Citrus Sinensis ID: 000921

Local Sequence Feature Prediction

Prediction and (Method)	Result

Residue Number Marker

Protein Sequence

Secondary Structure (PSIPRED)

Secondary Structure Prediction (SSPRO)

Coil and Loop (DISEMBL)

Flexible Loop (DISEMBL)

Low Complexity Region (SEG)

Disordered region (IsUnstruct)

Disordered Region (DISOPRED)

Disordered Region (DISEMBL)

Disordered Region (DISPRO)

Transmembrane Helix (TMHMM)

Transmembrane Helix (HMMTOP)

Transmembrane Helix (MEMSAT)

TM Helix, Signal Peptide (MEMSAT_SVM)

TM Helix, Signal Peptide (Phobius)

Signal Peptide (SignalP HMM Mode)

Signal Peptide (SignalP NN Mode)

Coiled Coils (COILS)

Positional Conservation

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820-------830-------840-------850-------860-------870-------880-------890-------900-------910-------920-------930-------940-------950-------960-------970-------980-------990------1000------1010------1020------1030------1040------1050------1060------1070------1080------1090------1100------1110------1120------1130------1140------1150------1160------1170------1180------1190------1200------1210------1220---

MVETRRSSSSSKRALPSSQASPPPSNKRSKATDAPPSTGDMPVAPPSEAASKSGSESREPELRSSDLDLTDDAKPADVDKSVDADVEADALVSPPTPGETAVDAEKSKAVGVVFNGRVKKRATKLGKVGSRIPWARLISQCSQNSHLSMTGAVFTVGHNRQCDLYLKDPSISKNLCRLRRIENGGPSGALLEITGGKGEVEVNGNVHPKDSQVVLRGGDELVFSPSGKHSYIFQQLSDDTLAAPGIHPPMSILEAQSAPLKTMHIEARSGDPSAVAGASILASLSNIQKDLSLIPPPTKAGVDAQNSEIASLASGCDGPEDRIPDVDMKDATSNNDDAGSSSRGKTVVPQSDAANENPNLDSIGLDACVDAEIGKIPGATYELRPLLRMLAGSSSPDFDISGGISKILDEQREIRELLKDSDRPTVLISARRQAFKDSLQEGILGPENIEVSFESFPYYLSDITKNVLIASTYVHLKCNNFAKYASDLPTMCPRILLSGPAGSEIYQETLAKALAKHFSARLLIVDSLLLPGGSSKEADSVKESSRTEKASMFAKRAALLQHRKPTSSVEADITGGTAVGSQALPKPEISTASSKNYTFKKGDRVKFVGNVTSGTTVQPTLRGPGIGFRGRVILPFEDNDFSKIGVRFDRSIPEGNNLGGFCEDDHGFFCTASSLRLDSSLGDEVDKLAINELFEVALNESKSSPLIVFVKDIEKSLTGNNDAYGALKSKLENLPSNVVVIGSHTQLDSRKEKSHPGGLLFTKFGSNQTALLDLAFPDNFSRLHDRSKETPKALKQISRLFPNKVTIQLPQDEALLSDWKQQLERDVETLKGQSNIISIRSVLSRNGLDCVDLESLCIKDQTLTTEGVEKIVGWALSHHFMHCSEAPGKDAKLKISTESIMYGLNILQGIQSESKSLKKSLKDVVTENEFEKKLLADVIPPSDIGVTFDDIGALENVKDTLKELVMLPLQRPELFCKGQLTKPCKGILLFGPPGTGKTMLAKAVATEAGANFINISMSSITSKVDSMLGRRENPGEHEAMRKMKNEFMVNWDGLRTKDKERVLVLAATNRPFDLDEAVVRRLPRRLMVNLPDAPNREKIIRVILAKEELASDVDLEGIANMADGYSGSDLKNLCVTAAHCPIREILEKEKKERALALAENRASPPLYSSVDVRPLKMDDFKYAHEQVCASVSSESTNMNELLQWNELYGEGGSRKRKSLSYFM

ccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHccccccccccccHHHHHcccccccccccHHHHcccccccccEEEEccEEEEEccccccccccccccccccEEEEEEEEccccEEEEEEEccccEEEEccEEcccccEEEEccccEEEEcccccccEEcccccccccccccccccccccccccccccccccccccccccccccHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHccccccccccccccHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHcccccccccccccccccccHHHHHHHHHHHHHHccccccccccccccccccccEEcccccccHHHHHHHHHHHHHHccccEEEEEccccccccccccHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccEEEEEccccccccccccccccccccccEEEccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHcccccccEEEEEcccHHHcccccHHHHHHHHHHHcccccEEEEEEccccccccccccccccEEEEEEcccccccccccccccccccccccccHHHHHcccccccEEccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHccccccccHHHHHHHHHHHHHHHHHcccccccccccccccHHHHHHHHcccccccHHHHHHHHHHcccccccHHHHHHHcccccccccccccccccccHHHHHHHHHHHHccccccccccccccccccccEEEEcccccHHHHHHHHHHHHcccEEEEEEcccHHHHHHHHccccccccccHHHHHHHHHHHHHHccccccccccEEEEEcccccccccHHHHHccccccccccccHHHHHHHHHHHHccccccccccHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccHHHHHHHHHHcccccccccccHHHHHHHHHHHccccccccccccccc

ccccccccccccccccccccccccccccccccccccccccccccccccHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHccccccccEEEcccEEEEcccccccccccccccccHEEEEEEEEccccEEEEEEEEcccEEEEEccEEEccccEEEEccccEEEEcccccEEEEEEccccccccccccccccEEEcccccccccEEEEcccccccHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHcccccccccccccccccccccccccccccccccccHHHHHHHHHHHHcccccccccccccHHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHccccccccEcccccccEccHHHHHHHHHHHHHHHHHHcHHHHHHccccccccEEEcccccHHHHHHHHHHHHHHHccccEEEEEcccccccccccccccccccHHHHHHHcccHHHHHHccccccccccccccccccccccccccccccccccccccccccEEEEEccccccccccccccccccccccEEEEEEccccccEEEEEccccccccccccccccccccEEEccHHcccccccccHHHHHHHHHHHHHHHHHcccccEEEEEccHHHHccccHHHHHHHHHHHHcccccEEEEcccccHHcccccHcccHHHHHHcccccccEEEcccccccccccccccccHHHHHHHHHHcccEEEEcccccccHHHHccHHHHHHccccccHHHHHHHHHHHHccccccccHHHccccccccHHHHHHHHHHHHHHHHHHHcccHHHcccEEEEcccccccccEEEEcccccccccccccccccccccccccccccccccccccccHccHcHHHHHHHHHHHHHHcccccHHHHHHccccccccEEEEEcccccHHHHHHHHHHHHccccEEEEccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHccccccccccEEEEEEccccccccHHHHHHcccEEEcccccHHHHHHHHHHHHccccccccccHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccHHHHHHHHHHccccHcHHHHEHcHHHcHHHccccccccEccccEccc

mvetrrssssskralpssqaspppsnkrskatdappstgdmpvappseaasksgsesrepelrssdldltddakpadvdksvdadveadalvspptpgetavdaekskaVGVVFNGRVKKRATklgkvgsripwarlisqcsqnshlsmtgavftvghnrqcdlylkdpsisknlcrlrrienggpsgalleitggkgevevngnvhpkdsqvvlrggdelvfspsgkhsyifqqlsddtlaapgihppmsileaqsaplktmhiearsgdpsaVAGASILASLSNIQkdlslippptkagvdaqnSEIAslasgcdgpedripdvdmkdatsnnddagsssrgktvvpqsdaanenpnldsigldacvdaeigkipgatyELRPLLRmlagssspdfdisggiSKILDEQREIRELLkdsdrptvLISARRQAFKDSlqegilgpenievsfesfpyylsdITKNVLIASTYVHLKCNnfakyasdlptmcprillsgpagseIYQETLAKALAKHFSARLLIVDslllpggsskeadsvkessRTEKASMFAKRAALLqhrkptssveaditggtavgsqalpkpeistassknytfkkgdrvkfvgnvtsgttvqptlrgpgigfrgrvilpfedndfskigvrfdrsipegnnlggfceddhgffctasslrldsslgdevDKLAINELFEVAlnesksspliVFVKDIEksltgnndaYGALKSklenlpsnvvvigshtqldsrkekshpggllftkfgsnqtalldlafpdnfsrlhdrsketPKALKQISRlfpnkvtiqlpqdeALLSDWKQQLERDVETLKGQSNIISIRSVlsrngldcvdleslcikdqtlttEGVEKIVGWALSHhfmhcseapgkdaklkiSTESIMYGLNILQGIQSESKSLKKSLKDVVTENEFEKKLladvippsdigvtfddigALENVKDTLKELVMlplqrpelfckgqltkpckgillfgppgtgkTMLAKAVATEAGANFINISMSSITSKVdsmlgrrenpgeHEAMRKMKNEFMvnwdglrtkdKERVLVLAAtnrpfdldeAVVRRLPRrlmvnlpdapnrEKIIRVILAKeelasdvdlegianmadgysgsdlknlcvtaahcpiREILEKEKKERALALAenraspplyssvdvrplkmddfkYAHEQVCASVSSESTNMNELLQWNElygeggsrkRKSLSYFM

mvetrrssssskralpssqaspppsnkrskatdappstgdmpvappseaasksgsesrepelrssdldltddakPADVDKSVDADVEadalvspptpgetavdaekskavgvvfngrvkkratklgkvgsripwARLISQCSQNSHLSMTGAVFTVGHNRQCDLYLKDPSISKNLCRLRRIENGGPSGALLEITGGKGEVEVNGNVHPKDSQVVLRGGDELVFSPSGKHSYIFQQLSDDTLAAPGIHPPMSILEAQSAPLKTMHIEARSGDPSAVAGASILASLSNIQKDLSLIPPPTKAGVDAQNSEIASLASGCDGPEDRIPDVDMKDAtsnnddagsssrgktvvpqsdaanenpnldsIGLDACVDAEIGKIPGATYELRPLLRMLAGSsspdfdisgGISKILDEQREIREllkdsdrptvlISARRQAFKDSLQEGILGPENIEVSFESFPYYLSDITKNVLIASTYVHLKCNNFAKYASDLPTMCPRILLSGPAGSEIYQETLAKALAKHFSARLLIVDSlllpggsskeadsvkessrteKASMFAKRAAllqhrkptssveaditggtavgsqalpkpeistassknytfkkgdrvkfvgnvtsgttvqptlrgpgigFRGRVILPFEDNDFSKIGVRFDRSIPEGNNLGGFCEDDHGFFCTASSLRLDSSLGDEVDKLAINELFEValneskssplIVFVKDIEKSLTGNNDAYGALKSKLENLPSNVVVIGSHTQLDSRKEKSHPGGLLFTKFGSNQTALLDLAFPDNFSRLHDRSKETPKALKQISRLFPNKVTIQLPQDEALLSDWKQQLERDVEtlkgqsniisirsvlsrnglDCVDLESLcikdqtlttEGVEKIVGWALSHHFMHCSEAPGKDAKLKISTESIMYGLNILQGIQSESKSLKKSLKDVVTENEFEkklladvippsdiGVTFDDIGALENVKDTLKELVMLPLQRPELFCKGQLTKPCKGILLFGPPGTGKTMLAKAVATEAGANFINISMSSITSKVDSMLGRRENPGEHEAMRKMKNEFMVNWDGLRTKDKERVLVLAatnrpfdldeavvrrlprrlmvnlpdapnrekIIRVILAKEELASDVDLEGIANMADGYSGSDLKNLCVTAAHCPIREILEKEKKERALALaenraspplyssvdVRPLKMDDFKYAHEQVCASVSSESTNMNELLQWnelygeggsrkrkslsyfm

MVETrrssssskralpssqaspppsNKRSKATDAPPSTGDMPVAPPSEAASKSGSESREPELRSSDLDLTDDAKPADVDKSVDADVEADALVSPPTPGETAVDAEKSKAVGVVFNGRVKKRATKLGKVGSRIPWARLISQCSQNSHLSMTGAVFTVGHNRQCDLYLKDPSISKNLCRLRRIENGGPSGALLEITggkgevevngnvHPKDSQVVLRGGDELVFSPSGKHSYIFQQLSDDTLAAPGIHPPMSILEAQSAPLKTMHIEARSGDPSAVAGASILASLSNIQKDLSLIPPPTKAGVDAQNSEIASLASGCDGPEDRIPDVDMKDATSNNDDAGSSSRGKTVVPQSDAANENPNLDSIGLDACVDAEIGKIPGATYELRPLLRMLAGSSSPDFDISGGISKILDEQREIRELLKDSDRPTVLISARRQAFKDSLQEGILGPENIEVSFESFPYYLSDITKNVLIASTYVHLKCNNFAKYASDLPTMCPRILLSGPAGSEIYQETLAKALAKHFSARLLIVDSLLLPGGSSKEADSVKESSRTEKASMFAKRAALLQHRKPTSSVEADITGGTAVGSQALPKPEISTASSKNYTFKKGDRVKFVGNVTSGTTVQPTLRGPGIGFRGRVILPFEDNDFSKIGVRFDRSIPEGNNLGGFCEDDHGFFCTASSLRLDSSLGDEVDKLAINELFEVALNESKSSPLIVFVKDIEKSLTGNNDAYGALKSKLENLPSNVVVIGSHTQLDSRKEKSHPGGLLFTKFGSNQTALLDLAFPDNFSRLHDRSKETPKALKQISRLFPNKVTIQLPQDEALLSDWKQQLERDVETLKGQSNIISIRSVLSRNGLDCVDLESLCIKDQTLTTEGVEKIVGWALSHHFMHCSEAPGKDAKLKISTESIMYGLNILQGIQseskslkkslkDVVTENEFEKKLLADVIPPSDIGVTFDDIGALENVKDTLKELVMLPLQRPELFCKGQLTKPCKGILLFGPPGTGKTMLAKAVATEAGANFINISMSSITSKVDSMLGRRENPGEHEAMRKMKNEFMVNWDGLRTKDKERVLVLAATNRPFDLDEAVVRRLPRRLMVNLPDAPNREKIIRVILAKEELASDVDLEGIANMADGYSGSDLKNLCVTAAHCPireilekekkeralalaeNRASPPLYSSVDVRPLKMDDFKYAHEQVCASVSSESTNMNELLQWNELYGEGGSRKRKSLSYFM

************************************************************************************************************AVGVVFNGRVKKRATKLGKVGSRIPWARLISQCSQNSHLSMTGAVFTVGHNRQCDLYLKDPSISKNLCRLRRIENGGPSGALLEITGGKGEVEV*********QVVLRGGDELVFSPSGKHSYIFQQLS****************************************************************************************************************************SIGLDACVDAEIGKIPGATYELRPLLRMLAG*******ISGGISKIL*****************VLISARRQAFKDSLQEGILGPENIEVSFESFPYYLSDITKNVLIASTYVHLKCNNFAKYASDLPTMCPRILLSGPAGSEIYQETLAKALAKHFSARLLIVDSLLL*******************************************************************TFKKGDRVKFVGNVTSGTTVQPTLRGPGIGFRGRVILPFEDNDFSKIGVRFDRSIPEGNNLGGFCEDDHGFFCTASSLRLDSSLGDEVDKLAINELFEVALNESKSSPLIVFVKDIEKSLTGNNDAYGALKSKLENLPSNVVVIG***************GLLFTKFGSNQTALLDLAFPDNF****************ISRLFPNKVTIQLPQDEALLSDWKQQLERDVETLKGQSNIISIRSVLSRNGLDCVDLESLCIKDQTLTTEGVEKIVGWALSHHFMHCSEAPGKDAKLKISTESIMYGLNILQGI*************VVTENEFEKKLLADVIPPSDIGVTFDDIGALENVKDTLKELVMLPLQRPELFCKGQLTKPCKGILLFGPPGTGKTMLAKAVATEAGANFINISM****************************EFMVNWDGLRTKDKERVLVLAATNRPFDLDEAVVRRLPRRLMVNLPDAPNREKIIRVILAKEELASDVDLEGIANMADGYSGSDLKNLCVTAAHCPIREILE************************VRPLKMDDFKYAHEQVCA***********LLQWNELY***************

*************************************************************************************************************************************WARLISQCSQNSHLSMTGAVFTVGHNRQCDLYLKDPSISKNLCRLRRIENGGPSGALLEITGGKGEVEVNGNVHPKDSQVVLRGGDELVFSPSGKHSYIFQQLSD******************SA**KTMH*********AVAGASILA*******************************************VDMK********************************************GKIPGATYELRPLLRMLAG**S***DI*GGIS***D***************************DSLQEGILGPENIEVSFESFPYYLSDITKNVLIASTYVHLKCNNFAKYAS**PT*CPRILLSGPAGSEIYQETLAKALAKHFSARLLIVDSLLLPG***************************************************************************************************************************************FFCTASSLRLDSSLGDEVDKLAINELFEVALNESKSSPLIVFVKDIEKSLTGNNDAYGALKSKLENLPSNVVVIGSHT**************LFTKFGSNQTALLDLAFPDNFSRLHDR*K**PKALKQISRLFPNKVTIQLPQDEALLSDWKQQLERDVETLKGQSNIISIRSVLSRNGLDCVDLESLCIKDQTLTTEGVEKIVGWALSHHFM*************************************************EKKLLADVIPPSDIGVTFDDIGALENVKDTLKELVMLPLQRPELFCKGQLTKPCKGILLFGPPGTGKTMLAKAVATEAGANFINISMSSITSKVD*******************NEFMVNWDGLRTKDKERVLVLAATNRPFDLDEAVVRRLPRRLMVNLPDAPNREKIIRVILAKEELASDVDLEGIANMADGYSGSDLKNLCVTAAHCPIREI************************VDVRPLKMDDFKYAHE*************NELLQWN**************SYFM

*****************************************************************DLDLTDDAKPADVDKSVDADVEADALVS***********EKSKAVGVVFNGRVKKRATKLGKVGSRIPWARLISQCSQNSHLSMTGAVFTVGHNRQCDLYLKDPSISKNLCRLRRIENGGPSGALLEITGGKGEVEVNGNVHPKDSQVVLRGGDELVFSPSGKHSYIFQQLSDDTLAAPGIHPPMSILEAQSAPLKTMHIEARSGDPSAVAGASILASLSNIQKDLSLIPPPTKAGVDAQNSEIASLASGCDGPEDRIPDVDMKDAT******************SDAANENPNLDSIGLDACVDAEIGKIPGATYELRPLLRMLAGSSSPDFDISGGISKILDEQREIRELLKDSDRPTVLISARRQAFKDSLQEGILGPENIEVSFESFPYYLSDITKNVLIASTYVHLKCNNFAKYASDLPTMCPRILLSGPAGSEIYQETLAKALAKHFSARLLIVDSLLLPGG*****************SMFAKRAALL**********ADITGGTAVGSQALPKPEISTASSKNYTFKKGDRVKFVGNVTSGTTVQPTLRGPGIGFRGRVILPFEDNDFSKIGVRFDRSIPEGNNLGGFCEDDHGFFCTASSLRLDSSLGDEVDKLAINELFEVALNESKSSPLIVFVKDIEKSLTGNNDAYGALKSKLENLPSNVVVIGSH*********SHPGGLLFTKFGSNQTALLDLAFPDNFSRLHDRSKETPKALKQISRLFPNKVTIQLPQDEALLSDWKQQLERDVETLKGQSNIISIRSVLSRNGLDCVDLESLCIKDQTLTTEGVEKIVGWALSHHFMHCSEAPGKDAKLKISTESIMYGLNILQGIQSESKSLKKSLKDVVTENEFEKKLLADVIPPSDIGVTFDDIGALENVKDTLKELVMLPLQRPELFCKGQLTKPCKGILLFGPPGTGKTMLAKAVATEAGANFINISMSSITSKVDSMLGRRENPGEHEAMRKMKNEFMVNWDGLRTKDKERVLVLAATNRPFDLDEAVVRRLPRRLMVNLPDAPNREKIIRVILAKEELASDVDLEGIANMADGYSGSDLKNLCVTAAHCPIREILEKEKKERALALAENRASPPLYSSVDVRPLKMDDFKYAHEQVCASVSSESTNMNELLQWNELYGEGGSRKRKSLSYFM

**********************************************************************************************************************************RIPWARLISQCSQNSHLSMTGAVFTVGHNRQCDLYLKDPSISKNLCRLRRIENGGPSGALLEITGGKGEVEVNGNVHPKDSQVVLRGGDELVFSPSGKHSYIFQQLSDDTLAAPGIHPPMSILEAQSAPLKTMHIEARSGDPS**************QKDLSLIPP************************************************************NPNLDSIGLDACVDAEIGKIPGATYELRPLLRMLAGSSSPDFDISGGISKILDEQREIRELLKDSDRPTVLISARRQAFKDSLQEGILGPENIEVSFESFPYYLSDITKNVLIASTYVHLKCNNFAKYASDLPTMCPRILLSGPAGSEIYQETLAKALAKHFSARLLIVDSLLLP*******************************************************************FKKGDRVKFVGNVTSGTTVQPTLRGPGIGFRGRVILPFEDNDFSKIGVRFDRSIPEGNNLGGFCEDDHGFFCTASSLRLDSSLGDEVDKLAINELFEVALNESKSSPLIVFVKDIEKSLTGNNDAYGALKSKLENLPSNVVVIGSHTQLDSRKEKSHPGGLLFTKFGSNQTALLDLAFPDNFSRLHDRSKETPKALKQISRLFPNKVTIQLPQDEALLSDWKQQLERDVETLKGQSNIISIRSVLSRNGLDCVDLESLCIKDQTLTTEGVEKIVGWALSHHFMHCSEAPGKDAKLKISTESIMYGLNILQGIQSESKSLKKSLKDVVTENEFEKKLLADVIPPSDIGVTFDDIGALENVKDTLKELVMLPLQRPELFCKGQLTKPCKGILLFGPPGTGKTMLAKAVATEAGANFINISMSSITSKVDSMLGRRENPGEHEAMRKMKNEFMVNWDGLRTKDKERVLVLAATNRPFDLDEAVVRRLPRRLMVNLPDAPNREKIIRVILAKEELASDVDLEGIANMADGYSGSDLKNLCVTAAHCPIREILEKEKKERALALA**********SVDVRPLKMDDFKYAHEQVCASVSSESTNMNELLQWNELYGEGGSRKRKSLSYFM

ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii

ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii

SSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST

Original result of BLAST against SWISS-PROT Database

ID	Alignment graph	Length	Definition	RBH(Q2H)	RBH(H2Q)	Q cover	H cover	Identity	E-value
Query		1223	2.2.26 [Sep-21-2011]
Q5ZK92		613	Spastin OS=Gallus gallus	yes	no	0.210	0.420	0.375	3e-47
Q6DDU8		655	Fidgetin-like protein 1 O	N/A	no	0.207	0.387	0.382	3e-47
A4IHT0		656	Fidgetin-like protein 1 O	yes	no	0.201	0.376	0.389	5e-47
Q8BPY9		683	Fidgetin-like protein 1 O	yes	no	0.207	0.371	0.372	7e-47
Q9QYY8		614	Spastin OS=Mus musculus G	no	no	0.224	0.446	0.372	1e-46
B2RYN7		581	Spastin OS=Rattus norvegi	yes	no	0.224	0.471	0.372	1e-46
Q7ZZ25		380	ATPase family AAA domain-	no	no	0.225	0.726	0.339	2e-46
Q6GX84		677	Fidgetin-like protein 1 O	yes	no	0.201	0.364	0.372	3e-46
Q505J9		361	ATPase family AAA domain-	no	no	0.211	0.717	0.360	3e-46
Q9D5T0		361	ATPase family AAA domain-	no	no	0.211	0.717	0.360	3e-46

>sp\|Q5ZK92\|SPAST_CHICK Spastin OS=Gallus gallus GN=SPAST PE=2 SV=1	Back alignment and function desciption

 Score =  191 bits (485), Expect = 3e-47,   Method: Compositional matrix adjust.
 Identities = 115/306 (37%), Positives = 176/306 (57%), Gaps = 48/306 (15%)

Query: 934  LLADVIPPSDIGVTFDDIGALENVKDTLKELVMLPLQRPELFCKGQLTKPCKGILLFGPP 993
            L+ + I  S   V FDDI   E  K  L+E+V+LP  RPELF    L  P +G+LLFGPP
Sbjct: 324  LILNEIVDSGPAVKFDDIAGQELAKQALQEIVILPSLRPELFTG--LRAPARGLLLFGPP 381

Query: 994  GTGKTMLAKAVATEAGANFINISMSSITSK----------------------------VD 1025
            G GKTMLAKAVA E+ A F NIS +S+TSK                            VD
Sbjct: 382  GNGKTMLAKAVAAESNATFFNISAASLTSKYVGEGEKLVRALFAVARELQPSIIFIDEVD 441

Query: 1026 SMLGRRENPGEHEAMRKMKNEFMVNWDGLRTKDKERVLVLAATNRPFDLDEAVVRRLPRR 1085
            S+L  R   GEH+A R++K EF++ +DG+++  ++R+LV+ ATNRP +LD+AV+RR  +R
Sbjct: 442  SLLCERRE-GEHDASRRLKTEFLIEFDGVQSSGEDRILVMGATNRPQELDDAVLRRFTKR 500

Query: 1086 LMVNLPDAPNREKIIRVILAKE-ELASDVDLEGIANMADGYSGSDLKNLCVTAAHCPIRE 1144
            + V+LP+   R  +++ +L+K+    +  +L  +A M DGYSGSDL  L   AA  PIRE
Sbjct: 501  VYVSLPNEETRLILLKNLLSKQGSPLTQKELAQLARMTDGYSGSDLTALVKDAALGPIRE 560

Query: 1145 ILEKEKKERALALAENRASPPLYSSVDVRPLKMDDFKYAHEQVCASVSSESTNMNELLQW 1204
            +  ++ K                S+ ++R +K+ DF  + +++  S+S ++  +   ++W
Sbjct: 561  LKPEQVKN--------------MSASEMRNIKLSDFTESLKKIKRSLSPQT--LEAYIRW 604

Query: 1205 NELYGE 1210
            N+ +G+
Sbjct: 605  NKDFGD 610

ATP-dependent microtubule severing protein. Microtubule severing may promote reorganization of cellular microtubule arrays and the release of microtubules from the centrosome following nucleation. Required for membrane traffic from the endoplasmic reticulum (ER) to the Golgi and for completion of the abscission stage of cytokinesis. Also plays a role in axon growth and the formation of axonal branches.
Gallus gallus (taxid: 9031)
EC: 3EC: .EC: 6EC: .EC: 4EC: .EC: 3

>sp\|Q6DDU8\|FIGL1_XENLA Fidgetin-like protein 1 OS=Xenopus laevis GN=fignl1 PE=2 SV=1	Back alignment and function description

>sp\|A4IHT0\|FIGL1_XENTR Fidgetin-like protein 1 OS=Xenopus tropicalis GN=fignl1 PE=2 SV=1	Back alignment and function description

>sp\|Q8BPY9\|FIGL1_MOUSE Fidgetin-like protein 1 OS=Mus musculus GN=Fignl1 PE=2 SV=1	Back alignment and function description

>sp\|Q9QYY8\|SPAST_MOUSE Spastin OS=Mus musculus GN=Spast PE=2 SV=3	Back alignment and function description

>sp\|B2RYN7\|SPAST_RAT Spastin OS=Rattus norvegicus GN=Spast PE=2 SV=1	Back alignment and function description

>sp\|Q7ZZ25\|ATD1A_DANRE ATPase family AAA domain-containing protein 1-A OS=Danio rerio GN=atad1a PE=2 SV=2	Back alignment and function description

>sp\|Q6GX84\|FIGL1_RAT Fidgetin-like protein 1 OS=Rattus norvegicus GN=Fignl1 PE=2 SV=1	Back alignment and function description

>sp\|Q505J9\|ATAD1_RAT ATPase family AAA domain-containing protein 1 OS=Rattus norvegicus GN=Atad1 PE=1 SV=1	Back alignment and function description

>sp\|Q9D5T0\|ATAD1_MOUSE ATPase family AAA domain-containing protein 1 OS=Mus musculus GN=Atad1 PE=1 SV=1	Back alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST

Original result of BLAST against Nonredundant Database

GI	Alignment Graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		1223
359479902		1258	PREDICTED: uncharacterized protein LOC10	0.971	0.944	0.715	0.0
297743865		1287	unnamed protein product [Vitis vinifera]	0.972	0.923	0.701	0.0
224131154		1231	predicted protein [Populus trichocarpa]	0.896	0.891	0.720	0.0
449436513		1270	PREDICTED: uncharacterized protein LOC10	0.971	0.935	0.670	0.0
356536729		1250	PREDICTED: uncharacterized protein LOC10	0.946	0.925	0.683	0.0
224064434		1223	predicted protein [Populus trichocarpa]	0.910	0.910	0.701	0.0
356536727		1247	PREDICTED: uncharacterized protein LOC10	0.961	0.943	0.676	0.0
356502858		1235	PREDICTED: uncharacterized protein LOC10	0.968	0.958	0.661	0.0
357442557		1242	Katanin p60 ATPase-containing subunit A-	0.981	0.966	0.647	0.0
356502860		1334	PREDICTED: uncharacterized protein LOC10	0.871	0.799	0.711	0.0

>gi\|359479902\|ref\|XP_002267361.2\| PREDICTED: uncharacterized protein LOC100260666 [Vitis vinifera]	Back alignment and taxonomy information

 Score = 1711 bits (4432), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 888/1241 (71%), Positives = 1007/1241 (81%), Gaps = 53/1241 (4%)

Query: 27   KRSKATDAPPSTGDMPVAPPSEA---ASKSGSESREPELRSSDLDLTDDAKPADV----- 78
            KRSK+ +   S+ ++P   P EA   A +SGSE  +   + SD   TD +K +D      
Sbjct: 27   KRSKSQETASSSSEVPGPLPEEALCQAKESGSEHIDQAPQPSDPPRTDTSKASDACDVIA 86

Query: 79   -DKSVDADVEADALV--SPPTPGETAVDAEKSKAVGVVFNGRVKKRATKLGKVGSRIPWA 135
             +KS +A  E +ALV  SP    ++AV  EKSK+V VV N R +KR+ K     + + W 
Sbjct: 87   KEKSTEAVAEGEALVAASPLPLVDSAVGGEKSKSVAVVSN-RGRKRSVK---SNATVAWG 142

Query: 136  RLISQCSQNSHLSMTGAVFTVGHNRQCDLYLKDPSISKNLCRLRRIENGGPSGALLEITG 195
            +L+SQCSQ  H  + G +FT+G +R  +L L+DPSIS  LCRLR IE GG S  LLEITG
Sbjct: 143  KLLSQCSQYPHQPLCGPLFTIGQSRASNLSLRDPSISNTLCRLRHIERGGASVVLLEITG 202

Query: 196  GKGEVEVNGNVHPKDSQVVLRGGDELVFSPSGKHSYIFQQLSDDTLAAPGIHPPMSILEA 255
            GKG V+VNG +H K S +++ GGDELVFS SG+ +YIFQQ + D LAAP I   +SILEA
Sbjct: 203  GKGVVQVNGKIHQKSSTLIISGGDELVFSASGQPAYIFQQFTSDNLAAPVIPSSVSILEA 262

Query: 256  QSAPLKTMHIEARSGDPSAVAGASILASLSNIQKDLSLIPPPTKAGVDAQN-SEIASLAS 314
            QSAP+K +H+EARSGDPSAVAGASILASLSN++KDLSL+PPP K+G D Q  +E+ +   
Sbjct: 263  QSAPVKGIHVEARSGDPSAVAGASILASLSNLRKDLSLLPPP-KSGEDVQQGTEMTT--P 319

Query: 315  GCDGPEDRIPDVDMKDATSNNDDAGSSSRGKTVVPQSDAANENPNLDSIGLDACVDAEIG 374
             C   +  IPD DMKDA  NND AG SSR KT VP S+AANEN NL SIGLDAC D EIG
Sbjct: 320  PCGASDSCIPDADMKDA-ENNDVAGVSSREKTDVPSSEAANENLNLQSIGLDACTDTEIG 378

Query: 375  KIPGATYELRPLLRMLAGSSSPDFDISGGISKILDEQREIRELLKDSDRPTVLISARRQA 434
            K+PGATYELRPLLRMLAGSSS DFD+SG ISKIL+EQREIRE+LKD + P  L S RRQA
Sbjct: 379  KVPGATYELRPLLRMLAGSSSSDFDLSGSISKILEEQREIREILKDLEPPMALTSTRRQA 438

Query: 435  FKDSLQEGILGPENIEVSFESFPYYLSDITKNVLIASTYVHLKCNNFAKYASDLPTMCPR 494
            FKDSLQEGIL  ++IEVSFESFPYYLSD TKNVLI STY+HL    FAKY  DL ++CPR
Sbjct: 439  FKDSLQEGILSSDDIEVSFESFPYYLSDTTKNVLITSTYIHLMHIKFAKYTMDLSSVCPR 498

Query: 495  ILLSGPAGSEIYQETLAKALAKHFSARLLIVDSLLLPGGSS-KEADSVKESSRTEKASMF 553
            ILLSGPAGSEIYQETL KALAKHF+ARLLIVDSLLLPGGS+ K+ D VKE++R E+AS+F
Sbjct: 499  ILLSGPAGSEIYQETLTKALAKHFTARLLIVDSLLLPGGSTPKDPDPVKENTRGERASIF 558

Query: 554  AKRAA---LLQHRKPTSSVEADITGGTAVGSQALPKPEISTASSKNYTFKKGDRVKFVGN 610
            AKRAA   +LQH+KP SSVEADITG + V S+ALPK E STA+SKNY FK G  VKFVG 
Sbjct: 559  AKRAAQAAVLQHKKPASSVEADITGASTVSSRALPKQETSTATSKNYIFKAG-IVKFVGP 617

Query: 611  VTSGTTVQPTLRGPGIGFRGRVILPFEDNDFSKIGVRFDRSIPEGNNLGGFCEDDHGFFC 670
              SG +  P LRGP  G+RG+V+L FE+N  SKIGVRFDRSIPEGN+LGG CEDDHGFFC
Sbjct: 618  PPSGFSPMPPLRGPTNGYRGKVLLAFEENGSSKIGVRFDRSIPEGNDLGGLCEDDHGFFC 677

Query: 671  TASSLRLDSSLGDEVDKLAINELFEVALNESKSSPLIVFVKDIEKSLTGNNDAYGALKSK 730
             A  LRLDSS  D+VDKLA+NELFEVA NESKSSPLI+F+KDIEKS+ GN +AY      
Sbjct: 678  PADLLRLDSSSSDDVDKLALNELFEVASNESKSSPLILFIKDIEKSIVGNPEAYXXXXXX 737

Query: 731  LENLPSNVVVIGSHTQLDSRKEKSHPGGLLFTKFGSNQTALLDLAFPDNFSRLHDRSKET 790
            L+NLP N+V+IGSHTQ+DSRKEKSHPGGLLFTKFGSNQTALLDLAFPDNF RLHDRSKET
Sbjct: 738  LDNLPENIVIIGSHTQMDSRKEKSHPGGLLFTKFGSNQTALLDLAFPDNFGRLHDRSKET 797

Query: 791  PKALKQISRLFPNKVTIQLPQDEALLSDWKQQLERDVETLKGQSNIISIRSVLSRNGLDC 850
            PK +KQ++RLFPNKV IQLPQDE+LL DWKQQL+RD ETLK Q+NI++IRSVL+RNGLDC
Sbjct: 798  PKTMKQLTRLFPNKVMIQLPQDESLLLDWKQQLDRDGETLKAQANIVNIRSVLNRNGLDC 857

Query: 851  VDLESLCIKDQTLTTEGVEKIVGWALSHHFMHCSEAPGKDAKLKISTESIMYGLNILQGI 910
             DLE+L IKDQ+L ++GV+K+VGWALS+HFMHCS+A  +D+KL IS+ESI YGLN+LQGI
Sbjct: 858  PDLETLSIKDQSLASDGVDKLVGWALSYHFMHCSDASVRDSKLLISSESISYGLNLLQGI 917

Query: 911  QSESKSLKKSLKDVVTENEFEKKLLADVIPPSDIGVTFDDIGALENVKDTLKELVMLPLQ 970
            QSESKSLKKSLKDVVTENEFEKKLL+DVIPPSDIGVTFDDIGALENVKDTLKELVMLPLQ
Sbjct: 918  QSESKSLKKSLKDVVTENEFEKKLLSDVIPPSDIGVTFDDIGALENVKDTLKELVMLPLQ 977

Query: 971  RPELFCKGQLTKPCKGILLFGPPGTGKTMLAKAVATEAGANFINISMSSITSK------- 1023
            RPELFCKGQLTKPCKGILLFGPPGTGKTMLAKAVATEAGANFINISMSSITSK       
Sbjct: 978  RPELFCKGQLTKPCKGILLFGPPGTGKTMLAKAVATEAGANFINISMSSITSKWFGEGEK 1037

Query: 1024 ---------------------VDSMLGRRENPGEHEAMRKMKNEFMVNWDGLRTKDKERV 1062
                                 VDSMLGRRENPGEHEAMRKMKNEFMVNWDGLRTKDKERV
Sbjct: 1038 YVKAVFSLASKIAPSVVFVDEVDSMLGRRENPGEHEAMRKMKNEFMVNWDGLRTKDKERV 1097

Query: 1063 LVLAATNRPFDLDEAVVRRLPRRLMVNLPDAPNREKIIRVILAKEELASDVDLEGIANMA 1122
            LVLAATNRPFDLDEAV+RRLPRRLMVNLPDA NREKI+RVILAKEELA DV LE +ANM 
Sbjct: 1098 LVLAATNRPFDLDEAVIRRLPRRLMVNLPDALNREKILRVILAKEELAPDVGLEAVANMT 1157

Query: 1123 DGYSGSDLKNLCVTAAHCPIREILEKEKKERALALAENRASPPLYSSVDVRPLKMDDFKY 1182
            DGYSGSDLKNLCVTAAHCPIREILE+EKKE+ALALAE+RA P LY S D+RPL ++DF+Y
Sbjct: 1158 DGYSGSDLKNLCVTAAHCPIREILEREKKEKALALAESRALPALYCSTDIRPLNIEDFRY 1217

Query: 1183 AHEQVCASVSSESTNMNELLQWNELYGEGGSRKRKSLSYFM 1223
            AHEQVCASVSSESTNM ELLQWNELYGEGGSRKR SLSYFM
Sbjct: 1218 AHEQVCASVSSESTNMTELLQWNELYGEGGSRKRASLSYFM 1258

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi\|297743865\|emb\|CBI36835.3\| unnamed protein product [Vitis vinifera]	Back alignment and taxonomy information

>gi\|224131154\|ref\|XP_002321014.1\| predicted protein [Populus trichocarpa] gi\|222861787\|gb\|EEE99329.1\| predicted protein [Populus trichocarpa]	Back alignment and taxonomy information

>gi\|449436513\|ref\|XP_004136037.1\| PREDICTED: uncharacterized protein LOC101211144 [Cucumis sativus]	Back alignment and taxonomy information

>gi\|356536729\|ref\|XP_003536888.1\| PREDICTED: uncharacterized protein LOC100794932 [Glycine max]	Back alignment and taxonomy information

>gi\|224064434\|ref\|XP_002301474.1\| predicted protein [Populus trichocarpa] gi\|222843200\|gb\|EEE80747.1\| predicted protein [Populus trichocarpa]	Back alignment and taxonomy information

>gi\|356536727\|ref\|XP_003536887.1\| PREDICTED: uncharacterized protein LOC100794406 [Glycine max]	Back alignment and taxonomy information

>gi\|356502858\|ref\|XP_003520232.1\| PREDICTED: uncharacterized protein LOC100800938 [Glycine max]	Back alignment and taxonomy information

>gi\|357442557\|ref\|XP_003591556.1\| Katanin p60 ATPase-containing subunit A-like protein [Medicago truncatula] gi\|355480604\|gb\|AES61807.1\| Katanin p60 ATPase-containing subunit A-like protein [Medicago truncatula]	Back alignment and taxonomy information

>gi\|356502860\|ref\|XP_003520233.1\| PREDICTED: uncharacterized protein LOC100801477 [Glycine max]	Back alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST

Original result of BLAST against Gene Ontology (AMIGO)

ID	Alignment graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		1223
TAIR\|locus:2133298		1265	AT4G02480 [Arabidopsis thalian	0.787	0.761	0.600	0.0
TAIR\|locus:2126783		1122	AT4G24860 [Arabidopsis thalian	0.195	0.213	0.6	7.4e-192
TAIR\|locus:2132922		830	AT4G28000 [Arabidopsis thalian	0.163	0.240	0.502	4.3e-119
TAIR\|locus:2024522		829	DAA1 "DUO1-activated ATPase 1"	0.164	0.242	0.524	1e-102
TAIR\|locus:2031005		1003	AT1G50140 [Arabidopsis thalian	0.153	0.187	0.497	5.3e-101
TAIR\|locus:4010714050		829	AT5G52882 [Arabidopsis thalian	0.163	0.241	0.507	4.1e-98
TAIR\|locus:2137777		398	AT4G27680 [Arabidopsis thalian	0.096	0.296	0.478	5.5e-52
TAIR\|locus:2168646		403	AT5G53540 [Arabidopsis thalian	0.096	0.292	0.462	1.5e-48
FB\|FBgn0005322		369	nmd "no mitochondrial derivati	0.094	0.311	0.448	1.3e-42
ZFIN\|ZDB-GENE-030616-593		380	atad1a "ATPase family, AAA dom	0.094	0.302	0.482	1.7e-42

TAIR\|locus:2133298 AT4G02480 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

 Score = 2851 (1008.7 bits), Expect = 0., Sum P(2) = 0.
 Identities = 604/1006 (60%), Positives = 726/1006 (72%)

Query:    37 STGDMPVAPPSEAASKSGSESREPELRSSDLDLTDDAKPA---DV---DKS--VDADVEA 88
             S  ++P+     A S  GSES EPEL SSD    D  KP    DV   + S   DA+ E 
Sbjct:    56 SASEVPIENQGPA-SDPGSESGEPELGSSDPQAMDAEKPVVTTDVPVMENSPETDANPEV 114

Query:    89 DALVSPPTPGETAVDAEKSKAVGVVFNGRVKKRATKLGKVGSRIPWARLISQCSQNSHLS 148
             + L +P   GE   DA+KSKA         KKRA K        PWA+L+SQ SQN H  
Sbjct:   115 EVLATPTVAGEAVADADKSKAA--------KKRALKA-------PWAKLLSQYSQNPHRV 159

Query:   149 MTGAVFTVGHNRQCDLYLKDPSISKNLCRLRRIENGGPSGALLEITXXXXXXXXXXXXHP 208
             + G VFTVG  R CDL ++D ++   LC L++ E+GGPS A LEI             + 
Sbjct:   160 IRGPVFTVGR-RGCDLSIRDQAMPSTLCELKQSEHGGPSVASLEILGNGVIVHVNGKCYQ 218

Query:   209 KDSQVVLRGGDELVFSPSGKHSYIFQQLSDDTLAAPGIHPPMSILEAQSAPLKTMHIEAR 268
             K + V LRGGDE++FS +GKH+YIFQ + D+ LAAP     +SI EA+ APLK +H+E R
Sbjct:   219 KSTCVHLRGGDEVIFSLNGKHAYIFQPVKDENLAAPDRASSLSICEARGAPLKGVHVETR 278

Query:   269 SGD---PSAVAGASILASLSNIQKDLSLIPPPTKAGVDAQNSEIASLASGCDGPEDRIPD 325
             +GD    S V GASILASLS + +   L+PP  KAG   QN  +  + S  +   D I D
Sbjct:   279 AGDVDGASDVDGASILASLSKL-RSFHLLPPIAKAGKRQQNPAVPVVPSSFN---DCISD 334

Query:   326 VDMKDATSNNDDAGSSSRGKTVVPQSDA-ANENPNLDSIGLDACVDAEIGKIPGATYELR 384
              DM DA SNND A  +S  K     +   ANEN N+D  GLD   +A+ G +P A YE+R
Sbjct:   335 TDMNDADSNNDHAAVASVEKIAAASTPGTANENLNVDGSGLDPFQEADGGNVPAAGYEIR 394

Query:   385 PLLRMLAGSSSPDFDISGGISKILDEQREIRELLKDSDRPTVLISARRQAFKDSLQEGIL 444
             P++ +L  SSS  FDI G IS++LDE+RE++E L++ D  +  IS RRQAFKDSL+ G+L
Sbjct:   395 PIVHLLGESSS--FDIRGSISRLLDERREVKEFLREFDLSST-ISTRRQAFKDSLRGGVL 451

Query:   445 GPENIEVSFESFPYYLSDITKNVLIASTYVHLKCNN-FAKYASDLPTMCPRILLSGPAGS 503
               +NI++SFE+FPYYLS  TK VL+ S YVH+   + +A +A+DL T CPRILLSGP+GS
Sbjct:   452 NAQNIDISFENFPYYLSATTKGVLMISMYVHMNGGSKYANFATDLTTACPRILLSGPSGS 511

Query:   504 EIYQETLAKALAKHFSARLLIVDSLLLPGGS-SKEADSVKESSRTEKASMFAKRAA---- 558
             EIYQE LAKALAK F A+L+IVDSLLLPGGS ++EA+S KE SR E+ SM AKRA     
Sbjct:   512 EIYQEMLAKALAKQFGAKLMIVDSLLLPGGSPAREAESSKEGSRRERLSMLAKRAVQAAQ 571

Query:   559 LLQHRKPTSSVEADITGGTAVGSQALPKPEISTASSKNYTFKKGDRVKFVGNVTSG-TTV 617
             +LQH+KPTSSV+ADITGG+ + SQALPK E+STA+SK+YTFK GDRVKFVG   S  +++
Sbjct:   572 VLQHKKPTSSVDADITGGSTLSSQALPKQEVSTATSKSYTFKAGDRVKFVGPSASAISSL 631

Query:   618 QPTLRGPGIGFRGRVILPFEDNDFSKIGVRFDRSIPEGNNLGGFCEDDHGFFCTASSLRL 677
             Q  LRGP IG +G+V L FEDN  SKIG+RFDR + +GN+LGG CE+DHGFFC ASSLRL
Sbjct:   632 QGQLRGPAIGSQGKVALAFEDNCASKIGIRFDRPVQDGNDLGGLCEEDHGFFCAASSLRL 691

Query:   678 DSSLGDEVDKLAINELFEVALNESKSSPLIVFVKDIEKSLTGNNDAYGALKSKLENLPSN 737
             + S  D+ DKLA+NE+FEVAL+ES+   LI+F+KDIEKSL GN+D Y  LKSKLE LP N
Sbjct:   692 EGSSSDDADKLAVNEIFEVALSESEGGSLILFLKDIEKSLVGNSDVYATLKSKLETLPEN 751

Query:   738 VVVIGSHTQLDSRKEKSHPGGLLFTKFGSNQTALLDLAFPDNFSRLHDRSKETPKALKQI 797
             +VVI S TQLDSRKEKSHPGG LFTKFG NQTALLDLAFPDNF +LHDRSKETPK++KQI
Sbjct:   752 IVVIASQTQLDSRKEKSHPGGFLFTKFGGNQTALLDLAFPDNFGKLHDRSKETPKSMKQI 811

Query:   798 SRLFPNKVTIQLPQDEALLSDWKQQLERDVETLKGQSNIISIRSVLSRNGLDCVDLESLC 857
             +RLFPNK+ IQLPQ+EALLSDWK++L+RD E LK Q+NI SI +VL++N LDC DL +LC
Sbjct:   812 TRLFPNKIAIQLPQEEALLSDWKEKLDRDTEILKVQANITSILAVLAKNKLDCPDLGTLC 871

Query:   858 IKDQTLTTEGVEKIVGWALSHHFMHCSEAPGKDAKLKISTESIMYGLNILQGIQXXXXXX 917
             IKDQTL +E VEK+VGWA  HH M C+E   KD KL IS ESI YGL  L  IQ      
Sbjct:   872 IKDQTLPSESVEKVVGWAFGHHLMICTEPIVKDNKLVISAESISYGLQTLHDIQNENKSL 931

Query:   918 XXXXXDVVTENEFEKKLLADVIPPSDIGVTFDDIGALENVKDTLKELVMLPLQRPELFCK 977
                  DVVTENEFEKKLL+DVIPPSDIGV+FDDIGALENVK+TLKELVMLPLQRPELF K
Sbjct:   932 KKSLKDVVTENEFEKKLLSDVIPPSDIGVSFDDIGALENVKETLKELVMLPLQRPELFDK 991

Query:   978 GQLTKPCKGILLFGPPGTGKTMLAKAVATEAGANFINISMSSITSK 1023
             GQLTKP KGILLFGPPGTGKTMLAKAVATEAGANFINISMSSITSK
Sbjct:   992 GQLTKPTKGILLFGPPGTGKTMLAKAVATEAGANFINISMSSITSK 1037

GO:0000166 "nucleotide binding" evidence=IEA

GO:0005524 "ATP binding" evidence=IEA

GO:0009507 "chloroplast" evidence=ISM

GO:0016887 "ATPase activity" evidence=ISS

GO:0017111 "nucleoside-triphosphatase activity" evidence=IEA

GO:0006487 "protein N-linked glycosylation" evidence=RCA

GO:0009630 "gravitropism" evidence=RCA

TAIR\|locus:2126783 AT4G24860 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2132922 AT4G28000 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2024522 DAA1 "DUO1-activated ATPase 1" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2031005 AT1G50140 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:4010714050 AT5G52882 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2137777 AT4G27680 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2168646 AT5G53540 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

FB\|FBgn0005322 nmd "no mitochondrial derivative" [Drosophila melanogaster (taxid:7227)]	Back alignment and assigned GO terms

ZFIN\|ZDB-GENE-030616-593 atad1a "ATPase family, AAA domain containing 1a" [Danio rerio (taxid:7955)]	Back alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING

Original result from the STRING server

Your Input:
	GSVIVG00027975001	SubName- Full=Chromosome chr7 scaffold_42, whole genome shotgun sequence; (1146 aa)
		(Vitis vinifera)
Predicted Functional Partners:
		Sorry, there are no predicted associations at the current settings.

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST

Original result of RPS-BLAST against CDD database part I

ID	Alignment Graph	Length	Definition	E-value
Query		1223
COG0464		494	COG0464, SpoVK, ATPases of the AAA+ class [Posttra	1e-56
PRK03992		389	PRK03992, PRK03992, proteasome-activating nucleoti	4e-41
COG1222		406	COG1222, RPT1, ATP-dependent 26S proteasome regula	6e-41
TIGR01243		733	TIGR01243, CDC48, AAA family ATPase, CDC48 subfami	9e-39
TIGR01242		364	TIGR01242, 26Sp45, 26S proteasome subunit P45 fami	4e-37
TIGR01243		733	TIGR01243, CDC48, AAA family ATPase, CDC48 subfami	1e-35
TIGR01241		495	TIGR01241, FtsH_fam, ATP-dependent metalloprotease	2e-35
CHL00176		638	CHL00176, ftsH, cell division protein; Validated	1e-30
PTZ00361		438	PTZ00361, PTZ00361, 26 proteosome regulatory subun	2e-28
pfam00004		131	pfam00004, AAA, ATPase family associated with vari	1e-27
PTZ00454		398	PTZ00454, PTZ00454, 26S protease regulatory subuni	1e-26
COG0465		596	COG0465, HflB, ATP-dependent Zn proteases [Posttra	4e-26
PRK10733		644	PRK10733, hflB, ATP-dependent metalloprotease; Rev	1e-25
COG1223		368	COG1223, COG1223, Predicted ATPase (AAA+ superfami	3e-20
COG0464		494	COG0464, SpoVK, ATPases of the AAA+ class [Posttra	2e-17
cd00009		151	cd00009, AAA, The AAA+ (ATPases Associated with a	2e-13
TIGR03689		512	TIGR03689, pup_AAA, proteasome ATPase	2e-12
cd00060		102	cd00060, FHA, Forkhead associated domain (FHA); fo	2e-06
PRK13342		413	PRK13342, PRK13342, recombination factor protein R	5e-06
CHL00195		489	CHL00195, ycf46, Ycf46; Provisional	6e-06
smart00382		148	smart00382, AAA, ATPases associated with a variety	6e-06
COG0714		329	COG0714, COG0714, MoxR-like ATPases [General funct	1e-05
pfam00498		67	pfam00498, FHA, FHA domain	1e-04
PRK00080		328	PRK00080, ruvB, Holliday junction DNA helicase Ruv	2e-04
COG2256		436	COG2256, MGS1, ATPase related to the helicase subu	2e-04
COG2255		332	COG2255, RuvB, Holliday junction resolvasome, heli	3e-04
COG1224		450	COG1224, TIP49, DNA helicase TIP49, TBP-interactin	3e-04
pfam05496		231	pfam05496, RuvB_N, Holliday junction DNA helicase	0.001
PRK08116		268	PRK08116, PRK08116, hypothetical protein; Validate	0.002
pfam06068		395	pfam06068, TIP49, TIP49 C-terminus	0.002
pfam01078		207	pfam01078, Mg_chelatase, Magnesium chelatase, subu	0.002
COG0466		782	COG0466, Lon, ATP-dependent Lon protease, bacteria	0.003

>gnl\|CDD\|223540 COG0464, SpoVK, ATPases of the AAA+ class [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

 Score =  204 bits (521), Expect = 1e-56
 Identities = 108/290 (37%), Positives = 152/290 (52%), Gaps = 44/290 (15%)

Query: 913  ESKSLKKSLKDVVTENEFEKKLLADVIPPSDIG-----VTFDDIGALENVKDTLKELVML 967
                        VTE++FE+  L  V+P   +      VT DDIG LE  K+ LKE +  
Sbjct: 202  RRAIDLVGEYIGVTEDDFEE-ALKKVLPSRGVLFEDEDVTLDDIGGLEEAKEELKEAIET 260

Query: 968  PLQRPELFCKGQLTKPCKGILLFGPPGTGKTMLAKAVATEAGANFINISMSSITSK---- 1023
            PL+RPELF K  L +P KG+LL+GPPGTGKT+LAKAVA E+ + FI++  S + SK    
Sbjct: 261  PLKRPELFRKLGL-RPPKGVLLYGPPGTGKTLLAKAVALESRSRFISVKGSELLSKWVGE 319

Query: 1024 ------------------------VDSMLGRRENPGEHEAMRKMKNEFMVNWDGLRTKDK 1059
                                    +DS+   R  P E  + R++  + +   DG+  +  
Sbjct: 320  SEKNIRELFEKARKLAPSIIFIDEIDSLASGR-GPSEDGSGRRVVGQLLTELDGI--EKA 376

Query: 1060 ERVLVLAATNRPFDLDEAVVR--RLPRRLMVNLPDAPNREKIIRVILAKEE--LASDVDL 1115
            E VLV+AATNRP DLD A++R  R  R + V LPD   R +I ++ L  ++  LA DVDL
Sbjct: 377  EGVLVIAATNRPDDLDPALLRPGRFDRLIYVPLPDLEERLEIFKIHLRDKKPPLAEDVDL 436

Query: 1116 EGIANMADGYSGSDLKNLCVTAAHCPIREILEKEKKERAL--ALAENRAS 1163
            E +A + +GYSG+D+  L   AA   +RE   +E        AL + + S
Sbjct: 437  EELAEITEGYSGADIAALVREAALEALREARRREVTLDDFLDALKKIKPS 486

Length = 494

>gnl\|CDD\|179699 PRK03992, PRK03992, proteasome-activating nucleotidase; Provisional	Back alignment and domain information

>gnl\|CDD\|224143 COG1222, RPT1, ATP-dependent 26S proteasome regulatory subunit [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>gnl\|CDD\|233328 TIGR01243, CDC48, AAA family ATPase, CDC48 subfamily	Back alignment and domain information

>gnl\|CDD\|130309 TIGR01242, 26Sp45, 26S proteasome subunit P45 family	Back alignment and domain information

>gnl\|CDD\|233328 TIGR01243, CDC48, AAA family ATPase, CDC48 subfamily	Back alignment and domain information

>gnl\|CDD\|233327 TIGR01241, FtsH_fam, ATP-dependent metalloprotease FtsH	Back alignment and domain information

>gnl\|CDD\|214386 CHL00176, ftsH, cell division protein; Validated	Back alignment and domain information

>gnl\|CDD\|185575 PTZ00361, PTZ00361, 26 proteosome regulatory subunit 4-like protein; Provisional	Back alignment and domain information

>gnl\|CDD\|215649 pfam00004, AAA, ATPase family associated with various cellular activities (AAA)	Back alignment and domain information

>gnl\|CDD\|240423 PTZ00454, PTZ00454, 26S protease regulatory subunit 6B-like protein; Provisional	Back alignment and domain information

>gnl\|CDD\|223541 COG0465, HflB, ATP-dependent Zn proteases [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>gnl\|CDD\|182683 PRK10733, hflB, ATP-dependent metalloprotease; Reviewed	Back alignment and domain information

>gnl\|CDD\|224144 COG1223, COG1223, Predicted ATPase (AAA+ superfamily) [General function prediction only]	Back alignment and domain information

>gnl\|CDD\|223540 COG0464, SpoVK, ATPases of the AAA+ class [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>gnl\|CDD\|99707 cd00009, AAA, The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold	Back alignment and domain information

>gnl\|CDD\|200312 TIGR03689, pup_AAA, proteasome ATPase	Back alignment and domain information

>gnl\|CDD\|238017 cd00060, FHA, Forkhead associated domain (FHA); found in eukaryotic and prokaryotic proteins	Back alignment and domain information

>gnl\|CDD\|237355 PRK13342, PRK13342, recombination factor protein RarA; Reviewed	Back alignment and domain information

>gnl\|CDD\|177094 CHL00195, ycf46, Ycf46; Provisional	Back alignment and domain information

>gnl\|CDD\|214640 smart00382, AAA, ATPases associated with a variety of cellular activities	Back alignment and domain information

>gnl\|CDD\|223786 COG0714, COG0714, MoxR-like ATPases [General function prediction only]	Back alignment and domain information

>gnl\|CDD\|215951 pfam00498, FHA, FHA domain	Back alignment and domain information

>gnl\|CDD\|234619 PRK00080, ruvB, Holliday junction DNA helicase RuvB; Reviewed	Back alignment and domain information

>gnl\|CDD\|225165 COG2256, MGS1, ATPase related to the helicase subunit of the Holliday junction resolvase [DNA replication, recombination, and repair]	Back alignment and domain information

>gnl\|CDD\|225164 COG2255, RuvB, Holliday junction resolvasome, helicase subunit [DNA replication, recombination, and repair]	Back alignment and domain information

>gnl\|CDD\|224145 COG1224, TIP49, DNA helicase TIP49, TBP-interacting protein [Transcription]	Back alignment and domain information

>gnl\|CDD\|203260 pfam05496, RuvB_N, Holliday junction DNA helicase ruvB N-terminus	Back alignment and domain information

>gnl\|CDD\|236153 PRK08116, PRK08116, hypothetical protein; Validated	Back alignment and domain information

>gnl\|CDD\|147949 pfam06068, TIP49, TIP49 C-terminus	Back alignment and domain information

>gnl\|CDD\|144608 pfam01078, Mg_chelatase, Magnesium chelatase, subunit ChlI	Back alignment and domain information

>gnl\|CDD\|223542 COG0466, Lon, ATP-dependent Lon protease, bacterial type [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

Conserved Domains Detected by HHsearch

Original result of HHsearch against CDD database

ID	Alignment Graph	Length	Definition	Probability
Query		1223
KOG0737		386	consensus AAA+-type ATPase [Posttranslational modi	100.0
KOG0733		802	consensus Nuclear AAA ATPase (VCP subfamily) [Post	100.0
KOG0730		693	consensus AAA+-type ATPase [Posttranslational modi	100.0
KOG0736		953	consensus Peroxisome assembly factor 2 containing	100.0
COG1222		406	RPT1 ATP-dependent 26S proteasome regulatory subun	100.0
KOG0733		802	consensus Nuclear AAA ATPase (VCP subfamily) [Post	100.0
KOG0738		491	consensus AAA+-type ATPase [Posttranslational modi	100.0
TIGR01243		733	CDC48 AAA family ATPase, CDC48 subfamily. This sub	100.0
KOG0739		439	consensus AAA+-type ATPase [Posttranslational modi	100.0
COG0464		494	SpoVK ATPases of the AAA+ class [Posttranslational	100.0
KOG0735		952	consensus AAA+-type ATPase [Posttranslational modi	100.0
CHL00195		489	ycf46 Ycf46; Provisional	100.0
KOG0734		752	consensus AAA+-type ATPase containing the peptidas	100.0
KOG0652		424	consensus 26S proteasome regulatory complex, ATPas	100.0
KOG0731		774	consensus AAA+-type ATPase containing the peptidas	100.0
KOG0727		408	consensus 26S proteasome regulatory complex, ATPas	100.0
KOG0740		428	consensus AAA+-type ATPase [Posttranslational modi	100.0
KOG0730		693	consensus AAA+-type ATPase [Posttranslational modi	100.0
PTZ00454		398	26S protease regulatory subunit 6B-like protein; P	100.0
KOG0728		404	consensus 26S proteasome regulatory complex, ATPas	100.0
KOG0726		440	consensus 26S proteasome regulatory complex, ATPas	100.0
KOG0741		744	consensus AAA+-type ATPase [Posttranslational modi	99.98
KOG0729		435	consensus 26S proteasome regulatory complex, ATPas	99.97
PRK03992		389	proteasome-activating nucleotidase; Provisional	99.97
COG1223		368	Predicted ATPase (AAA+ superfamily) [General funct	99.97
COG0465		596	HflB ATP-dependent Zn proteases [Posttranslational	99.97
PTZ00361		438	26 proteosome regulatory subunit 4-like protein; P	99.97
TIGR01241		495	FtsH_fam ATP-dependent metalloprotease FtsH. HflB(	99.97
TIGR01243		733	CDC48 AAA family ATPase, CDC48 subfamily. This sub	99.96
TIGR01242		364	26Sp45 26S proteasome subunit P45 family. Many pro	99.96
TIGR03689		512	pup_AAA proteasome ATPase. In the Actinobacteria,	99.95
CHL00176		638	ftsH cell division protein; Validated	99.95
KOG0651		388	consensus 26S proteasome regulatory complex, ATPas	99.95
PRK10733		644	hflB ATP-dependent metalloprotease; Reviewed	99.94
KOG0741		744	consensus AAA+-type ATPase [Posttranslational modi	99.94
KOG0732		1080	consensus AAA+-type ATPase containing the bromodom	99.94
CHL00206		2281	ycf2 Ycf2; Provisional	99.92
PLN00020		413	ribulose bisphosphate carboxylase/oxygenase activa	99.87
KOG0736		953	consensus Peroxisome assembly factor 2 containing	99.87
KOG0735		952	consensus AAA+-type ATPase [Posttranslational modi	99.76
TIGR02639		731	ClpA ATP-dependent Clp protease ATP-binding subuni	99.75
PRK11034		758	clpA ATP-dependent Clp protease ATP-binding subuni	99.75
COG0542		786	clpA ATP-binding subunits of Clp protease and DnaK	99.74
KOG0743		457	consensus AAA+-type ATPase [Posttranslational modi	99.72
CHL00181		287	cbbX CbbX; Provisional	99.7
COG0464		494	SpoVK ATPases of the AAA+ class [Posttranslational	99.7
KOG0742		630	consensus AAA+-type ATPase [Posttranslational modi	99.69
KOG0744		423	consensus AAA+-type ATPase [Posttranslational modi	99.67
TIGR02880		284	cbbX_cfxQ probable Rubsico expression protein CbbX	99.66
TIGR02881		261	spore_V_K stage V sporulation protein K. Members o	99.65
TIGR03345		852	VI_ClpV1 type VI secretion ATPase, ClpV1 family. M	99.61
CHL00095		821	clpC Clp protease ATP binding subunit	99.56
TIGR03346		852	chaperone_ClpB ATP-dependent chaperone ClpB. Membe	99.56
TIGR00635		305	ruvB Holliday junction DNA helicase, RuvB subunit.	99.54
PF00004		132	AAA: ATPase family associated with various cellula	99.52
PRK10865		857	protein disaggregation chaperone; Provisional	99.51
PRK00080		328	ruvB Holliday junction DNA helicase RuvB; Reviewed	99.51
PF05496		233	RuvB_N: Holliday junction DNA helicase ruvB N-term	99.47
TIGR00763		775	lon ATP-dependent protease La. This protein is ind	99.42
TIGR02902		531	spore_lonB ATP-dependent protease LonB. Members of	99.41
KOG2004		906	consensus Mitochondrial ATP-dependent protease PIM	99.35
PRK14962		472	DNA polymerase III subunits gamma and tau; Provisi	99.35
COG2256		436	MGS1 ATPase related to the helicase subunit of the	99.34
TIGR02639		731	ClpA ATP-dependent Clp protease ATP-binding subuni	99.34
PRK14956		484	DNA polymerase III subunits gamma and tau; Provisi	99.31
PRK12323		700	DNA polymerase III subunits gamma and tau; Provisi	99.3
PRK04195		482	replication factor C large subunit; Provisional	99.3
PRK07003		830	DNA polymerase III subunits gamma and tau; Validat	99.3
PRK14961		363	DNA polymerase III subunits gamma and tau; Provisi	99.29
PF05673		249	DUF815: Protein of unknown function (DUF815); Inte	99.27
PRK14960		702	DNA polymerase III subunits gamma and tau; Provisi	99.26
PRK14964		491	DNA polymerase III subunits gamma and tau; Provisi	99.26
PRK14958		509	DNA polymerase III subunits gamma and tau; Provisi	99.25
PRK06645		507	DNA polymerase III subunits gamma and tau; Validat	99.24
COG0466		782	Lon ATP-dependent Lon protease, bacterial type [Po	99.24
COG2255		332	RuvB Holliday junction resolvasome, helicase subun	99.24
PRK07940		394	DNA polymerase III subunit delta'; Validated	99.22
PRK07994		647	DNA polymerase III subunits gamma and tau; Validat	99.22
PRK14949		944	DNA polymerase III subunits gamma and tau; Provisi	99.21
TIGR02397		355	dnaX_nterm DNA polymerase III, subunit gamma and t	99.21
TIGR03420		226	DnaA_homol_Hda DnaA regulatory inactivator Hda. Me	99.2
PRK05563		559	DNA polymerase III subunits gamma and tau; Validat	99.19
PRK00411		394	cdc6 cell division control protein 6; Reviewed	99.18
PRK14963		504	DNA polymerase III subunits gamma and tau; Provisi	99.17
PRK13342		413	recombination factor protein RarA; Reviewed	99.17
PRK08691		709	DNA polymerase III subunits gamma and tau; Validat	99.17
PRK08903		227	DnaA regulatory inactivator Hda; Validated	99.16
PRK14969		527	DNA polymerase III subunits gamma and tau; Provisi	99.16
PRK11034		758	clpA ATP-dependent Clp protease ATP-binding subuni	99.15
PRK06893		229	DNA replication initiation factor; Validated	99.15
TIGR02928		365	orc1/cdc6 family replication initiation protein. M	99.15
TIGR00362		405	DnaA chromosomal replication initiator protein Dna	99.15
PRK00149		450	dnaA chromosomal replication initiation protein; R	99.15
PRK14951		618	DNA polymerase III subunits gamma and tau; Provisi	99.14
PRK14959		624	DNA polymerase III subunits gamma and tau; Provisi	99.14
PRK12402		337	replication factor C small subunit 2; Reviewed	99.13
PHA02544		316	44 clamp loader, small subunit; Provisional	99.13
PLN03025		319	replication factor C subunit; Provisional	99.13
PRK14957		546	DNA polymerase III subunits gamma and tau; Provisi	99.13
PRK10787		784	DNA-binding ATP-dependent protease La; Provisional	99.12
PRK08084		235	DNA replication initiation factor; Provisional	99.11
PRK07764		824	DNA polymerase III subunits gamma and tau; Validat	99.1
PRK05896		605	DNA polymerase III subunits gamma and tau; Validat	99.1
PRK06647		563	DNA polymerase III subunits gamma and tau; Validat	99.1
KOG2028		554	consensus ATPase related to the helicase subunit o	99.09
PRK05342		412	clpX ATP-dependent protease ATP-binding subunit Cl	99.09
PRK07133		725	DNA polymerase III subunits gamma and tau; Validat	99.08
KOG0615		475	consensus Serine/threonine protein kinase Chk2 and	99.08
PRK14965		576	DNA polymerase III subunits gamma and tau; Provisi	99.08
PF00498		68	FHA: FHA domain; InterPro: IPR000253 The forkhead-	99.08
PRK14952		584	DNA polymerase III subunits gamma and tau; Provisi	99.07
PRK06305		451	DNA polymerase III subunits gamma and tau; Validat	99.07
PRK14953		486	DNA polymerase III subunits gamma and tau; Provisi	99.06
TIGR03345		852	VI_ClpV1 type VI secretion ATPase, ClpV1 family. M	99.06
PRK08727		233	hypothetical protein; Validated	99.05
PRK14955		397	DNA polymerase III subunits gamma and tau; Provisi	99.05
PRK13341		725	recombination factor protein RarA/unknown domain f	99.03
PRK12422		445	chromosomal replication initiation protein; Provis	99.03
PRK10865		857	protein disaggregation chaperone; Provisional	99.02
PRK09111		598	DNA polymerase III subunits gamma and tau; Validat	99.02
PRK14970		367	DNA polymerase III subunits gamma and tau; Provisi	99.01
KOG0989		346	consensus Replication factor C, subunit RFC4 [Repl	99.0
PRK08451		535	DNA polymerase III subunits gamma and tau; Validat	99.0
cd00060		102	FHA Forkhead associated domain (FHA); found in euk	98.99
PRK00440		319	rfc replication factor C small subunit; Reviewed	98.99
PRK14950		585	DNA polymerase III subunits gamma and tau; Provisi	98.98
PRK05642		234	DNA replication initiation factor; Validated	98.97
PRK14088		440	dnaA chromosomal replication initiation protein; P	98.97
COG2607		287	Predicted ATPase (AAA+ superfamily) [General funct	98.94
PRK14948		620	DNA polymerase III subunits gamma and tau; Provisi	98.93
PRK14954		620	DNA polymerase III subunits gamma and tau; Provisi	98.92
TIGR03346		852	chaperone_ClpB ATP-dependent chaperone ClpB. Membe	98.92
TIGR02903		615	spore_lon_C ATP-dependent protease, Lon family. Me	98.92
PRK06620		214	hypothetical protein; Validated	98.91
TIGR00382		413	clpX endopeptidase Clp ATP-binding regulatory subu	98.91
CHL00095		821	clpC Clp protease ATP binding subunit	98.91
PTZ00112		1164	origin recognition complex 1 protein; Provisional	98.89
PRK14971		614	DNA polymerase III subunits gamma and tau; Provisi	98.89
PRK14086		617	dnaA chromosomal replication initiation protein; P	98.89
TIGR02640		262	gas_vesic_GvpN gas vesicle protein GvpN. Members o	98.86
COG2812		515	DnaX DNA polymerase III, gamma/tau subunits [DNA r	98.84
CHL00195		489	ycf46 Ycf46; Provisional	98.84
PRK13407		334	bchI magnesium chelatase subunit I; Provisional	98.83
PRK14087		450	dnaA chromosomal replication initiation protein; P	98.83
PRK09087		226	hypothetical protein; Validated	98.83
TIGR00390		441	hslU ATP-dependent protease HslVU, ATPase subunit.	98.81
PRK03992		389	proteasome-activating nucleotidase; Provisional	98.72
KOG1969		877	consensus DNA replication checkpoint protein CHL12	98.71
TIGR01650		327	PD_CobS cobaltochelatase, CobS subunit. This model	98.71
PRK05201		443	hslU ATP-dependent protease ATP-binding subunit Hs	98.7
PRK05564		313	DNA polymerase III subunit delta'; Validated	98.7
PF07728		139	AAA_5: AAA domain (dynein-related subfamily); Inte	98.7
CHL00081		350	chlI Mg-protoporyphyrin IX chelatase	98.69
COG0714		329	MoxR-like ATPases [General function prediction onl	98.68
COG1224		450	TIP49 DNA helicase TIP49, TBP-interacting protein	98.66
PF00308		219	Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013	98.66
COG1474		366	CDC6 Cdc6-related protein, AAA superfamily ATPase	98.65
PHA02244		383	ATPase-like protein	98.65
cd00009		151	AAA The AAA+ (ATPases Associated with a wide varie	98.63
KOG0737		386	consensus AAA+-type ATPase [Posttranslational modi	98.62
smart00763		361	AAA_PrkA PrkA AAA domain. This is a family of PrkA	98.62
TIGR00678		188	holB DNA polymerase III, delta' subunit. At positi	98.62
PRK09112		351	DNA polymerase III subunit delta'; Validated	98.61
PRK07471		365	DNA polymerase III subunit delta'; Validated	98.59
TIGR02442		633	Cob-chelat-sub cobaltochelatase subunit. A number	98.58
smart00350		509	MCM minichromosome maintenance proteins.	98.57
TIGR02030		337	BchI-ChlI magnesium chelatase ATPase subunit I. Th	98.57
PF07726		131	AAA_3: ATPase family associated with various cellu	98.54
COG1222		406	RPT1 ATP-dependent 26S proteasome regulatory subun	98.49
PRK08058		329	DNA polymerase III subunit delta'; Validated	98.48
PF06068		398	TIP49: TIP49 C-terminus; InterPro: IPR010339 This	98.44
TIGR01241		495	FtsH_fam ATP-dependent metalloprotease FtsH. HflB(	98.44
PRK07399		314	DNA polymerase III subunit delta'; Validated	98.43
TIGR03354		396	VI_FHA type VI secretion system FHA domain protein	98.41
COG0470		325	HolB ATPase involved in DNA replication [DNA repli	98.4
PRK13531		498	regulatory ATPase RavA; Provisional	98.4
KOG1051		898	consensus Chaperone HSP104 and related ATP-depende	98.4
PF07724		171	AAA_2: AAA domain (Cdc48 subfamily); InterPro: IPR	98.4
TIGR03015		269	pepcterm_ATPase putative secretion ATPase, PEP-CTE	98.4
PRK11331		459	5-methylcytosine-specific restriction enzyme subun	98.4
COG0593		408	DnaA ATPase involved in DNA replication initiation	98.39
CHL00206		2281	ycf2 Ycf2; Provisional	98.39
TIGR00764		608	lon_rel lon-related putative ATP-dependent proteas	98.34
COG1220		444	HslU ATP-dependent protease HslVU (ClpYQ), ATPase	98.33
PRK05707		328	DNA polymerase III subunit delta'; Validated	98.32
PF01078		206	Mg_chelatase: Magnesium chelatase, subunit ChlI; I	98.28
PRK08116		268	hypothetical protein; Validated	98.26
TIGR02031		589	BchD-ChlD magnesium chelatase ATPase subunit D. Th	98.25
CHL00176		638	ftsH cell division protein; Validated	98.23
COG1223		368	Predicted ATPase (AAA+ superfamily) [General funct	98.22
KOG0734		752	consensus AAA+-type ATPase containing the peptidas	98.18
smart00382		148	AAA ATPases associated with a variety of cellular	98.14
PF03215		519	Rad17: Rad17 cell cycle checkpoint protein	98.13
PRK11608		326	pspF phage shock protein operon transcriptional ac	98.12
TIGR01817		534	nifA Nif-specific regulatory protein. This model r	98.12
COG1219		408	ClpX ATP-dependent protease Clp, ATPase subunit [P	98.08
PRK04132		846	replication factor C small subunit; Provisional	98.07
PRK12377		248	putative replication protein; Provisional	98.07
KOG0991		333	consensus Replication factor C, subunit RFC2 [Repl	98.07
TIGR02974		329	phageshock_pspF psp operon transcriptional activat	98.06
PRK15429		686	formate hydrogenlyase transcriptional activator Fh	98.04
PTZ00454		398	26S protease regulatory subunit 6B-like protein; P	98.03
TIGR00368		499	Mg chelatase-related protein. The N-terminal end m	98.01
KOG2227		529	consensus Pre-initiation complex, subunit CDC6, AA	98.0
PF13177		162	DNA_pol3_delta2: DNA polymerase III, delta subunit	97.99
KOG1942		456	consensus DNA helicase, TBP-interacting protein [R	97.98
PRK11388		638	DNA-binding transcriptional regulator DhaR; Provis	97.97
smart00240		52	FHA Forkhead associated domain. Found in eukaryoti	97.96
PLN02927		668	antheraxanthin epoxidase/zeaxanthin epoxidase	97.96
PRK08769		319	DNA polymerase III subunit delta'; Validated	97.94
PF05621		302	TniB: Bacterial TniB protein; InterPro: IPR008868	97.94
TIGR00602		637	rad24 checkpoint protein rad24. This family is bas	97.94
COG1221		403	PspF Transcriptional regulators containing an AAA-	97.93
PRK15424		538	propionate catabolism operon regulatory protein Pr	97.93
COG0606		490	Predicted ATPase with chaperone activity [Posttran	97.92
PRK06871		325	DNA polymerase III subunit delta'; Validated	97.91
PRK05022		509	anaerobic nitric oxide reductase transcription reg	97.89
PRK07993		334	DNA polymerase III subunit delta'; Validated	97.89
PRK06835		329	DNA replication protein DnaC; Validated	97.88
PRK06964		342	DNA polymerase III subunit delta'; Validated	97.88
PRK07952		244	DNA replication protein DnaC; Validated	97.84
COG1484		254	DnaC DNA replication protein [DNA replication, rec	97.84
TIGR02329		526	propionate_PrpR propionate catabolism operon regul	97.81
PRK06090		319	DNA polymerase III subunit delta'; Validated	97.81
PRK10820		520	DNA-binding transcriptional regulator TyrR; Provis	97.81
COG3829		560	RocR Transcriptional regulator containing PAS, AAA	97.8
PF13207		121	AAA_17: AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6	97.78
PRK08939		306	primosomal protein DnaI; Reviewed	97.78
PF01695		178	IstB_IS21: IstB-like ATP binding protein; InterPro	97.77
KOG2035		351	consensus Replication factor C, subunit RFC3 [Cell	97.77
PRK08181		269	transposase; Validated	97.75
KOG1514		767	consensus Origin recognition complex, subunit 1, a	97.74
COG3604		550	FhlA Transcriptional regulator containing GAF, AAA	97.74
PRK13765		637	ATP-dependent protease Lon; Provisional	97.73
PTZ00361		438	26 proteosome regulatory subunit 4-like protein; P	97.72
COG1716		191	FOG: FHA domain [Signal transduction mechanisms]	97.7
PF00158		168	Sigma54_activat: Sigma-54 interaction domain; Inte	97.67
TIGR02915		445	PEP_resp_reg putative PEP-CTERM system response re	97.67
COG1239		423	ChlI Mg-chelatase subunit ChlI [Coenzyme metabolis	97.67
KOG0745		564	consensus Putative ATP-dependent Clp-type protease	97.66
PRK10733		644	hflB ATP-dependent metalloprotease; Reviewed	97.63
PRK08118		167	topology modulation protein; Reviewed	97.63
PTZ00111		915	DNA replication licensing factor MCM4; Provisional	97.61
PRK08699		325	DNA polymerase III subunit delta'; Validated	97.6
PRK10923		469	glnG nitrogen regulation protein NR(I); Provisiona	97.59
COG2204		464	AtoC Response regulator containing CheY-like recei	97.58
PRK09862		506	putative ATP-dependent protease; Provisional	97.54
PRK06526		254	transposase; Provisional	97.53
PRK06921		266	hypothetical protein; Provisional	97.51
KOG2680		454	consensus DNA helicase TIP49, TBP-interacting prot	97.5
COG0542		786	clpA ATP-binding subunits of Clp protease and DnaK	97.49
PRK11361		457	acetoacetate metabolism regulatory protein AtoC; P	97.48
PRK13949		169	shikimate kinase; Provisional	97.47
PRK07261		171	topology modulation protein; Provisional	97.46
KOG1970		634	consensus Checkpoint RAD17-RFC complex, RAD17/RAD2	97.42
KOG0990		360	consensus Replication factor C, subunit RFC5 [Repl	97.37
KOG0740		428	consensus AAA+-type ATPase [Posttranslational modi	97.31
TIGR01242		364	26Sp45 26S proteasome subunit P45 family. Many pro	97.3
KOG0738		491	consensus AAA+-type ATPase [Posttranslational modi	97.25
PRK15455		644	PrkA family serine protein kinase; Provisional	97.25
TIGR01818		463	ntrC nitrogen regulation protein NR(I). This model	97.22
PF12775		272	AAA_7: P-loop containing dynein motor region D3; P	97.22
PF00910		107	RNA_helicase: RNA helicase; InterPro: IPR000605 He	97.22
PRK00131		175	aroK shikimate kinase; Reviewed	97.19
KOG0739		439	consensus AAA+-type ATPase [Posttranslational modi	97.18
PRK09183		259	transposase/IS protein; Provisional	97.18
PRK06217		183	hypothetical protein; Validated	97.17
KOG0731		774	consensus AAA+-type ATPase containing the peptidas	97.16
PF12774		231	AAA_6: Hydrolytic ATP binding site of dynein motor	97.15
PRK13947		171	shikimate kinase; Provisional	97.14
KOG1881		793	consensus Anion exchanger adaptor protein Kanadapt	97.12
cd00227		175	CPT Chloramphenicol (Cm) phosphotransferase (CPT).	97.11
PRK15115		444	response regulator GlrR; Provisional	97.1
PF14532		138	Sigma54_activ_2: Sigma-54 interaction domain; PDB:	97.09
PF13671		143	AAA_33: AAA domain; PDB: 1LTQ_A 2IA5_K 1RC8_A 1LY1	97.08
KOG0728		404	consensus 26S proteasome regulatory complex, ATPas	97.07
COG3456		430	Predicted component of the type VI protein secreti	97.06
PHA02624		647	large T antigen; Provisional	97.06
TIGR03689		512	pup_AAA proteasome ATPase. In the Actinobacteria,	97.04
KOG1968		871	consensus Replication factor C, subunit RFC1 (larg	97.01
PF01637		234	Arch_ATPase: Archaeal ATPase; InterPro: IPR011579	97.0
PF00931		287	NB-ARC: NB-ARC domain; InterPro: IPR002182 This is	96.98
PRK13406		584	bchD magnesium chelatase subunit D; Provisional	96.97
TIGR01313		163	therm_gnt_kin carbohydrate kinase, thermoresistant	96.93
PF03969		362	AFG1_ATPase: AFG1-like ATPase; InterPro: IPR005654	96.9
PF05729		166	NACHT: NACHT domain	96.89
PRK08154		309	anaerobic benzoate catabolism transcriptional regu	96.89
PRK13948		182	shikimate kinase; Provisional	96.87
cd02021		150	GntK Gluconate kinase (GntK) catalyzes the phospho	96.86
cd00464		154	SK Shikimate kinase (SK) is the fifth enzyme in th	96.83
KOG0726		440	consensus 26S proteasome regulatory complex, ATPas	96.8
PRK03839		180	putative kinase; Provisional	96.8
COG0703		172	AroK Shikimate kinase [Amino acid transport and me	96.78
KOG0478		804	consensus DNA replication licensing factor, MCM4 c	96.78
PRK06547		172	hypothetical protein; Provisional	96.77
PRK06762		166	hypothetical protein; Provisional	96.76
PRK00771		437	signal recognition particle protein Srp54; Provisi	96.72
PRK08233		182	hypothetical protein; Provisional	96.72
PRK05917		290	DNA polymerase III subunit delta'; Validated	96.71
COG0465		596	HflB ATP-dependent Zn proteases [Posttranslational	96.67
PF13401		131	AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S	96.66
) proteins. It has been suggested that torsins play a role in effectively managing protein folding and that possible breakdown in a neuroprotective mechanism that is, in part, mediated by torsins may be responsible for the neuronal dysfunction associated with dystonia [].; GO: 0005524 ATP binding, 0051085 chaperone mediated protein folding requiring cofactor" target="_blank" href="http://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=PF06309">PF06309		127	Torsin: Torsin; InterPro: IPR010448 This family co	96.65
PHA00729		226	NTP-binding motif containing protein	96.65
PRK05057		172	aroK shikimate kinase I; Reviewed	96.64
PRK07276		290	DNA polymerase III subunit delta'; Validated	96.64
PRK04040		188	adenylate kinase; Provisional	96.62
PRK00625		173	shikimate kinase; Provisional	96.61
TIGR01359		183	UMP_CMP_kin_fam UMP-CMP kinase family. This subfam	96.6
PRK14532		188	adenylate kinase; Provisional	96.59
PRK07132		299	DNA polymerase III subunit delta'; Validated	96.58
PF00493		331	MCM: MCM2/3/5 family This family extends the MCM d	96.56
KOG0652		424	consensus 26S proteasome regulatory complex, ATPas	96.55
PRK10365		441	transcriptional regulatory protein ZraR; Provision	96.51
cd01428		194	ADK Adenylate kinase (ADK) catalyzes the reversibl	96.5
cd02020		147	CMPK Cytidine monophosphate kinase (CMPK) catalyze	96.49
PF06414		199	Zeta_toxin: Zeta toxin; InterPro: IPR010488 This e	96.42
PRK14531		183	adenylate kinase; Provisional	96.4
PF13191		185	AAA_16: AAA ATPase domain; PDB: 2V1U_A.	96.4
KOG0744		423	consensus AAA+-type ATPase [Posttranslational modi	96.38
PLN03210		1153	Resistant to P. syringae 6; Provisional	96.34
COG1241		682	MCM2 Predicted ATPase involved in replication cont	96.33
PRK12723		388	flagellar biosynthesis regulator FlhF; Provisional	96.29
KOG3347		176	consensus Predicted nucleotide kinase/nuclear prot	96.27
PRK14530		215	adenylate kinase; Provisional	96.2
PRK05818		261	DNA polymerase III subunit delta'; Validated	96.19
KOG2383		467	consensus Predicted ATPase [General function predi	96.18
COG5271		4600	MDN1 AAA ATPase containing von Willebrand factor t	96.16
PRK03731		171	aroL shikimate kinase II; Reviewed	96.16
TIGR01618		220	phage_P_loop phage nucleotide-binding protein. Thi	96.15
PRK13808		333	adenylate kinase; Provisional	96.14
PF01583		156	APS_kinase: Adenylylsulphate kinase; InterPro: IPR	96.13
PHA02530		300	pseT polynucleotide kinase; Provisional	96.09
PF01745		233	IPT: Isopentenyl transferase; InterPro: IPR002648	96.09
PTZ00088		229	adenylate kinase 1; Provisional	96.09
TIGR01360		188	aden_kin_iso1 adenylate kinase, isozyme 1 subfamil	96.08
PRK13946		184	shikimate kinase; Provisional	96.07
PRK02496		184	adk adenylate kinase; Provisional	96.04
PRK14528		186	adenylate kinase; Provisional	96.0
cd02027		149	APSK Adenosine 5'-phosphosulfate kinase (APSK) cat	96.0
TIGR01351		210	adk adenylate kinases. Adenylate kinase (EC 2.7.4.	95.99
PHA02774		613	E1; Provisional	95.98
PRK00279		215	adk adenylate kinase; Reviewed	95.96
PLN02200		234	adenylate kinase family protein	95.94
PRK05541		176	adenylylsulfate kinase; Provisional	95.92
COG0529		197	CysC Adenylylsulfate kinase and related kinases [I	95.89
COG0324		308	MiaA tRNA delta(2)-isopentenylpyrophosphate transf	95.89
PRK14527		191	adenylate kinase; Provisional	95.87
COG1618		179	Predicted nucleotide kinase [Nucleotide transport	95.84
PRK05480		209	uridine/cytidine kinase; Provisional	95.83
PRK14722		374	flhF flagellar biosynthesis regulator FlhF; Provis	95.81
COG1102		179	Cmk Cytidylate kinase [Nucleotide transport and me	95.77
cd01120		165	RecA-like_NTPases RecA-like NTPases. This family i	95.77
PF00406		151	ADK: Adenylate kinase; InterPro: IPR000850 Adenyla	95.72
PRK07667		193	uridine kinase; Provisional	95.69
PF13238		129	AAA_18: AAA domain; PDB: 3IIK_A 3IIJ_A 3IIL_A 1RKB	95.65
PRK04182		180	cytidylate kinase; Provisional	95.64
PRK10867		433	signal recognition particle protein; Provisional	95.63
cd02028		179	UMPK_like Uridine monophosphate kinase_like (UMPK_	95.63
TIGR01425		429	SRP54_euk signal recognition particle protein SRP5	95.62
PLN02199		303	shikimate kinase	95.62
KOG0732		1080	consensus AAA+-type ATPase containing the bromodom	95.6
TIGR03574		249	selen_PSTK L-seryl-tRNA(Sec) kinase, archaeal. Mem	95.6
KOG0482		721	consensus DNA replication licensing factor, MCM7 c	95.58
PRK06696		223	uridine kinase; Validated	95.57
PRK14730		195	coaE dephospho-CoA kinase; Provisional	95.54
cd02024		187	NRK1 Nicotinamide riboside kinase (NRK) is an enzy	95.51
PF13173		128	AAA_14: AAA domain	95.51
KOG0480		764	consensus DNA replication licensing factor, MCM6 c	95.5
KOG0245		1221	consensus Kinesin-like protein [Cytoskeleton]	95.48
PRK01184		184	hypothetical protein; Provisional	95.47
TIGR02173		171	cyt_kin_arch cytidylate kinase, putative. Proteins	95.45
cd01124		187	KaiC KaiC is a circadian clock protein primarily f	95.44
COG0563		178	Adk Adenylate kinase and related kinases [Nucleoti	95.38
PF13521		163	AAA_28: AAA domain; PDB: 1LW7_A.	95.37
PF13086		236	AAA_11: AAA domain; PDB: 2XZL_A 2XZO_A 2WJY_A 2WJV	95.34
PRK00091		307	miaA tRNA delta(2)-isopentenylpyrophosphate transf	95.32
PLN02674		244	adenylate kinase	95.3
PRK14526		211	adenylate kinase; Provisional	95.28
PRK00889		175	adenylylsulfate kinase; Provisional	95.27
PF13245		76	AAA_19: Part of AAA domain	95.25
PTZ00202		550	tuzin; Provisional	95.22
COG1936		180	Predicted nucleotide kinase (related to CMP and AM	95.2
PF05272		198	VirE: Virulence-associated protein E; InterPro: IP	95.15
COG1485		367	Predicted ATPase [General function prediction only	95.14
PRK05537		568	bifunctional sulfate adenylyltransferase subunit 1	95.12
cd02025		220	PanK Pantothenate kinase (PanK) catalyzes the phos	94.96
TIGR00235		207	udk uridine kinase. Model contains a number of lon	94.95
TIGR00152		188	dephospho-CoA kinase. This model produces scores i	94.93
TIGR00959		428	ffh signal recognition particle protein. This mode	94.92
TIGR00455		184	apsK adenylylsulfate kinase (apsK). Important resi	94.89
TIGR00150		133	HI0065_YjeE ATPase, YjeE family. Members of this f	94.87
PF08298		358	AAA_PrkA: PrkA AAA domain; InterPro: IPR013153 Thi	94.83
cd02023		198	UMPK Uridine monophosphate kinase (UMPK, EC 2.7.1.	94.83
cd02019		69	NK Nucleoside/nucleotide kinase (NK) is a protein	94.78
PRK14529		223	adenylate kinase; Provisional	94.75
PLN02165		334	adenylate isopentenyltransferase	94.7
KOG2228		408	consensus Origin recognition complex, subunit 4 [R	94.67
PRK11889		436	flhF flagellar biosynthesis regulator FlhF; Provis	94.64
PRK13951		488	bifunctional shikimate kinase/3-dehydroquinate syn	94.61
PLN02840		421	tRNA dimethylallyltransferase	94.58
PRK12339		197	2-phosphoglycerate kinase; Provisional	94.56
PRK12724		432	flagellar biosynthesis regulator FlhF; Provisional	94.5
COG1855		604	ATPase (PilT family) [General function prediction	94.49
TIGR02012		321	tigrfam_recA protein RecA. This model describes or	94.47
TIGR02237		209	recomb_radB DNA repair and recombination protein R	94.45
PLN02459		261	probable adenylate kinase	94.43
PRK10078		186	ribose 1,5-bisphosphokinase; Provisional	94.39
COG3267		269	ExeA Type II secretory pathway, component ExeA (pr	94.38
TIGR00174		287	miaA tRNA isopentenyltransferase (miaA). Catalyzes	94.33
PRK04220		301	2-phosphoglycerate kinase; Provisional	94.29
KOG3354		191	consensus Gluconate kinase [Carbohydrate transport	94.25
PRK05439		311	pantothenate kinase; Provisional	94.22
PRK12338		319	hypothetical protein; Provisional	94.18
COG0572		218	Udk Uridine kinase [Nucleotide transport and metab	94.1
KOG0729		435	consensus 26S proteasome regulatory complex, ATPas	94.09
PF09336		62	Vps4_C: Vps4 C terminal oligomerisation domain; In	94.03
KOG0477		854	consensus DNA replication licensing factor, MCM2 c	93.9
cd01394		218	radB RadB. The archaeal protein radB shares simila	93.9
PRK14021		542	bifunctional shikimate kinase/3-dehydroquinate syn	93.85
PRK10416		318	signal recognition particle-docking protein FtsY;	93.83
PRK05800		170	cobU adenosylcobinamide kinase/adenosylcobinamide-	93.82
COG0467		260	RAD55 RecA-superfamily ATPases implicated in signa	93.75
cd00983		325	recA RecA is a bacterial enzyme which has roles in	93.74
TIGR03877		237	thermo_KaiC_1 KaiC domain protein, Ph0284 family.	93.74
PRK09270		229	nucleoside triphosphate hydrolase domain-containin	93.74
PF06745		226	KaiC: KaiC; InterPro: IPR014774 This entry represe	93.72
TIGR02322		179	phosphon_PhnN phosphonate metabolism protein/1,5-b	93.72
COG4088		261	Predicted nucleotide kinase [Nucleotide transport	93.71
cd02022		179	DPCK Dephospho-coenzyme A kinase (DPCK, EC 2.7.1.2	93.7
PRK09361		225	radB DNA repair and recombination protein RadB; Pr	93.7
PRK13975		196	thymidylate kinase; Provisional	93.69
PF07931		174	CPT: Chloramphenicol phosphotransferase-like prote	93.69
PRK12726		407	flagellar biosynthesis regulator FlhF; Provisional	93.67
PLN02348		395	phosphoribulokinase	93.59
PF02367		123	UPF0079: Uncharacterised P-loop hydrolase UPF0079;	93.56
cd01129		264	PulE-GspE PulE/GspE The type II secretory pathway	93.5
PRK09825		176	idnK D-gluconate kinase; Provisional	93.45
PRK05973		237	replicative DNA helicase; Provisional	93.43
PRK00300		205	gmk guanylate kinase; Provisional	93.42
TIGR00064		272	ftsY signal recognition particle-docking protein F	93.42
cd03115		173	SRP The signal recognition particle (SRP) mediates	93.37
TIGR03878		259	thermo_KaiC_2 KaiC domain protein, AF_0795 family.	93.36
TIGR03263		180	guanyl_kin guanylate kinase. Members of this famil	93.35
PTZ00301		210	uridine kinase; Provisional	93.31
PRK09354		349	recA recombinase A; Provisional	93.3
PRK06067		234	flagellar accessory protein FlaH; Validated	93.28
PRK08356		195	hypothetical protein; Provisional	93.22
PF13604		196	AAA_30: AAA domain; PDB: 1W36_G 3K70_G 3UPU_B 3GPL	93.19
PF03266		168	NTPase_1: NTPase; InterPro: IPR004948 This entry r	93.12
cd01672		200	TMPK Thymidine monophosphate kinase (TMPK), also k	93.12
PRK11545		163	gntK gluconate kinase 1; Provisional	93.06
PF00485		194	PRK: Phosphoribulokinase / Uridine kinase family;	93.04
PLN02748		468	tRNA dimethylallyltransferase	93.04
PF10443		431	RNA12: RNA12 protein; InterPro: IPR018850 Mitochon	93.03
COG5271		4600	MDN1 AAA ATPase containing von Willebrand factor t	93.01
PRK14738		206	gmk guanylate kinase; Provisional	92.89
cd01128		249	rho_factor Transcription termination factor rho is	92.86
TIGR03881		229	KaiC_arch_4 KaiC domain protein, PAE1156 family. M	92.86
PF00437		270	T2SE: Type II/IV secretion system protein; InterPr	92.86
cd00544		169	CobU Adenosylcobinamide kinase / adenosylcobinamid	92.82
PRK06761		282	hypothetical protein; Provisional	92.82
PF08423		256	Rad51: Rad51; InterPro: IPR013632 This domain is f	92.79
TIGR00017		217	cmk cytidylate kinase. This family consists of cyt	92.79
PF10662		143	PduV-EutP: Ethanolamine utilisation - propanediol	92.78
PRK03846		198	adenylylsulfate kinase; Provisional	92.75
TIGR03499		282	FlhF flagellar biosynthetic protein FlhF.	92.69
PRK14732		196	coaE dephospho-CoA kinase; Provisional	92.67
cd00071		137	GMPK Guanosine monophosphate kinase (GMPK, EC 2.7.	92.65
PRK00023		225	cmk cytidylate kinase; Provisional	92.64
PRK05703		424	flhF flagellar biosynthesis regulator FlhF; Valida	92.54
PRK08533		230	flagellar accessory protein FlaH; Reviewed	92.51
TIGR01663		526	PNK-3'Pase polynucleotide 5'-kinase 3'-phosphatase	92.5
PF12780		268	AAA_8: P-loop containing dynein motor region D4; I	92.48
PF13479		213	AAA_24: AAA domain	92.48
PRK14974		336	cell division protein FtsY; Provisional	92.47
PRK12608		380	transcription termination factor Rho; Provisional	92.46
PRK09518		712	bifunctional cytidylate kinase/GTPase Der; Reviewe	92.39
TIGR01613		304	primase_Cterm phage/plasmid primase, P4 family, C-	92.38
KOG2543		438	consensus Origin recognition complex, subunit 5 [R	92.38
PLN00020		413	ribulose bisphosphate carboxylase/oxygenase activa	92.35
PLN02318		656	phosphoribulokinase/uridine kinase	92.35
cd01134		369	V_A-ATPase_A V/A-type ATP synthase catalytic subun	92.34
PRK04328		249	hypothetical protein; Provisional	92.31
PF00448		196	SRP54: SRP54-type protein, GTPase domain; InterPro	92.3
PRK06851		367	hypothetical protein; Provisional	92.29
cd01123		235	Rad51_DMC1_radA Rad51_DMC1_radA,B. This group of r	92.29
PRK14737		186	gmk guanylate kinase; Provisional	92.21
COG5245		3164	DYN1 Dynein, heavy chain [Cytoskeleton]	92.19
COG3283		511	TyrR Transcriptional regulator of aromatic amino a	92.13
PRK04841		903	transcriptional regulator MalT; Provisional	92.1
PRK10536		262	hypothetical protein; Provisional	92.07
PF01202		158	SKI: Shikimate kinase; InterPro: IPR000623 Shikima	92.06
cd00046		144	DEXDc DEAD-like helicases superfamily. A diverse f	92.06
PF04851		184	ResIII: Type III restriction enzyme, res subunit;	92.05
cd00984		242	DnaB_C DnaB helicase C terminal domain. The hexame	91.92
TIGR03880		224	KaiC_arch_3 KaiC domain protein, AF_0351 family. T	91.87
PRK12337		475	2-phosphoglycerate kinase; Provisional	91.86
PRK00081		194	coaE dephospho-CoA kinase; Reviewed	91.85
PRK08099		399	bifunctional DNA-binding transcriptional repressor	91.84
PF10236		309	DAP3: Mitochondrial ribosomal death-associated pro	91.78

>KOG0737 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

Probab=100.00  E-value=2.9e-54  Score=482.35  Aligned_cols=352  Identities=58%  Similarity=0.896  Sum_probs=317.7

Q ss_pred             cccccccCChHHHHHHHhhhhhhhhhccCCCCCCCCceeecchhHHHHHHHHhhhhhhhhhhhhhhh-cccChhHHHHHH
Q 000921          856 LCIKDQTLTTEGVEKIVGWALSHHFMHCSEAPGKDAKLKISTESIMYGLNILQGIQSESKSLKKSLK-DVVTENEFEKKL  934 (1223)
Q Consensus       856 La~~tk~~sgaeIe~LV~sA~S~al~~~~~~~~~~~kl~Is~esl~~~l~~lq~i~~~~~~~~~al~-evv~~~e~e~~l  934 (1223)
                      .+..+..+...-|+.++.||++||..++..+..++ +..++.+++.++...+++....     .+++ +++..++|+..+
T Consensus         4 ~~~~~~~~i~~~~~~i~~~A~~~~~~~~~~~~~d~-~~~~~~eS~~~~~~~l~~~~~~-----~s~k~~~i~~ne~E~~i   77 (386)
T KOG0737|consen    4 SFTKDDVLITSLIRKIVAAAISHHLVHLLVPRLDP-NLKASRESLEKTEELLKNLEAE-----LSLKYRIIQKNEYEKRI   77 (386)
T ss_pred             cccccchHHHHHHHHHHHHHHHHHHHhccccccCh-hhhhhHHHHHHHHHHHHhhhhc-----cchhhhhhhhhHHHHHh
Confidence            34455667788899999999999999887666555 7889999999987777655432     3444 378899999999


Q ss_pred             hcCCCCCCCCCCCcccccCcHHHHHHHHHHHHccccChHhhhcCCCCCCCceEEEEcCCCChHHHHHHHHHHHhCCceeE
Q 000921          935 LADVIPPSDIGVTFDDIGALENVKDTLKELVMLPLQRPELFCKGQLTKPCKGILLFGPPGTGKTMLAKAVATEAGANFIN 1014 (1223)
Q Consensus       935 l~~vI~~~e~~vtfdDIgGle~vk~~L~e~V~lpL~~pelf~k~gl~~PprGILL~GPPGTGKT~LAkAIA~elg~pfI~ 1014 (1223)
                      ..++++|.++.|+|+||||++.+++++++.|.+|+++|++|..+++..|++|||||||||||||++|+|+|+++|++|+.
T Consensus        78 ~s~~v~p~~I~v~f~DIggLe~v~~~L~e~VilPlr~pelF~~g~Ll~p~kGiLL~GPpG~GKTmlAKA~Akeaga~fIn  157 (386)
T KOG0737|consen   78 ASDVVPPSEIGVSFDDIGGLEEVKDALQELVILPLRRPELFAKGKLLRPPKGILLYGPPGTGKTMLAKAIAKEAGANFIN  157 (386)
T ss_pred             hhcccchhhceeehhhccchHHHHHHHHHHHhhcccchhhhcccccccCCccceecCCCCchHHHHHHHHHHHcCCCcce
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             eecccccch----------------------------hhhcccccCCCChhHHHHHHHHHHHHHhccCCCCCCccEEEEe
Q 000921         1015 ISMSSITSK----------------------------VDSMLGRRENPGEHEAMRKMKNEFMVNWDGLRTKDKERVLVLA 1066 (1223)
Q Consensus      1015 Vs~seL~sk----------------------------IDsI~g~R~s~~e~e~~~rIl~~LL~~LDgl~~k~~~rVLVIA 1066 (1223)
                      |+++.++++                            ||++++.| ...+|+++..+.++||..|||+.++.+.+|+|+|
T Consensus       158 v~~s~lt~KWfgE~eKlv~AvFslAsKl~P~iIFIDEvds~L~~R-~s~dHEa~a~mK~eFM~~WDGl~s~~~~rVlVlg  236 (386)
T KOG0737|consen  158 VSVSNLTSKWFGEAQKLVKAVFSLASKLQPSIIFIDEVDSFLGQR-RSTDHEATAMMKNEFMALWDGLSSKDSERVLVLG  236 (386)
T ss_pred             eeccccchhhHHHHHHHHHHHHhhhhhcCcceeehhhHHHHHhhc-ccchHHHHHHHHHHHHHHhccccCCCCceEEEEe
Confidence            999998876                            78889999 6789999999999999999999999888999999


Q ss_pred             ecCCCCCCCHHHHcccCceeeecCCCHHHHHHHHHHHHhhcccCCcccHHHHHHHccCCcHHHHHHHHHHHHHHHHHHHH
Q 000921         1067 ATNRPFDLDEAVVRRLPRRLMVNLPDAPNREKIIRVILAKEELASDVDLEGIANMADGYSGSDLKNLCVTAAHCPIREIL 1146 (1223)
Q Consensus      1067 TTNrp~~LD~ALlRRFd~~I~VplPd~eeR~~ILr~~L~k~~l~~dvDL~~LA~~TeGySGaDL~~L~~~Aa~~aireil 1146 (1223)
                      |||||.+||+|++||++++++|++|+..+|.+||+.+++++++.+++|+.++|.+|+||||+||+++|+.|++.++|+++
T Consensus       237 ATNRP~DlDeAiiRR~p~rf~V~lP~~~qR~kILkviLk~e~~e~~vD~~~iA~~t~GySGSDLkelC~~Aa~~~ire~~  316 (386)
T KOG0737|consen  237 ATNRPFDLDEAIIRRLPRRFHVGLPDAEQRRKILKVILKKEKLEDDVDLDEIAQMTEGYSGSDLKELCRLAALRPIRELL  316 (386)
T ss_pred             CCCCCccHHHHHHHhCcceeeeCCCchhhHHHHHHHHhcccccCcccCHHHHHHhcCCCcHHHHHHHHHHHhHhHHHHHH
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHH--HHHHHHHHhhccCCCCCCCCCCCCCCCHHHHHHHHHhcCccccccccccccchhHhhhcCCCCcC
Q 000921         1147 EKE--KKERALALAENRASPPLYSSVDVRPLKMDDFKYAHEQVCASVSSESTNMNELLQWNELYGEGGSR 1214 (1223)
Q Consensus      1147 ek~--kk~~~~~~~e~~~~~~~~~~~~~rpLT~eDF~~ALe~v~PS~s~e~~~~~p~v~WnDIGGl~~vK 1214 (1223)
                      +++  ..+.+...++..+.+.....-..|+++++||.+|+.++.+++..+...|....+|++.||++++|
T Consensus       317 ~~~~~~~d~d~~~~d~~~~~~~~~~~~~r~l~~eDf~~a~~~v~~~~~~~~t~~~a~~~~~~~~~e~~sr  386 (386)
T KOG0737|consen  317 VSETGLLDLDKAIADLKPTQAAASSCLLRPLEQEDFPKAINRVSASVAMDATRMNALKQWNELYGEGGSR  386 (386)
T ss_pred             HhcccchhhhhhhhhccCCcccccccccCcccHHHHHHHHHhhhhHHHHhhhhhHHHHHHHhhhccccCC
Confidence            886  33334445555555555556678999999999999999999998888999999999999999876

>KOG0733 consensus Nuclear AAA ATPase (VCP subfamily) [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG0730 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG0736 consensus Peroxisome assembly factor 2 containing the AAA+-type ATPase domain [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>COG1222 RPT1 ATP-dependent 26S proteasome regulatory subunit [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG0733 consensus Nuclear AAA ATPase (VCP subfamily) [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG0738 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>TIGR01243 CDC48 AAA family ATPase, CDC48 subfamily	Back alignment and domain information

>KOG0739 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>COG0464 SpoVK ATPases of the AAA+ class [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG0735 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>CHL00195 ycf46 Ycf46; Provisional	Back alignment and domain information

>KOG0734 consensus AAA+-type ATPase containing the peptidase M41 domain [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG0652 consensus 26S proteasome regulatory complex, ATPase RPT5 [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG0731 consensus AAA+-type ATPase containing the peptidase M41 domain [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG0727 consensus 26S proteasome regulatory complex, ATPase RPT3 [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG0740 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG0730 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PTZ00454 26S protease regulatory subunit 6B-like protein; Provisional	Back alignment and domain information

>KOG0728 consensus 26S proteasome regulatory complex, ATPase RPT6 [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG0726 consensus 26S proteasome regulatory complex, ATPase RPT2 [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG0741 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG0729 consensus 26S proteasome regulatory complex, ATPase RPT1 [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PRK03992 proteasome-activating nucleotidase; Provisional	Back alignment and domain information

>COG1223 Predicted ATPase (AAA+ superfamily) [General function prediction only]	Back alignment and domain information

>COG0465 HflB ATP-dependent Zn proteases [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PTZ00361 26 proteosome regulatory subunit 4-like protein; Provisional	Back alignment and domain information

>TIGR01241 FtsH_fam ATP-dependent metalloprotease FtsH	Back alignment and domain information

>TIGR01243 CDC48 AAA family ATPase, CDC48 subfamily	Back alignment and domain information

>TIGR01242 26Sp45 26S proteasome subunit P45 family	Back alignment and domain information

>TIGR03689 pup_AAA proteasome ATPase	Back alignment and domain information

>CHL00176 ftsH cell division protein; Validated	Back alignment and domain information

>KOG0651 consensus 26S proteasome regulatory complex, ATPase RPT4 [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PRK10733 hflB ATP-dependent metalloprotease; Reviewed	Back alignment and domain information

>KOG0741 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG0732 consensus AAA+-type ATPase containing the bromodomain [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>CHL00206 ycf2 Ycf2; Provisional	Back alignment and domain information

>PLN00020 ribulose bisphosphate carboxylase/oxygenase activase -RuBisCO activase (RCA); Provisional	Back alignment and domain information

>KOG0736 consensus Peroxisome assembly factor 2 containing the AAA+-type ATPase domain [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG0735 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>TIGR02639 ClpA ATP-dependent Clp protease ATP-binding subunit clpA	Back alignment and domain information

>PRK11034 clpA ATP-dependent Clp protease ATP-binding subunit; Provisional	Back alignment and domain information

>COG0542 clpA ATP-binding subunits of Clp protease and DnaK/DnaJ chaperones [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG0743 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>CHL00181 cbbX CbbX; Provisional	Back alignment and domain information

>COG0464 SpoVK ATPases of the AAA+ class [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG0742 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG0744 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>TIGR02880 cbbX_cfxQ probable Rubsico expression protein CbbX	Back alignment and domain information

>TIGR02881 spore_V_K stage V sporulation protein K	Back alignment and domain information

>TIGR03345 VI_ClpV1 type VI secretion ATPase, ClpV1 family	Back alignment and domain information

>CHL00095 clpC Clp protease ATP binding subunit	Back alignment and domain information

>TIGR03346 chaperone_ClpB ATP-dependent chaperone ClpB	Back alignment and domain information

>TIGR00635 ruvB Holliday junction DNA helicase, RuvB subunit	Back alignment and domain information

>PF00004 AAA: ATPase family associated with various cellular activities (AAA); InterPro: IPR003959 AAA ATPases (ATPases Associated with diverse cellular Activities) form a large protein family and play a number of roles in the cell including cell-cycle regulation, protein proteolysis and disaggregation, organelle biogenesis and intracellular transport	Back alignment and domain information

>PRK10865 protein disaggregation chaperone; Provisional	Back alignment and domain information

>PRK00080 ruvB Holliday junction DNA helicase RuvB; Reviewed	Back alignment and domain information

>PF05496 RuvB_N: Holliday junction DNA helicase ruvB N-terminus; InterPro: IPR008824 The RuvB protein makes up part of the RuvABC revolvasome which catalyses the resolution of Holliday junctions that arise during genetic recombination and DNA repair	Back alignment and domain information

>TIGR00763 lon ATP-dependent protease La	Back alignment and domain information

>TIGR02902 spore_lonB ATP-dependent protease LonB	Back alignment and domain information

>KOG2004 consensus Mitochondrial ATP-dependent protease PIM1/LON [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PRK14962 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>COG2256 MGS1 ATPase related to the helicase subunit of the Holliday junction resolvase [DNA replication, recombination, and repair]	Back alignment and domain information

>TIGR02639 ClpA ATP-dependent Clp protease ATP-binding subunit clpA	Back alignment and domain information

>PRK14956 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PRK12323 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PRK04195 replication factor C large subunit; Provisional	Back alignment and domain information

>PRK07003 DNA polymerase III subunits gamma and tau; Validated	Back alignment and domain information

>PRK14961 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PF05673 DUF815: Protein of unknown function (DUF815); InterPro: IPR008533 This domain consists of several bacterial proteins of unknown function	Back alignment and domain information

>PRK14960 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PRK14964 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PRK14958 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PRK06645 DNA polymerase III subunits gamma and tau; Validated	Back alignment and domain information

>COG0466 Lon ATP-dependent Lon protease, bacterial type [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>COG2255 RuvB Holliday junction resolvasome, helicase subunit [DNA replication, recombination, and repair]	Back alignment and domain information

>PRK07940 DNA polymerase III subunit delta'; Validated	Back alignment and domain information

>PRK07994 DNA polymerase III subunits gamma and tau; Validated	Back alignment and domain information

>PRK14949 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>TIGR02397 dnaX_nterm DNA polymerase III, subunit gamma and tau	Back alignment and domain information

>TIGR03420 DnaA_homol_Hda DnaA regulatory inactivator Hda	Back alignment and domain information

>PRK05563 DNA polymerase III subunits gamma and tau; Validated	Back alignment and domain information

>PRK00411 cdc6 cell division control protein 6; Reviewed	Back alignment and domain information

>PRK14963 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PRK13342 recombination factor protein RarA; Reviewed	Back alignment and domain information

>PRK08691 DNA polymerase III subunits gamma and tau; Validated	Back alignment and domain information

>PRK08903 DnaA regulatory inactivator Hda; Validated	Back alignment and domain information

>PRK14969 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PRK11034 clpA ATP-dependent Clp protease ATP-binding subunit; Provisional	Back alignment and domain information

>PRK06893 DNA replication initiation factor; Validated	Back alignment and domain information

>TIGR02928 orc1/cdc6 family replication initiation protein	Back alignment and domain information

>TIGR00362 DnaA chromosomal replication initiator protein DnaA	Back alignment and domain information

>PRK00149 dnaA chromosomal replication initiation protein; Reviewed	Back alignment and domain information

>PRK14951 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PRK14959 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PRK12402 replication factor C small subunit 2; Reviewed	Back alignment and domain information

>PHA02544 44 clamp loader, small subunit; Provisional	Back alignment and domain information

>PLN03025 replication factor C subunit; Provisional	Back alignment and domain information

>PRK14957 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PRK10787 DNA-binding ATP-dependent protease La; Provisional	Back alignment and domain information

>PRK08084 DNA replication initiation factor; Provisional	Back alignment and domain information

>PRK07764 DNA polymerase III subunits gamma and tau; Validated	Back alignment and domain information

>PRK05896 DNA polymerase III subunits gamma and tau; Validated	Back alignment and domain information

>PRK06647 DNA polymerase III subunits gamma and tau; Validated	Back alignment and domain information

>KOG2028 consensus ATPase related to the helicase subunit of the Holliday junction resolvase [Replication, recombination and repair]	Back alignment and domain information

>PRK05342 clpX ATP-dependent protease ATP-binding subunit ClpX; Provisional	Back alignment and domain information

>PRK07133 DNA polymerase III subunits gamma and tau; Validated	Back alignment and domain information

>KOG0615 consensus Serine/threonine protein kinase Chk2 and related proteins [Cell cycle control, cell division, chromosome partitioning]	Back alignment and domain information

>PRK14965 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PF00498 FHA: FHA domain; InterPro: IPR000253 The forkhead-associated (FHA) domain [] is a phosphopeptide recognition domain found in many regulatory proteins	Back alignment and domain information

>PRK14952 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PRK06305 DNA polymerase III subunits gamma and tau; Validated	Back alignment and domain information

>PRK14953 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>TIGR03345 VI_ClpV1 type VI secretion ATPase, ClpV1 family	Back alignment and domain information

>PRK08727 hypothetical protein; Validated	Back alignment and domain information

>PRK14955 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PRK13341 recombination factor protein RarA/unknown domain fusion protein; Reviewed	Back alignment and domain information

>PRK12422 chromosomal replication initiation protein; Provisional	Back alignment and domain information

>PRK10865 protein disaggregation chaperone; Provisional	Back alignment and domain information

>PRK09111 DNA polymerase III subunits gamma and tau; Validated	Back alignment and domain information

>PRK14970 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>KOG0989 consensus Replication factor C, subunit RFC4 [Replication, recombination and repair]	Back alignment and domain information

>PRK08451 DNA polymerase III subunits gamma and tau; Validated	Back alignment and domain information

>cd00060 FHA Forkhead associated domain (FHA); found in eukaryotic and prokaryotic proteins	Back alignment and domain information

>PRK00440 rfc replication factor C small subunit; Reviewed	Back alignment and domain information

>PRK14950 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PRK05642 DNA replication initiation factor; Validated	Back alignment and domain information

>PRK14088 dnaA chromosomal replication initiation protein; Provisional	Back alignment and domain information

>COG2607 Predicted ATPase (AAA+ superfamily) [General function prediction only]	Back alignment and domain information

>PRK14948 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PRK14954 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>TIGR03346 chaperone_ClpB ATP-dependent chaperone ClpB	Back alignment and domain information

>TIGR02903 spore_lon_C ATP-dependent protease, Lon family	Back alignment and domain information

>PRK06620 hypothetical protein; Validated	Back alignment and domain information

>TIGR00382 clpX endopeptidase Clp ATP-binding regulatory subunit (clpX)	Back alignment and domain information

>CHL00095 clpC Clp protease ATP binding subunit	Back alignment and domain information

>PTZ00112 origin recognition complex 1 protein; Provisional	Back alignment and domain information

>PRK14971 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PRK14086 dnaA chromosomal replication initiation protein; Provisional	Back alignment and domain information

>TIGR02640 gas_vesic_GvpN gas vesicle protein GvpN	Back alignment and domain information

>COG2812 DnaX DNA polymerase III, gamma/tau subunits [DNA replication, recombination, and repair]	Back alignment and domain information

>CHL00195 ycf46 Ycf46; Provisional	Back alignment and domain information

>PRK13407 bchI magnesium chelatase subunit I; Provisional	Back alignment and domain information

>PRK14087 dnaA chromosomal replication initiation protein; Provisional	Back alignment and domain information

>PRK09087 hypothetical protein; Validated	Back alignment and domain information

>TIGR00390 hslU ATP-dependent protease HslVU, ATPase subunit	Back alignment and domain information

>PRK03992 proteasome-activating nucleotidase; Provisional	Back alignment and domain information

>KOG1969 consensus DNA replication checkpoint protein CHL12/CTF18 [Cell cycle control, cell division, chromosome partitioning; Replication, recombination and repair]	Back alignment and domain information

>TIGR01650 PD_CobS cobaltochelatase, CobS subunit	Back alignment and domain information

>PRK05201 hslU ATP-dependent protease ATP-binding subunit HslU; Provisional	Back alignment and domain information

>PRK05564 DNA polymerase III subunit delta'; Validated	Back alignment and domain information

>PF07728 AAA_5: AAA domain (dynein-related subfamily); InterPro: IPR011704 The ATPases Associated to a variety of cellular Activities (AAA) are a family distinguished by a highly conserved module of 230 amino acids []	Back alignment and domain information

>CHL00081 chlI Mg-protoporyphyrin IX chelatase	Back alignment and domain information

>COG0714 MoxR-like ATPases [General function prediction only]	Back alignment and domain information

>COG1224 TIP49 DNA helicase TIP49, TBP-interacting protein [Transcription]	Back alignment and domain information

>PF00308 Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013317 This entry represents the central domain of bacterial DnaA proteins [, , ] that play an important role in initiating and regulating chromosomal replication	Back alignment and domain information

>COG1474 CDC6 Cdc6-related protein, AAA superfamily ATPase [DNA replication, recombination, and repair / Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PHA02244 ATPase-like protein	Back alignment and domain information

>cd00009 AAA The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold	Back alignment and domain information

>KOG0737 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>smart00763 AAA_PrkA PrkA AAA domain	Back alignment and domain information

>TIGR00678 holB DNA polymerase III, delta' subunit	Back alignment and domain information

>PRK09112 DNA polymerase III subunit delta'; Validated	Back alignment and domain information

>PRK07471 DNA polymerase III subunit delta'; Validated	Back alignment and domain information

>TIGR02442 Cob-chelat-sub cobaltochelatase subunit	Back alignment and domain information

>smart00350 MCM minichromosome maintenance proteins	Back alignment and domain information

>TIGR02030 BchI-ChlI magnesium chelatase ATPase subunit I	Back alignment and domain information

>PF07726 AAA_3: ATPase family associated with various cellular activities (AAA); InterPro: IPR011703 This entry includes some of the AAA proteins not detected by the IPR003959 from INTERPRO model	Back alignment and domain information

>COG1222 RPT1 ATP-dependent 26S proteasome regulatory subunit [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PRK08058 DNA polymerase III subunit delta'; Validated	Back alignment and domain information

>PF06068 TIP49: TIP49 C-terminus; InterPro: IPR010339 This family consists of the C-terminal region of several eukaryotic and archaeal RuvB-like 1 (Pontin or TIP49a) and RuvB-like 2 (Reptin or TIP49b) proteins	Back alignment and domain information

>TIGR01241 FtsH_fam ATP-dependent metalloprotease FtsH	Back alignment and domain information

>PRK07399 DNA polymerase III subunit delta'; Validated	Back alignment and domain information

>TIGR03354 VI_FHA type VI secretion system FHA domain protein	Back alignment and domain information

>COG0470 HolB ATPase involved in DNA replication [DNA replication, recombination, and repair]	Back alignment and domain information

>PRK13531 regulatory ATPase RavA; Provisional	Back alignment and domain information

>KOG1051 consensus Chaperone HSP104 and related ATP-dependent Clp proteases [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PF07724 AAA_2: AAA domain (Cdc48 subfamily); InterPro: IPR013093 ATPases Associated to a variety of cellular Activities (AAA) are a family distinguished by a highly conserved module of 230 amino acids []	Back alignment and domain information

>TIGR03015 pepcterm_ATPase putative secretion ATPase, PEP-CTERM locus subfamily	Back alignment and domain information

>PRK11331 5-methylcytosine-specific restriction enzyme subunit McrB; Provisional	Back alignment and domain information

>COG0593 DnaA ATPase involved in DNA replication initiation [DNA replication, recombination, and repair]	Back alignment and domain information

>CHL00206 ycf2 Ycf2; Provisional	Back alignment and domain information

>TIGR00764 lon_rel lon-related putative ATP-dependent protease	Back alignment and domain information

>COG1220 HslU ATP-dependent protease HslVU (ClpYQ), ATPase subunit [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PRK05707 DNA polymerase III subunit delta'; Validated	Back alignment and domain information

>PF01078 Mg_chelatase: Magnesium chelatase, subunit ChlI; InterPro: IPR000523 Magnesium-chelatase is a three-component enzyme that catalyses the insertion of Mg2+ into protoporphyrin IX	Back alignment and domain information

>PRK08116 hypothetical protein; Validated	Back alignment and domain information

>TIGR02031 BchD-ChlD magnesium chelatase ATPase subunit D	Back alignment and domain information

>CHL00176 ftsH cell division protein; Validated	Back alignment and domain information

>COG1223 Predicted ATPase (AAA+ superfamily) [General function prediction only]	Back alignment and domain information

>KOG0734 consensus AAA+-type ATPase containing the peptidase M41 domain [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>smart00382 AAA ATPases associated with a variety of cellular activities	Back alignment and domain information

>PF03215 Rad17: Rad17 cell cycle checkpoint protein	Back alignment and domain information

>PRK11608 pspF phage shock protein operon transcriptional activator; Provisional	Back alignment and domain information

>TIGR01817 nifA Nif-specific regulatory protein	Back alignment and domain information

>COG1219 ClpX ATP-dependent protease Clp, ATPase subunit [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PRK04132 replication factor C small subunit; Provisional	Back alignment and domain information

>PRK12377 putative replication protein; Provisional	Back alignment and domain information

>KOG0991 consensus Replication factor C, subunit RFC2 [Replication, recombination and repair]	Back alignment and domain information

>TIGR02974 phageshock_pspF psp operon transcriptional activator PspF	Back alignment and domain information

>PRK15429 formate hydrogenlyase transcriptional activator FhlA; Provisional	Back alignment and domain information

>PTZ00454 26S protease regulatory subunit 6B-like protein; Provisional	Back alignment and domain information

>TIGR00368 Mg chelatase-related protein	Back alignment and domain information

>KOG2227 consensus Pre-initiation complex, subunit CDC6, AAA+ superfamily ATPase [Replication, recombination and repair; Cell cycle control, cell division, chromosome partitioning]	Back alignment and domain information

>PF13177 DNA_pol3_delta2: DNA polymerase III, delta subunit; PDB: 1NJF_B 3GLG_G 1XXH_I 1NJG_A 3GLF_B 3GLI_G 1IQP_E 2GNO_A 1SXJ_E 1A5T_A	Back alignment and domain information

>KOG1942 consensus DNA helicase, TBP-interacting protein [Replication, recombination and repair]	Back alignment and domain information

>PRK11388 DNA-binding transcriptional regulator DhaR; Provisional	Back alignment and domain information

>smart00240 FHA Forkhead associated domain	Back alignment and domain information

>PLN02927 antheraxanthin epoxidase/zeaxanthin epoxidase	Back alignment and domain information

>PRK08769 DNA polymerase III subunit delta'; Validated	Back alignment and domain information

>PF05621 TniB: Bacterial TniB protein; InterPro: IPR008868 This family consists of several bacterial TniB NTP-binding proteins	Back alignment and domain information

>TIGR00602 rad24 checkpoint protein rad24	Back alignment and domain information

>COG1221 PspF Transcriptional regulators containing an AAA-type ATPase domain and a DNA-binding domain [Transcription / Signal transduction mechanisms]	Back alignment and domain information

>PRK15424 propionate catabolism operon regulatory protein PrpR; Provisional	Back alignment and domain information

>COG0606 Predicted ATPase with chaperone activity [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PRK06871 DNA polymerase III subunit delta'; Validated	Back alignment and domain information

>PRK05022 anaerobic nitric oxide reductase transcription regulator; Provisional	Back alignment and domain information

>PRK07993 DNA polymerase III subunit delta'; Validated	Back alignment and domain information

>PRK06835 DNA replication protein DnaC; Validated	Back alignment and domain information

>PRK06964 DNA polymerase III subunit delta'; Validated	Back alignment and domain information

>PRK07952 DNA replication protein DnaC; Validated	Back alignment and domain information

>COG1484 DnaC DNA replication protein [DNA replication, recombination, and repair]	Back alignment and domain information

>TIGR02329 propionate_PrpR propionate catabolism operon regulatory protein PrpR	Back alignment and domain information

>PRK06090 DNA polymerase III subunit delta'; Validated	Back alignment and domain information

>PRK10820 DNA-binding transcriptional regulator TyrR; Provisional	Back alignment and domain information

>COG3829 RocR Transcriptional regulator containing PAS, AAA-type ATPase, and DNA-binding domains [Transcription / Signal transduction mechanisms]	Back alignment and domain information

>PF13207 AAA_17: AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6_G 2QT1_A 2QSZ_A 2QSY_A 2QT0_A 2QG6_A 2P0E_A	Back alignment and domain information

>PRK08939 primosomal protein DnaI; Reviewed	Back alignment and domain information

>PF01695 IstB_IS21: IstB-like ATP binding protein; InterPro: IPR002611 Proteins in this entry contain an ATP/GTP binding P-loop motif	Back alignment and domain information

>KOG2035 consensus Replication factor C, subunit RFC3 [Cell cycle control, cell division, chromosome partitioning; Replication, recombination and repair]	Back alignment and domain information

>PRK08181 transposase; Validated	Back alignment and domain information

>KOG1514 consensus Origin recognition complex, subunit 1, and related proteins [Replication, recombination and repair]	Back alignment and domain information

>COG3604 FhlA Transcriptional regulator containing GAF, AAA-type ATPase, and DNA binding domains [Transcription / Signal transduction mechanisms]	Back alignment and domain information

>PRK13765 ATP-dependent protease Lon; Provisional	Back alignment and domain information

>PTZ00361 26 proteosome regulatory subunit 4-like protein; Provisional	Back alignment and domain information

>COG1716 FOG: FHA domain [Signal transduction mechanisms]	Back alignment and domain information

>PF00158 Sigma54_activat: Sigma-54 interaction domain; InterPro: IPR002078 Some bacterial regulatory proteins activate the expression of genes from promoters recognised by core RNA polymerase associated with the alternative sigma-54 factor	Back alignment and domain information

>TIGR02915 PEP_resp_reg putative PEP-CTERM system response regulator	Back alignment and domain information

>COG1239 ChlI Mg-chelatase subunit ChlI [Coenzyme metabolism]	Back alignment and domain information

>KOG0745 consensus Putative ATP-dependent Clp-type protease (AAA+ ATPase superfamily) [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PRK10733 hflB ATP-dependent metalloprotease; Reviewed	Back alignment and domain information

>PRK08118 topology modulation protein; Reviewed	Back alignment and domain information

>PTZ00111 DNA replication licensing factor MCM4; Provisional	Back alignment and domain information

>PRK08699 DNA polymerase III subunit delta'; Validated	Back alignment and domain information

>PRK10923 glnG nitrogen regulation protein NR(I); Provisional	Back alignment and domain information

>COG2204 AtoC Response regulator containing CheY-like receiver, AAA-type ATPase, and DNA-binding domains [Signal transduction mechanisms]	Back alignment and domain information

>PRK09862 putative ATP-dependent protease; Provisional	Back alignment and domain information

>PRK06526 transposase; Provisional	Back alignment and domain information

>PRK06921 hypothetical protein; Provisional	Back alignment and domain information

>KOG2680 consensus DNA helicase TIP49, TBP-interacting protein [Transcription]	Back alignment and domain information

>COG0542 clpA ATP-binding subunits of Clp protease and DnaK/DnaJ chaperones [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PRK11361 acetoacetate metabolism regulatory protein AtoC; Provisional	Back alignment and domain information

>PRK13949 shikimate kinase; Provisional	Back alignment and domain information

>PRK07261 topology modulation protein; Provisional	Back alignment and domain information

>KOG1970 consensus Checkpoint RAD17-RFC complex, RAD17/RAD24 component [Cell cycle control, cell division, chromosome partitioning; Replication, recombination and repair]	Back alignment and domain information

>KOG0990 consensus Replication factor C, subunit RFC5 [Replication, recombination and repair]	Back alignment and domain information

>KOG0740 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>TIGR01242 26Sp45 26S proteasome subunit P45 family	Back alignment and domain information

>KOG0738 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PRK15455 PrkA family serine protein kinase; Provisional	Back alignment and domain information

>TIGR01818 ntrC nitrogen regulation protein NR(I)	Back alignment and domain information

>PF12775 AAA_7: P-loop containing dynein motor region D3; PDB: 4AKI_A 4AI6_B 4AKH_A 4AKG_A 3QMZ_A 3VKH_A 3VKG_A	Back alignment and domain information

>PF00910 RNA_helicase: RNA helicase; InterPro: IPR000605 Helicases have been classified in 5 superfamilies (SF1-SF5)	Back alignment and domain information

>PRK00131 aroK shikimate kinase; Reviewed	Back alignment and domain information

>KOG0739 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PRK09183 transposase/IS protein; Provisional	Back alignment and domain information

>PRK06217 hypothetical protein; Validated	Back alignment and domain information

>KOG0731 consensus AAA+-type ATPase containing the peptidase M41 domain [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PF12774 AAA_6: Hydrolytic ATP binding site of dynein motor region D1; PDB: 3VKH_A 3VKG_A 4AKI_A 4AI6_B 4AKH_A 4AKG_A 3QMZ_A	Back alignment and domain information

>PRK13947 shikimate kinase; Provisional	Back alignment and domain information

>KOG1881 consensus Anion exchanger adaptor protein Kanadaptin, contains FHA domain [General function prediction only]	Back alignment and domain information

>cd00227 CPT Chloramphenicol (Cm) phosphotransferase (CPT)	Back alignment and domain information

>PRK15115 response regulator GlrR; Provisional	Back alignment and domain information

>PF14532 Sigma54_activ_2: Sigma-54 interaction domain; PDB: 3CO5_B 3N70_H	Back alignment and domain information

>PF13671 AAA_33: AAA domain; PDB: 1LTQ_A 2IA5_K 1RC8_A 1LY1_A 1RRC_A 1RPZ_A 3ZVM_A 1YJ5_A 3ZVL_A 3U7E_B	Back alignment and domain information

>KOG0728 consensus 26S proteasome regulatory complex, ATPase RPT6 [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>COG3456 Predicted component of the type VI protein secretion system, contains a FHA domain [Intracellular trafficking, secretion, and vesicular transport; Signal transduction mechanisms]	Back alignment and domain information

>PHA02624 large T antigen; Provisional	Back alignment and domain information

>TIGR03689 pup_AAA proteasome ATPase	Back alignment and domain information

>KOG1968 consensus Replication factor C, subunit RFC1 (large subunit) [Replication, recombination and repair]	Back alignment and domain information

>PF01637 Arch_ATPase: Archaeal ATPase; InterPro: IPR011579 This domain has been found in a number of bacterial and archaeal proteins, all of which contain a conserved P-loop motif that is involved in binding ATP	Back alignment and domain information

>PF00931 NB-ARC: NB-ARC domain; InterPro: IPR002182 This is the NB-ARC domain, a novel signalling motif found in bacteria and eukaryotes, shared by plant resistance gene products and regulators of cell death in animals []	Back alignment and domain information

>PRK13406 bchD magnesium chelatase subunit D; Provisional	Back alignment and domain information

>TIGR01313 therm_gnt_kin carbohydrate kinase, thermoresistant glucokinase family	Back alignment and domain information

>PF03969 AFG1_ATPase: AFG1-like ATPase; InterPro: IPR005654 ATPase family gene 1 (AFG1) ATPase is a 377 amino acid putative protein with an ATPase motif typical of the protein family including SEC18p PAS1, CDC48-VCP and TBP	Back alignment and domain information

>PF05729 NACHT: NACHT domain	Back alignment and domain information

>PRK08154 anaerobic benzoate catabolism transcriptional regulator; Reviewed	Back alignment and domain information

>PRK13948 shikimate kinase; Provisional	Back alignment and domain information

>cd02021 GntK Gluconate kinase (GntK) catalyzes the phosphoryl transfer from ATP to gluconate	Back alignment and domain information

>cd00464 SK Shikimate kinase (SK) is the fifth enzyme in the shikimate pathway, a seven-step biosynthetic pathway which converts erythrose-4-phosphate to chorismic acid, found in bacteria, fungi and plants	Back alignment and domain information

>KOG0726 consensus 26S proteasome regulatory complex, ATPase RPT2 [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PRK03839 putative kinase; Provisional	Back alignment and domain information

>COG0703 AroK Shikimate kinase [Amino acid transport and metabolism]	Back alignment and domain information

>KOG0478 consensus DNA replication licensing factor, MCM4 component [Replication, recombination and repair]	Back alignment and domain information

>PRK06547 hypothetical protein; Provisional	Back alignment and domain information

>PRK06762 hypothetical protein; Provisional	Back alignment and domain information

>PRK00771 signal recognition particle protein Srp54; Provisional	Back alignment and domain information

>PRK08233 hypothetical protein; Provisional	Back alignment and domain information

>PRK05917 DNA polymerase III subunit delta'; Validated	Back alignment and domain information

>COG0465 HflB ATP-dependent Zn proteases [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PF13401 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S_B	Back alignment and domain information

>PF06309 Torsin: Torsin; InterPro: IPR010448 This family consists of several eukaryotic torsin proteins	Back alignment and domain information

>PHA00729 NTP-binding motif containing protein	Back alignment and domain information

>PRK05057 aroK shikimate kinase I; Reviewed	Back alignment and domain information

>PRK07276 DNA polymerase III subunit delta'; Validated	Back alignment and domain information

>PRK04040 adenylate kinase; Provisional	Back alignment and domain information

>PRK00625 shikimate kinase; Provisional	Back alignment and domain information

>TIGR01359 UMP_CMP_kin_fam UMP-CMP kinase family	Back alignment and domain information

>PRK14532 adenylate kinase; Provisional	Back alignment and domain information

>PRK07132 DNA polymerase III subunit delta'; Validated	Back alignment and domain information

>PF00493 MCM: MCM2/3/5 family This family extends the MCM domain of Prosite	Back alignment and domain information

>KOG0652 consensus 26S proteasome regulatory complex, ATPase RPT5 [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PRK10365 transcriptional regulatory protein ZraR; Provisional	Back alignment and domain information

>cd01428 ADK Adenylate kinase (ADK) catalyzes the reversible phosphoryl transfer from adenosine triphosphates (ATP) to adenosine monophosphates (AMP) and to yield adenosine diphosphates (ADP)	Back alignment and domain information

>cd02020 CMPK Cytidine monophosphate kinase (CMPK) catalyzes the reversible phosphorylation of cytidine monophosphate (CMP) to produce cytidine diphosphate (CDP), using ATP as the preferred phosphoryl donor	Back alignment and domain information

>PF06414 Zeta_toxin: Zeta toxin; InterPro: IPR010488 This entry represents a domain originally identified in bacterial zeta toxin proteins, where it comprises the whole protein []	Back alignment and domain information

>PRK14531 adenylate kinase; Provisional	Back alignment and domain information

>PF13191 AAA_16: AAA ATPase domain; PDB: 2V1U_A	Back alignment and domain information

>KOG0744 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PLN03210 Resistant to P	Back alignment and domain information

>COG1241 MCM2 Predicted ATPase involved in replication control, Cdc46/Mcm family [DNA replication, recombination, and repair]	Back alignment and domain information

>PRK12723 flagellar biosynthesis regulator FlhF; Provisional	Back alignment and domain information

>KOG3347 consensus Predicted nucleotide kinase/nuclear protein involved oxidative stress response [Nucleotide transport and metabolism]	Back alignment and domain information

>PRK14530 adenylate kinase; Provisional	Back alignment and domain information

>PRK05818 DNA polymerase III subunit delta'; Validated	Back alignment and domain information

>KOG2383 consensus Predicted ATPase [General function prediction only]	Back alignment and domain information

>COG5271 MDN1 AAA ATPase containing von Willebrand factor type A (vWA) domain [General function prediction only]	Back alignment and domain information

>PRK03731 aroL shikimate kinase II; Reviewed	Back alignment and domain information

>TIGR01618 phage_P_loop phage nucleotide-binding protein	Back alignment and domain information

>PRK13808 adenylate kinase; Provisional	Back alignment and domain information

>PF01583 APS_kinase: Adenylylsulphate kinase; InterPro: IPR002891 Protein phosphorylation, which plays a key role in most cellular activities, is a reversible process mediated by protein kinases and phosphoprotein phosphatases	Back alignment and domain information

>PHA02530 pseT polynucleotide kinase; Provisional	Back alignment and domain information

>PF01745 IPT: Isopentenyl transferase; InterPro: IPR002648 Isopentenyl transferase / dimethylallyl transferase synthesizes isopentenyladensosine 5'-monophosphate, a cytokinin that induces shoot formation on host plants infected with the Ti plasmid []	Back alignment and domain information

>PTZ00088 adenylate kinase 1; Provisional	Back alignment and domain information

>TIGR01360 aden_kin_iso1 adenylate kinase, isozyme 1 subfamily	Back alignment and domain information

>PRK13946 shikimate kinase; Provisional	Back alignment and domain information

>PRK02496 adk adenylate kinase; Provisional	Back alignment and domain information

>PRK14528 adenylate kinase; Provisional	Back alignment and domain information

>cd02027 APSK Adenosine 5'-phosphosulfate kinase (APSK) catalyzes the phosphorylation of adenosine 5'-phosphosulfate to form 3'-phosphoadenosine 5'-phosphosulfate (PAPS)	Back alignment and domain information

>TIGR01351 adk adenylate kinases	Back alignment and domain information

>PHA02774 E1; Provisional	Back alignment and domain information

>PRK00279 adk adenylate kinase; Reviewed	Back alignment and domain information

>PLN02200 adenylate kinase family protein	Back alignment and domain information

>PRK05541 adenylylsulfate kinase; Provisional	Back alignment and domain information

>COG0529 CysC Adenylylsulfate kinase and related kinases [Inorganic ion transport and metabolism]	Back alignment and domain information

>COG0324 MiaA tRNA delta(2)-isopentenylpyrophosphate transferase [Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>PRK14527 adenylate kinase; Provisional	Back alignment and domain information

>COG1618 Predicted nucleotide kinase [Nucleotide transport and metabolism]	Back alignment and domain information

>PRK05480 uridine/cytidine kinase; Provisional	Back alignment and domain information

>PRK14722 flhF flagellar biosynthesis regulator FlhF; Provisional	Back alignment and domain information

>COG1102 Cmk Cytidylate kinase [Nucleotide transport and metabolism]	Back alignment and domain information

>cd01120 RecA-like_NTPases RecA-like NTPases	Back alignment and domain information

>PF00406 ADK: Adenylate kinase; InterPro: IPR000850 Adenylate kinases (ADK) are phosphotransferases that catalyse the reversible reaction AMP + MgATP = ADP + MgADP an essential reaction for many processes in living cells	Back alignment and domain information

>PRK07667 uridine kinase; Provisional	Back alignment and domain information

>PF13238 AAA_18: AAA domain; PDB: 3IIK_A 3IIJ_A 3IIL_A 1RKB_A 3IIM_A 2AXP_A 3KB2_A 1KHT_A 1NKS_A 3H86_C	Back alignment and domain information

>PRK04182 cytidylate kinase; Provisional	Back alignment and domain information

>PRK10867 signal recognition particle protein; Provisional	Back alignment and domain information

>cd02028 UMPK_like Uridine monophosphate kinase_like (UMPK_like) is a family of proteins highly similar to the uridine monophosphate kinase (UMPK, EC 2	Back alignment and domain information

>TIGR01425 SRP54_euk signal recognition particle protein SRP54	Back alignment and domain information

>PLN02199 shikimate kinase	Back alignment and domain information

>KOG0732 consensus AAA+-type ATPase containing the bromodomain [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>TIGR03574 selen_PSTK L-seryl-tRNA(Sec) kinase, archaeal	Back alignment and domain information

>KOG0482 consensus DNA replication licensing factor, MCM7 component [Replication, recombination and repair]	Back alignment and domain information

>PRK06696 uridine kinase; Validated	Back alignment and domain information

>PRK14730 coaE dephospho-CoA kinase; Provisional	Back alignment and domain information

>cd02024 NRK1 Nicotinamide riboside kinase (NRK) is an enzyme involved in the metabolism of nicotinamide adenine dinucleotide (NAD+)	Back alignment and domain information

>PF13173 AAA_14: AAA domain	Back alignment and domain information

>KOG0480 consensus DNA replication licensing factor, MCM6 component [Replication, recombination and repair]	Back alignment and domain information

>KOG0245 consensus Kinesin-like protein [Cytoskeleton]	Back alignment and domain information

>PRK01184 hypothetical protein; Provisional	Back alignment and domain information

>TIGR02173 cyt_kin_arch cytidylate kinase, putative	Back alignment and domain information

>cd01124 KaiC KaiC is a circadian clock protein primarily found in cyanobacteria KaiC is a RecA-like ATPase, having both Walker A and Walker B motifs	Back alignment and domain information

>COG0563 Adk Adenylate kinase and related kinases [Nucleotide transport and metabolism]	Back alignment and domain information

>PF13521 AAA_28: AAA domain; PDB: 1LW7_A	Back alignment and domain information

>PF13086 AAA_11: AAA domain; PDB: 2XZL_A 2XZO_A 2WJY_A 2WJV_A 2XZP_A 2GK6_A 2GK7_A 2GJK_A	Back alignment and domain information

>PRK00091 miaA tRNA delta(2)-isopentenylpyrophosphate transferase; Reviewed	Back alignment and domain information

>PLN02674 adenylate kinase	Back alignment and domain information

>PRK14526 adenylate kinase; Provisional	Back alignment and domain information

>PRK00889 adenylylsulfate kinase; Provisional	Back alignment and domain information

>PF13245 AAA_19: Part of AAA domain	Back alignment and domain information

>PTZ00202 tuzin; Provisional	Back alignment and domain information

>COG1936 Predicted nucleotide kinase (related to CMP and AMP kinases) [Nucleotide transport and metabolism]	Back alignment and domain information

>PF05272 VirE: Virulence-associated protein E; InterPro: IPR007936 This family contains several bacterial virulence-associated protein E like proteins	Back alignment and domain information

>COG1485 Predicted ATPase [General function prediction only]	Back alignment and domain information

>PRK05537 bifunctional sulfate adenylyltransferase subunit 1/adenylylsulfate kinase protein; Validated	Back alignment and domain information

>cd02025 PanK Pantothenate kinase (PanK) catalyzes the phosphorylation of pantothenic acid to form 4'-phosphopantothenic, which is the first of five steps in coenzyme A (CoA) biosynthetic pathway	Back alignment and domain information

>TIGR00235 udk uridine kinase	Back alignment and domain information

>TIGR00152 dephospho-CoA kinase	Back alignment and domain information

>TIGR00959 ffh signal recognition particle protein	Back alignment and domain information

>TIGR00455 apsK adenylylsulfate kinase (apsK)	Back alignment and domain information

>TIGR00150 HI0065_YjeE ATPase, YjeE family	Back alignment and domain information

>PF08298 AAA_PrkA: PrkA AAA domain; InterPro: IPR013153 This is entry is found at the N terminus of PrkA proteins - bacterial and archaeal serine kinases approximately 630 residues in length	Back alignment and domain information

>cd02023 UMPK Uridine monophosphate kinase (UMPK, EC 2	Back alignment and domain information

>cd02019 NK Nucleoside/nucleotide kinase (NK) is a protein superfamily consisting of multiple families of enzymes that share structural similarity and are functionally related to the catalysis of the reversible phosphate group transfer from nucleoside triphosphates to nucleosides/nucleotides, nucleoside monophosphates, or sugars	Back alignment and domain information

>PRK14529 adenylate kinase; Provisional	Back alignment and domain information

>PLN02165 adenylate isopentenyltransferase	Back alignment and domain information

>KOG2228 consensus Origin recognition complex, subunit 4 [Replication, recombination and repair]	Back alignment and domain information

>PRK11889 flhF flagellar biosynthesis regulator FlhF; Provisional	Back alignment and domain information

>PRK13951 bifunctional shikimate kinase/3-dehydroquinate synthase; Provisional	Back alignment and domain information

>PLN02840 tRNA dimethylallyltransferase	Back alignment and domain information

>PRK12339 2-phosphoglycerate kinase; Provisional	Back alignment and domain information

>PRK12724 flagellar biosynthesis regulator FlhF; Provisional	Back alignment and domain information

>COG1855 ATPase (PilT family) [General function prediction only]	Back alignment and domain information

>TIGR02012 tigrfam_recA protein RecA	Back alignment and domain information

>TIGR02237 recomb_radB DNA repair and recombination protein RadB	Back alignment and domain information

>PLN02459 probable adenylate kinase	Back alignment and domain information

>PRK10078 ribose 1,5-bisphosphokinase; Provisional	Back alignment and domain information

>COG3267 ExeA Type II secretory pathway, component ExeA (predicted ATPase) [Intracellular trafficking and secretion]	Back alignment and domain information

>TIGR00174 miaA tRNA isopentenyltransferase (miaA)	Back alignment and domain information

>PRK04220 2-phosphoglycerate kinase; Provisional	Back alignment and domain information

>KOG3354 consensus Gluconate kinase [Carbohydrate transport and metabolism]	Back alignment and domain information

>PRK05439 pantothenate kinase; Provisional	Back alignment and domain information

>PRK12338 hypothetical protein; Provisional	Back alignment and domain information

>COG0572 Udk Uridine kinase [Nucleotide transport and metabolism]	Back alignment and domain information

>KOG0729 consensus 26S proteasome regulatory complex, ATPase RPT1 [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PF09336 Vps4_C: Vps4 C terminal oligomerisation domain; InterPro: IPR015415 This domain is found at the C-terminal of ATPase proteins involved in vacuolar sorting	Back alignment and domain information

>KOG0477 consensus DNA replication licensing factor, MCM2 component [Replication, recombination and repair]	Back alignment and domain information

>cd01394 radB RadB	Back alignment and domain information

>PRK14021 bifunctional shikimate kinase/3-dehydroquinate synthase; Provisional	Back alignment and domain information

>PRK10416 signal recognition particle-docking protein FtsY; Provisional	Back alignment and domain information

>PRK05800 cobU adenosylcobinamide kinase/adenosylcobinamide-phosphate guanylyltransferase; Validated	Back alignment and domain information

>COG0467 RAD55 RecA-superfamily ATPases implicated in signal transduction [Signal transduction mechanisms]	Back alignment and domain information

>cd00983 recA RecA is a bacterial enzyme which has roles in homologous recombination, DNA repair, and the induction of the SOS response	Back alignment and domain information

>TIGR03877 thermo_KaiC_1 KaiC domain protein, Ph0284 family	Back alignment and domain information

>PRK09270 nucleoside triphosphate hydrolase domain-containing protein; Reviewed	Back alignment and domain information

>PF06745 KaiC: KaiC; InterPro: IPR014774 This entry represents a domain within bacterial and archaeal proteins, most of which are hypothetical	Back alignment and domain information

>TIGR02322 phosphon_PhnN phosphonate metabolism protein/1,5-bisphosphokinase (PRPP-forming) PhnN	Back alignment and domain information

>COG4088 Predicted nucleotide kinase [Nucleotide transport and metabolism]	Back alignment and domain information

>cd02022 DPCK Dephospho-coenzyme A kinase (DPCK, EC 2	Back alignment and domain information

>PRK09361 radB DNA repair and recombination protein RadB; Provisional	Back alignment and domain information

>PRK13975 thymidylate kinase; Provisional	Back alignment and domain information

>PF07931 CPT: Chloramphenicol phosphotransferase-like protein; InterPro: IPR012853 The members of this family are all similar to chloramphenicol 3-O phosphotransferase (CPT, Q56148 from SWISSPROT) expressed by Streptomyces venezuelae	Back alignment and domain information

>PRK12726 flagellar biosynthesis regulator FlhF; Provisional	Back alignment and domain information

>PLN02348 phosphoribulokinase	Back alignment and domain information

>PF02367 UPF0079: Uncharacterised P-loop hydrolase UPF0079; InterPro: IPR003442 This group consists of bacterial proteins, which contain a P-loop	Back alignment and domain information

>cd01129 PulE-GspE PulE/GspE The type II secretory pathway is the main terminal branch of the general secretory pathway (GSP)	Back alignment and domain information

>PRK09825 idnK D-gluconate kinase; Provisional	Back alignment and domain information

>PRK05973 replicative DNA helicase; Provisional	Back alignment and domain information

>PRK00300 gmk guanylate kinase; Provisional	Back alignment and domain information

>TIGR00064 ftsY signal recognition particle-docking protein FtsY	Back alignment and domain information

>cd03115 SRP The signal recognition particle (SRP) mediates the transport to or across the plasma membrane in bacteria and the endoplasmic reticulum in eukaryotes	Back alignment and domain information

>TIGR03878 thermo_KaiC_2 KaiC domain protein, AF_0795 family	Back alignment and domain information

>TIGR03263 guanyl_kin guanylate kinase	Back alignment and domain information

>PTZ00301 uridine kinase; Provisional	Back alignment and domain information

>PRK09354 recA recombinase A; Provisional	Back alignment and domain information

>PRK06067 flagellar accessory protein FlaH; Validated	Back alignment and domain information

>PRK08356 hypothetical protein; Provisional	Back alignment and domain information

>PF13604 AAA_30: AAA domain; PDB: 1W36_G 3K70_G 3UPU_B 3GPL_A 3E1S_A 3GP8_A	Back alignment and domain information

>PF03266 NTPase_1: NTPase; InterPro: IPR004948 This entry represents a family of nucleoside-triphosphatases which have activity towards ATP, GTP, CTP, TTP and UTP and may hydrolyse nucleoside diphosphates with lower efficiency []	Back alignment and domain information

>cd01672 TMPK Thymidine monophosphate kinase (TMPK), also known as thymidylate kinase, catalyzes the phosphorylation of thymidine monophosphate (TMP) to thymidine diphosphate (TDP) utilizing ATP as its preferred phophoryl donor	Back alignment and domain information

>PRK11545 gntK gluconate kinase 1; Provisional	Back alignment and domain information

>PF00485 PRK: Phosphoribulokinase / Uridine kinase family; InterPro: IPR006083 Phosphoribulokinase (PRK) 2	Back alignment and domain information

>PLN02748 tRNA dimethylallyltransferase	Back alignment and domain information

>PF10443 RNA12: RNA12 protein; InterPro: IPR018850 Mitochondrial escape protein 2 (also known as RNA12) plays a role in maintaining the mitochondrial genome and in controlling mtDNA escape [, ]	Back alignment and domain information

>COG5271 MDN1 AAA ATPase containing von Willebrand factor type A (vWA) domain [General function prediction only]	Back alignment and domain information

>PRK14738 gmk guanylate kinase; Provisional	Back alignment and domain information

>cd01128 rho_factor Transcription termination factor rho is a bacterial ATP-dependent RNA/DNA helicase	Back alignment and domain information

>TIGR03881 KaiC_arch_4 KaiC domain protein, PAE1156 family	Back alignment and domain information

>PF00437 T2SE: Type II/IV secretion system protein; InterPro: IPR001482 A number of bacterial proteins, some of which are involved in a general secretion pathway (GSP) for the export of proteins (also called the type II pathway) belong to this group [, ]	Back alignment and domain information

>cd00544 CobU Adenosylcobinamide kinase / adenosylcobinamide phosphate guanyltransferase (CobU)	Back alignment and domain information

>PRK06761 hypothetical protein; Provisional	Back alignment and domain information

>PF08423 Rad51: Rad51; InterPro: IPR013632 This domain is found at the C terminus of the DNA repair and recombination protein Rad51	Back alignment and domain information

>TIGR00017 cmk cytidylate kinase	Back alignment and domain information

>PF10662 PduV-EutP: Ethanolamine utilisation - propanediol utilisation; InterPro: IPR012381 Members of this family function in ethanolamine [] and propanediol [] degradation pathways	Back alignment and domain information

>PRK03846 adenylylsulfate kinase; Provisional	Back alignment and domain information

>TIGR03499 FlhF flagellar biosynthetic protein FlhF	Back alignment and domain information

>PRK14732 coaE dephospho-CoA kinase; Provisional	Back alignment and domain information

>cd00071 GMPK Guanosine monophosphate kinase (GMPK, EC 2	Back alignment and domain information

>PRK00023 cmk cytidylate kinase; Provisional	Back alignment and domain information

>PRK05703 flhF flagellar biosynthesis regulator FlhF; Validated	Back alignment and domain information

>PRK08533 flagellar accessory protein FlaH; Reviewed	Back alignment and domain information

>TIGR01663 PNK-3'Pase polynucleotide 5'-kinase 3'-phosphatase	Back alignment and domain information

>PF12780 AAA_8: P-loop containing dynein motor region D4; InterPro: IPR024317 The 380 kDa motor unit of dynein belongs to the AAA class of chaperone-like ATPases	Back alignment and domain information

>PF13479 AAA_24: AAA domain	Back alignment and domain information

>PRK14974 cell division protein FtsY; Provisional	Back alignment and domain information

>PRK12608 transcription termination factor Rho; Provisional	Back alignment and domain information

>PRK09518 bifunctional cytidylate kinase/GTPase Der; Reviewed	Back alignment and domain information

>TIGR01613 primase_Cterm phage/plasmid primase, P4 family, C-terminal domain	Back alignment and domain information

>KOG2543 consensus Origin recognition complex, subunit 5 [Replication, recombination and repair]	Back alignment and domain information

>PLN00020 ribulose bisphosphate carboxylase/oxygenase activase -RuBisCO activase (RCA); Provisional	Back alignment and domain information

>PLN02318 phosphoribulokinase/uridine kinase	Back alignment and domain information

>cd01134 V_A-ATPase_A V/A-type ATP synthase catalytic subunit A	Back alignment and domain information

>PRK04328 hypothetical protein; Provisional	Back alignment and domain information

>PF00448 SRP54: SRP54-type protein, GTPase domain; InterPro: IPR000897 The signal recognition particle (SRP) is a multimeric protein, which along with its conjugate receptor (SR), is involved in targeting secretory proteins to the rough endoplasmic reticulum (RER) membrane in eukaryotes, or to the plasma membrane in prokaryotes [, ]	Back alignment and domain information

>PRK06851 hypothetical protein; Provisional	Back alignment and domain information

>cd01123 Rad51_DMC1_radA Rad51_DMC1_radA,B	Back alignment and domain information

>PRK14737 gmk guanylate kinase; Provisional	Back alignment and domain information

>COG5245 DYN1 Dynein, heavy chain [Cytoskeleton]	Back alignment and domain information

>COG3283 TyrR Transcriptional regulator of aromatic amino acids metabolism [Transcription / Amino acid transport and metabolism]	Back alignment and domain information

>PRK04841 transcriptional regulator MalT; Provisional	Back alignment and domain information

>PRK10536 hypothetical protein; Provisional	Back alignment and domain information

>PF01202 SKI: Shikimate kinase; InterPro: IPR000623 Shikimate kinase (2	Back alignment and domain information

>cd00046 DEXDc DEAD-like helicases superfamily	Back alignment and domain information

>PF04851 ResIII: Type III restriction enzyme, res subunit; InterPro: IPR006935 This entry represents a domain found in the N terminus of several proteins, including helicases, the R subunit (HsdR) of type I restriction endonucleases (3	Back alignment and domain information

>cd00984 DnaB_C DnaB helicase C terminal domain	Back alignment and domain information

>TIGR03880 KaiC_arch_3 KaiC domain protein, AF_0351 family	Back alignment and domain information

>PRK12337 2-phosphoglycerate kinase; Provisional	Back alignment and domain information

>PRK00081 coaE dephospho-CoA kinase; Reviewed	Back alignment and domain information

>PRK08099 bifunctional DNA-binding transcriptional repressor/ NMN adenylyltransferase; Provisional	Back alignment and domain information

>PF10236 DAP3: Mitochondrial ribosomal death-associated protein 3; InterPro: IPR019368 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms	Back alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST

Original result of BLAST against Protein Data Bank

ID	Alignment Graph	Length	Definition	E-value
Query		1223
3d8b_A		357	Crystal Structure Of Human Fidgetin-Like Protein 1		2e-44
3vfd_A		389	Human Spastin Aaa Domain Length = 389		9e-44
3b9p_A		297	Spastin Length = 297		4e-40
2qp9_X		355	Crystal Structure Of S.Cerevisiae Vps4 Length = 355		1e-32
2rko_A		331	Crystal Structure Of The Vps4p-Dimer Length = 331		3e-32
3eih_A		340	Crystal Structure Of S.Cerevisiae Vps4 In The Prese		3e-32
3eie_A		322	Crystal Structure Of S.Cerevisiae Vps4 In The So4-B		4e-32
2zam_A		444	Crystal Structure Of Mouse Skd1VPS4B APO-Form Lengt		1e-31
1r7r_A		816	The Crystal Structure Of Murine P97VCP AT 3.6A Leng		2e-30
3cf1_A		806	Structure Of P97VCP IN COMPLEX WITH ADPADP.ALFX Len		2e-30
3cf0_A		301	Structure Of D2 Subdomain Of P97VCP IN COMPLEX WITH		2e-30
1xwi_A		322	Crystal Structure Of Vps4b Length = 322		8e-30
3hu2_A		489	Structure Of P97 N-D1 R86a Mutant In Complex With A		9e-30
3hu3_A		489	Structure Of P97 N-D1 R155h Mutant In Complex With		9e-30
3hu1_A		489	Structure Of P97 N-D1 R95g Mutant In Complex With A		9e-30
1e32_A		458	Structure Of The N-Terminal Domain And The D1 Aaa D		2e-29
4b4t_L		437	Near-Atomic Resolution Structural Model Of The Yeas		3e-28
3h4m_A		285	Aaa Atpase Domain Of The Proteasome- Activating Nuc		1e-27
2x8a_A		274	Human Nuclear Valosin Containing Protein Like (Nvl)		6e-25
2ce7_A		476	Edta Treated Length = 476		8e-25
3kds_E		465	Apo-ftsh Crystal Structure Length = 465		4e-24
1lv7_A		257	Crystal Structure Of The Aaa Domain Of Ftsh Length		4e-24
4b4t_I		437	Near-Atomic Resolution Structural Model Of The Yeas		1e-23
2r62_A		268	Crystal Structure Of Helicobacter Pylori Atp Depend		1e-20
4b4t_J		405	Near-Atomic Resolution Structural Model Of The Yeas		5e-20
4b4t_H		467	Near-Atomic Resolution Structural Model Of The Yeas		5e-20
2qz4_A		262	Human Paraplegin, Aaa Domain In Complex With Adp Le		2e-19
4b4t_M		434	Near-Atomic Resolution Structural Model Of The Yeas		8e-19
4b4t_K		428	Near-Atomic Resolution Structural Model Of The Yeas		7e-17
1iy2_A		278	Crystal Structure Of The Ftsh Atpase Domain From Th		8e-17
1ixz_A		254	Crystal Structure Of The Ftsh Atpase Domain From Th		1e-16
2dhr_A		499	Whole Cytosolic Region Of Atp-Dependent Metalloprot		1e-16
4eiw_A		508	Whole Cytosolic Region Of Atp-Dependent Metalloprot		1e-16
3m6a_A		543	Crystal Structure Of Bacillus Subtilis Lon C-Termin		4e-04

>pdb|3D8B|A Chain A, Crystal Structure Of Human Fidgetin-Like Protein 1 In Complex With Adp Length = 357