyrococcus furiosus [TaxId: 2261]} 99.37
d1ye8a1178 Hypothetical kinase-like protein Aq_1292 {Aquifex 99.3
g1ii8.1369 Rad50 {Archaeon Pyrococcus furiosus [TaxId: 2261]} 99.05
d1e69a_308 Smc head domain {Thermotoga maritima [TaxId: 2336] 98.95
d1w1wa_427 Smc head domain {Baker's yeast (Saccharomyces cere 98.73
g1xew.1329 Smc head domain {Pyrococcus furiosus [TaxId: 2261] 98.71
d1w1wa_427 Smc head domain {Baker's yeast (Saccharomyces cere 98.7
d1e69a_308 Smc head domain {Thermotoga maritima [TaxId: 2336] 97.73
d1ewqa2224 DNA repair protein MutS, the C-terminal domain {Th 97.68
d1ye8a1178 Hypothetical kinase-like protein Aq_1292 {Aquifex 97.62
d1wb9a2234 DNA repair protein MutS, the C-terminal domain {Es 97.61
d1cr2a_277 Gene 4 protein (g4p, DNA primase), helicase domain 97.54
d1u0la2225 Probable GTPase EngC (YjeQ), C-terminal domain {Th 97.18
d1znwa1182 Guanylate kinase {Mycobacterium tuberculosis [TaxI 96.92
d1nlfa_274 Hexameric replicative helicase repA {Escherichia c 96.88
d1zp6a1176 Hypothetical protein Atu3015 {Agrobacterium tumefa 96.86
d1np6a_170 Molybdopterin-guanine dinucleotide biosynthesis pr 96.64
d1s96a_205 Guanylate kinase {Escherichia coli [TaxId: 562]} 96.59
d1t9ha2231 Probable GTPase EngC (YjeQ), C-terminal domain {Ba 96.51
d1svia_195 Probable GTPase EngB {Bacillus subtilis [TaxId: 14 96.5
d1knqa_171 Gluconate kinase {Escherichia coli [TaxId: 562]} 96.48
d1qhla_222 Cell division protein MukB {Escherichia coli [TaxI 96.43
d1m8pa3183 ATP sulfurylase C-terminal domain {Fungus (Penicil 96.43
d1y63a_174 Probable kinase LmjF30.1890 {Leishmania major [Tax 96.3
d1lw7a2192 Transcriptional regulator NadR, ribosylnicotinamid 96.29
g1xew.1329 Smc head domain {Pyrococcus furiosus [TaxId: 2261] 96.22
d1yrba1244 ATP(GTP)-binding protein PAB0955 {Pyrococcus abyss 96.14
d1tq4a_400 Interferon-inducible GTPase {Mouse (Mus musculus) 96.12
d1xjca_165 Molybdopterin-guanine dinucleotide biosynthesis pr 96.11
d2cxxa1184 GTP-binding protein engB {Pyrococcus horikoshii [T 96.03
d1rz3a_198 Hypothetical protein rbstp0775 {Bacillus stearothe 96.02
d1h65a_257 Chloroplast protein translocon GTPase Toc34 {Garde 96.0
d1ly1a_152 Polynucleotide kinase, kinase domain {Bacteriophag 95.91
d1lnza2185 Obg GTP-binding protein middle domain {Bacillus su 95.9
d1mkya1171 Probable GTPase Der, N-terminal and middle domains 95.89
d1rkba_173 Adenylate kinase {Human (Homo sapiens), isoenzyme 95.88
d1n0wa_242 DNA repair protein Rad51, catalytic domain {Human 95.88
d1qhxa_178 Chloramphenicol phosphotransferase {Streptomyces v 95.86
d1mkya2186 Probable GTPase Der, N-terminal and middle domains 95.85
d2bdta1176 Hypothetical protein BH3686 {Bacillus halodurans [ 95.83
d1qf9a_194 UMP/CMP kinase {Dictyostelium discoideum [TaxId: 4 95.81
d1gkya_186 Guanylate kinase {Baker's yeast (Saccharomyces cer 95.8
d1nrjb_209 Signal recognition particle receptor beta-subunit 95.76
d1egaa1179 GTPase Era, N-terminal domain {Escherichia coli [T 95.76
d1kgda_178 Guanylate kinase-like domain of Cask {Human (Homo 95.75
d2gj8a1161 Probable tRNA modification GTPase TrmE (MnmE), G d 95.75
d2i3ba1189 Cancer-related NTPase, C1orf57 {Human (Homo sapien 95.72
d1wf3a1178 GTPase Era, N-terminal domain {Thermus thermophilu 95.7
d2p67a1327 LAO/AO transport system kinase ArgK {Escherichia c 95.69
d1ak2a1190 Adenylate kinase {Cow (Bos taurus), mitochondrial 95.66
d1g6oa_323 Hexameric traffic ATPase, HP0525 {Helicobacter pyl 95.65
d1uj2a_213 Uridine-cytidine kinase 2 {Human (Homo sapiens) [T 95.62
d1lvga_190 Guanylate kinase {Mouse (Mus musculus) [TaxId: 100 95.61
d1khta_190 Adenylate kinase {Archaeon Methanococcus voltae [T 95.59
d1x6va3195 Adenosine-5'phosphosulfate kinase (APS kinase) {Hu 95.58
d1udxa2180 Obg GTP-binding protein middle domain {Thermus the 95.58
d1ukza_196 Uridylate kinase {Baker's yeast (Saccharomyces cer 95.57
d3adka_194 Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} 95.42
d1q3ta_223 CMP kinase {Streptococcus pneumoniae [TaxId: 1313] 95.41
d2qm8a1323 Metallochaperone MeaB {Methylobacterium extorquens 95.38
d1zaka1189 Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} 95.36
d1teva_194 UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606] 95.3
d1kaga_169 Shikimate kinase (AroK) {Escherichia coli [TaxId: 95.27
d1f6ba_186 SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: 95.27
d1viaa_161 Shikimate kinase (AroK) {Campylobacter jejuni [Tax 95.22
d1wb1a4179 Elongation factor SelB, N-terminal domain {Methano 95.21
d1ofha_309 HslU {Haemophilus influenzae [TaxId: 727]} 95.1
d1gvnb_273 Plasmid maintenance system epsilon/zeta, toxin zet 95.09
d1puia_188 Probable GTPase EngB {Escherichia coli [TaxId: 562 95.05
d1zina1182 Adenylate kinase {Bacillus stearothermophilus [Tax 95.03
d1tf7a1242 Circadian clock protein KaiC {Synechococcus sp. st 95.0
d1e6ca_170 Shikimate kinase (AroK) {Erwinia chrysanthemi [Tax 94.97
d1bifa1213 6-phosphofructo-2-kinase/fructose-2,6-bisphosphata 94.97
d1yj5a2172 5' polynucleotide kinase-3' phosphatase, C-termina 94.96
d1sq5a_308 Pantothenate kinase PanK {Escherichia coli [TaxId: 94.93
d1szpa2251 DNA repair protein Rad51, catalytic domain {Baker' 94.92
d1r8sa_160 ADP-ribosylation factor {Human (Homo sapiens), ARF 94.78
d2qtvb1166 SAR1 {Baker's yeast (Saccharomyces cerevisiae) [Ta 94.78
d1ckea_225 CMP kinase {Escherichia coli [TaxId: 562]} 94.77
d2fh5b1207 Signal recognition particle receptor beta-subunit 94.75
d1upta_169 ADP-ribosylation factor {Human (Homo sapiens), ARL 94.75
d1knxa2177 HPr kinase HprK C-terminal domain {Mycoplasma pneu 94.74
d1s3ga1182 Adenylate kinase {Bacillus globisporus [TaxId: 145 94.74
d1ksha_165 ADP-ribosylation factor {Mouse (Mus musculus), ARL 94.65
d2iyva1165 Shikimate kinase (AroK) {Mycobacterium tuberculosi 94.63
d2cdna1181 Adenylate kinase {Mycobacterium tuberculosis [TaxI 94.54
d1pzna2254 DNA repair protein Rad51, catalytic domain {Archae 94.53
d1m7ga_208 Adenosine-5'phosphosulfate kinase (APS kinase) {Fu 94.49
d1g7sa4227 Initiation factor IF2/eIF5b, N-terminal (G) domain 94.48
d2i1qa2258 DNA repair protein Rad51, catalytic domain {Archae 94.48
d1e4va1179 Adenylate kinase {Escherichia coli [TaxId: 562]} 94.43
d2ak3a1189 Adenylate kinase {Cow (Bos taurus), mitochondrial 94.42
d1tf7a2242 Circadian clock protein KaiC {Synechococcus sp. st 94.38
d1nn5a_209 Thymidylate kinase {Human (Homo sapiens) [TaxId: 9 94.35
d1nksa_194 Adenylate kinase {Archaeon Sulfolobus acidocaldari 94.35
d1uf9a_191 Dephospho-CoA kinase {Thermus thermophilus [TaxId: 94.34
d1zj6a1177 ADP-ribosylation factor {Human (Homo sapiens), ARL 94.31
d2vp4a1197 Deoxyribonucleoside kinase {Fruit fly (Drosophila 94.27
d1p9ra_401 Extracellular secretion NTPase EpsE {Vibrio choler 94.26
d1sxja2253 Replication factor C1 {Baker's yeast (Saccharomyce 94.26
d2fnaa2283 Archaeal ATPase SSO1545 {Sulfolobus solfataricus [ 94.23
d1v5wa_258 Meiotic recombination protein DMC1/LIM15 homolog { 94.17
d2f7sa1186 Rab27b {Human (Homo sapiens) [TaxId: 9606]} 94.16
d1a7ja_288 Phosphoribulokinase {Rhodobacter sphaeroides [TaxI 94.15
d1okkd2207 GTPase domain of the signal recognition particle r 94.13
d1akya1180 Adenylate kinase {Baker's yeast (Saccharomyces cer 94.08
d1lv7a_256 AAA domain of cell division protein FtsH {Escheric 93.9
d1p5zb_241 Deoxycytidine kinase {Human (Homo sapiens) [TaxId: 93.82
d1iqpa2231 Replication factor C {Archaeon Pyrococcus furiosus 93.81
d1kkma_176 HPr kinase HprK C-terminal domain {Lactobacillus c 93.74
d1d2na_246 Hexamerization domain of N-ethylmalemide-sensitive 93.67
d1in4a2238 Holliday junction helicase RuvB {Thermotoga mariti 93.67
d1jjva_205 Dephospho-CoA kinase {Haemophilus influenzae [TaxI 93.6
d1wxqa1319 GTP-binding protein PH0525 {Pyrococcus horikoshii 93.56
d1jwyb_306 Dynamin G domain {Dictyostelium discoideum [TaxId: 93.51
d1odfa_286 Hypothetical protein Ygr205W {Baker's yeast (Sacch 93.5
d4tmka_210 Thymidylate kinase {Escherichia coli [TaxId: 562]} 93.5
d1ls1a2207 GTPase domain of the signal sequence recognition p 93.49
d1xzpa2160 TrmE GTPase domain {Thermotoga maritima [TaxId: 23 93.48
d1fzqa_176 ADP-ribosylation factor {Mouse (Mus musculus), ARL 93.45
d1zd9a1164 ADP-ribosylation factor {Human (Homo sapiens), ARL 93.29
d2akab1299 Dynamin G domain {Rat (Rattus norvegicus) [TaxId: 93.29
d1f5na2277 Interferon-induced guanylate-binding protein 1 (GB 93.28
d1vmaa2213 GTPase domain of the signal recognition particle r 93.27
d1tmka_214 Thymidylate kinase {Baker's yeast (Saccharomyces c 93.26
d1vhta_208 Dephospho-CoA kinase {Escherichia coli [TaxId: 562 93.16
d3raba_169 Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} 93.16
d1r6bx3315 ClpA, an Hsp100 chaperone, AAA+ modules {Escherich 93.1
d1ko7a2169 HPr kinase HprK C-terminal domain {Staphylococcus 93.0
d1r7ra3265 Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu 92.99
d1ixsb2239 Holliday junction helicase RuvB {Thermus thermophi 92.96
d1ky3a_175 Rab-related protein ypt7p {Baker's yeast (Saccharo 92.95
d1j8yf2211 GTPase domain of the signal sequence recognition p 92.93
d1fnna2276 CDC6, N-domain {Archaeon Pyrobaculum aerophilum [T 92.92
d1u94a1263 RecA protein, ATPase-domain {Escherichia coli [Tax 92.87
d1ixza_247 AAA domain of cell division protein FtsH {Thermus 92.84
d2qy9a2211 GTPase domain of the signal recognition particle r 92.82
d1sxjd2237 Replication factor C2 {Baker's yeast (Saccharomyce 92.74
d1e32a2258 Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu 92.7
d1ctqa_166 cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9 92.68
d1g41a_443 HslU {Haemophilus influenzae [TaxId: 727]} 92.67
d2f9la1175 Rab11b {Human (Homo sapiens) [TaxId: 9606]} 92.6
d1xpua3289 Transcription termination factor Rho, ATPase domai 92.59
d1wmsa_174 Rab9a {Human (Homo sapiens) [TaxId: 9606]} 92.56
d1z2aa1164 Rab23 {Mouse (Mus musculus) [TaxId: 10090]} 92.54
d2gjsa1168 Rad {Human (Homo sapiens) [TaxId: 9606]} 92.49
d2erxa1171 di-Ras2 {Human (Homo sapiens) [TaxId: 9606]} 92.48
d1vg8a_184 Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]} 92.36
d1kk1a3195 Initiation factor eIF2 gamma subunit, N-terminal ( 92.32
d1ni3a1296 YchF GTP-binding protein N-terminal domain {Fissio 92.29
d1g16a_166 Rab-related protein Sec4 {Baker's yeast (Saccharom 92.24
d1gsia_208 Thymidylate kinase {Mycobacterium tuberculosis [Ta 92.22
d2a5ja1173 Rab2b {Human (Homo sapiens) [TaxId: 9606]} 92.1
d2g3ya1172 GTP-binding protein GEM {Human (Homo sapiens) [Tax 92.05
d1htwa_158 Hypothetical protein HI0065 {Haemophilus influenza 91.95
d1xtqa1167 GTP-binding protein RheB {Human (Homo sapiens) [Ta 91.95
d2ew1a1171 Rab30 {Human (Homo sapiens) [TaxId: 9606]} 91.94
d2bcgy1194 GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisi 91.84
d1moza_182 ADP-ribosylation factor {Baker's yeast (Saccharomy 91.8
d1sxjb2224 Replication factor C4 {Baker's yeast (Saccharomyce 91.79
d2erya1171 r-Ras2 {Human (Homo sapiens) [TaxId: 9606]} 91.66
d1kaoa_167 Rap2a {Human (Homo sapiens) [TaxId: 9606]} 91.62
d1x3sa1177 Rab18 {Human (Homo sapiens) [TaxId: 9606]} 91.52
d1z06a1165 Rab-33b {Mouse (Mus musculus) [TaxId: 10090]} 91.34
d1z0fa1166 Rab14 {Human (Homo sapiens) [TaxId: 9606]} 91.2
d1sxjc2227 Replication factor C3 {Baker's yeast (Saccharomyce 91.13
d1sxje2252 Replication factor C5 {Baker's yeast (Saccharomyce 91.11
d1z0ja1167 Rab-22a {Mouse (Mus musculus) [TaxId: 10090]} 91.06
d2dy1a2267 Elongation factor G (EF-G), N-terminal (G) domain 91.04
d1mh1a_183 Rac {Human (Homo sapiens) [TaxId: 9606]} 91.04
d1svma_362 Papillomavirus large T antigen helicase domain {Si 90.99
d1kmqa_177 RhoA {Human (Homo sapiens) [TaxId: 9606]} 90.98
d1yzqa1164 Rab6 {Human (Homo sapiens) [TaxId: 9606]} 90.97
d1i2ma_170 Ran {Human (Homo sapiens) [TaxId: 9606]} 90.93
d2bv3a2276 Elongation factor G (EF-G), N-terminal (G) domain 90.93
d1jala1278 YchF GTP-binding protein N-terminal domain {Haemop 90.76
d2bmea1174 Rab4a {Human (Homo sapiens) [TaxId: 9606]} 90.73
d2fu5c1173 Rab8a {Mouse (Mus musculus) [TaxId: 10090]} 90.72
d1e0sa_173 ADP-ribosylation factor {Human (Homo sapiens), ARF 90.7
d2fn4a1173 r-Ras {Human (Homo sapiens) [TaxId: 9606]} 90.62
d1w5sa2287 CDC6-like protein APE0152, N-terminal domain {Aero 90.6
d1z08a1167 Rab21 {Human (Homo sapiens) [TaxId: 9606]} 90.52
d1e9ra_433 Bacterial conjugative coupling protein TrwB {Esche 90.44
d1azta2221 Transducin (alpha subunit) {Cow (Bos taurus) [TaxI 90.4
d1w44a_321 NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} 90.25
d1ek0a_170 Ypt51 {Baker's yeast (Saccharomyces cerevisiae) [T 90.22
d2g6ba1170 Rab26 {Human (Homo sapiens) [TaxId: 9606]} 90.2
d2atva1168 Ras-like estrogen-regulated growth inhibitor, RERG 90.19
d1u8za_168 Ras-related protein RalA {Cotton-top tamarin (Sagu 90.15
d1r2qa_170 Rab5a {Human (Homo sapiens) [TaxId: 9606]} 90.14
d2atxa1185 RhoQ {Human (Homo sapiens) [TaxId: 9606]} 90.08
d1zcba2200 Transducin (alpha subunit) {Mouse (Mus musculus) [ 90.05
d2jdid3276 Central domain of beta subunit of F1 ATP synthase 89.66
d1x1ra1169 Ras-related protein M-Ras (XRas) {Mouse (Mus muscu 89.64
d2bmja1175 Centaurin gamma 1, G domain {Human (Homo sapiens) 89.53
d1qvra3315 ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 89.17
d1mo6a1269 RecA protein, ATPase-domain {Mycobacterium tubercu 89.08
d1deka_241 Deoxynucleoside monophosphate kinase {Bacteriophag 89.05
d2ocpa1241 Deoxyguanosine kinase {Human (Homo sapiens) [TaxId 89.03
d2ngra_191 CDC42 {Human (Homo sapiens) [TaxId: 9606]} 89.01
d1m7ba_179 RhoE (RND3) {Mouse (Mus musculus) [TaxId: 10090]} 88.95
d1xp8a1268 RecA protein, ATPase-domain {Deinococcus radiodura 88.93
d1l8qa2213 Chromosomal replication initiation factor DnaA {Aq 88.68
d1c1ya_167 Rap1A {Human (Homo sapiens) [TaxId: 9606]} 88.59
d1um8a_364 ClpX {Helicobacter pylori [TaxId: 210]} 88.57
d2qn6a3205 Initiation factor eIF2 gamma subunit, N-terminal ( 88.53
d2c78a3204 Elongation factor Tu (EF-Tu), N-terminal (G) domai 88.46
d1puja_273 Probable GTPase YlqF {Bacillus subtilis [TaxId: 14 87.49
d2a5yb3277 CED-4, NB-ARC domain {Caenorhabditis elegans [TaxI 86.37
d1g8pa_333 ATPase subunit of magnesium chelatase, BchI {Rhodo 86.24
d1nija1222 Hypothetical protein YjiA, N-terminal domain {Esch 85.53
d1d2ea3196 Elongation factor Tu (EF-Tu), N-terminal (G) domai 85.44
d1r6bx2268 ClpA, an Hsp100 chaperone, AAA+ modules {Escherich 85.4
d2bcjq2200 Transducin (alpha subunit) {Mouse (Mus musculus) [ 84.89
d1pjra1318 DEXX box DNA helicase {Bacillus stearothermophilus 84.78
d1svsa1195 Transducin (alpha subunit) {Rat (Rattus norvegicus 84.73
d1n0ua2341 Elongation factor 2 (eEF-2), N-terminal (G) domain 83.96
d1e2ka_329 Thymidine kinase {Herpes simplex virus type 1, dif 83.31
d2olra1313 Phosphoenolpyruvate (PEP) carboxykinase (ATP-oxalo 83.13
d1uaaa1306 DEXX box DNA helicase {Escherichia coli, RepD [Tax 83.05
d1p6xa_333 Thymidine kinase {Equine herpesvirus type 4 [TaxId 82.44
d1j3ba1318 Phosphoenolpyruvate (PEP) carboxykinase (ATP-oxalo 82.36
d1njfa_239 delta prime subunit of DNA polymerase III, N-domai 81.96
d1a5ta2207 delta prime subunit of DNA polymerase III, N-domai 81.81
d1jnya3224 Elongation factor eEF-1alpha, N-terminal (G) domai 81.71
d2jdia3285 Central domain of alpha subunit of F1 ATP synthase 81.45
d1zunb3222 Sulfate adenylate transferase subunit cysN/C, EF-T 80.33
d1ii2a1323 Phosphoenolpyruvate (PEP) carboxykinase (ATP-oxalo 80.15
d1w36d1359 Exodeoxyribonuclease V alpha chain (RecD) {Escheri 80.01
>d1g2912 c.37.1.12 (1:1-240) Maltose transport protein MalK, N-terminal domain {Archaeon Thermococcus litoralis [TaxId: 2265]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: ABC transporter ATPase domain-like
domain: Maltose transport protein MalK, N-terminal domain
species: Archaeon Thermococcus litoralis [TaxId: 2265]

Probab=100.00  E-value=0  Score=308.29  Aligned_cols=199  Identities=25%  Similarity=0.334  Sum_probs=175.8

Q ss_pred             EEEEEEEEEEEECCCCCCCCCCCCCCEEEEECEEEEEECCEEEEEECCCCCCHHHHHHHHHCCCCCCEEEEEEEECCEEC
Q ss_conf             36894249999567210114523783257534289995772999995999949999998959998971899999989516
Q 000907          660 SLTFDEITYSVDMPQEMKRRGVHDDKLVLLNGVSGAFRPGVLTALMGVTGSGKTTLMDVLAGRKTRGYITGNITISGYPK  739 (1230)
Q Consensus       660 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~iL~~vs~~i~~Ge~~ai~G~sGaGKSTLl~~l~g~~~~~~~~G~i~~~g~~~  739 (1230)
                      .++++|++.++.             ...+|+|||+.+++||+++|+||||||||||+++|+|..++  .+|+|.++|.+.
T Consensus         3 ~i~v~nl~k~yg-------------~~~al~~vsl~i~~Ge~~~liG~sGaGKSTll~~i~gl~~p--~sG~I~~~g~~i   67 (240)
T d1g2912           3 GVRLVDVWKVFG-------------EVTAVREMSLEVKDGEFMILLGPSGCGKTTTLRMIAGLEEP--SRGQIYIGDKLV   67 (240)
T ss_dssp             EEEEEEEEEEET-------------TEEEEEEEEEEEETTCEEEEECSTTSSHHHHHHHHHTSSCC--SEEEEEETTEEE
T ss_pred             CEEEEEEEEEEC-------------CEEEECCEEEEECCCCEEEEECCCCCHHHHHHHHHHCCCCC--CCCEEEECCEEE
T ss_conf             189986999989-------------99998560668869989999999998099999999648788--989899999980


Q ss_pred             CH-------HCCCCEEEEECCCCCCCCCCCHHHHHHHHHHHCCCCCCCHHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCC
Q ss_conf             80-------01245599971488669999999999999982089899999999999999999199843323235999988
Q 000907          740 NQ-------ETFTRISGYCEQNDIHSPYVTVYESLLYSAWLRLSSEVNSKTREMFVEEVMELVELNPLRQALVGLPGVNG  812 (1230)
Q Consensus       740 ~~-------~~~~~~~~yv~q~~~~~~~ltv~e~l~f~~~lr~~~~~~~~~~~~~v~~~l~~l~l~~~~~~~~g~~~~~~  812 (1230)
                      ..       ...++.+|||+|++.++|.+||.|++.|...++   ..+.++.+++++++++.++|.+..+..+.     .
T Consensus        68 ~~~~~~~~~~~~~r~ig~v~Q~~~L~~~ltV~eni~~~~~~~---~~~~~e~~~~v~~~l~~~~l~~~~~~~p~-----~  139 (240)
T d1g2912          68 ADPEKGIFVPPKDRDIAMVFQSYALYPHMTVYDNIAFPLKLR---KVPRQEIDQRVREVAELLGLTELLNRKPR-----E  139 (240)
T ss_dssp             EEGGGTEECCGGGSSEEEECSCCCCCTTSCHHHHHHHHHHHT---TCCHHHHHHHHHHHHHHHTCGGGTTCCGG-----G
T ss_pred             CCCCHHHHCCCCCCCCEECCCCHHHCCHHHHHHHHHHHHHHC---CCCHHHHHHHHHHHHHHCCCHHHHCCCHH-----H
T ss_conf             356644424532255120022122231011667633068772---99989999999999987599667629933-----4


Q ss_pred             CCHHHHHHHHHHHHHHHCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHC-CCEEEEEECCCCHHHHHHHHC
Q ss_conf             8988999999999996199776994999999999999999999998848-988999914898889998713
Q 000907          813 LSTEQRKRLTIAVELVANPSIIFMDEPTSGLDARAAAVVMRTVRNTVDT-GRTVVCTIHQPSIDIFEAFDA  882 (1230)
Q Consensus       813 lSgGerkrl~ia~~l~~~p~illlDEptsgLD~~~~~~i~~~l~~~~~~-~~tvi~~~hqp~~~i~~~fd~  882 (1230)
                      ||||||||++|||+|+.+|+++++||||+|||+.++..+++.++++.++ |.|+|+++|... ++....|+
T Consensus       140 LSGGqkQRv~IAraL~~~P~iLllDEPt~~LD~~~~~~i~~~l~~l~~~~g~tvi~vTHd~~-~~~~~~dr  209 (240)
T d1g2912         140 LSGGQRQRVALGRAIVRKPQVFLMDEPLSNLDAKLRVRMRAELKKLQRQLGVTTIYVTHDQV-EAMTMGDR  209 (240)
T ss_dssp             SCHHHHHHHHHHHHHHTCCSEEEEECTTTTSCHHHHHHHHHHHHHHHHHHTCEEEEEESCHH-HHHHHCSE
T ss_pred             CCHHHHHHHHHHHHHHCCCCEEEECCCCCCCCHHHHHHHHHHHHHHHHCCCCEEEEECCCHH-HHHHHCCE
T ss_conf             99999999999999826998898258876569899989999999998636988999959999-99996999
>d1v43a3 c.37.1.12 (A:7-245) Hypothetical protein PH0022, N-terminal domain {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d2awna2 c.37.1.12 (A:4-235) Maltose transport protein MalK, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1oxxk2 c.37.1.12 (K:1-242) Glucose transport protein GlcV, N-terminal domain {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1l2ta_ c.37.1.12 (A:) MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d3dhwc1 c.37.1.12 (C:1-240) Methionine import ATP-binding protein MetN {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d3d31a2 c.37.1.12 (A:1-229) Sulfate/molybdate ABC transporter, ATP-binding protein {Methanosarcina acetivorans [TaxId: 2214]} Back     information, alignment and structure
>d1vpla_ c.37.1.12 (A:) Putative ABC transporter TM0544 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1b0ua_ c.37.1.12 (A:) ATP-binding subunit of the histidine permease {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1ji0a_ c.37.1.12 (A:) Branched chain aminoacid ABC transporter {Thermotoga maritima, TM1139 [TaxId: 2336]} Back     information, alignment and structure
>d1g6ha_ c.37.1.12 (A:) MJ1267 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d2pmka1 c.37.1.12 (A:467-707) Haemolysin B ATP-binding protein {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2onka1 c.37.1.12 (A:1-240) Molybdate/tungstate import ATP-binding protein WtpC (ModC) {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2hyda1 c.37.1.12 (A:324-578) Putative multidrug export ATP-binding/permease protein SAV1866 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1jj7a_ c.37.1.12 (A:) Peptide transporter Tap1, C-terminal ABC domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mv5a_ c.37.1.12 (A:) Multidrug resistance ABC transporter LmrA, C-terminal domain {Lactococcus lactis [TaxId: 1358]} Back     information, alignment and structure
>d3b60a1 c.37.1.12 (A:329-581) Multidrug resistance ABC transporter MsbA, C-terminal domain {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1sgwa_ c.37.1.12 (A:) Putative ABC transporter PF0895 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1l7vc_ c.37.1.12 (C:) ABC transporter involved in vitamin B12 uptake, BtuD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1r0wa_ c.37.1.12 (A:) Cystic fibrosis transmembrane conductance regulator, CFTR, nucleotide-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2awna2 c.37.1.12 (A:4-235) Maltose transport protein MalK, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1v43a3 c.37.1.12 (A:7-245) Hypothetical protein PH0022, N-terminal domain {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d3d31a2 c.37.1.12 (A:1-229) Sulfate/molybdate ABC transporter, ATP-binding protein {Methanosarcina acetivorans [TaxId: 2214]} Back     information, alignment and structure
>d1g2912 c.37.1.12 (1:1-240) Maltose transport protein MalK, N-terminal domain {Archaeon Thermococcus litoralis [TaxId: 2265]} Back     information, alignment and structure
>d2onka1 c.37.1.12 (A:1-240) Molybdate/tungstate import ATP-binding protein WtpC (ModC) {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d3dhwc1 c.37.1.12 (C:1-240) Methionine import ATP-binding protein MetN {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1oxxk2 c.37.1.12 (K:1-242) Glucose transport protein GlcV, N-terminal domain {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1l2ta_ c.37.1.12 (A:) MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1jj7a_ c.37.1.12 (A:) Peptide transporter Tap1, C-terminal ABC domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2hyda1 c.37.1.12 (A:324-578) Putative multidrug export ATP-binding/permease protein SAV1866 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d2pmka1 c.37.1.12 (A:467-707) Haemolysin B ATP-binding protein {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1vpla_ c.37.1.12 (A:) Putative ABC transporter TM0544 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d3b60a1 c.37.1.12 (A:329-581) Multidrug resistance ABC transporter MsbA, C-terminal domain {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1g6ha_ c.37.1.12 (A:) MJ1267 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1ji0a_ c.37.1.12 (A:) Branched chain aminoacid ABC transporter {Thermotoga maritima, TM1139 [TaxId: 2336]} Back     information, alignment and structure
>d1b0ua_ c.37.1.12 (A:) ATP-binding subunit of the histidine permease {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1mv5a_ c.37.1.12 (A:) Multidrug resistance ABC transporter LmrA, C-terminal domain {Lactococcus lactis [TaxId: 1358]} Back     information, alignment and structure
>d1r0wa_ c.37.1.12 (A:) Cystic fibrosis transmembrane conductance regulator, CFTR, nucleotide-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1l7vc_ c.37.1.12 (C:) ABC transporter involved in vitamin B12 uptake, BtuD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1sgwa_ c.37.1.12 (A:) Putative ABC transporter PF0895 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1ye8a1 c.37.1.11 (A:1-178) Hypothetical kinase-like protein Aq_1292 {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1e69a_ c.37.1.12 (A:) Smc head domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1w1wa_ c.37.1.12 (A:) Smc head domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1w1wa_ c.37.1.12 (A:) Smc head domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1e69a_ c.37.1.12 (A:) Smc head domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1ewqa2 c.37.1.12 (A:542-765) DNA repair protein MutS, the C-terminal domain {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1ye8a1 c.37.1.11 (A:1-178) Hypothetical kinase-like protein Aq_1292 {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1wb9a2 c.37.1.12 (A:567-800) DNA repair protein MutS, the C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1cr2a_ c.37.1.11 (A:) Gene 4 protein (g4p, DNA primase), helicase domain {Bacteriophage T7 [TaxId: 10760]} Back     information, alignment and structure
>d1u0la2 c.37.1.8 (A:69-293) Probable GTPase EngC (YjeQ), C-terminal domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1znwa1 c.37.1.1 (A:20-201) Guanylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1nlfa_ c.37.1.11 (A:) Hexameric replicative helicase repA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1zp6a1 c.37.1.25 (A:6-181) Hypothetical protein Atu3015 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1np6a_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1s96a_ c.37.1.1 (A:) Guanylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1t9ha2 c.37.1.8 (A:68-298) Probable GTPase EngC (YjeQ), C-terminal domain {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1svia_ c.37.1.8 (A:) Probable GTPase EngB {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1knqa_ c.37.1.17 (A:) Gluconate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1qhla_ c.37.1.12 (A:) Cell division protein MukB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1m8pa3 c.37.1.15 (A:391-573) ATP sulfurylase C-terminal domain {Fungus (Penicillium chrysogenum) [TaxId: 5076]} Back     information, alignment and structure
>d1y63a_ c.37.1.1 (A:) Probable kinase LmjF30.1890 {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d1lw7a2 c.37.1.1 (A:220-411) Transcriptional regulator NadR, ribosylnicotinamide kinase domain {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1yrba1 c.37.1.10 (A:1-244) ATP(GTP)-binding protein PAB0955 {Pyrococcus abyssi [TaxId: 29292]} Back     information, alignment and structure
>d1tq4a_ c.37.1.8 (A:) Interferon-inducible GTPase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1xjca_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d2cxxa1 c.37.1.8 (A:2-185) GTP-binding protein engB {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1rz3a_ c.37.1.6 (A:) Hypothetical protein rbstp0775 {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1h65a_ c.37.1.8 (A:) Chloroplast protein translocon GTPase Toc34 {Garden pea (Pisum sativum) [TaxId: 3888]} Back     information, alignment and structure
>d1ly1a_ c.37.1.1 (A:) Polynucleotide kinase, kinase domain {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d1lnza2 c.37.1.8 (A:158-342) Obg GTP-binding protein middle domain {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1mkya1 c.37.1.8 (A:2-172) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1rkba_ c.37.1.1 (A:) Adenylate kinase {Human (Homo sapiens), isoenzyme 6 [TaxId: 9606]} Back     information, alignment and structure
>d1n0wa_ c.37.1.11 (A:) DNA repair protein Rad51, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qhxa_ c.37.1.3 (A:) Chloramphenicol phosphotransferase {Streptomyces venezuelae [TaxId: 54571]} Back     information, alignment and structure
>d1mkya2 c.37.1.8 (A:173-358) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2bdta1 c.37.1.25 (A:1-176) Hypothetical protein BH3686 {Bacillus halodurans [TaxId: 86665]} Back     information, alignment and structure
>d1qf9a_ c.37.1.1 (A:) UMP/CMP kinase {Dictyostelium discoideum [TaxId: 44689]} Back     information, alignment and structure
>d1gkya_ c.37.1.1 (A:) Guanylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1nrjb_ c.37.1.8 (B:) Signal recognition particle receptor beta-subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1egaa1 c.37.1.8 (A:4-182) GTPase Era, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1kgda_ c.37.1.1 (A:) Guanylate kinase-like domain of Cask {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2gj8a1 c.37.1.8 (A:216-376) Probable tRNA modification GTPase TrmE (MnmE), G domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2i3ba1 c.37.1.11 (A:1-189) Cancer-related NTPase, C1orf57 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wf3a1 c.37.1.8 (A:3-180) GTPase Era, N-terminal domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2p67a1 c.37.1.10 (A:1-327) LAO/AO transport system kinase ArgK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ak2a1 c.37.1.1 (A:14-146,A:177-233) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-2 [TaxId: 9913]} Back     information, alignment and structure
>d1g6oa_ c.37.1.11 (A:) Hexameric traffic ATPase, HP0525 {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1uj2a_ c.37.1.6 (A:) Uridine-cytidine kinase 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lvga_ c.37.1.1 (A:) Guanylate kinase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1khta_ c.37.1.1 (A:) Adenylate kinase {Archaeon Methanococcus voltae [TaxId: 2188]} Back     information, alignment and structure
>d1x6va3 c.37.1.4 (A:34-228) Adenosine-5'phosphosulfate kinase (APS kinase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1udxa2 c.37.1.8 (A:157-336) Obg GTP-binding protein middle domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1ukza_ c.37.1.1 (A:) Uridylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d3adka_ c.37.1.1 (A:) Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1q3ta_ c.37.1.1 (A:) CMP kinase {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d2qm8a1 c.37.1.10 (A:5-327) Metallochaperone MeaB {Methylobacterium extorquens [TaxId: 408]} Back     information, alignment and structure
>d1zaka1 c.37.1.1 (A:3-127,A:159-222) Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} Back     information, alignment and structure
>d1teva_ c.37.1.1 (A:) UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kaga_ c.37.1.2 (A:) Shikimate kinase (AroK) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1f6ba_ c.37.1.8 (A:) SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d1viaa_ c.37.1.2 (A:) Shikimate kinase (AroK) {Campylobacter jejuni [TaxId: 197]} Back     information, alignment and structure
>d1wb1a4 c.37.1.8 (A:1-179) Elongation factor SelB, N-terminal domain {Methanococcus maripaludis [TaxId: 39152]} Back     information, alignment and structure
>d1ofha_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1gvnb_ c.37.1.21 (B:) Plasmid maintenance system epsilon/zeta, toxin zeta subunit {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1puia_ c.37.1.8 (A:) Probable GTPase EngB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1zina1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1tf7a1 c.37.1.11 (A:14-255) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} Back     information, alignment and structure
>d1e6ca_ c.37.1.2 (A:) Shikimate kinase (AroK) {Erwinia chrysanthemi [TaxId: 556]} Back     information, alignment and structure
>d1bifa1 c.37.1.7 (A:37-249) 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase, kinase domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1yj5a2 c.37.1.1 (A:351-522) 5' polynucleotide kinase-3' phosphatase, C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1sq5a_ c.37.1.6 (A:) Pantothenate kinase PanK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1szpa2 c.37.1.11 (A:145-395) DNA repair protein Rad51, catalytic domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1r8sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF1 [TaxId: 9606]} Back     information, alignment and structure
>d2qtvb1 c.37.1.8 (B:24-189) SAR1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ckea_ c.37.1.1 (A:) CMP kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2fh5b1 c.37.1.8 (B:63-269) Signal recognition particle receptor beta-subunit {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1upta_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARL1 [TaxId: 9606]} Back     information, alignment and structure
>d1knxa2 c.91.1.2 (A:133-309) HPr kinase HprK C-terminal domain {Mycoplasma pneumoniae [TaxId: 2104]} Back     information, alignment and structure
>d1s3ga1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus globisporus [TaxId: 1459]} Back     information, alignment and structure
>d1ksha_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL2 [TaxId: 10090]} Back     information, alignment and structure
>d2iyva1 c.37.1.2 (A:2-166) Shikimate kinase (AroK) {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2cdna1 c.37.1.1 (A:1-181) Adenylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1pzna2 c.37.1.11 (A:96-349) DNA repair protein Rad51, catalytic domain {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1m7ga_ c.37.1.4 (A:) Adenosine-5'phosphosulfate kinase (APS kinase) {Fungus (Penicillium chrysogenum) [TaxId: 5076]} Back     information, alignment and structure
>d1g7sa4 c.37.1.8 (A:1-227) Initiation factor IF2/eIF5b, N-terminal (G) domain {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d2i1qa2 c.37.1.11 (A:65-322) DNA repair protein Rad51, catalytic domain {Archaeon Methanococcus voltae [TaxId: 2188]} Back     information, alignment and structure
>d1e4va1 c.37.1.1 (A:1-121,A:157-214) Adenylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2ak3a1 c.37.1.1 (A:0-124,A:162-225) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-3 [TaxId: 9913]} Back     information, alignment and structure
>d1tf7a2 c.37.1.11 (A:256-497) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} Back     information, alignment and structure
>d1nn5a_ c.37.1.1 (A:) Thymidylate kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nksa_ c.37.1.1 (A:) Adenylate kinase {Archaeon Sulfolobus acidocaldarius [TaxId: 2285]} Back     information, alignment and structure
>d1uf9a_ c.37.1.1 (A:) Dephospho-CoA kinase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1zj6a1 c.37.1.8 (A:2-178) ADP-ribosylation factor {Human (Homo sapiens), ARL5A [TaxId: 9606]} Back     information, alignment and structure
>d2vp4a1 c.37.1.1 (A:12-208) Deoxyribonucleoside kinase {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1p9ra_ c.37.1.11 (A:) Extracellular secretion NTPase EpsE {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1sxja2 c.37.1.20 (A:295-547) Replication factor C1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2fnaa2 c.37.1.20 (A:1-283) Archaeal ATPase SSO1545 {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1v5wa_ c.37.1.11 (A:) Meiotic recombination protein DMC1/LIM15 homolog {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2f7sa1 c.37.1.8 (A:5-190) Rab27b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a7ja_ c.37.1.6 (A:) Phosphoribulokinase {Rhodobacter sphaeroides [TaxId: 1063]} Back     information, alignment and structure
>d1okkd2 c.37.1.10 (D:97-303) GTPase domain of the signal recognition particle receptor FtsY {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1akya1 c.37.1.1 (A:3-130,A:169-220) Adenylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1lv7a_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1p5zb_ c.37.1.1 (B:) Deoxycytidine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1iqpa2 c.37.1.20 (A:2-232) Replication factor C {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1kkma_ c.91.1.2 (A:) HPr kinase HprK C-terminal domain {Lactobacillus casei [TaxId: 1582]} Back     information, alignment and structure
>d1d2na_ c.37.1.20 (A:) Hexamerization domain of N-ethylmalemide-sensitive fusion (NSF) protein {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d1in4a2 c.37.1.20 (A:17-254) Holliday junction helicase RuvB {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1jjva_ c.37.1.1 (A:) Dephospho-CoA kinase {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1wxqa1 c.37.1.8 (A:1-319) GTP-binding protein PH0525 {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1jwyb_ c.37.1.8 (B:) Dynamin G domain {Dictyostelium discoideum [TaxId: 44689]} Back     information, alignment and structure
>d1odfa_ c.37.1.6 (A:) Hypothetical protein Ygr205W {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d4tmka_ c.37.1.1 (A:) Thymidylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ls1a2 c.37.1.10 (A:89-295) GTPase domain of the signal sequence recognition protein Ffh {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1xzpa2 c.37.1.8 (A:212-371) TrmE GTPase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1fzqa_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL3 [TaxId: 10090]} Back     information, alignment and structure
>d1zd9a1 c.37.1.8 (A:18-181) ADP-ribosylation factor {Human (Homo sapiens), ARL8A [TaxId: 9606]} Back     information, alignment and structure
>d2akab1 c.37.1.8 (B:6-304) Dynamin G domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1f5na2 c.37.1.8 (A:7-283) Interferon-induced guanylate-binding protein 1 (GBP1), N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vmaa2 c.37.1.10 (A:82-294) GTPase domain of the signal recognition particle receptor FtsY {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1tmka_ c.37.1.1 (A:) Thymidylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1vhta_ c.37.1.1 (A:) Dephospho-CoA kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d3raba_ c.37.1.8 (A:) Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1r6bx3 c.37.1.20 (X:437-751) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ko7a2 c.91.1.2 (A:130-298) HPr kinase HprK C-terminal domain {Staphylococcus xylosus [TaxId: 1288]} Back     information, alignment and structure
>d1r7ra3 c.37.1.20 (A:471-735) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ixsb2 c.37.1.20 (B:4-242) Holliday junction helicase RuvB {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1ky3a_ c.37.1.8 (A:) Rab-related protein ypt7p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1j8yf2 c.37.1.10 (F:87-297) GTPase domain of the signal sequence recognition protein Ffh {Archaeon Acidianus ambivalens [TaxId: 2283]} Back     information, alignment and structure
>d1fnna2 c.37.1.20 (A:1-276) CDC6, N-domain {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d1u94a1 c.37.1.11 (A:6-268) RecA protein, ATPase-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ixza_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2qy9a2 c.37.1.10 (A:285-495) GTPase domain of the signal recognition particle receptor FtsY {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1sxjd2 c.37.1.20 (D:26-262) Replication factor C2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1e32a2 c.37.1.20 (A:201-458) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ctqa_ c.37.1.8 (A:) cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g41a_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d2f9la1 c.37.1.8 (A:8-182) Rab11b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xpua3 c.37.1.11 (A:129-417) Transcription termination factor Rho, ATPase domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1wmsa_ c.37.1.8 (A:) Rab9a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z2aa1 c.37.1.8 (A:8-171) Rab23 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2gjsa1 c.37.1.8 (A:91-258) Rad {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2erxa1 c.37.1.8 (A:6-176) di-Ras2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vg8a_ c.37.1.8 (A:) Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1kk1a3 c.37.1.8 (A:6-200) Initiation factor eIF2 gamma subunit, N-terminal (G) domain {Archaeon Pyrococcus abyssi [TaxId: 29292]} Back     information, alignment and structure
>d1ni3a1 c.37.1.8 (A:11-306) YchF GTP-binding protein N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1g16a_ c.37.1.8 (A:) Rab-related protein Sec4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1gsia_ c.37.1.1 (A:) Thymidylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2a5ja1 c.37.1.8 (A:9-181) Rab2b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2g3ya1 c.37.1.8 (A:73-244) GTP-binding protein GEM {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1htwa_ c.37.1.18 (A:) Hypothetical protein HI0065 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1xtqa1 c.37.1.8 (A:3-169) GTP-binding protein RheB {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ew1a1 c.37.1.8 (A:4-174) Rab30 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bcgy1 c.37.1.8 (Y:3-196) GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1moza_ c.37.1.8 (A:) ADP-ribosylation factor {Baker's yeast (Saccharomyces cerevisiae), ARL1 [TaxId: 4932]} Back     information, alignment and structure
>d1sxjb2 c.37.1.20 (B:7-230) Replication factor C4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2erya1 c.37.1.8 (A:10-180) r-Ras2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kaoa_ c.37.1.8 (A:) Rap2a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x3sa1 c.37.1.8 (A:2-178) Rab18 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z06a1 c.37.1.8 (A:32-196) Rab-33b {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1z0fa1 c.37.1.8 (A:8-173) Rab14 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sxjc2 c.37.1.20 (C:12-238) Replication factor C3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1sxje2 c.37.1.20 (E:4-255) Replication factor C5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1z0ja1 c.37.1.8 (A:2-168) Rab-22a {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2dy1a2 c.37.1.8 (A:8-274) Elongation factor G (EF-G), N-terminal (G) domain {Thermus thermophilus, EF-G-2 [TaxId: 274]} Back     information, alignment and structure
>d1mh1a_ c.37.1.8 (A:) Rac {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1svma_ c.37.1.20 (A:) Papillomavirus large T antigen helicase domain {Simian virus 40 [TaxId: 10633]} Back     information, alignment and structure
>d1kmqa_ c.37.1.8 (A:) RhoA {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yzqa1 c.37.1.8 (A:14-177) Rab6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1i2ma_ c.37.1.8 (A:) Ran {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bv3a2 c.37.1.8 (A:7-282) Elongation factor G (EF-G), N-terminal (G) domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1jala1 c.37.1.8 (A:1-278) YchF GTP-binding protein N-terminal domain {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d2bmea1 c.37.1.8 (A:6-179) Rab4a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fu5c1 c.37.1.8 (C:3-175) Rab8a {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1e0sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF6 [TaxId: 9606]} Back     information, alignment and structure
>d2fn4a1 c.37.1.8 (A:24-196) r-Ras {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w5sa2 c.37.1.20 (A:7-293) CDC6-like protein APE0152, N-terminal domain {Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1z08a1 c.37.1.8 (A:17-183) Rab21 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1e9ra_ c.37.1.11 (A:) Bacterial conjugative coupling protein TrwB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1azta2 c.37.1.8 (A:35-65,A:202-391) Transducin (alpha subunit) {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1w44a_ c.37.1.11 (A:) NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} Back     information, alignment and structure
>d1ek0a_ c.37.1.8 (A:) Ypt51 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2g6ba1 c.37.1.8 (A:58-227) Rab26 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2atva1 c.37.1.8 (A:5-172) Ras-like estrogen-regulated growth inhibitor, RERG {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u8za_ c.37.1.8 (A:) Ras-related protein RalA {Cotton-top tamarin (Saguinus oedipus) [TaxId: 9490]} Back     information, alignment and structure
>d1r2qa_ c.37.1.8 (A:) Rab5a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2atxa1 c.37.1.8 (A:9-193) RhoQ {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zcba2 c.37.1.8 (A:47-75,A:202-372) Transducin (alpha subunit) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2jdid3 c.37.1.11 (D:82-357) Central domain of beta subunit of F1 ATP synthase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1x1ra1 c.37.1.8 (A:10-178) Ras-related protein M-Ras (XRas) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2bmja1 c.37.1.8 (A:66-240) Centaurin gamma 1, G domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qvra3 c.37.1.20 (A:536-850) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1mo6a1 c.37.1.11 (A:1-269) RecA protein, ATPase-domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1deka_ c.37.1.1 (A:) Deoxynucleoside monophosphate kinase {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d2ocpa1 c.37.1.1 (A:37-277) Deoxyguanosine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ngra_ c.37.1.8 (A:) CDC42 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m7ba_ c.37.1.8 (A:) RhoE (RND3) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1xp8a1 c.37.1.11 (A:15-282) RecA protein, ATPase-domain {Deinococcus radiodurans [TaxId: 1299]} Back     information, alignment and structure
>d1l8qa2 c.37.1.20 (A:77-289) Chromosomal replication initiation factor DnaA {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1c1ya_ c.37.1.8 (A:) Rap1A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1um8a_ c.37.1.20 (A:) ClpX {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d2qn6a3 c.37.1.8 (A:2-206) Initiation factor eIF2 gamma subunit, N-terminal (G) domain {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d2c78a3 c.37.1.8 (A:9-212) Elongation factor Tu (EF-Tu), N-terminal (G) domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1puja_ c.37.1.8 (A:) Probable GTPase YlqF {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2a5yb3 c.37.1.20 (B:109-385) CED-4, NB-ARC domain {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1g8pa_ c.37.1.20 (A:) ATPase subunit of magnesium chelatase, BchI {Rhodobacter capsulatus [TaxId: 1061]} Back     information, alignment and structure
>d1nija1 c.37.1.10 (A:2-223) Hypothetical protein YjiA, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1d2ea3 c.37.1.8 (A:55-250) Elongation factor Tu (EF-Tu), N-terminal (G) domain {Cow (Bos taurus), mitochondrial [TaxId: 9913]} Back     information, alignment and structure
>d1r6bx2 c.37.1.20 (X:169-436) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2bcjq2 c.37.1.8 (Q:38-66,Q:184-354) Transducin (alpha subunit) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1pjra1 c.37.1.19 (A:1-318) DEXX box DNA helicase {Bacillus stearothermophilus, PcrA [TaxId: 1422]} Back     information, alignment and structure
>d1svsa1 c.37.1.8 (A:32-60,A:182-347) Transducin (alpha subunit) {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1n0ua2 c.37.1.8 (A:3-343) Elongation factor 2 (eEF-2), N-terminal (G) domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1e2ka_ c.37.1.1 (A:) Thymidine kinase {Herpes simplex virus type 1, different strains [TaxId: 10298]} Back     information, alignment and structure
>d2olra1 c.91.1.1 (A:228-540) Phosphoenolpyruvate (PEP) carboxykinase (ATP-oxaloacetate carboxy-lyase) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1uaaa1 c.37.1.19 (A:2-307) DEXX box DNA helicase {Escherichia coli, RepD [TaxId: 562]} Back     information, alignment and structure
>d1p6xa_ c.37.1.1 (A:) Thymidine kinase {Equine herpesvirus type 4 [TaxId: 10331]} Back     information, alignment and structure
>d1j3ba1 c.91.1.1 (A:212-529) Phosphoenolpyruvate (PEP) carboxykinase (ATP-oxaloacetate carboxy-lyase) {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1njfa_ c.37.1.20 (A:) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1a5ta2 c.37.1.20 (A:1-207) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1jnya3 c.37.1.8 (A:4-227) Elongation factor eEF-1alpha, N-terminal (G) domain {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d2jdia3 c.37.1.11 (A:95-379) Central domain of alpha subunit of F1 ATP synthase {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1zunb3 c.37.1.8 (B:16-237) Sulfate adenylate transferase subunit cysN/C, EF-Tu domain G-like domain {Pseudomonas syringae pv. tomato [TaxId: 323]} Back     information, alignment and structure
>d1ii2a1 c.91.1.1 (A:201-523) Phosphoenolpyruvate (PEP) carboxykinase (ATP-oxaloacetate carboxy-lyase) {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d1w36d1 c.37.1.19 (D:2-360) Exodeoxyribonuclease V alpha chain (RecD) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure