Citrus Sinensis ID: 000922
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
|
|
Close Homologs for Annotation Transfer
Close Homologs in SWISS-PROT Database Detected by BLAST 
Original result of BLAST against SWISS-PROT Database
| ID | Alignment graph | Length |
Definition |
RBH(Q2H) |
RBH(H2Q) |
Q cover |
H cover |
Identity |
E-value |
| Query | 1223 | 2.2.26 [Sep-21-2011] | |||||||
| Q40392 | 1144 | TMV resistance protein N | N/A | no | 0.777 | 0.831 | 0.360 | 1e-167 | |
| O82500 | 1095 | Putative disease resistan | no | no | 0.614 | 0.686 | 0.381 | 1e-145 | |
| O23530 | 1301 | Protein SUPPRESSOR OF npr | no | no | 0.694 | 0.652 | 0.356 | 1e-134 | |
| Q9SZ67 | 1895 | Probable WRKY transcripti | no | no | 0.615 | 0.397 | 0.352 | 1e-123 | |
| Q9FL92 | 1372 | Probable WRKY transcripti | no | no | 0.601 | 0.536 | 0.321 | 1e-101 | |
| Q9FH83 | 1288 | Probable WRKY transcripti | no | no | 0.748 | 0.710 | 0.307 | 3e-96 | |
| Q9FKN7 | 1613 | Protein DA1-related 4 OS= | no | no | 0.631 | 0.478 | 0.305 | 4e-87 | |
| Q9FHE9 | 354 | Protein PHLOEM PROTEIN 2- | no | no | 0.144 | 0.5 | 0.383 | 3e-26 | |
| Q9LVT1 | 623 | Putative disease resistan | no | no | 0.424 | 0.833 | 0.232 | 9e-25 | |
| Q9C5Q9 | 411 | Protein PHLOEM PROTEIN 2- | no | no | 0.106 | 0.316 | 0.450 | 2e-24 |
| >sp|Q40392|TMVRN_NICGU TMV resistance protein N OS=Nicotiana glutinosa GN=N PE=1 SV=1 | Back alignment and function desciption |
|---|
Score = 589 bits (1519), Expect = e-167, Method: Compositional matrix adjust.
Identities = 391/1084 (36%), Positives = 598/1084 (55%), Gaps = 133/1084 (12%)
Query: 66 YDVFVSFRGEDTRDNFTSHLVAALCRKKIKTFIDEQ-LDRGDDISPALLDAIERSKISVI 124
YDVF+SFRGEDTR FTSHL L K IKTF D++ L+ G I L AIE S+ +++
Sbjct: 12 YDVFLSFRGEDTRKTFTSHLYEVLNDKGIKTFQDDKRLEYGATIPGELCKAIEESQFAIV 71
Query: 125 IFSENYASSKWCLDELVKILECKNKNAQMVVPVFYHVDPSDVRKQTGSFGDAFVKHEKQF 184
+FSENYA+S+WCL+ELVKI+ECK + Q V+P+FY VDPS VR Q SF AF +HE ++
Sbjct: 72 VFSENYATSRWCLNELVKIMECKTRFKQTVIPIFYDVDPSHVRNQKESFAKAFEEHETKY 131
Query: 185 KGIPEKVQKWRVVLTEASNLSGWDSMNIRPEAKLVDEIIEDILKKLKDKSFSSDFEGLVG 244
K E +Q+WR+ L EA+NL G + +A + +I++ I KL S S + +VG
Sbjct: 132 KDDVEGIQRWRIALNEAANLKGSCDNRDKTDADCIRQIVDQISSKLCKISLSY-LQNIVG 190
Query: 245 IYSRIEQIKSLLCVGLPDFQIIGIWGMGGIGKTTIAGAIFNQI------SNDFEGRCFMA 298
I + +E+I+SLL +G+ +I+GIWGMGG+GKTTIA AIF+ + S F+G CF+
Sbjct: 191 IDTHLEKIESLLEIGINGVRIMGIWGMGGVGKTTIARAIFDTLLGRMDSSYQFDGACFLK 250
Query: 299 NVREESERGGLVYLRERLYSEILEETLKIRTPSVPKC-IKERLQQMKVFVVLDDV-NKPE 356
+++E + G+ L+ L SE+L E K + RL+ KV +VLDD+ NK
Sbjct: 251 DIKE--NKRGMHSLQNALLSELLREKANYNNEEDGKHQMASRLRSKKVLIVLDDIDNKDH 308
Query: 357 QLDYLAGGLDRFGLGSRVVVTSRDRQVFDKCRVDKIYEVEGLNQNEALEHFSNYAFRQNI 416
L+YLAG LD FG GSR+++T+RD+ + +K D IYEV L +E+++ F +AF + +
Sbjct: 309 YLEYLAGDLDWFGNGSRIIITTRDKHLIEKN--DIIYEVTALPDHESIQLFKQHAFGKEV 366
Query: 417 CPKDFLVLSERIVFYANGNPLALKVLGSFLQRKCKLQWENALKNLTRISDPDIYDMLKIS 476
++F LS +V YA G PLALKV GS L +W++A++++ S I D LKIS
Sbjct: 367 PNENFEKLSLEVVNYAKGLPLALKVWGSLLHNLRLTEWKSAIEHMKNNSYSGIIDKLKIS 426
Query: 477 YNELKQEEKSIFLDIACFFKGDDKDFMTRIQDDPESVH----YGLNVLVDKSLVALSCNN 532
Y+ L+ +++ +FLDIACF +G++KD++ +I ES H YGL +L+DKSLV +S N
Sbjct: 427 YDGLEPKQQEMFLDIACFLRGEEKDYILQIL---ESCHIGAEYGLRILIDKSLVFISEYN 483
Query: 533 KLQIHDLLQEFGREIVRQQSVKEPGKRSRLWYYEDVYQVLKKNKGTESIEGMFLDVSQIE 592
++Q+HDL+Q+ G+ IV Q K+PG+RSRLW ++V +V+ N GT ++E +++ S
Sbjct: 484 QVQMHDLIQDMGKYIVNFQ--KDPGERSRLWLAKEVEEVMSNNTGTMAMEAIWVS-SYSS 540
Query: 593 DLHLTSRAFVKMPNLRLLKFYVPGQITGSDMCTKVHLQQGLQYLPDELRYFHWYGYPLKA 652
L +++A M LR+ + + YLP+ LR F YP ++
Sbjct: 541 TLRFSNQAVKNMKRLRVFNM------------GRSSTHYAIDYLPNNLRCFVCTNYPWES 588
Query: 653 LPFDFSPENLIELNLPHSKVEQIWEGKKHFNNLVMLCLSHCESLRCFPQNIHFRTLIEID 712
P F + L+ L L H+ + +W KH SLR ID
Sbjct: 589 FPSTFELKMLVHLQLRHNSLRHLWTETKHL-----------PSLR------------RID 625
Query: 713 FSYCINLTEFPEISG--NVIELDL-KGTAIEEIPSSIECLTKLEELDLAYCRRLKSLPSS 769
S+ LT P+ +G N+ ++L + + +EE+ S+ C +K+ L L C+ LK P
Sbjct: 626 LSWSKRLTRTPDFTGMPNLEYVNLYQCSNLEEVHHSLGCCSKVIGLYLNDCKSLKRFPC- 684
Query: 770 ICKLKSLHLLCLYNCSNFEIFPEILEKMECLEYIDLESTAVKELPSSVEQ---------- 819
++SL L L +C + E PEI +M+ I ++ + ++ELPSS+ Q
Sbjct: 685 -VNVESLEYLGLRSCDSLEKLPEIYGRMKPEIQIHMQGSGIRELPSSIFQYKTHVTKLLL 743
Query: 820 ---------------LKGLRELILEDCSELSKLPENLGNLKSLKRLFAKRSAISKLPSSI 864
LK L L + CS+L LPE +G+L +L+ A + I + PSSI
Sbjct: 744 WNMKNLVALPSSICRLKSLVSLSVSGCSKLESLPEEIGDLDNLRVFDASDTLILRPPSSI 803
Query: 865 AYLDEVIELSFHGCRGLV---LPPILSGLSSLTKLDLSDCDVME--IPQDIGRASSLEIL 919
L+++I L F G + V PP+ GL SL L+LS C++++ +P++IG SSL+ L
Sbjct: 804 IRLNKLIILMFRGFKDGVHFEFPPVAEGLHSLEYLNLSYCNLIDGGLPEEIGSLSSLKKL 863
Query: 920 DISGNDFDSLPASIKQLSRLRELYLSNCSMLQSLPELPLRVKLLDASNCKQLQSLPELPS 979
D+S N+F+ LP+SI QL L+ L L +C L LPELP PE
Sbjct: 864 DLSRNNFEHLPSSIAQLGALQSLDLKDCQRLTQLPELP-----------------PE--- 903
Query: 980 CLEELPISI-LEMTSKHSLGSTQFKILADPCMELTFTDCLKLNEKGNNILADLRLIILHM 1038
L EL + + + H L + + K+ +KL++ N+ + +L +
Sbjct: 904 -LNELHVDCHMALKFIHYLVTKRKKLHR-----------VKLDDAHNDTMYNLFAYTMFQ 951
Query: 1039 AIASLRLFSEKEFKKPHGISIFLPG---SGIPDWFSNQGSGSSITIQLSQHC-CSTNLIG 1094
I+S+R + +++F IP WF +QG SS+++ L ++ +G
Sbjct: 952 NISSMR--HDISASDSLSLTVFTGQPYPEKIPSWFHHQGWDSSVSVNLPENWYIPDKFLG 1009
Query: 1095 FSVC 1098
F+VC
Sbjct: 1010 FAVC 1013
|
Disease resistance protein. Resistance proteins guard the plant against pathogens that contain an appropriate avirulence protein via a direct or indirect interaction with this avirulence protein. That triggers a defense system including the hypersensitive response, which restricts the pathogen growth. Nicotiana glutinosa (taxid: 35889) |
| >sp|O82500|Y4117_ARATH Putative disease resistance protein At4g11170 OS=Arabidopsis thaliana GN=At4g11170 PE=2 SV=1 | Back alignment and function description |
|---|
| >sp|O23530|SNC1_ARATH Protein SUPPRESSOR OF npr1-1, CONSTITUTIVE 1 OS=Arabidopsis thaliana GN=SNC1 PE=1 SV=3 | Back alignment and function description |
|---|
| >sp|Q9SZ67|WRK19_ARATH Probable WRKY transcription factor 19 OS=Arabidopsis thaliana GN=WRKY19 PE=2 SV=1 | Back alignment and function description |
|---|
| >sp|Q9FL92|WRK16_ARATH Probable WRKY transcription factor 16 OS=Arabidopsis thaliana GN=WRKY16 PE=2 SV=1 | Back alignment and function description |
|---|
| >sp|Q9FH83|WRK52_ARATH Probable WRKY transcription factor 52 OS=Arabidopsis thaliana GN=WRKY52 PE=2 SV=3 | Back alignment and function description |
|---|
| >sp|Q9FKN7|DAR4_ARATH Protein DA1-related 4 OS=Arabidopsis thaliana GN=DAR4 PE=1 SV=2 | Back alignment and function description |
|---|
| >sp|Q9FHE9|P2A08_ARATH Protein PHLOEM PROTEIN 2-LIKE A8 OS=Arabidopsis thaliana GN=PP2A8 PE=2 SV=1 | Back alignment and function description |
|---|
| >sp|Q9LVT1|DRL39_ARATH Putative disease resistance protein At5g47280 OS=Arabidopsis thaliana GN=At5g47280 PE=3 SV=1 | Back alignment and function description |
|---|
| >sp|Q9C5Q9|P2A05_ARATH Protein PHLOEM PROTEIN 2-LIKE A5 OS=Arabidopsis thaliana GN=PP2A5 PE=2 SV=1 | Back alignment and function description |
|---|
Close Homologs in the Non-Redundant Database Detected by BLAST
Original result of BLAST against Nonredundant Database
| GI | Alignment Graph | Length |
Definition |
Q cover |
H cover |
Identity |
E-value |
| Query | 1223 | ||||||
| 255537139 | 1137 | leucine-rich repeat-containing protein, | 0.882 | 0.948 | 0.432 | 0.0 | |
| 359486075 | 1291 | PREDICTED: TMV resistance protein N-like | 0.882 | 0.835 | 0.411 | 0.0 | |
| 224127917 | 1470 | tir-nbs-lrr resistance protein [Populus | 0.878 | 0.731 | 0.410 | 0.0 | |
| 359486073 | 1296 | PREDICTED: TMV resistance protein N-like | 0.885 | 0.835 | 0.407 | 0.0 | |
| 359486071 | 1261 | PREDICTED: TMV resistance protein N-like | 0.875 | 0.849 | 0.398 | 0.0 | |
| 255569048 | 1084 | leucine-rich repeat-containing protein, | 0.834 | 0.940 | 0.433 | 0.0 | |
| 451798990 | 1335 | TMV resistance protein N-like protein 7 | 0.907 | 0.831 | 0.396 | 0.0 | |
| 255563202 | 1158 | leucine-rich repeat containing protein, | 0.861 | 0.910 | 0.407 | 0.0 | |
| 224145016 | 1254 | tir-nbs-lrr resistance protein [Populus | 0.855 | 0.834 | 0.411 | 0.0 | |
| 147770134 | 1414 | hypothetical protein VITISV_040107 [Viti | 0.861 | 0.745 | 0.398 | 0.0 |
| >gi|255537139|ref|XP_002509636.1| leucine-rich repeat-containing protein, putative [Ricinus communis] gi|223549535|gb|EEF51023.1| leucine-rich repeat-containing protein, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
Score = 839 bits (2167), Expect = 0.0, Method: Compositional matrix adjust.
Identities = 515/1190 (43%), Positives = 710/1190 (59%), Gaps = 111/1190 (9%)
Query: 56 SSSCLAAQCKYDVFVSFRGEDTRDNFTSHLVAALCRKKIKTFIDEQ-LDRGDDISPALLD 114
S+S Q KYDVF+SFRGEDTRDNFTSHL AAL RK + TF+D L G++I+PA+
Sbjct: 6 STSHTTHQWKYDVFLSFRGEDTRDNFTSHLFAALSRKSVITFMDNNDLHVGEEITPAISK 65
Query: 115 AIERSKISVIIFSENYASSKWCLDELVKILECKNKNAQMVVPVFYHVDPSDVRKQTGSFG 174
AIE SKI+++IFSE YA S+WCL+E+V+I+ECK Q+V+PVFYHV PSDV F
Sbjct: 66 AIEESKIAIVIFSERYAFSRWCLNEIVRIIECKETCGQLVLPVFYHVGPSDV----SVFA 121
Query: 175 DAFVKHEKQFKGIPEKVQKWRVVLTEASNLSGWDSMNIRPEAKLVDEIIEDILKKLKDKS 234
+AF ++ QF EKVQKW+ L++A+NLS +DS RPE+KLVDEI+ LK+LK +S
Sbjct: 122 EAFPSYD-QF----EKVQKWKNALSKAANLSAFDSRVTRPESKLVDEIVMYTLKQLK-QS 175
Query: 235 FSSDF-EGLVGIYSRIEQIKSLLCVGLPDFQIIGIWGMGGIGKTTIAGAIFNQISNDFEG 293
+SSD EG+VG+ SRIEQIK LL +G D + +GIWGMGGIGKTT+A A+F QI+ FEG
Sbjct: 176 YSSDVVEGIVGVDSRIEQIKELLSIGSVDVRFLGIWGMGGIGKTTLAEAVFYQIAYQFEG 235
Query: 294 RCFMANVREESER-GGLVYLRERLYSEILEET-LKIRTPSVPKC--IKERLQQMKVFVVL 349
CF+ANVR E+ GGL L+E L S+ LE+ KI TP++ +K+ L+ +V +V+
Sbjct: 236 SCFLANVRGNFEKNGGLARLQEELLSKTLEKRDFKIDTPNIGYSFWVKQMLKHRRVLIVV 295
Query: 350 DDVNKPEQLDYLAGGLDRFGLGSRVVVTSRDRQVFDKCRVDKIYEVEGLNQNEALEHFSN 409
DD N EQLD L G D FG GSR++VTSRD+QV K VD IYEV+ L +EAL+ F+
Sbjct: 296 DDANDSEQLDLLVGSHDWFGPGSRIIVTSRDKQVLTKI-VDDIYEVKELVHHEALQLFNQ 354
Query: 410 YAFRQNICPKDFLVLSERIVFYANGNPLALKVLGSFLQRKCKLQWENALKNLTRISDPDI 469
F++ P+D+ LS+ ++ YA G PLALKVLGSFL K K +WE+AL L +
Sbjct: 355 TTFKKKCVPEDYSYLSDLVIEYAKGVPLALKVLGSFLFGKSKTEWESALDKLKKAPHRAT 414
Query: 470 YDMLKISYNELKQEEKSIFLDIACFFKGDDKDFMTRIQDD-PESVHYGLNVLVDKSLVAL 528
++LKISY+ L EEK+IFLDIACFF+G+ + +T+I D S GL +LVDKSL+ +
Sbjct: 415 QNVLKISYDGLDAEEKNIFLDIACFFRGESVEMVTKILDGCGFSTKIGLCLLVDKSLITI 474
Query: 529 SCNNKLQIHDLLQEFGREIVRQQSVKEPGKRSRLWYYEDVYQVLKKNKGTESIEGMFLDV 588
N+K+++HDLLQE G+EIV Q+S K+P +R+RLW +ED+ V +N GTE+IEGM L+
Sbjct: 475 -LNDKVEMHDLLQEMGKEIVLQES-KQPSQRTRLWNHEDILHVFSRNLGTETIEGMCLNT 532
Query: 589 SQIEDLHLTSRAFVKMPNLRLLKFYVPGQITGSDMCTKVHLQQGLQYLPDELRYFHWYGY 648
S I + L S AF +M NLR LKFY G CTK+ L QGL L +ELRY HW+GY
Sbjct: 533 SMINKIELNSNAFGRMYNLRFLKFYQSYIHGGFKECTKIRLPQGLDSLSNELRYLHWHGY 592
Query: 649 PLKALPFDFSPENLIELNLPHSKVEQIWEGKKHFNNLVMLCLSHCESLRCFPQNIHFRTL 708
PLK+LP NL+ L LP+SKV+++W+G K L ++ LS+ ++L
Sbjct: 593 PLKSLPARIHLMNLVVLVLPYSKVKRLWKGCKDLKKLKVIDLSYSQAL------------ 640
Query: 709 IEIDFSYCINLTEFPEISGNVIELDLKGTA-IEEIPSSIECLTKLEELDLAYCRRLKSLP 767
I +TE S N+ + L G + +PS+ L L++ YC +L+SLP
Sbjct: 641 --------IRITELTTAS-NLSYMKLSGCKNLRSMPSTTR-WKSLSTLEMNYCTKLESLP 690
Query: 768 SSICKLKSLHLLCLYNCSNFEIFPEILEKMECLEYIDLESTAVKELPSSVEQLKGLRELI 827
SSICKLKSL L L CSN + FPEILE M+ L+ + L TA+KELPSS+E+LKGL +
Sbjct: 691 SSICKLKSLESLSLCGCSNLQSFPEILESMDRLKVLVLNGTAIKELPSSIERLKGLSSIY 750
Query: 828 LEDCSELSKLPENLGNLKSLKRLFAKRSAISKLPSSIAYLDEVIELSFHGCRGL-VLPPI 886
LE+C L+ LPE+ NLK+L LF L+F C L LP
Sbjct: 751 LENCRNLAHLPESFCNLKALYWLF---------------------LTF--CPKLEKLPEK 787
Query: 887 LSGLSSLTKLDLSDCDVMEIPQDIGRASSLEILDISGNDFDSLPASIKQLSRLRELYLSN 946
LS L++L L + C+++++P + S + LD+SGN FD LP S K L LR L +S+
Sbjct: 788 LSNLTTLEDLSVGVCNLLKLPSHMNHLSCISKLDLSGNYFDQLP-SFKYLLNLRCLDISS 846
Query: 947 CSMLQSLPELPLRVKLLDASNCKQLQSLPELPSCLEELPISILEMTSKHSLGSTQFKILA 1006
C L+SLPE+P + +DA +C+ L+++ L I ++ H+ +
Sbjct: 847 CRRLRSLPEVPHSLTDIDAHDCRSLETISGLKQ--------IFQLKYTHTFYDKK----- 893
Query: 1007 DPCMELTFTDCLKLNEKG-NNILADLRLIILHMAIASLRLFSEKEFKKPHGISIFLPGSG 1065
+ FT C K++E ++ LAD + I +A+ + K SI+ PGS
Sbjct: 894 -----IIFTSCFKMDESAWSDFLADAQFWIQKVAMRA---------KDEESFSIWYPGSK 939
Query: 1066 IPDWFSNQGSGSSITIQLSQHCCSTNLIGFSVCAVIEYEDDFPNGGGYFNVGCSYCF--- 1122
IP WF Q GSSI IQL NL+GF++C V+ +ED+F +F+V C Y
Sbjct: 940 IPKWFGYQSEGSSIVIQLHPRSHKHNLLGFTLCVVLAFEDEFEYHNSFFDVLCVYQLKNY 999
Query: 1123 --EITALSETKHDDFWYLGNQVSTCSDHIYIGFRPCINFGLPDGISVSFHFFTYNLF-TN 1179
E T E G SDH+ + + P NF + +S++ ++ + N
Sbjct: 1000 RGEYTDCKEVYSSRTHVSGKNKYVGSDHVILFYDP--NFSSTEANELSYNEASFEFYWQN 1057
Query: 1180 NEN----GHKVKSCGVCPVYAHPNQ--TKL-NTFTINMLPPSEEECDEIR 1222
NE+ VK C P+Y+ + +L I + P EE D R
Sbjct: 1058 NESCCMQSSMVKKCAAIPLYSREEECCNRLEGPIEIGINPMEEEAIDHKR 1107
|
Source: Ricinus communis Species: Ricinus communis Genus: Ricinus Family: Euphorbiaceae Order: Malpighiales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|359486075|ref|XP_002273047.2| PREDICTED: TMV resistance protein N-like [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|224127917|ref|XP_002329209.1| tir-nbs-lrr resistance protein [Populus trichocarpa] gi|222870990|gb|EEF08121.1| tir-nbs-lrr resistance protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|359486073|ref|XP_002272820.2| PREDICTED: TMV resistance protein N-like, partial [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|359486071|ref|XP_002272667.2| PREDICTED: TMV resistance protein N-like [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|255569048|ref|XP_002525493.1| leucine-rich repeat-containing protein, putative [Ricinus communis] gi|223535172|gb|EEF36851.1| leucine-rich repeat-containing protein, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|451798990|gb|AGF69193.1| TMV resistance protein N-like protein 7 [Vitis labrusca] | Back alignment and taxonomy information |
|---|
| >gi|255563202|ref|XP_002522604.1| leucine-rich repeat containing protein, putative [Ricinus communis] gi|223538080|gb|EEF39691.1| leucine-rich repeat containing protein, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|224145016|ref|XP_002325496.1| tir-nbs-lrr resistance protein [Populus trichocarpa] gi|222862371|gb|EEE99877.1| tir-nbs-lrr resistance protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|147770134|emb|CAN76615.1| hypothetical protein VITISV_040107 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST
Original result of BLAST against Gene Ontology (AMIGO)
| ID |
Alignment graph |
Length |
Definition |
Q cover |
H cover |
Identity |
E-value |
| Query | 1223 | ||||||
| TAIR|locus:2175991 | 1294 | AT5G17680 [Arabidopsis thalian | 0.719 | 0.680 | 0.370 | 1.7e-152 | |
| TAIR|locus:2118106 | 1219 | AT4G12010 [Arabidopsis thalian | 0.735 | 0.737 | 0.377 | 6e-151 | |
| UNIPROTKB|Q40392 | 1144 | N "TMV resistance protein N" [ | 0.719 | 0.769 | 0.365 | 3e-144 | |
| TAIR|locus:2163426 | 1187 | TAO1 "target of AVRB operation | 0.843 | 0.868 | 0.328 | 1.4e-135 | |
| TAIR|locus:2147992 | 1189 | AT5G11250 [Arabidopsis thalian | 0.721 | 0.742 | 0.344 | 1.3e-130 | |
| TAIR|locus:2053405 | 1215 | AT2G14080 [Arabidopsis thalian | 0.749 | 0.754 | 0.325 | 2.1e-126 | |
| TAIR|locus:2155189 | 980 | AT5G49140 [Arabidopsis thalian | 0.654 | 0.816 | 0.360 | 1.2e-123 | |
| TAIR|locus:2175075 | 1068 | AT5G41750 [Arabidopsis thalian | 0.664 | 0.761 | 0.336 | 3.5e-122 | |
| TAIR|locus:2115870 | 1234 | AT4G08450 [Arabidopsis thalian | 0.762 | 0.755 | 0.330 | 6.5e-122 | |
| TAIR|locus:2167457 | 1191 | AT5G36930 [Arabidopsis thalian | 0.695 | 0.713 | 0.350 | 1.8e-119 |
| TAIR|locus:2175991 AT5G17680 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 1384 (492.3 bits), Expect = 1.7e-152, Sum P(2) = 1.7e-152
Identities = 341/920 (37%), Positives = 511/920 (55%)
Query: 51 SFMAASSSCLAAQCKYDVFVSFRGEDTRDNFTSHLVAALCRKKIKTFIDE-QLDRGDDIS 109
S ++SSS + K DVFVSFRGED R F SHL R IK F D+ L RG IS
Sbjct: 3 SLPSSSSSSSSTVWKTDVFVSFRGEDVRKTFVSHLFCEFDRMGIKAFRDDLDLQRGKSIS 62
Query: 110 PALLDAIERSKISVIIFSENYASSKWCLDELVKILECKNKNAQMVVPVFYHVDPSDVRKQ 169
P L+DAI+ S+ ++++ S NYA+S WCLDEL+KI+EC NK+ +VP+FY VDPSDVR+Q
Sbjct: 63 PELIDAIKGSRFAIVVVSRNYAASSWCLDELLKIMEC-NKDT--IVPIFYEVDPSDVRRQ 119
Query: 170 TGSFGDAFVKHEKQFKGIPEKVQKWRVVLTEASNLSGWDSMNIRPEAKLVXXXXXXXXXX 229
GSFG+ H + EKV KW+ L + + +SG DS N ++KL+
Sbjct: 120 RGSFGEDVESHSDK-----EKVGKWKEALKKLAAISGEDSRNW-DDSKLIKKIVKDISDK 173
Query: 230 XXXXXXXXXXEGLVGIYSRIEQIKSLLCVGLPDFQXXXXXXXXXXXXXXXXXXXFNQISN 289
+GL+G+ S ++ ++S++ + D + +NQ+S
Sbjct: 174 LVSTSWDDS-KGLIGMSSHMDFLQSMISIVDKDVRMLGIWGMGGVGKTTIAKYLYNQLSG 232
Query: 290 DFEGRCFMANVREESERGGLVYLRERLYSEILEETLKIRTPSVPKC--IKERLQQMKVFV 347
F+ CFM NV+E R G+ L+ + +E K SV C IKER + VF+
Sbjct: 233 QFQVHCFMENVKEVCNRYGVRRLQVEFLCRMFQERDKEAWSSVSCCNIIKERFRHKMVFI 292
Query: 348 VLDDVNKPEQLDYLAGGLDRFGLGSRVVVTSRDRQVFDKCRVDKIYEVEGLNQNEALEHF 407
VLDDV++ EQL+ L FG GSR++VT+RDR + ++ +Y+V+ L + EAL+ F
Sbjct: 293 VLDDVDRSEQLNELVKETGWFGPGSRIIVTTRDRHLLLSHGINLVYKVKCLPKKEALQLF 352
Query: 408 SNYAFRQNIC-PKDFLVLSERIVFYANGNPLALKVLGSFLQRKCKLQWENALKNLTRISD 466
NYAFR+ I P F LS + V YA+G PLAL+VLGSFL R+ +++WE+ L L
Sbjct: 353 CNYAFREEIILPHGFEELSVQAVNYASGLPLALRVLGSFLYRRSQIEWESTLARLKTYPH 412
Query: 467 PDIYDMLKISYNELKQEEKSIFLDIACFFKGDDKDFMTRIQD-DPESVHYGLNVLVDKSL 525
DI ++L++SY+ L ++EK+IFL I+CF+ D++ ++ D + G+ +L +KSL
Sbjct: 413 SDIMEVLRVSYDGLDEQEKAIFLYISCFYNMKQVDYVRKLLDLCGYAAEIGITILTEKSL 472
Query: 526 VALSCNNKLQIHDLLQEFGREIVRQQSVKEPGKRSRLWYYEDVYQVLKKNKGTESIEGMF 585
+ S N ++IHDLL++ GRE+VRQQ+V P +R LW ED+ +L +N GT+ +EG+
Sbjct: 473 IVES-NGCVKIHDLLEQMGRELVRQQAVNNPAQRLLLWDPEDICHLLSENSGTQLVEGIS 531
Query: 586 LDVSQIEDLHLTSRAFVKMPNLRLLKFYVPGQITGSDMCTKVHLQQGLQYLPDELRYFHW 645
L++S+I ++ + RAF + NL+LL FY D T+VHL GL YLP +LRY W
Sbjct: 532 LNLSEISEVFASDRAFEGLSNLKLLNFYD----LSFDGETRVHLPNGLSYLPRKLRYLRW 587
Query: 646 YGYPLKALPFDFSPENLIELNLPHSKVEQIWEGKKHFNNLVMLCLSHCESLRCFPQNIHF 705
GYPLK +P F PE L+EL + +S +E++W+G + NL + LS C+ L P
Sbjct: 588 DGYPLKTMPSRFFPEFLVELCMSNSNLEKLWDGIQPLRNLKKMDLSRCKYLVEVPDLSKA 647
Query: 706 RTLIEIDFSYCINLTEF-PEISGNVIELDL----KGTAIEEIPSSIECLTKLEELDLAYC 760
L E++ SYC +L E P I N+ L +++IP I L LE + ++ C
Sbjct: 648 TNLEELNLSYCQSLVEVTPSIK-NLKGLSCFYLTNCIQLKDIPIGI-ILKSLETVGMSGC 705
Query: 761 RRLKSLPSSICKLKSLHLLCLYNCSNFEIFPEILEKMECLEYIDL-ESTAVKELPSSVEQ 819
LK P + L+L + + E P + ++ CL +D+ + ++ LPS +
Sbjct: 706 SSLKHFPEISWNTRRLYL----SSTKIEELPSSISRLSCLVKLDMSDCQRLRTLPSYLGH 761
Query: 820 LKGLRELILEDCSELSKLPENLGNLKSLKRLFAKRSA-ISKLPSSIAYLDEVIELSFHGC 878
L L+ L L+ C L LP+ L NL SL+ L +++ P ++ EV+ +S
Sbjct: 762 LVSLKSLNLDGCRRLENLPDTLQNLTSLETLEVSGCLNVNEFPR-VSTSIEVLRISETSI 820
Query: 879 RGLVLPPILSGLSSLTKLDLSDCD-VMEIPQDIGRASSLEILDISG-NDFDSLPASIKQ- 935
+ P + LS L LD+S+ + +P I SLE L +SG + +S P I Q
Sbjct: 821 EEI--PARICNLSQLRSLDISENKRLASLPVSISELRSLEKLKLSGCSVLESFPLEICQT 878
Query: 936 LSRLRELYLSNCSMLQSLPE 955
+S LR L S ++ LPE
Sbjct: 879 MSCLRWFDLDRTS-IKELPE 897
|
|
| TAIR|locus:2118106 AT4G12010 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q40392 N "TMV resistance protein N" [Nicotiana glutinosa (taxid:35889)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2163426 TAO1 "target of AVRB operation1" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2147992 AT5G11250 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2053405 AT2G14080 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2155189 AT5G49140 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2175075 AT5G41750 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2115870 AT4G08450 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2167457 AT5G36930 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Annotation Transfer from SWISS-PROT Entries
Original result of BLAST against SWISS-PROT
No confident hit for EC number transfering in SWISSPROT detected by BLAST
EC Number Prediction by Ezypred Server
Original result from Ezypred Server
Fail to connect to Ezypred Server
EC Number Prediction by EFICAz Software
No EC number assignment, probably not an enzyme!
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING
Original result from the STRING server
 |
 |
 |
 |
 |
 |
 |
 |
 |
 | eugene3.01250003 | tir-nbs-lrr resistance protein (1470 aa) | ||||||
(Populus trichocarpa) | ||||||||
| Sorry, there are no predicted associations at the current settings. |
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST
Original result of RPS-BLAST against CDD database part I
| ID | Alignment Graph | Length |
Definition |
E-value |
| Query | 1223 | |||
| PLN03210 | 1153 | PLN03210, PLN03210, Resistant to P | 0.0 | |
| pfam01582 | 135 | pfam01582, TIR, TIR domain | 2e-42 | |
| pfam00931 | 285 | pfam00931, NB-ARC, NB-ARC domain | 2e-40 | |
| smart00255 | 140 | smart00255, TIR, Toll - interleukin 1 - resistance | 2e-40 | |
| COG4886 | 394 | COG4886, COG4886, Leucine-rich repeat (LRR) protei | 3e-16 | |
| COG4886 | 394 | COG4886, COG4886, Leucine-rich repeat (LRR) protei | 6e-15 | |
| COG4886 | 394 | COG4886, COG4886, Leucine-rich repeat (LRR) protei | 7e-14 | |
| PLN03194 | 187 | PLN03194, PLN03194, putative disease resistance pr | 7e-12 | |
| pfam13676 | 102 | pfam13676, TIR_2, TIR domain | 4e-11 | |
| PRK15370 | 754 | PRK15370, PRK15370, E3 ubiquitin-protein ligase Sl | 2e-09 | |
| PLN00113 | 968 | PLN00113, PLN00113, leucine-rich repeat receptor-l | 5e-09 | |
| PLN00113 | 968 | PLN00113, PLN00113, leucine-rich repeat receptor-l | 2e-08 | |
| PLN03150 | 623 | PLN03150, PLN03150, hypothetical protein; Provisio | 3e-08 | |
| COG4886 | 394 | COG4886, COG4886, Leucine-rich repeat (LRR) protei | 6e-08 | |
| PLN00113 | 968 | PLN00113, PLN00113, leucine-rich repeat receptor-l | 1e-07 | |
| pfam13855 | 60 | pfam13855, LRR_8, Leucine rich repeat | 3e-05 | |
| PRK15387 | 788 | PRK15387, PRK15387, E3 ubiquitin-protein ligase Ss | 1e-04 | |
| PRK15387 | 788 | PRK15387, PRK15387, E3 ubiquitin-protein ligase Ss | 0.001 | |
| pfam07725 | 20 | pfam07725, LRR_3, Leucine Rich Repeat | 0.001 | |
| COG4886 | 394 | COG4886, COG4886, Leucine-rich repeat (LRR) protei | 0.002 | |
| PRK15387 | 788 | PRK15387, PRK15387, E3 ubiquitin-protein ligase Ss | 0.002 | |
| pfam12799 | 43 | pfam12799, LRR_4, Leucine Rich repeats (2 copies) | 0.003 |
| >gnl|CDD|215633 PLN03210, PLN03210, Resistant to P | Back alignment and domain information |
|---|
Score = 576 bits (1486), Expect = 0.0
Identities = 388/1101 (35%), Positives = 583/1101 (52%), Gaps = 114/1101 (10%)
Query: 54 AASSSCLAAQCKYDVFVSFRGEDTRDNFTSHLVAALCRKKIKTFIDEQLDRGDDISPALL 113
ASSS + YDVF SF GED R F SH + L RK I F D +++R + P L
Sbjct: 1 MASSSSSSRNWVYDVFPSFSGEDVRITFLSHFLKELDRKLIIAFKDNEIERSQSLDPELK 60
Query: 114 DAIERSKISVIIFSENYASSKWCLDELVKILECKNKNAQMVVPVFYHVDPSDVRKQTGSF 173
AI S+I+V++FS+NYASS WCL+EL++I+ CK + Q+V+PVFY +DPS VRKQTG F
Sbjct: 61 QAIRDSRIAVVVFSKNYASSSWCLNELLEIVRCKEELGQLVIPVFYGLDPSHVRKQTGDF 120
Query: 174 GDAFVKHEKQFKGIPEKVQKWRVVLTEASNLSGWDSMNIRPEAKLVDEIIEDILKKLKDK 233
G+AF K Q K EK+Q W+ LT+ +N+ G+ S N EAK+++EI D+L KL +
Sbjct: 121 GEAFEK-TCQNKTEDEKIQ-WKQALTDVANILGYHSQNWPNEAKMIEEIANDVLGKL-NL 177
Query: 234 SFSSDFEGLVGIYSRIEQIKSLLCVGLPDFQIIGIWGMGGIGKTTIAGAIFNQISNDFEG 293
+ S+DFE VGI I ++ SLL + + +++GIWG GIGKTTIA A+F+++S F+
Sbjct: 178 TPSNDFEDFVGIEDHIAKMSSLLHLESEEVRMVGIWGSSGIGKTTIARALFSRLSRQFQS 237
Query: 294 -----RCFMANVREESERGGLV------YLRERLYSEILE-ETLKIRTPSVPKCIKERLQ 341
R F++ E +L+ SEIL+ + +KI ++ERL+
Sbjct: 238 SVFIDRAFISKSMEIYSSANPDDYNMKLHLQRAFLSEILDKKDIKIYHLGA---MEERLK 294
Query: 342 QMKVFVVLDDVNKPEQLDYLAGGLDRFGLGSRVVVTSRDRQVFDKCRVDKIYEVEGLNQN 401
KV + +DD++ + LD LAG FG GSR++V ++D+ +D IYEV +
Sbjct: 295 HRKVLIFIDDLDDQDVLDALAGQTQWFGSGSRIIVITKDKHFLRAHGIDHIYEVCLPSNE 354
Query: 402 EALEHFSNYAFRQNICPKDFLVLSERIVFYANGNPLALKVLGSFLQRKCKLQWENALKNL 461
ALE F AF++N P F+ L+ + A PL L VLGS+L+ + K W + L L
Sbjct: 355 LALEMFCRSAFKKNSPPDGFMELASEVALRAGNLPLGLNVLGSYLRGRDKEDWMDMLPRL 414
Query: 462 TRISDPDIYDMLKISYNELK-QEEKSIFLDIACFFKGDD-KDFMTRIQDDPESVHYGLNV 519
D I L++SY+ L +++K+IF IAC F G+ D + + V+ GL
Sbjct: 415 RNGLDGKIEKTLRVSYDGLNNKKDKAIFRHIACLFNGEKVNDIKLLLANSDLDVNIGLKN 474
Query: 520 LVDKSLVALSCNNKLQIHDLLQEFGREIVRQQSVKEPGKRSRLWYYEDVYQVLKKNKGTE 579
LVDKSL+ + + +++H LLQE G+EIVR QS EPG+R L +D+ VL+ N GT+
Sbjct: 475 LVDKSLIHVR-EDIVEMHSLLQEMGKEIVRAQS-NEPGEREFLVDAKDICDVLEDNTGTK 532
Query: 580 SIEGMFLDVSQIEDLHLTSRAFVKMPNLRLLKFYVPGQITGSDMCTKVHLQQGLQYLPDE 639
+ G+ LD+ +I++LH+ AF M NL LKFY ++ + HL +G YLP +
Sbjct: 533 KVLGITLDIDEIDELHIHENAFKGMRNLLFLKFYTKKWDQKKEV--RWHLPEGFDYLPPK 590
Query: 640 LRYFHWYGYPLKALPFDFSPENLIELNLPHSKVEQIWEGKKHFNNLVMLCLSHCESLRCF 699
LR W YPL+ +P +F PENL++L + SK+E++W+G
Sbjct: 591 LRLLRWDKYPLRCMPSNFRPENLVKLQMQGSKLEKLWDG--------------------- 629
Query: 700 PQNIH-FRTLIEIDFSYCINLTEFPEIS--GNVIELDLKG-TAIEEIPSSIECLTKLEEL 755
+H L ID NL E P++S N+ L L +++ E+PSSI+ L KLE+L
Sbjct: 630 ---VHSLTGLRNIDLRGSKNLKEIPDLSMATNLETLKLSDCSSLVELPSSIQYLNKLEDL 686
Query: 756 DLAYCRRLKSLPSSICKLKSLHLLCLYNCSNFEIFPEILEKMECLEYIDLESTAVKELPS 815
D++ C L+ LP+ I LKSL+ L L CS + FP+I + ++DL+ TA++E PS
Sbjct: 687 DMSRCENLEILPTGI-NLKSLYRLNLSGCSRLKSFPDISTN---ISWLDLDETAIEEFPS 742
Query: 816 SVEQLKGLRELILEDCSELSKLPENLGNLK--------SLKRLF-AKRSAISKLPSSIAY 866
++ +L+ L ELIL + KL E + L SL RLF + ++ +LPSSI
Sbjct: 743 NL-RLENLDELILCEMKS-EKLWERVQPLTPLMTMLSPSLTRLFLSDIPSLVELPSSIQN 800
Query: 867 LDEVIELSFHGCRGLVLPPILSGLSSLTKLDLSDCDVMEIPQDIGRASSLEILDISGNDF 926
L ++ L C L P L SL LDLS C + DI ++++ L++S
Sbjct: 801 LHKLEHLEIENCINLETLPTGINLESLESLDLSGCSRLRTFPDI--STNISDLNLSRTGI 858
Query: 927 DSLPASIKQLSRLRELYLSNCSMLQSLPELPLRVKLL---DASNCKQLQ--SLPELPSCL 981
+ +P I++ S L L ++ C+ LQ + ++K L D S+C L S PS
Sbjct: 859 EEVPWWIEKFSNLSFLDMNGCNNLQRVSLNISKLKHLETVDFSDCGALTEASWNGSPS-- 916
Query: 982 EELPISILEMTSKHSLGSTQFKILADPCMELTFTDCLKLNEKGNNILADLRLIILHMAIA 1041
E+ ++ + SK L ST C + F +C L D ++ +I
Sbjct: 917 -EVAMATDNIHSK--LPST-------VC--INFINCFNL---------DQEALLQQQSI- 954
Query: 1042 SLRLFSEKEFKKPHGISIFLPGSGIPDWFSNQGSGSSIT-IQLSQHCCSTNLIGFSVCAV 1100
FK + L G +P +F+++ +G+S+T I L F CAV
Sbjct: 955 ---------FK-----QLILSGEEVPSYFTHRTTGASLTNIPLLHISPCQPFFRFRACAV 1000
Query: 1101 IEYEDDFPNGGG-YFNVGCSY 1120
++ E F V C +
Sbjct: 1001 VDSESFFIISVSFDIQVCCRF 1021
|
syringae 6; Provisional. Length = 1153 |
| >gnl|CDD|216585 pfam01582, TIR, TIR domain | Back alignment and domain information |
|---|
| >gnl|CDD|216202 pfam00931, NB-ARC, NB-ARC domain | Back alignment and domain information |
|---|
| >gnl|CDD|214587 smart00255, TIR, Toll - interleukin 1 - resistance | Back alignment and domain information |
|---|
| >gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] | Back alignment and domain information |
|---|
| >gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] | Back alignment and domain information |
|---|
| >gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] | Back alignment and domain information |
|---|
| >gnl|CDD|215626 PLN03194, PLN03194, putative disease resistance protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|222311 pfam13676, TIR_2, TIR domain | Back alignment and domain information |
|---|
| >gnl|CDD|185268 PRK15370, PRK15370, E3 ubiquitin-protein ligase SlrP; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] | Back alignment and domain information |
|---|
| >gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat | Back alignment and domain information |
|---|
| >gnl|CDD|185285 PRK15387, PRK15387, E3 ubiquitin-protein ligase SspH2; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|185285 PRK15387, PRK15387, E3 ubiquitin-protein ligase SspH2; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|191828 pfam07725, LRR_3, Leucine Rich Repeat | Back alignment and domain information |
|---|
| >gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] | Back alignment and domain information |
|---|
| >gnl|CDD|185285 PRK15387, PRK15387, E3 ubiquitin-protein ligase SspH2; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|205079 pfam12799, LRR_4, Leucine Rich repeats (2 copies) | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch
Original result of HHsearch against CDD database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 1223 | |||
| PLN03210 | 1153 | Resistant to P. syringae 6; Provisional | 100.0 | |
| KOG4658 | 889 | consensus Apoptotic ATPase [Signal transduction me | 100.0 | |
| PLN03194 | 187 | putative disease resistance protein; Provisional | 100.0 | |
| PF00931 | 287 | NB-ARC: NB-ARC domain; InterPro: IPR002182 This is | 100.0 | |
| PLN00113 | 968 | leucine-rich repeat receptor-like protein kinase; | 99.97 | |
| PLN00113 | 968 | leucine-rich repeat receptor-like protein kinase; | 99.96 | |
| KOG0444 | 1255 | consensus Cytoskeletal regulator Flightless-I (con | 99.95 | |
| KOG0444 | 1255 | consensus Cytoskeletal regulator Flightless-I (con | 99.94 | |
| KOG4194 | 873 | consensus Membrane glycoprotein LIG-1 [Signal tran | 99.93 | |
| KOG4194 | 873 | consensus Membrane glycoprotein LIG-1 [Signal tran | 99.92 | |
| KOG0472 | 565 | consensus Leucine-rich repeat protein [Function un | 99.91 | |
| KOG0472 | 565 | consensus Leucine-rich repeat protein [Function un | 99.91 | |
| PLN03210 | 1153 | Resistant to P. syringae 6; Provisional | 99.89 | |
| KOG0618 | 1081 | consensus Serine/threonine phosphatase 2C containi | 99.86 | |
| PRK15387 | 788 | E3 ubiquitin-protein ligase SspH2; Provisional | 99.81 | |
| PF01582 | 141 | TIR: TIR domain; InterPro: IPR000157 In Drosophila | 99.81 | |
| PRK15387 | 788 | E3 ubiquitin-protein ligase SspH2; Provisional | 99.8 | |
| KOG0618 | 1081 | consensus Serine/threonine phosphatase 2C containi | 99.79 | |
| smart00255 | 140 | TIR Toll - interleukin 1 - resistance. | 99.75 | |
| PRK15370 | 754 | E3 ubiquitin-protein ligase SlrP; Provisional | 99.73 | |
| PRK15370 | 754 | E3 ubiquitin-protein ligase SlrP; Provisional | 99.72 | |
| KOG0617 | 264 | consensus Ras suppressor protein (contains leucine | 99.61 | |
| KOG4237 | 498 | consensus Extracellular matrix protein slit, conta | 99.57 | |
| KOG0617 | 264 | consensus Ras suppressor protein (contains leucine | 99.56 | |
| KOG4237 | 498 | consensus Extracellular matrix protein slit, conta | 99.5 | |
| cd00116 | 319 | LRR_RI Leucine-rich repeats (LRRs), ribonuclease i | 99.46 | |
| cd00116 | 319 | LRR_RI Leucine-rich repeats (LRRs), ribonuclease i | 99.46 | |
| PF13676 | 102 | TIR_2: TIR domain; PDB: 3H16_B 3UB4_A 2Y92_A 3UB3_ | 99.36 | |
| PRK04841 | 903 | transcriptional regulator MalT; Provisional | 99.33 | |
| KOG0532 | 722 | consensus Leucine-rich repeat (LRR) protein, conta | 99.15 | |
| PRK00411 | 394 | cdc6 cell division control protein 6; Reviewed | 99.1 | |
| KOG4658 | 889 | consensus Apoptotic ATPase [Signal transduction me | 99.09 | |
| COG4886 | 394 | Leucine-rich repeat (LRR) protein [Function unknow | 99.06 | |
| KOG0532 | 722 | consensus Leucine-rich repeat (LRR) protein, conta | 99.05 | |
| TIGR00635 | 305 | ruvB Holliday junction DNA helicase, RuvB subunit. | 99.05 | |
| COG4886 | 394 | Leucine-rich repeat (LRR) protein [Function unknow | 99.05 | |
| PRK00080 | 328 | ruvB Holliday junction DNA helicase RuvB; Reviewed | 99.0 | |
| PF01637 | 234 | Arch_ATPase: Archaeal ATPase; InterPro: IPR011579 | 98.99 | |
| PF05729 | 166 | NACHT: NACHT domain | 98.96 | |
| TIGR02928 | 365 | orc1/cdc6 family replication initiation protein. M | 98.96 | |
| KOG1259 | 490 | consensus Nischarin, modulator of integrin alpha5 | 98.95 | |
| KOG3207 | 505 | consensus Beta-tubulin folding cofactor E [Posttra | 98.93 | |
| KOG1259 | 490 | consensus Nischarin, modulator of integrin alpha5 | 98.87 | |
| TIGR03015 | 269 | pepcterm_ATPase putative secretion ATPase, PEP-CTE | 98.86 | |
| COG3899 | 849 | Predicted ATPase [General function prediction only | 98.75 | |
| KOG1909 | 382 | consensus Ran GTPase-activating protein [RNA proce | 98.75 | |
| KOG3207 | 505 | consensus Beta-tubulin folding cofactor E [Posttra | 98.73 | |
| PF14580 | 175 | LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ | 98.69 | |
| PF14580 | 175 | LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ | 98.68 | |
| COG2909 | 894 | MalT ATP-dependent transcriptional regulator [Tran | 98.66 | |
| PRK06893 | 229 | DNA replication initiation factor; Validated | 98.65 | |
| COG2256 | 436 | MGS1 ATPase related to the helicase subunit of the | 98.62 | |
| KOG1909 | 382 | consensus Ran GTPase-activating protein [RNA proce | 98.62 | |
| PRK13342 | 413 | recombination factor protein RarA; Reviewed | 98.49 | |
| TIGR03420 | 226 | DnaA_homol_Hda DnaA regulatory inactivator Hda. Me | 98.43 | |
| PTZ00112 | 1164 | origin recognition complex 1 protein; Provisional | 98.42 | |
| PLN03150 | 623 | hypothetical protein; Provisional | 98.36 | |
| KOG0531 | 414 | consensus Protein phosphatase 1, regulatory subuni | 98.36 | |
| PRK15386 | 426 | type III secretion protein GogB; Provisional | 98.35 | |
| COG3903 | 414 | Predicted ATPase [General function prediction only | 98.34 | |
| TIGR01242 | 364 | 26Sp45 26S proteasome subunit P45 family. Many pro | 98.33 | |
| KOG3678 | 832 | consensus SARM protein (with sterile alpha and arm | 98.3 | |
| PRK15386 | 426 | type III secretion protein GogB; Provisional | 98.3 | |
| PRK12402 | 337 | replication factor C small subunit 2; Reviewed | 98.3 | |
| PRK07003 | 830 | DNA polymerase III subunits gamma and tau; Validat | 98.3 | |
| PRK14961 | 363 | DNA polymerase III subunits gamma and tau; Provisi | 98.28 | |
| PLN03150 | 623 | hypothetical protein; Provisional | 98.26 | |
| PRK14963 | 504 | DNA polymerase III subunits gamma and tau; Provisi | 98.26 | |
| KOG0531 | 414 | consensus Protein phosphatase 1, regulatory subuni | 98.23 | |
| PRK00440 | 319 | rfc replication factor C small subunit; Reviewed | 98.23 | |
| PRK04195 | 482 | replication factor C large subunit; Provisional | 98.22 | |
| PRK14960 | 702 | DNA polymerase III subunits gamma and tau; Provisi | 98.21 | |
| PF13173 | 128 | AAA_14: AAA domain | 98.2 | |
| PLN03025 | 319 | replication factor C subunit; Provisional | 98.18 | |
| cd00009 | 151 | AAA The AAA+ (ATPases Associated with a wide varie | 98.17 | |
| PF05496 | 233 | RuvB_N: Holliday junction DNA helicase ruvB N-term | 98.17 | |
| PRK08727 | 233 | hypothetical protein; Validated | 98.16 | |
| PRK12323 | 700 | DNA polymerase III subunits gamma and tau; Provisi | 98.14 | |
| PRK14949 | 944 | DNA polymerase III subunits gamma and tau; Provisi | 98.12 | |
| PRK05564 | 313 | DNA polymerase III subunit delta'; Validated | 98.12 | |
| PTZ00202 | 550 | tuzin; Provisional | 98.11 | |
| PF13191 | 185 | AAA_16: AAA ATPase domain; PDB: 2V1U_A. | 98.11 | |
| PRK07471 | 365 | DNA polymerase III subunit delta'; Validated | 98.11 | |
| KOG2120 | 419 | consensus SCF ubiquitin ligase, Skp2 component [Po | 98.1 | |
| PRK08903 | 227 | DnaA regulatory inactivator Hda; Validated | 98.1 | |
| PF13401 | 131 | AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S | 98.09 | |
| PRK13341 | 725 | recombination factor protein RarA/unknown domain f | 98.08 | |
| PRK14957 | 546 | DNA polymerase III subunits gamma and tau; Provisi | 98.08 | |
| PF00308 | 219 | Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013 | 98.06 | |
| PRK14956 | 484 | DNA polymerase III subunits gamma and tau; Provisi | 98.06 | |
| PRK03992 | 389 | proteasome-activating nucleotidase; Provisional | 98.05 | |
| PRK09087 | 226 | hypothetical protein; Validated | 98.04 | |
| PRK08691 | 709 | DNA polymerase III subunits gamma and tau; Validat | 98.04 | |
| KOG2120 | 419 | consensus SCF ubiquitin ligase, Skp2 component [Po | 98.03 | |
| PRK05642 | 234 | DNA replication initiation factor; Validated | 98.01 | |
| PRK08084 | 235 | DNA replication initiation factor; Provisional | 98.0 | |
| PRK06645 | 507 | DNA polymerase III subunits gamma and tau; Validat | 98.0 | |
| COG1474 | 366 | CDC6 Cdc6-related protein, AAA superfamily ATPase | 97.99 | |
| PRK07994 | 647 | DNA polymerase III subunits gamma and tau; Validat | 97.98 | |
| KOG2028 | 554 | consensus ATPase related to the helicase subunit o | 97.97 | |
| PRK14962 | 472 | DNA polymerase III subunits gamma and tau; Provisi | 97.96 | |
| TIGR02397 | 355 | dnaX_nterm DNA polymerase III, subunit gamma and t | 97.93 | |
| PF13855 | 61 | LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF | 97.93 | |
| KOG4341 | 483 | consensus F-box protein containing LRR [General fu | 97.92 | |
| PRK07940 | 394 | DNA polymerase III subunit delta'; Validated | 97.92 | |
| PRK14951 | 618 | DNA polymerase III subunits gamma and tau; Provisi | 97.92 | |
| PRK14964 | 491 | DNA polymerase III subunits gamma and tau; Provisi | 97.91 | |
| PRK14087 | 450 | dnaA chromosomal replication initiation protein; P | 97.9 | |
| TIGR02903 | 615 | spore_lon_C ATP-dependent protease, Lon family. Me | 97.89 | |
| KOG1859 | 1096 | consensus Leucine-rich repeat proteins [General fu | 97.89 | |
| PRK14958 | 509 | DNA polymerase III subunits gamma and tau; Provisi | 97.87 | |
| PRK05896 | 605 | DNA polymerase III subunits gamma and tau; Validat | 97.86 | |
| PRK09112 | 351 | DNA polymerase III subunit delta'; Validated | 97.86 | |
| PF14516 | 331 | AAA_35: AAA-like domain | 97.84 | |
| TIGR03689 | 512 | pup_AAA proteasome ATPase. In the Actinobacteria, | 97.83 | |
| PF13855 | 61 | LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF | 97.82 | |
| PRK14955 | 397 | DNA polymerase III subunits gamma and tau; Provisi | 97.82 | |
| KOG1859 | 1096 | consensus Leucine-rich repeat proteins [General fu | 97.8 | |
| PRK14969 | 527 | DNA polymerase III subunits gamma and tau; Provisi | 97.8 | |
| PRK14970 | 367 | DNA polymerase III subunits gamma and tau; Provisi | 97.78 | |
| PTZ00361 | 438 | 26 proteosome regulatory subunit 4-like protein; P | 97.78 | |
| KOG2982 | 418 | consensus Uncharacterized conserved protein [Funct | 97.76 | |
| PRK14088 | 440 | dnaA chromosomal replication initiation protein; P | 97.76 | |
| KOG0989 | 346 | consensus Replication factor C, subunit RFC4 [Repl | 97.76 | |
| PRK14954 | 620 | DNA polymerase III subunits gamma and tau; Provisi | 97.76 | |
| PRK14952 | 584 | DNA polymerase III subunits gamma and tau; Provisi | 97.75 | |
| KOG4341 | 483 | consensus F-box protein containing LRR [General fu | 97.75 | |
| PHA02544 | 316 | 44 clamp loader, small subunit; Provisional | 97.74 | |
| PRK09376 | 416 | rho transcription termination factor Rho; Provisio | 97.74 | |
| PRK14959 | 624 | DNA polymerase III subunits gamma and tau; Provisi | 97.73 | |
| PRK09111 | 598 | DNA polymerase III subunits gamma and tau; Validat | 97.73 | |
| PTZ00454 | 398 | 26S protease regulatory subunit 6B-like protein; P | 97.72 | |
| TIGR00678 | 188 | holB DNA polymerase III, delta' subunit. At positi | 97.72 | |
| PRK06620 | 214 | hypothetical protein; Validated | 97.7 | |
| PRK00149 | 450 | dnaA chromosomal replication initiation protein; R | 97.68 | |
| TIGR02881 | 261 | spore_V_K stage V sporulation protein K. Members o | 97.68 | |
| PRK07764 | 824 | DNA polymerase III subunits gamma and tau; Validat | 97.68 | |
| TIGR00362 | 405 | DnaA chromosomal replication initiator protein Dna | 97.67 | |
| PF12799 | 44 | LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ | 97.66 | |
| TIGR02639 | 731 | ClpA ATP-dependent Clp protease ATP-binding subuni | 97.65 | |
| PRK06305 | 451 | DNA polymerase III subunits gamma and tau; Validat | 97.63 | |
| PRK14950 | 585 | DNA polymerase III subunits gamma and tau; Provisi | 97.61 | |
| PRK07133 | 725 | DNA polymerase III subunits gamma and tau; Validat | 97.6 | |
| PRK08451 | 535 | DNA polymerase III subunits gamma and tau; Validat | 97.6 | |
| PRK12422 | 445 | chromosomal replication initiation protein; Provis | 97.55 | |
| TIGR03345 | 852 | VI_ClpV1 type VI secretion ATPase, ClpV1 family. M | 97.54 | |
| cd01128 | 249 | rho_factor Transcription termination factor rho is | 97.54 | |
| COG5238 | 388 | RNA1 Ran GTPase-activating protein (RanGAP) involv | 97.52 | |
| PRK14953 | 486 | DNA polymerase III subunits gamma and tau; Provisi | 97.48 | |
| TIGR02880 | 284 | cbbX_cfxQ probable Rubsico expression protein CbbX | 97.48 | |
| COG2255 | 332 | RuvB Holliday junction resolvasome, helicase subun | 97.48 | |
| KOG2982 | 418 | consensus Uncharacterized conserved protein [Funct | 97.47 | |
| PRK10865 | 857 | protein disaggregation chaperone; Provisional | 97.47 | |
| PRK14948 | 620 | DNA polymerase III subunits gamma and tau; Provisi | 97.46 | |
| PRK14086 | 617 | dnaA chromosomal replication initiation protein; P | 97.46 | |
| CHL00195 | 489 | ycf46 Ycf46; Provisional | 97.46 | |
| KOG4579 | 177 | consensus Leucine-rich repeat (LRR) protein associ | 97.46 | |
| PRK06647 | 563 | DNA polymerase III subunits gamma and tau; Validat | 97.44 | |
| TIGR00767 | 415 | rho transcription termination factor Rho. Members | 97.43 | |
| PF08937 | 130 | DUF1863: MTH538 TIR-like domain (DUF1863); InterPr | 97.42 | |
| PRK14971 | 614 | DNA polymerase III subunits gamma and tau; Provisi | 97.41 | |
| KOG3665 | 699 | consensus ZYG-1-like serine/threonine protein kina | 97.38 | |
| TIGR03346 | 852 | chaperone_ClpB ATP-dependent chaperone ClpB. Membe | 97.38 | |
| CHL00176 | 638 | ftsH cell division protein; Validated | 97.37 | |
| TIGR01241 | 495 | FtsH_fam ATP-dependent metalloprotease FtsH. HflB( | 97.34 | |
| KOG2543 | 438 | consensus Origin recognition complex, subunit 5 [R | 97.33 | |
| PRK08116 | 268 | hypothetical protein; Validated | 97.33 | |
| PF12799 | 44 | LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ | 97.33 | |
| PRK07399 | 314 | DNA polymerase III subunit delta'; Validated | 97.3 | |
| CHL00181 | 287 | cbbX CbbX; Provisional | 97.28 | |
| COG1222 | 406 | RPT1 ATP-dependent 26S proteasome regulatory subun | 97.27 | |
| CHL00095 | 821 | clpC Clp protease ATP binding subunit | 97.26 | |
| PRK05563 | 559 | DNA polymerase III subunits gamma and tau; Validat | 97.25 | |
| KOG0991 | 333 | consensus Replication factor C, subunit RFC2 [Repl | 97.25 | |
| KOG4579 | 177 | consensus Leucine-rich repeat (LRR) protein associ | 97.22 | |
| COG0593 | 408 | DnaA ATPase involved in DNA replication initiation | 97.22 | |
| PRK12377 | 248 | putative replication protein; Provisional | 97.19 | |
| PF00004 | 132 | AAA: ATPase family associated with various cellula | 97.19 | |
| KOG2227 | 529 | consensus Pre-initiation complex, subunit CDC6, AA | 97.15 | |
| KOG3665 | 699 | consensus ZYG-1-like serine/threonine protein kina | 97.15 | |
| PRK11034 | 758 | clpA ATP-dependent Clp protease ATP-binding subuni | 97.13 | |
| PF05673 | 249 | DUF815: Protein of unknown function (DUF815); Inte | 97.1 | |
| PRK14965 | 576 | DNA polymerase III subunits gamma and tau; Provisi | 97.1 | |
| COG1373 | 398 | Predicted ATPase (AAA+ superfamily) [General funct | 97.09 | |
| PRK05707 | 328 | DNA polymerase III subunit delta'; Validated | 97.07 | |
| PRK07952 | 244 | DNA replication protein DnaC; Validated | 97.06 | |
| TIGR00602 | 637 | rad24 checkpoint protein rad24. This family is bas | 97.0 | |
| KOG1644 | 233 | consensus U2-associated snRNP A' protein [RNA proc | 96.99 | |
| PF05621 | 302 | TniB: Bacterial TniB protein; InterPro: IPR008868 | 96.98 | |
| PRK10536 | 262 | hypothetical protein; Provisional | 96.97 | |
| PRK08181 | 269 | transposase; Validated | 96.95 | |
| TIGR01243 | 733 | CDC48 AAA family ATPase, CDC48 subfamily. This sub | 96.95 | |
| smart00382 | 148 | AAA ATPases associated with a variety of cellular | 96.92 | |
| PLN00020 | 413 | ribulose bisphosphate carboxylase/oxygenase activa | 96.92 | |
| PRK09183 | 259 | transposase/IS protein; Provisional | 96.83 | |
| KOG0744 | 423 | consensus AAA+-type ATPase [Posttranslational modi | 96.81 | |
| TIGR01243 | 733 | CDC48 AAA family ATPase, CDC48 subfamily. This sub | 96.8 | |
| TIGR02640 | 262 | gas_vesic_GvpN gas vesicle protein GvpN. Members o | 96.8 | |
| PF10443 | 431 | RNA12: RNA12 protein; InterPro: IPR018850 Mitochon | 96.79 | |
| COG5238 | 388 | RNA1 Ran GTPase-activating protein (RanGAP) involv | 96.71 | |
| KOG1644 | 233 | consensus U2-associated snRNP A' protein [RNA proc | 96.71 | |
| PRK00771 | 437 | signal recognition particle protein Srp54; Provisi | 96.71 | |
| PRK06526 | 254 | transposase; Provisional | 96.7 | |
| TIGR02639 | 731 | ClpA ATP-dependent Clp protease ATP-binding subuni | 96.64 | |
| PF01695 | 178 | IstB_IS21: IstB-like ATP binding protein; InterPro | 96.64 | |
| PRK10865 | 857 | protein disaggregation chaperone; Provisional | 96.63 | |
| COG0466 | 782 | Lon ATP-dependent Lon protease, bacterial type [Po | 96.62 | |
| PRK06921 | 266 | hypothetical protein; Provisional | 96.61 | |
| PRK08769 | 319 | DNA polymerase III subunit delta'; Validated | 96.61 | |
| PRK08118 | 167 | topology modulation protein; Reviewed | 96.6 | |
| COG1223 | 368 | Predicted ATPase (AAA+ superfamily) [General funct | 96.6 | |
| TIGR00763 | 775 | lon ATP-dependent protease La. This protein is ind | 96.57 | |
| COG3267 | 269 | ExeA Type II secretory pathway, component ExeA (pr | 96.56 | |
| PRK11331 | 459 | 5-methylcytosine-specific restriction enzyme subun | 96.54 | |
| PRK10787 | 784 | DNA-binding ATP-dependent protease La; Provisional | 96.46 | |
| KOG0735 | 952 | consensus AAA+-type ATPase [Posttranslational modi | 96.45 | |
| TIGR03346 | 852 | chaperone_ClpB ATP-dependent chaperone ClpB. Membe | 96.42 | |
| PRK11889 | 436 | flhF flagellar biosynthesis regulator FlhF; Provis | 96.36 | |
| KOG0741 | 744 | consensus AAA+-type ATPase [Posttranslational modi | 96.36 | |
| PF04665 | 241 | Pox_A32: Poxvirus A32 protein; InterPro: IPR006758 | 96.28 | |
| TIGR03345 | 852 | VI_ClpV1 type VI secretion ATPase, ClpV1 family. M | 96.27 | |
| PRK06090 | 319 | DNA polymerase III subunit delta'; Validated | 96.27 | |
| COG0542 | 786 | clpA ATP-binding subunits of Clp protease and DnaK | 96.27 | |
| PRK14974 | 336 | cell division protein FtsY; Provisional | 96.26 | |
| CHL00095 | 821 | clpC Clp protease ATP binding subunit | 96.26 | |
| cd01133 | 274 | F1-ATPase_beta F1 ATP synthase beta subunit, nucle | 96.22 | |
| PF02562 | 205 | PhoH: PhoH-like protein; InterPro: IPR003714 PhoH | 96.2 | |
| smart00763 | 361 | AAA_PrkA PrkA AAA domain. This is a family of PrkA | 96.2 | |
| cd01131 | 198 | PilT Pilus retraction ATPase PilT. PilT is a nucle | 96.19 | |
| PF13207 | 121 | AAA_17: AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6 | 96.19 | |
| PRK06835 | 329 | DNA replication protein DnaC; Validated | 96.19 | |
| PRK07261 | 171 | topology modulation protein; Provisional | 96.18 | |
| PRK10416 | 318 | signal recognition particle-docking protein FtsY; | 96.14 | |
| KOG2739 | 260 | consensus Leucine-rich acidic nuclear protein [Cel | 96.11 | |
| PRK08058 | 329 | DNA polymerase III subunit delta'; Validated | 96.09 | |
| KOG0731 | 774 | consensus AAA+-type ATPase containing the peptidas | 96.01 | |
| COG1618 | 179 | Predicted nucleotide kinase [Nucleotide transport | 96.01 | |
| COG0470 | 325 | HolB ATPase involved in DNA replication [DNA repli | 96.0 | |
| COG0488 | 530 | Uup ATPase components of ABC transporters with dup | 96.0 | |
| TIGR00064 | 272 | ftsY signal recognition particle-docking protein F | 96.0 | |
| PF08357 | 150 | SEFIR: SEFIR domain; InterPro: IPR013568 This doma | 95.99 | |
| PRK10733 | 644 | hflB ATP-dependent metalloprotease; Reviewed | 95.98 | |
| PRK06964 | 342 | DNA polymerase III subunit delta'; Validated | 95.96 | |
| PRK07993 | 334 | DNA polymerase III subunit delta'; Validated | 95.93 | |
| PRK04132 | 846 | replication factor C small subunit; Provisional | 95.91 | |
| PRK05541 | 176 | adenylylsulfate kinase; Provisional | 95.9 | |
| PRK12608 | 380 | transcription termination factor Rho; Provisional | 95.9 | |
| KOG2228 | 408 | consensus Origin recognition complex, subunit 4 [R | 95.9 | |
| TIGR00959 | 428 | ffh signal recognition particle protein. This mode | 95.9 | |
| PRK06871 | 325 | DNA polymerase III subunit delta'; Validated | 95.89 | |
| PRK11034 | 758 | clpA ATP-dependent Clp protease ATP-binding subuni | 95.87 | |
| KOG0730 | 693 | consensus AAA+-type ATPase [Posttranslational modi | 95.85 | |
| PRK12724 | 432 | flagellar biosynthesis regulator FlhF; Provisional | 95.82 | |
| PRK08939 | 306 | primosomal protein DnaI; Reviewed | 95.81 | |
| PRK05703 | 424 | flhF flagellar biosynthesis regulator FlhF; Valida | 95.81 | |
| PRK06696 | 223 | uridine kinase; Validated | 95.78 | |
| KOG0733 | 802 | consensus Nuclear AAA ATPase (VCP subfamily) [Post | 95.77 | |
| cd01120 | 165 | RecA-like_NTPases RecA-like NTPases. This family i | 95.73 | |
| COG1484 | 254 | DnaC DNA replication protein [DNA replication, rec | 95.72 | |
| PRK07667 | 193 | uridine kinase; Provisional | 95.7 | |
| KOG1947 | 482 | consensus Leucine rich repeat proteins, some prote | 95.67 | |
| TIGR01425 | 429 | SRP54_euk signal recognition particle protein SRP5 | 95.64 | |
| PRK09361 | 225 | radB DNA repair and recombination protein RadB; Pr | 95.64 | |
| TIGR02902 | 531 | spore_lonB ATP-dependent protease LonB. Members of | 95.62 | |
| PHA00729 | 226 | NTP-binding motif containing protein | 95.61 | |
| PF00448 | 196 | SRP54: SRP54-type protein, GTPase domain; InterPro | 95.55 | |
| KOG2739 | 260 | consensus Leucine-rich acidic nuclear protein [Cel | 95.55 | |
| PRK04296 | 190 | thymidine kinase; Provisional | 95.53 | |
| cd01394 | 218 | radB RadB. The archaeal protein radB shares simila | 95.5 | |
| PRK11608 | 326 | pspF phage shock protein operon transcriptional ac | 95.49 | |
| cd03221 | 144 | ABCF_EF-3 ABCF_EF-3 Elongation factor 3 (EF-3) is | 95.45 | |
| PF13177 | 162 | DNA_pol3_delta2: DNA polymerase III, delta subunit | 95.44 | |
| PF07693 | 325 | KAP_NTPase: KAP family P-loop domain; InterPro: IP | 95.44 | |
| PRK12337 | 475 | 2-phosphoglycerate kinase; Provisional | 95.42 | |
| KOG2123 | 388 | consensus Uncharacterized conserved protein [Funct | 95.41 | |
| TIGR01359 | 183 | UMP_CMP_kin_fam UMP-CMP kinase family. This subfam | 95.4 | |
| COG2607 | 287 | Predicted ATPase (AAA+ superfamily) [General funct | 95.4 | |
| cd00561 | 159 | CobA_CobO_BtuR ATP:corrinoid adenosyltransferase B | 95.38 | |
| cd01121 | 372 | Sms Sms (bacterial radA) DNA repair protein. This | 95.38 | |
| KOG0728 | 404 | consensus 26S proteasome regulatory complex, ATPas | 95.36 | |
| COG2812 | 515 | DnaX DNA polymerase III, gamma/tau subunits [DNA r | 95.35 | |
| PRK10867 | 433 | signal recognition particle protein; Provisional | 95.34 | |
| KOG0733 | 802 | consensus Nuclear AAA ATPase (VCP subfamily) [Post | 95.32 | |
| TIGR02237 | 209 | recomb_radB DNA repair and recombination protein R | 95.29 | |
| COG0464 | 494 | SpoVK ATPases of the AAA+ class [Posttranslational | 95.22 | |
| TIGR01817 | 534 | nifA Nif-specific regulatory protein. This model r | 95.21 | |
| KOG1514 | 767 | consensus Origin recognition complex, subunit 1, a | 95.19 | |
| KOG1947 | 482 | consensus Leucine rich repeat proteins, some prote | 95.17 | |
| PF01583 | 156 | APS_kinase: Adenylylsulphate kinase; InterPro: IPR | 95.07 | |
| cd03214 | 180 | ABC_Iron-Siderophores_B12_Hemin ABC transporters, | 95.07 | |
| PF13238 | 129 | AAA_18: AAA domain; PDB: 3IIK_A 3IIJ_A 3IIL_A 1RKB | 95.04 | |
| PRK00625 | 173 | shikimate kinase; Provisional | 95.04 | |
| cd01393 | 226 | recA_like RecA is a bacterial enzyme which has rol | 94.97 | |
| PRK15455 | 644 | PrkA family serine protein kinase; Provisional | 94.96 | |
| PRK12723 | 388 | flagellar biosynthesis regulator FlhF; Provisional | 94.94 | |
| PRK15429 | 686 | formate hydrogenlyase transcriptional activator Fh | 94.92 | |
| PF00406 | 151 | ADK: Adenylate kinase; InterPro: IPR000850 Adenyla | 94.88 | |
| KOG2035 | 351 | consensus Replication factor C, subunit RFC3 [Cell | 94.85 | |
| PF00485 | 194 | PRK: Phosphoribulokinase / Uridine kinase family; | 94.83 | |
| KOG1969 | 877 | consensus DNA replication checkpoint protein CHL12 | 94.82 | |
| PRK14722 | 374 | flhF flagellar biosynthesis regulator FlhF; Provis | 94.8 | |
| KOG0743 | 457 | consensus AAA+-type ATPase [Posttranslational modi | 94.78 | |
| TIGR01420 | 343 | pilT_fam pilus retraction protein PilT. This model | 94.77 | |
| PRK12727 | 559 | flagellar biosynthesis regulator FlhF; Provisional | 94.75 | |
| PRK08699 | 325 | DNA polymerase III subunit delta'; Validated | 94.75 | |
| PRK06067 | 234 | flagellar accessory protein FlaH; Validated | 94.73 | |
| cd03223 | 166 | ABCD_peroxisomal_ALDP Peroxisomal ATP-binding cass | 94.73 | |
| PF14532 | 138 | Sigma54_activ_2: Sigma-54 interaction domain; PDB: | 94.64 | |
| TIGR02974 | 329 | phageshock_pspF psp operon transcriptional activat | 94.64 | |
| TIGR03499 | 282 | FlhF flagellar biosynthetic protein FlhF. | 94.61 | |
| PRK05022 | 509 | anaerobic nitric oxide reductase transcription reg | 94.55 | |
| PRK11823 | 446 | DNA repair protein RadA; Provisional | 94.49 | |
| PF07726 | 131 | AAA_3: ATPase family associated with various cellu | 94.47 | |
| COG0542 | 786 | clpA ATP-binding subunits of Clp protease and DnaK | 94.46 | |
| PTZ00301 | 210 | uridine kinase; Provisional | 94.46 | |
| PRK12726 | 407 | flagellar biosynthesis regulator FlhF; Provisional | 94.43 | |
| PF08433 | 270 | KTI12: Chromatin associated protein KTI12 ; InterP | 94.42 | |
| TIGR03574 | 249 | selen_PSTK L-seryl-tRNA(Sec) kinase, archaeal. Mem | 94.38 | |
| cd02019 | 69 | NK Nucleoside/nucleotide kinase (NK) is a protein | 94.34 | |
| PRK03839 | 180 | putative kinase; Provisional | 94.31 | |
| PRK13531 | 498 | regulatory ATPase RavA; Provisional | 94.3 | |
| cd01129 | 264 | PulE-GspE PulE/GspE The type II secretory pathway | 94.28 | |
| PRK08356 | 195 | hypothetical protein; Provisional | 94.28 | |
| cd03222 | 177 | ABC_RNaseL_inhibitor The ABC ATPase RNase L inhibi | 94.26 | |
| cd03216 | 163 | ABC_Carb_Monos_I This family represents the domain | 94.24 | |
| TIGR00416 | 454 | sms DNA repair protein RadA. The gene protuct code | 94.24 | |
| COG4608 | 268 | AppF ABC-type oligopeptide transport system, ATPas | 94.23 | |
| cd03228 | 171 | ABCC_MRP_Like The MRP (Mutidrug Resistance Protein | 94.21 | |
| KOG2123 | 388 | consensus Uncharacterized conserved protein [Funct | 94.19 | |
| PRK06762 | 166 | hypothetical protein; Provisional | 94.19 | |
| cd01122 | 271 | GP4d_helicase GP4d_helicase is a homohexameric 5'- | 94.17 | |
| PF13604 | 196 | AAA_30: AAA domain; PDB: 1W36_G 3K70_G 3UPU_B 3GPL | 94.17 | |
| PRK08233 | 182 | hypothetical protein; Provisional | 94.16 | |
| COG4088 | 261 | Predicted nucleotide kinase [Nucleotide transport | 94.16 | |
| KOG0727 | 408 | consensus 26S proteasome regulatory complex, ATPas | 94.15 | |
| cd00544 | 169 | CobU Adenosylcobinamide kinase / adenosylcobinamid | 94.15 | |
| cd03115 | 173 | SRP The signal recognition particle (SRP) mediates | 94.14 | |
| PF00910 | 107 | RNA_helicase: RNA helicase; InterPro: IPR000605 He | 94.12 | |
| COG0563 | 178 | Adk Adenylate kinase and related kinases [Nucleoti | 94.06 | |
| KOG0651 | 388 | consensus 26S proteasome regulatory complex, ATPas | 94.06 | |
| PRK05480 | 209 | uridine/cytidine kinase; Provisional | 94.06 | |
| COG0572 | 218 | Udk Uridine kinase [Nucleotide transport and metab | 94.03 | |
| PF00560 | 22 | LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le | 94.02 | |
| PTZ00088 | 229 | adenylate kinase 1; Provisional | 93.99 | |
| PRK04040 | 188 | adenylate kinase; Provisional | 93.98 | |
| KOG0734 | 752 | consensus AAA+-type ATPase containing the peptidas | 93.94 | |
| PF13671 | 143 | AAA_33: AAA domain; PDB: 1LTQ_A 2IA5_K 1RC8_A 1LY1 | 93.89 | |
| KOG1051 | 898 | consensus Chaperone HSP104 and related ATP-depende | 93.87 | |
| TIGR03600 | 421 | phage_DnaB phage replicative helicase, DnaB family | 93.86 | |
| TIGR00235 | 207 | udk uridine kinase. Model contains a number of lon | 93.85 | |
| cd02027 | 149 | APSK Adenosine 5'-phosphosulfate kinase (APSK) cat | 93.84 | |
| KOG1970 | 634 | consensus Checkpoint RAD17-RFC complex, RAD17/RAD2 | 93.82 | |
| cd03247 | 178 | ABCC_cytochrome_bd The CYD subfamily implicated in | 93.8 | |
| PRK06995 | 484 | flhF flagellar biosynthesis regulator FlhF; Valida | 93.74 | |
| TIGR01360 | 188 | aden_kin_iso1 adenylate kinase, isozyme 1 subfamil | 93.66 | |
| PRK09270 | 229 | nucleoside triphosphate hydrolase domain-containin | 93.65 | |
| cd03230 | 173 | ABC_DR_subfamily_A This family of ATP-binding prot | 93.64 | |
| PF03308 | 266 | ArgK: ArgK protein; InterPro: IPR005129 Bacterial | 93.62 | |
| COG1121 | 254 | ZnuC ABC-type Mn/Zn transport systems, ATPase comp | 93.62 | |
| KOG0652 | 424 | consensus 26S proteasome regulatory complex, ATPas | 93.61 | |
| KOG2004 | 906 | consensus Mitochondrial ATP-dependent protease PIM | 93.6 | |
| TIGR01351 | 210 | adk adenylate kinases. Adenylate kinase (EC 2.7.4. | 93.58 | |
| PRK00131 | 175 | aroK shikimate kinase; Reviewed | 93.56 | |
| PF00560 | 22 | LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le | 93.55 | |
| COG0703 | 172 | AroK Shikimate kinase [Amino acid transport and me | 93.51 | |
| PRK06217 | 183 | hypothetical protein; Validated | 93.48 | |
| TIGR02858 | 270 | spore_III_AA stage III sporulation protein AA. Mem | 93.48 | |
| cd03238 | 176 | ABC_UvrA The excision repair protein UvrA; Nucleot | 93.45 | |
| TIGR00150 | 133 | HI0065_YjeE ATPase, YjeE family. Members of this f | 93.45 | |
| TIGR02788 | 308 | VirB11 P-type DNA transfer ATPase VirB11. The VirB | 93.44 | |
| cd00267 | 157 | ABC_ATPase ABC (ATP-binding cassette) transporter | 93.44 | |
| PRK13947 | 171 | shikimate kinase; Provisional | 93.43 | |
| cd01123 | 235 | Rad51_DMC1_radA Rad51_DMC1_radA,B. This group of r | 93.37 | |
| cd03232 | 192 | ABC_PDR_domain2 The pleiotropic drug resistance-li | 93.22 | |
| PRK10820 | 520 | DNA-binding transcriptional regulator TyrR; Provis | 93.21 | |
| PRK06547 | 172 | hypothetical protein; Provisional | 93.2 | |
| PRK14526 | 211 | adenylate kinase; Provisional | 93.2 | |
| PF07728 | 139 | AAA_5: AAA domain (dynein-related subfamily); Inte | 93.15 | |
| cd03240 | 204 | ABC_Rad50 The catalytic domains of Rad50 are simil | 93.15 | |
| COG1066 | 456 | Sms Predicted ATP-dependent serine protease [Postt | 93.15 | |
| KOG0729 | 435 | consensus 26S proteasome regulatory complex, ATPas | 93.14 | |
| cd03246 | 173 | ABCC_Protease_Secretion This family represents the | 93.12 | |
| PRK14528 | 186 | adenylate kinase; Provisional | 93.06 | |
| COG2884 | 223 | FtsE Predicted ATPase involved in cell division [C | 93.05 | |
| PRK00889 | 175 | adenylylsulfate kinase; Provisional | 93.01 | |
| cd00227 | 175 | CPT Chloramphenicol (Cm) phosphotransferase (CPT). | 93.0 | |
| COG1120 | 258 | FepC ABC-type cobalamin/Fe3+-siderophores transpor | 93.0 | |
| PRK00279 | 215 | adk adenylate kinase; Reviewed | 92.99 | |
| PRK01184 | 184 | hypothetical protein; Provisional | 92.92 | |
| COG5635 | 824 | Predicted NTPase (NACHT family) [Signal transducti | 92.9 | |
| PRK09354 | 349 | recA recombinase A; Provisional | 92.84 | |
| COG2019 | 189 | AdkA Archaeal adenylate kinase [Nucleotide transpo | 92.8 | |
| PRK10463 | 290 | hydrogenase nickel incorporation protein HypB; Pro | 92.79 | |
| TIGR00708 | 173 | cobA cob(I)alamin adenosyltransferase. Alternate n | 92.76 | |
| cd02028 | 179 | UMPK_like Uridine monophosphate kinase_like (UMPK_ | 92.75 | |
| COG0467 | 260 | RAD55 RecA-superfamily ATPases implicated in signa | 92.74 | |
| COG0541 | 451 | Ffh Signal recognition particle GTPase [Intracellu | 92.7 | |
| PRK06731 | 270 | flhF flagellar biosynthesis regulator FlhF; Valida | 92.7 | |
| PRK03846 | 198 | adenylylsulfate kinase; Provisional | 92.67 | |
| PRK14531 | 183 | adenylate kinase; Provisional | 92.67 | |
| PRK11388 | 638 | DNA-binding transcriptional regulator DhaR; Provis | 92.67 | |
| COG1875 | 436 | NYN ribonuclease and ATPase of PhoH family domains | 92.66 | |
| cd01130 | 186 | VirB11-like_ATPase Type IV secretory pathway compo | 92.66 | |
| TIGR01069 | 771 | mutS2 MutS2 family protein. Function of MutS2 is u | 92.65 | |
| cd03233 | 202 | ABC_PDR_domain1 The pleiotropic drug resistance (P | 92.62 | |
| TIGR00390 | 441 | hslU ATP-dependent protease HslVU, ATPase subunit. | 92.6 | |
| PF03266 | 168 | NTPase_1: NTPase; InterPro: IPR004948 This entry r | 92.59 | |
| cd02025 | 220 | PanK Pantothenate kinase (PanK) catalyzes the phos | 92.58 | |
| cd02024 | 187 | NRK1 Nicotinamide riboside kinase (NRK) is an enzy | 92.56 | |
| PF07724 | 171 | AAA_2: AAA domain (Cdc48 subfamily); InterPro: IPR | 92.56 | |
| cd01428 | 194 | ADK Adenylate kinase (ADK) catalyzes the reversibl | 92.54 | |
| PRK13949 | 169 | shikimate kinase; Provisional | 92.5 | |
| PRK14529 | 223 | adenylate kinase; Provisional | 92.49 | |
| TIGR02655 | 484 | circ_KaiC circadian clock protein KaiC. Members of | 92.48 | |
| COG1428 | 216 | Deoxynucleoside kinases [Nucleotide transport and | 92.46 | |
| cd01858 | 157 | NGP_1 NGP-1. Autoantigen NGP-1 (Nucleolar G-protei | 92.45 | |
| cd01125 | 239 | repA Hexameric Replicative Helicase RepA. RepA is | 92.44 | |
| PRK05201 | 443 | hslU ATP-dependent protease ATP-binding subunit Hs | 92.39 | |
| COG0468 | 279 | RecA RecA/RadA recombinase [DNA replication, recom | 92.38 | |
| cd03281 | 213 | ABC_MSH5_euk MutS5 homolog in eukaryotes. The MutS | 92.37 | |
| KOG3928 | 461 | consensus Mitochondrial ribosome small subunit com | 92.36 | |
| KOG4308 | 478 | consensus LRR-containing protein [Function unknown | 92.36 | |
| cd02023 | 198 | UMPK Uridine monophosphate kinase (UMPK, EC 2.7.1. | 92.36 | |
| KOG0739 | 439 | consensus AAA+-type ATPase [Posttranslational modi | 92.35 | |
| PF00437 | 270 | T2SE: Type II/IV secretion system protein; InterPr | 92.34 | |
| COG0488 | 530 | Uup ATPase components of ABC transporters with dup | 92.25 | |
| PRK10923 | 469 | glnG nitrogen regulation protein NR(I); Provisiona | 92.25 | |
| cd00464 | 154 | SK Shikimate kinase (SK) is the fifth enzyme in th | 92.23 | |
| TIGR03877 | 237 | thermo_KaiC_1 KaiC domain protein, Ph0284 family. | 92.23 | |
| PRK05439 | 311 | pantothenate kinase; Provisional | 92.21 | |
| cd02020 | 147 | CMPK Cytidine monophosphate kinase (CMPK) catalyze | 92.21 | |
| PF03205 | 140 | MobB: Molybdopterin guanine dinucleotide synthesis | 92.2 | |
| COG1936 | 180 | Predicted nucleotide kinase (related to CMP and AM | 92.2 | |
| TIGR02782 | 299 | TrbB_P P-type conjugative transfer ATPase TrbB. Th | 92.19 | |
| TIGR02322 | 179 | phosphon_PhnN phosphonate metabolism protein/1,5-b | 92.18 | |
| PF10236 | 309 | DAP3: Mitochondrial ribosomal death-associated pro | 92.18 | |
| COG0396 | 251 | sufC Cysteine desulfurase activator ATPase [Posttr | 92.15 | |
| cd02021 | 150 | GntK Gluconate kinase (GntK) catalyzes the phospho | 92.11 | |
| PRK13948 | 182 | shikimate kinase; Provisional | 92.04 | |
| COG1703 | 323 | ArgK Putative periplasmic protein kinase ArgK and | 92.02 | |
| PRK13765 | 637 | ATP-dependent protease Lon; Provisional | 92.02 | |
| PRK13946 | 184 | shikimate kinase; Provisional | 92.01 | |
| KOG1532 | 366 | consensus GTPase XAB1, interacts with DNA repair p | 92.01 | |
| TIGR02524 | 358 | dot_icm_DotB Dot/Icm secretion system ATPase DotB. | 91.98 | |
| KOG0736 | 953 | consensus Peroxisome assembly factor 2 containing | 91.98 | |
| PF03969 | 362 | AFG1_ATPase: AFG1-like ATPase; InterPro: IPR005654 | 91.94 | |
| cd00071 | 137 | GMPK Guanosine monophosphate kinase (GMPK, EC 2.7. | 91.92 | |
| PRK10751 | 173 | molybdopterin-guanine dinucleotide biosynthesis pr | 91.86 | |
| TIGR00455 | 184 | apsK adenylylsulfate kinase (apsK). Important resi | 91.78 | |
| TIGR03878 | 259 | thermo_KaiC_2 KaiC domain protein, AF_0795 family. | 91.7 | |
| PRK07132 | 299 | DNA polymerase III subunit delta'; Validated | 91.66 | |
| PF06068 | 398 | TIP49: TIP49 C-terminus; InterPro: IPR010339 This | 91.66 | |
| COG0003 | 322 | ArsA Predicted ATPase involved in chromosome parti | 91.64 | |
| PRK14723 | 767 | flhF flagellar biosynthesis regulator FlhF; Provis | 91.63 | |
| PF13481 | 193 | AAA_25: AAA domain; PDB: 1G8Y_J 1OLO_A 1NLF_C. | 91.63 | |
| COG0465 | 596 | HflB ATP-dependent Zn proteases [Posttranslational | 91.62 | |
| PRK13975 | 196 | thymidylate kinase; Provisional | 91.61 | |
| PRK05057 | 172 | aroK shikimate kinase I; Reviewed | 91.55 | |
| COG1102 | 179 | Cmk Cytidylate kinase [Nucleotide transport and me | 91.54 | |
| TIGR00176 | 155 | mobB molybdopterin-guanine dinucleotide biosynthes | 91.52 | |
| PRK14530 | 215 | adenylate kinase; Provisional | 91.51 | |
| COG1136 | 226 | SalX ABC-type antimicrobial peptide transport syst | 91.49 | |
| PHA02244 | 383 | ATPase-like protein | 91.49 | |
| cd03217 | 200 | ABC_FeS_Assembly ABC-type transport system involve | 91.48 | |
| PRK12339 | 197 | 2-phosphoglycerate kinase; Provisional | 91.48 | |
| KOG0726 | 440 | consensus 26S proteasome regulatory complex, ATPas | 91.48 | |
| PRK05986 | 191 | cob(I)alamin adenolsyltransferase/cobinamide ATP-d | 91.47 | |
| PF08423 | 256 | Rad51: Rad51; InterPro: IPR013632 This domain is f | 91.42 | |
| PLN02674 | 244 | adenylate kinase | 91.4 | |
| PRK09435 | 332 | membrane ATPase/protein kinase; Provisional | 91.38 | |
| cd01124 | 187 | KaiC KaiC is a circadian clock protein primarily f | 91.34 | |
| PRK05800 | 170 | cobU adenosylcobinamide kinase/adenosylcobinamide- | 91.34 | |
| PRK12678 | 672 | transcription termination factor Rho; Provisional | 91.3 | |
| CHL00206 | 2281 | ycf2 Ycf2; Provisional | 91.27 | |
| PLN02318 | 656 | phosphoribulokinase/uridine kinase | 91.27 | |
| PF01078 | 206 | Mg_chelatase: Magnesium chelatase, subunit ChlI; I | 91.26 | |
| COG1224 | 450 | TIP49 DNA helicase TIP49, TBP-interacting protein | 91.25 | |
| cd03243 | 202 | ABC_MutS_homologs The MutS protein initiates DNA m | 91.24 | |
| KOG0738 | 491 | consensus AAA+-type ATPase [Posttranslational modi | 91.24 | |
| TIGR00764 | 608 | lon_rel lon-related putative ATP-dependent proteas | 91.23 | |
| PLN02459 | 261 | probable adenylate kinase | 91.2 | |
| COG2274 | 709 | SunT ABC-type bacteriocin/lantibiotic exporters, c | 91.17 | |
| COG2401 | 593 | ABC-type ATPase fused to a predicted acetyltransfe | 91.16 | |
| PRK05973 | 237 | replicative DNA helicase; Provisional | 91.16 | |
| KOG0927 | 614 | consensus Predicted transporter (ABC superfamily) | 91.15 | |
| TIGR03263 | 180 | guanyl_kin guanylate kinase. Members of this famil | 91.14 | |
| COG0529 | 197 | CysC Adenylylsulfate kinase and related kinases [I | 91.11 | |
| PF13306 | 129 | LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ | 91.09 | |
| PF00158 | 168 | Sigma54_activat: Sigma-54 interaction domain; Inte | 90.98 | |
| COG2842 | 297 | Uncharacterized ATPase, putative transposase [Gene | 90.94 | |
| cd03213 | 194 | ABCG_EPDR ABCG transporters are involved in eye pi | 90.93 | |
| PF13306 | 129 | LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ | 90.92 | |
| smart00534 | 185 | MUTSac ATPase domain of DNA mismatch repair MUTS f | 90.9 | |
| PRK05342 | 412 | clpX ATP-dependent protease ATP-binding subunit Cl | 90.89 | |
| PF13504 | 17 | LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO | 90.89 | |
| PRK14493 | 274 | putative bifunctional molybdopterin-guanine dinucl | 90.84 | |
| PRK03731 | 171 | aroL shikimate kinase II; Reviewed | 90.83 | |
| TIGR00554 | 290 | panK_bact pantothenate kinase, bacterial type. Sho | 90.83 | |
| TIGR01313 | 163 | therm_gnt_kin carbohydrate kinase, thermoresistant | 90.76 | |
| PF00625 | 183 | Guanylate_kin: Guanylate kinase; InterPro: IPR0081 | 90.72 |
| >PLN03210 Resistant to P | Back alignment and domain information |
|---|
Probab=100.00 E-value=6.1e-150 Score=1475.02 Aligned_cols=1075 Identities=35% Similarity=0.585 Sum_probs=898.8
Q ss_pred ccccCCCCCCCCcccEEEcCcccccccchHHHHHHHHhhCCCcccccCCCCCCCCccHHHHHHHhhcceEEEEeccCccc
Q 000922 53 MAASSSCLAAQCKYDVFVSFRGEDTRDNFTSHLVAALCRKKIKTFIDEQLDRGDDISPALLDAIERSKISVIIFSENYAS 132 (1223)
Q Consensus 53 m~~~~~~~~~~~~~dvFis~~g~d~~~~f~~~l~~~L~~~gi~~f~d~~~~~g~~~~~~~~~ai~~s~~~ivv~S~~y~~ 132 (1223)
||+|| |+++.|+|||||||||+|||++|++|||++|.++||++|+|+++++|+.|++++++||++||++|||||++||+
T Consensus 1 ~~~~~-~~~~~~~~~vf~sfrg~d~r~~f~~hl~~~l~~~~i~~f~d~~~~~g~~~~~~l~~~i~~s~~~ivv~s~~ya~ 79 (1153)
T PLN03210 1 MASSS-SSSRNWVYDVFPSFSGEDVRITFLSHFLKELDRKLIIAFKDNEIERSQSLDPELKQAIRDSRIAVVVFSKNYAS 79 (1153)
T ss_pred CCCCC-CCCCCCCCcEEeeCCCcccccCHHHHHHHHHHHCCCeEEccCCccCCCcccHHHHHHHHhCeEEEEEecCCccc
Confidence 56554 45578999999999999999999999999999999999999999999999999999999999999999999999
Q ss_pred chhhHHHHHHHHHHhhcCCCEEEEEEeeeCCccccccccchhhHHHHHHhhhcCChhHHHHHHHHHHHHhccCCCCCCCC
Q 000922 133 SKWCLDELVKILECKNKNAQMVVPVFYHVDPSDVRKQTGSFGDAFVKHEKQFKGIPEKVQKWRVVLTEASNLSGWDSMNI 212 (1223)
Q Consensus 133 S~wcl~El~~i~~~~~~~~~~v~Pvfy~v~ps~vr~q~g~~~~~~~~~~~~~~~~~~~v~~w~~aL~~~a~~~g~~~~~~ 212 (1223)
|+|||+||++|++|+++.+++|+||||+|||+|||+|+|+||+||.+|+++ ...+++++||+||++||+++||++.++
T Consensus 80 s~wcl~el~~i~~~~~~~~~~v~pvfy~v~p~~v~~~~g~f~~~f~~~~~~--~~~~~~~~w~~al~~~~~~~g~~~~~~ 157 (1153)
T PLN03210 80 SSWCLNELLEIVRCKEELGQLVIPVFYGLDPSHVRKQTGDFGEAFEKTCQN--KTEDEKIQWKQALTDVANILGYHSQNW 157 (1153)
T ss_pred chHHHHHHHHHHHhhhhcCceEEEEEecccHHHHhhccchHHHHHHHHhcc--cchhHHHHHHHHHHHHhCcCceecCCC
Confidence 999999999999999999999999999999999999999999999999876 467899999999999999999999999
Q ss_pred chhHHHHHHHHHHHHhhccCCCCCCCCCCceehhhHHHHHHHhhhcCCCCeEEEEEEccCCCchHHHHHHHHHHHhhccC
Q 000922 213 RPEAKLVDEIIEDILKKLKDKSFSSDFEGLVGIYSRIEQIKSLLCVGLPDFQIIGIWGMGGIGKTTIAGAIFNQISNDFE 292 (1223)
Q Consensus 213 ~~e~~~i~~i~~~v~~~l~~~~~~~~~~~~vGr~~~~~~l~~~L~~~~~~~~vv~I~G~gGiGKTtLA~~v~~~~~~~F~ 292 (1223)
.+|+++|++||++|++++ ..+++.+.+++|||++++++|..+|..+.+++++|+||||||+||||||+++|+++..+|+
T Consensus 158 ~~E~~~i~~Iv~~v~~~l-~~~~~~~~~~~vG~~~~l~~l~~lL~l~~~~~~vvgI~G~gGiGKTTLA~~l~~~l~~~F~ 236 (1153)
T PLN03210 158 PNEAKMIEEIANDVLGKL-NLTPSNDFEDFVGIEDHIAKMSSLLHLESEEVRMVGIWGSSGIGKTTIARALFSRLSRQFQ 236 (1153)
T ss_pred CCHHHHHHHHHHHHHHhh-ccccCcccccccchHHHHHHHHHHHccccCceEEEEEEcCCCCchHHHHHHHHHHHhhcCC
Confidence 999999999999999999 7788888899999999999999999888889999999999999999999999999999999
Q ss_pred cceeeeec--hhhh---c-----cC-CHHHHHHHHHHHHhhhccCcCCCCchHHHHHHHhcCeEEEEecCCCCHHHHHHH
Q 000922 293 GRCFMANV--REES---E-----RG-GLVYLRERLYSEILEETLKIRTPSVPKCIKERLQQMKVFVVLDDVNKPEQLDYL 361 (1223)
Q Consensus 293 ~~~~~~~~--~~~~---~-----~~-~l~~l~~~ll~~l~~~~~~~~~~~~~~~l~~~L~~kr~LlVLDdv~~~~~~~~l 361 (1223)
+.+|+.+. +... . .. ....++++++.++...... .......+++++++||+||||||||+.++|+.+
T Consensus 237 g~vfv~~~~v~~~~~~~~~~~~~~~~~~~~l~~~~l~~il~~~~~--~~~~~~~~~~~L~~krvLLVLDdv~~~~~l~~L 314 (1153)
T PLN03210 237 SSVFIDRAFISKSMEIYSSANPDDYNMKLHLQRAFLSEILDKKDI--KIYHLGAMEERLKHRKVLIFIDDLDDQDVLDAL 314 (1153)
T ss_pred eEEEeeccccccchhhcccccccccchhHHHHHHHHHHHhCCCCc--ccCCHHHHHHHHhCCeEEEEEeCCCCHHHHHHH
Confidence 99998542 1111 0 01 1235667777766543321 111256789999999999999999999999999
Q ss_pred hcCCCCCCCCCEEEEEeCChhhhhhcCCCceEEecCCCHHHHHHHHHHhhhcCCCCChhHHHHHHHHHHHhCCCchHHHH
Q 000922 362 AGGLDRFGLGSRVVVTSRDRQVFDKCRVDKIYEVEGLNQNEALEHFSNYAFRQNICPKDFLVLSERIVFYANGNPLALKV 441 (1223)
Q Consensus 362 ~~~~~~~~~gsrIIiTTR~~~v~~~~~~~~~~~l~~L~~~ea~~Lf~~~af~~~~~~~~~~~l~~~i~~~~~GlPLal~~ 441 (1223)
.+...|+++||+||||||+++++..++++.+|+|+.|+++||++||+++||++..+++++++++++|+++|+|+||||++
T Consensus 315 ~~~~~~~~~GsrIIiTTrd~~vl~~~~~~~~~~v~~l~~~ea~~LF~~~Af~~~~~~~~~~~l~~~iv~~c~GLPLAl~v 394 (1153)
T PLN03210 315 AGQTQWFGSGSRIIVITKDKHFLRAHGIDHIYEVCLPSNELALEMFCRSAFKKNSPPDGFMELASEVALRAGNLPLGLNV 394 (1153)
T ss_pred HhhCccCCCCcEEEEEeCcHHHHHhcCCCeEEEecCCCHHHHHHHHHHHhcCCCCCcHHHHHHHHHHHHHhCCCcHHHHH
Confidence 99889999999999999999999888888999999999999999999999998888888999999999999999999999
Q ss_pred HHhhhccCCHHHHHHHHhhhccCCCCcHHhHHHHhHhcccH-hHHhHhheeecccCCCCHHHHHHHhcCCC-CHHhhHHH
Q 000922 442 LGSFLQRKCKLQWENALKNLTRISDPDIYDMLKISYNELKQ-EEKSIFLDIACFFKGDDKDFMTRIQDDPE-SVHYGLNV 519 (1223)
Q Consensus 442 lg~~L~~~~~~~w~~~l~~l~~~~~~~i~~~L~~sy~~L~~-~~k~~fl~~a~f~~~~~~~~~~~~l~~~~-~~~~~l~~ 519 (1223)
+|++|++++..+|+.++++++..++.+|.++|++||++|++ .+|.||++|||||++.+++.+..+++.++ .+..+++.
T Consensus 395 lgs~L~~k~~~~W~~~l~~L~~~~~~~I~~~L~~SYd~L~~~~~k~~Fl~ia~ff~~~~~~~v~~~l~~~~~~~~~~l~~ 474 (1153)
T PLN03210 395 LGSYLRGRDKEDWMDMLPRLRNGLDGKIEKTLRVSYDGLNNKKDKAIFRHIACLFNGEKVNDIKLLLANSDLDVNIGLKN 474 (1153)
T ss_pred HHHHHcCCCHHHHHHHHHHHHhCccHHHHHHHHHhhhccCccchhhhhheehhhcCCCCHHHHHHHHHhcCCCchhChHH
Confidence 99999999999999999999988888999999999999976 58999999999999999999999999888 88889999
Q ss_pred HHhccceEEecCCeEEecHHHHHHHHHHHhhcccCCCCCceeecccccceeeeecCCCcccccccccccccccccccChh
Q 000922 520 LVDKSLVALSCNNKLQIHDLLQEFGREIVRQQSVKEPGKRSRLWYYEDVYQVLKKNKGTESIEGMFLDVSQIEDLHLTSR 599 (1223)
Q Consensus 520 L~~~sLi~~~~~~~~~mHdll~~~~~~i~~~~~~~~~~~~~rl~~~~~~~~~l~~~~~~~~v~~i~ldl~~~~~~~l~~~ 599 (1223)
|+++|||++. .+++.|||++|+||++++++++ .+|++|+|+|+++|+++++.+++|+..+++|++|++..+++.+...
T Consensus 475 L~~ksLi~~~-~~~~~MHdLl~~~~r~i~~~~~-~~~~~r~~l~~~~di~~vl~~~~g~~~v~~i~l~~~~~~~~~i~~~ 552 (1153)
T PLN03210 475 LVDKSLIHVR-EDIVEMHSLLQEMGKEIVRAQS-NEPGEREFLVDAKDICDVLEDNTGTKKVLGITLDIDEIDELHIHEN 552 (1153)
T ss_pred HHhcCCEEEc-CCeEEhhhHHHHHHHHHHHhhc-CCCCcceeEeCHHHHHHHHHhCcccceeeEEEeccCccceeeecHH
Confidence 9999999987 6899999999999999999987 7899999999999999999999999999999999999999999999
Q ss_pred hhcCCCCcceEEEecCCCCCCCCCccceeecCCccCCCCCeEEEEEcCCCCCCCCCCCCCCCCceEecCCCCCccccccc
Q 000922 600 AFVKMPNLRLLKFYVPGQITGSDMCTKVHLQQGLQYLPDELRYFHWYGYPLKALPFDFSPENLIELNLPHSKVEQIWEGK 679 (1223)
Q Consensus 600 ~f~~m~~Lr~L~l~~~~~~~~~~~~~~~~l~~~l~~l~~~Lr~L~~~~~~l~~lp~~~~~~~L~~L~L~~~~i~~l~~~~ 679 (1223)
+|.+|.+|++|+++.+.+.. ......++++++..+|.+||+|+|.+|+++.+|..|.+++|++|+|++|+++.+|.++
T Consensus 553 aF~~m~~L~~L~~~~~~~~~--~~~~~~~lp~~~~~lp~~Lr~L~~~~~~l~~lP~~f~~~~L~~L~L~~s~l~~L~~~~ 630 (1153)
T PLN03210 553 AFKGMRNLLFLKFYTKKWDQ--KKEVRWHLPEGFDYLPPKLRLLRWDKYPLRCMPSNFRPENLVKLQMQGSKLEKLWDGV 630 (1153)
T ss_pred HHhcCccccEEEEecccccc--cccceeecCcchhhcCcccEEEEecCCCCCCCCCcCCccCCcEEECcCcccccccccc
Confidence 99999999999998654211 1122567899999999999999999999999999999999999999999999999999
Q ss_pred cccccceEEecCCCCCCcccCcccccccceeecccCCcCCccCCCCCCCccEEEccCCCcccccccccccCccceeeecc
Q 000922 680 KHFNNLVMLCLSHCESLRCFPQNIHFRTLIEIDFSYCINLTEFPEISGNVIELDLKGTAIEEIPSSIECLTKLEELDLAY 759 (1223)
Q Consensus 680 ~~l~~L~~L~Ls~~~~l~~~p~~~~~~~L~~L~Ls~c~~l~~~p~~~~~L~~L~L~~~~i~~lp~~i~~L~~L~~L~L~~ 759 (1223)
..+++|+.|+|++|..++.+|+...+++|+.|+|++|..+. ++|.+++++++|+.|++++
T Consensus 631 ~~l~~Lk~L~Ls~~~~l~~ip~ls~l~~Le~L~L~~c~~L~--------------------~lp~si~~L~~L~~L~L~~ 690 (1153)
T PLN03210 631 HSLTGLRNIDLRGSKNLKEIPDLSMATNLETLKLSDCSSLV--------------------ELPSSIQYLNKLEDLDMSR 690 (1153)
T ss_pred ccCCCCCEEECCCCCCcCcCCccccCCcccEEEecCCCCcc--------------------ccchhhhccCCCCEEeCCC
Confidence 99999999999999999999988888888888888886554 6778889999999999999
Q ss_pred ccccccCccccccCCcccEEeecCCcCcccchhhhcccccceeeecCCCCccccccccccCCCCcEEEccCCCCCC----
Q 000922 760 CRRLKSLPSSICKLKSLHLLCLYNCSNFEIFPEILEKMECLEYIDLESTAVKELPSSVEQLKGLRELILEDCSELS---- 835 (1223)
Q Consensus 760 c~~l~~lp~~i~~L~~L~~L~L~~c~~~~~~p~~l~~l~~L~~L~L~~n~l~~lp~~i~~l~~L~~L~L~~~~~l~---- 835 (1223)
|+.++.+|..+ ++++|+.|++++|..+..+|.. ..+|++|++++|.+..+|..+ .+++|+.|.+.++....
T Consensus 691 c~~L~~Lp~~i-~l~sL~~L~Lsgc~~L~~~p~~---~~nL~~L~L~~n~i~~lP~~~-~l~~L~~L~l~~~~~~~l~~~ 765 (1153)
T PLN03210 691 CENLEILPTGI-NLKSLYRLNLSGCSRLKSFPDI---STNISWLDLDETAIEEFPSNL-RLENLDELILCEMKSEKLWER 765 (1153)
T ss_pred CCCcCccCCcC-CCCCCCEEeCCCCCCccccccc---cCCcCeeecCCCccccccccc-cccccccccccccchhhcccc
Confidence 99999999877 6999999999999998888865 467899999999999999876 68899999988754321
Q ss_pred --CC-ccccCCCCCCceeecCCcc-cccCCccccccccccEEEccCCCC-CCCCccccCCCCCCEEEcCCCCCC-CCchh
Q 000922 836 --KL-PENLGNLKSLKRLFAKRSA-ISKLPSSIAYLDEVIELSFHGCRG-LVLPPILSGLSSLTKLDLSDCDVM-EIPQD 909 (1223)
Q Consensus 836 --~l-p~~l~~l~~L~~L~l~~n~-i~~lp~~~~~l~~L~~L~l~~~~~-~~~p~~~~~l~~L~~L~L~~~~l~-~lp~~ 909 (1223)
.+ +......++|+.|++++|. +..+|.+++++++|+.|++++|.. ..+|... ++++|+.|+|++|... .+|..
T Consensus 766 ~~~l~~~~~~~~~sL~~L~Ls~n~~l~~lP~si~~L~~L~~L~Ls~C~~L~~LP~~~-~L~sL~~L~Ls~c~~L~~~p~~ 844 (1153)
T PLN03210 766 VQPLTPLMTMLSPSLTRLFLSDIPSLVELPSSIQNLHKLEHLEIENCINLETLPTGI-NLESLESLDLSGCSRLRTFPDI 844 (1153)
T ss_pred ccccchhhhhccccchheeCCCCCCccccChhhhCCCCCCEEECCCCCCcCeeCCCC-CccccCEEECCCCCcccccccc
Confidence 11 1122335789999999984 558999999999999999999874 4466654 7899999999998544 45542
Q ss_pred hcCCCCCcEEeCCCCCCcccchhhcCCCCCCEEeccCCCCCCCCCCcc---CCCcEEeccCCcCcCccCCCCccccccch
Q 000922 910 IGRASSLEILDISGNDFDSLPASIKQLSRLRELYLSNCSMLQSLPELP---LRVKLLDASNCKQLQSLPELPSCLEELPI 986 (1223)
Q Consensus 910 l~~l~~L~~L~Ls~n~l~~lp~~l~~l~~L~~L~L~~~~~l~~lp~l~---~~L~~L~~~~c~~L~~l~~~~~~l~~l~~ 986 (1223)
.++|+.|+|++|.++.+|.++..+++|+.|+|++|+.++.+|..+ ++|+.|++++|++|..++.. ..|.
T Consensus 845 ---~~nL~~L~Ls~n~i~~iP~si~~l~~L~~L~L~~C~~L~~l~~~~~~L~~L~~L~l~~C~~L~~~~l~-----~~~~ 916 (1153)
T PLN03210 845 ---STNISDLNLSRTGIEEVPWWIEKFSNLSFLDMNGCNNLQRVSLNISKLKHLETVDFSDCGALTEASWN-----GSPS 916 (1153)
T ss_pred ---ccccCEeECCCCCCccChHHHhcCCCCCEEECCCCCCcCccCcccccccCCCeeecCCCcccccccCC-----CCch
Confidence 478999999999999999999999999999999999999998644 56788899999999876531 1222
Q ss_pred hhhhccccCCCCCcccccccCCcccccccccccchhhhcchHHHHHHHHHHHHHHHHHHhhhcccCCCCeeEEecCCCCC
Q 000922 987 SILEMTSKHSLGSTQFKILADPCMELTFTDCLKLNEKGNNILADLRLIILHMAIASLRLFSEKEFKKPHGISIFLPGSGI 1066 (1223)
Q Consensus 987 ~~~~l~~~~~l~~~~~~~~~~~~~~l~~~~c~~l~~~~~~~~~~~~~~i~~~~~~~~~~~~~~~~~~~~~~~~~~pg~~i 1066 (1223)
....+..+. ... ++ +-..+.|.||++|++.+. ++. ......+++||.++
T Consensus 917 ~~~~~~~n~-~~~--~p----~~~~l~f~nC~~L~~~a~---------l~~---------------~~~~~~~~l~g~ev 965 (1153)
T PLN03210 917 EVAMATDNI-HSK--LP----STVCINFINCFNLDQEAL---------LQQ---------------QSIFKQLILSGEEV 965 (1153)
T ss_pred hhhhhcccc-ccc--CC----chhccccccccCCCchhh---------hcc---------------cccceEEECCCccC
Confidence 221111110 000 00 112367899999975431 111 01123478999999
Q ss_pred CCCcccccCCceEE-EEcCCCcCCCcccceEEEEEEecCCCCCCCCCeeEEEEEEEeeeccccccc---ccceeecCCCc
Q 000922 1067 PDWFSNQGSGSSIT-IQLSQHCCSTNLIGFSVCAVIEYEDDFPNGGGYFNVGCSYCFEITALSETK---HDDFWYLGNQV 1142 (1223)
Q Consensus 1067 P~wf~~~~~g~s~~-i~l~~~~~~~~~~gf~~c~v~~~~~~~~~~~~~~~v~c~~~~~~~~~~~~~---~~~~~~~~~~~ 1142 (1223)
|+||.||+.|++++ |++|+.|++..|.||++|+|+++.+... ....+.+.|.|+++...++... +.+.|..
T Consensus 966 p~~f~hr~~g~sl~~i~l~~~~~~~~~~~f~~c~v~~~~~~~~-~~~~~~~~~~c~~~~~~~~~~~~~~~~~~~~~---- 1040 (1153)
T PLN03210 966 PSYFTHRTTGASLTNIPLLHISPCQPFFRFRACAVVDSESFFI-ISVSFDIQVCCRFIDRLGNHFDSPYQPHVFSV---- 1040 (1153)
T ss_pred chhccCCcccceeeeeccCCcccCCCccceEEEEEEecCcccc-CCCceeEEEEEEEECCCCCccccCCCceeEee----
Confidence 99999999999999 9999999988899999999998876443 2345778888887554433221 1112211
Q ss_pred cCCCCcEEEEEEeccCcC-----CC--CCceEEEEEEEeeeecCCCCCcEEEEeceeEEecCCCccccccccccCCCCCh
Q 000922 1143 STCSDHIYIGFRPCINFG-----LP--DGISVSFHFFTYNLFTNNENGHKVKSCGVCPVYAHPNQTKLNTFTINMLPPSE 1215 (1223)
Q Consensus 1143 ~~~sDHl~l~y~~~~~~~-----~~--~~~~~~f~~~~~~~~~~~~~~~~Vk~CGv~lvy~~~~~~~~~~~~~~~~~~~~ 1215 (1223)
....+|+++|.. +.... .. .-.+++++|.... ....++||+|||+++|+.+.. +-.|||+
T Consensus 1041 ~~~~~~l~~~~~-~~~~~~~~~~~~~~~~~~~~~~f~~~~----~~~~~~~~~cg~~~~~~~~~~--------~~~~~~~ 1107 (1153)
T PLN03210 1041 TKKGSHLVIFDC-CFPLNEDNAPLAELNYDHVDIQFRLTN----KNSQLKLKGCGIRLSEDDSSL--------NNTLPNV 1107 (1153)
T ss_pred eccccceEEecc-cccccccccchhccCCceeeEEEEEec----CCCCeEEEeeeEEEeccCCCc--------ccCCCcc
Confidence 123455554421 11110 00 0134445554222 233489999999999965533 3355998
Q ss_pred hhhhh
Q 000922 1216 EECDE 1220 (1223)
Q Consensus 1216 ~~~~~ 1220 (1223)
.||||
T Consensus 1108 ~~~~~ 1112 (1153)
T PLN03210 1108 EEADD 1112 (1153)
T ss_pred ccccc
Confidence 88876
|
syringae 6; Provisional |
| >KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PLN03194 putative disease resistance protein; Provisional | Back alignment and domain information |
|---|
| >PF00931 NB-ARC: NB-ARC domain; InterPro: IPR002182 This is the NB-ARC domain, a novel signalling motif found in bacteria and eukaryotes, shared by plant resistance gene products and regulators of cell death in animals [] | Back alignment and domain information |
|---|
| >PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional | Back alignment and domain information |
|---|
| >PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional | Back alignment and domain information |
|---|
| >KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0472 consensus Leucine-rich repeat protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG0472 consensus Leucine-rich repeat protein [Function unknown] | Back alignment and domain information |
|---|
| >PLN03210 Resistant to P | Back alignment and domain information |
|---|
| >KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional | Back alignment and domain information |
|---|
| >PF01582 TIR: TIR domain; InterPro: IPR000157 In Drosophila melanogaster the Toll protein is involved in establishment of dorso-ventral polarity in the embryo | Back alignment and domain information |
|---|
| >PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional | Back alignment and domain information |
|---|
| >KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >smart00255 TIR Toll - interleukin 1 - resistance | Back alignment and domain information |
|---|
| >PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional | Back alignment and domain information |
|---|
| >PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional | Back alignment and domain information |
|---|
| >KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily | Back alignment and domain information |
|---|
| >cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily | Back alignment and domain information |
|---|
| >PF13676 TIR_2: TIR domain; PDB: 3H16_B 3UB4_A 2Y92_A 3UB3_A 3UB2_A | Back alignment and domain information |
|---|
| >PRK04841 transcriptional regulator MalT; Provisional | Back alignment and domain information |
|---|
| >KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] | Back alignment and domain information |
|---|
| >PRK00411 cdc6 cell division control protein 6; Reviewed | Back alignment and domain information |
|---|
| >KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >COG4886 Leucine-rich repeat (LRR) protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] | Back alignment and domain information |
|---|
| >TIGR00635 ruvB Holliday junction DNA helicase, RuvB subunit | Back alignment and domain information |
|---|
| >COG4886 Leucine-rich repeat (LRR) protein [Function unknown] | Back alignment and domain information |
|---|
| >PRK00080 ruvB Holliday junction DNA helicase RuvB; Reviewed | Back alignment and domain information |
|---|
| >PF01637 Arch_ATPase: Archaeal ATPase; InterPro: IPR011579 This domain has been found in a number of bacterial and archaeal proteins, all of which contain a conserved P-loop motif that is involved in binding ATP | Back alignment and domain information |
|---|
| >PF05729 NACHT: NACHT domain | Back alignment and domain information |
|---|
| >TIGR02928 orc1/cdc6 family replication initiation protein | Back alignment and domain information |
|---|
| >KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] | Back alignment and domain information |
|---|
| >TIGR03015 pepcterm_ATPase putative secretion ATPase, PEP-CTERM locus subfamily | Back alignment and domain information |
|---|
| >COG3899 Predicted ATPase [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A | Back alignment and domain information |
|---|
| >PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A | Back alignment and domain information |
|---|
| >COG2909 MalT ATP-dependent transcriptional regulator [Transcription] | Back alignment and domain information |
|---|
| >PRK06893 DNA replication initiation factor; Validated | Back alignment and domain information |
|---|
| >COG2256 MGS1 ATPase related to the helicase subunit of the Holliday junction resolvase [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PRK13342 recombination factor protein RarA; Reviewed | Back alignment and domain information |
|---|
| >TIGR03420 DnaA_homol_Hda DnaA regulatory inactivator Hda | Back alignment and domain information |
|---|
| >PTZ00112 origin recognition complex 1 protein; Provisional | Back alignment and domain information |
|---|
| >PLN03150 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PRK15386 type III secretion protein GogB; Provisional | Back alignment and domain information |
|---|
| >COG3903 Predicted ATPase [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR01242 26Sp45 26S proteasome subunit P45 family | Back alignment and domain information |
|---|
| >KOG3678 consensus SARM protein (with sterile alpha and armadillo motifs) [Extracellular structures] | Back alignment and domain information |
|---|
| >PRK15386 type III secretion protein GogB; Provisional | Back alignment and domain information |
|---|
| >PRK12402 replication factor C small subunit 2; Reviewed | Back alignment and domain information |
|---|
| >PRK07003 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >PRK14961 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PLN03150 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK14963 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PRK00440 rfc replication factor C small subunit; Reviewed | Back alignment and domain information |
|---|
| >PRK04195 replication factor C large subunit; Provisional | Back alignment and domain information |
|---|
| >PRK14960 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PF13173 AAA_14: AAA domain | Back alignment and domain information |
|---|
| >PLN03025 replication factor C subunit; Provisional | Back alignment and domain information |
|---|
| >cd00009 AAA The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold | Back alignment and domain information |
|---|
| >PF05496 RuvB_N: Holliday junction DNA helicase ruvB N-terminus; InterPro: IPR008824 The RuvB protein makes up part of the RuvABC revolvasome which catalyses the resolution of Holliday junctions that arise during genetic recombination and DNA repair | Back alignment and domain information |
|---|
| >PRK08727 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >PRK12323 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK14949 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK05564 DNA polymerase III subunit delta'; Validated | Back alignment and domain information |
|---|
| >PTZ00202 tuzin; Provisional | Back alignment and domain information |
|---|
| >PF13191 AAA_16: AAA ATPase domain; PDB: 2V1U_A | Back alignment and domain information |
|---|
| >PRK07471 DNA polymerase III subunit delta'; Validated | Back alignment and domain information |
|---|
| >KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK08903 DnaA regulatory inactivator Hda; Validated | Back alignment and domain information |
|---|
| >PF13401 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S_B | Back alignment and domain information |
|---|
| >PRK13341 recombination factor protein RarA/unknown domain fusion protein; Reviewed | Back alignment and domain information |
|---|
| >PRK14957 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PF00308 Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013317 This entry represents the central domain of bacterial DnaA proteins [, , ] that play an important role in initiating and regulating chromosomal replication | Back alignment and domain information |
|---|
| >PRK14956 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK03992 proteasome-activating nucleotidase; Provisional | Back alignment and domain information |
|---|
| >PRK09087 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >PRK08691 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK05642 DNA replication initiation factor; Validated | Back alignment and domain information |
|---|
| >PRK08084 DNA replication initiation factor; Provisional | Back alignment and domain information |
|---|
| >PRK06645 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >COG1474 CDC6 Cdc6-related protein, AAA superfamily ATPase [DNA replication, recombination, and repair / Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK07994 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >KOG2028 consensus ATPase related to the helicase subunit of the Holliday junction resolvase [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >PRK14962 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >TIGR02397 dnaX_nterm DNA polymerase III, subunit gamma and tau | Back alignment and domain information |
|---|
| >PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A | Back alignment and domain information |
|---|
| >KOG4341 consensus F-box protein containing LRR [General function prediction only] | Back alignment and domain information |
|---|
| >PRK07940 DNA polymerase III subunit delta'; Validated | Back alignment and domain information |
|---|
| >PRK14951 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK14964 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK14087 dnaA chromosomal replication initiation protein; Provisional | Back alignment and domain information |
|---|
| >TIGR02903 spore_lon_C ATP-dependent protease, Lon family | Back alignment and domain information |
|---|
| >KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] | Back alignment and domain information |
|---|
| >PRK14958 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK05896 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >PRK09112 DNA polymerase III subunit delta'; Validated | Back alignment and domain information |
|---|
| >PF14516 AAA_35: AAA-like domain | Back alignment and domain information |
|---|
| >TIGR03689 pup_AAA proteasome ATPase | Back alignment and domain information |
|---|
| >PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A | Back alignment and domain information |
|---|
| >PRK14955 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] | Back alignment and domain information |
|---|
| >PRK14969 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK14970 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PTZ00361 26 proteosome regulatory subunit 4-like protein; Provisional | Back alignment and domain information |
|---|
| >KOG2982 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >PRK14088 dnaA chromosomal replication initiation protein; Provisional | Back alignment and domain information |
|---|
| >KOG0989 consensus Replication factor C, subunit RFC4 [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >PRK14954 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK14952 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >KOG4341 consensus F-box protein containing LRR [General function prediction only] | Back alignment and domain information |
|---|
| >PHA02544 44 clamp loader, small subunit; Provisional | Back alignment and domain information |
|---|
| >PRK09376 rho transcription termination factor Rho; Provisional | Back alignment and domain information |
|---|
| >PRK14959 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK09111 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >PTZ00454 26S protease regulatory subunit 6B-like protein; Provisional | Back alignment and domain information |
|---|
| >TIGR00678 holB DNA polymerase III, delta' subunit | Back alignment and domain information |
|---|
| >PRK06620 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >PRK00149 dnaA chromosomal replication initiation protein; Reviewed | Back alignment and domain information |
|---|
| >TIGR02881 spore_V_K stage V sporulation protein K | Back alignment and domain information |
|---|
| >PRK07764 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >TIGR00362 DnaA chromosomal replication initiator protein DnaA | Back alignment and domain information |
|---|
| >PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B | Back alignment and domain information |
|---|
| >TIGR02639 ClpA ATP-dependent Clp protease ATP-binding subunit clpA | Back alignment and domain information |
|---|
| >PRK06305 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >PRK14950 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK07133 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >PRK08451 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >PRK12422 chromosomal replication initiation protein; Provisional | Back alignment and domain information |
|---|
| >TIGR03345 VI_ClpV1 type VI secretion ATPase, ClpV1 family | Back alignment and domain information |
|---|
| >cd01128 rho_factor Transcription termination factor rho is a bacterial ATP-dependent RNA/DNA helicase | Back alignment and domain information |
|---|
| >COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] | Back alignment and domain information |
|---|
| >PRK14953 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >TIGR02880 cbbX_cfxQ probable Rubsico expression protein CbbX | Back alignment and domain information |
|---|
| >COG2255 RuvB Holliday junction resolvasome, helicase subunit [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >KOG2982 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >PRK10865 protein disaggregation chaperone; Provisional | Back alignment and domain information |
|---|
| >PRK14948 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK14086 dnaA chromosomal replication initiation protein; Provisional | Back alignment and domain information |
|---|
| >CHL00195 ycf46 Ycf46; Provisional | Back alignment and domain information |
|---|
| >KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] | Back alignment and domain information |
|---|
| >PRK06647 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >TIGR00767 rho transcription termination factor Rho | Back alignment and domain information |
|---|
| >PF08937 DUF1863: MTH538 TIR-like domain (DUF1863); InterPro: IPR015032 This protein adopts the flavodoxin fold, that is, five parallel beta-strands and four helical segments | Back alignment and domain information |
|---|
| >PRK14971 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR03346 chaperone_ClpB ATP-dependent chaperone ClpB | Back alignment and domain information |
|---|
| >CHL00176 ftsH cell division protein; Validated | Back alignment and domain information |
|---|
| >TIGR01241 FtsH_fam ATP-dependent metalloprotease FtsH | Back alignment and domain information |
|---|
| >KOG2543 consensus Origin recognition complex, subunit 5 [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >PRK08116 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B | Back alignment and domain information |
|---|
| >PRK07399 DNA polymerase III subunit delta'; Validated | Back alignment and domain information |
|---|
| >CHL00181 cbbX CbbX; Provisional | Back alignment and domain information |
|---|
| >COG1222 RPT1 ATP-dependent 26S proteasome regulatory subunit [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >CHL00095 clpC Clp protease ATP binding subunit | Back alignment and domain information |
|---|
| >PRK05563 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >KOG0991 consensus Replication factor C, subunit RFC2 [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] | Back alignment and domain information |
|---|
| >COG0593 DnaA ATPase involved in DNA replication initiation [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PRK12377 putative replication protein; Provisional | Back alignment and domain information |
|---|
| >PF00004 AAA: ATPase family associated with various cellular activities (AAA); InterPro: IPR003959 AAA ATPases (ATPases Associated with diverse cellular Activities) form a large protein family and play a number of roles in the cell including cell-cycle regulation, protein proteolysis and disaggregation, organelle biogenesis and intracellular transport | Back alignment and domain information |
|---|
| >KOG2227 consensus Pre-initiation complex, subunit CDC6, AAA+ superfamily ATPase [Replication, recombination and repair; Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] | Back alignment and domain information |
|---|
| >PRK11034 clpA ATP-dependent Clp protease ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PF05673 DUF815: Protein of unknown function (DUF815); InterPro: IPR008533 This domain consists of several bacterial proteins of unknown function | Back alignment and domain information |
|---|
| >PRK14965 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >COG1373 Predicted ATPase (AAA+ superfamily) [General function prediction only] | Back alignment and domain information |
|---|
| >PRK05707 DNA polymerase III subunit delta'; Validated | Back alignment and domain information |
|---|
| >PRK07952 DNA replication protein DnaC; Validated | Back alignment and domain information |
|---|
| >TIGR00602 rad24 checkpoint protein rad24 | Back alignment and domain information |
|---|
| >KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] | Back alignment and domain information |
|---|
| >PF05621 TniB: Bacterial TniB protein; InterPro: IPR008868 This family consists of several bacterial TniB NTP-binding proteins | Back alignment and domain information |
|---|
| >PRK10536 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK08181 transposase; Validated | Back alignment and domain information |
|---|
| >TIGR01243 CDC48 AAA family ATPase, CDC48 subfamily | Back alignment and domain information |
|---|
| >smart00382 AAA ATPases associated with a variety of cellular activities | Back alignment and domain information |
|---|
| >PLN00020 ribulose bisphosphate carboxylase/oxygenase activase -RuBisCO activase (RCA); Provisional | Back alignment and domain information |
|---|
| >PRK09183 transposase/IS protein; Provisional | Back alignment and domain information |
|---|
| >KOG0744 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >TIGR01243 CDC48 AAA family ATPase, CDC48 subfamily | Back alignment and domain information |
|---|
| >TIGR02640 gas_vesic_GvpN gas vesicle protein GvpN | Back alignment and domain information |
|---|
| >PF10443 RNA12: RNA12 protein; InterPro: IPR018850 Mitochondrial escape protein 2 (also known as RNA12) plays a role in maintaining the mitochondrial genome and in controlling mtDNA escape [, ] | Back alignment and domain information |
|---|
| >COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] | Back alignment and domain information |
|---|
| >PRK00771 signal recognition particle protein Srp54; Provisional | Back alignment and domain information |
|---|
| >PRK06526 transposase; Provisional | Back alignment and domain information |
|---|
| >TIGR02639 ClpA ATP-dependent Clp protease ATP-binding subunit clpA | Back alignment and domain information |
|---|
| >PF01695 IstB_IS21: IstB-like ATP binding protein; InterPro: IPR002611 Proteins in this entry contain an ATP/GTP binding P-loop motif | Back alignment and domain information |
|---|
| >PRK10865 protein disaggregation chaperone; Provisional | Back alignment and domain information |
|---|
| >COG0466 Lon ATP-dependent Lon protease, bacterial type [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK06921 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK08769 DNA polymerase III subunit delta'; Validated | Back alignment and domain information |
|---|
| >PRK08118 topology modulation protein; Reviewed | Back alignment and domain information |
|---|
| >COG1223 Predicted ATPase (AAA+ superfamily) [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR00763 lon ATP-dependent protease La | Back alignment and domain information |
|---|
| >COG3267 ExeA Type II secretory pathway, component ExeA (predicted ATPase) [Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >PRK11331 5-methylcytosine-specific restriction enzyme subunit McrB; Provisional | Back alignment and domain information |
|---|
| >PRK10787 DNA-binding ATP-dependent protease La; Provisional | Back alignment and domain information |
|---|
| >KOG0735 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >TIGR03346 chaperone_ClpB ATP-dependent chaperone ClpB | Back alignment and domain information |
|---|
| >PRK11889 flhF flagellar biosynthesis regulator FlhF; Provisional | Back alignment and domain information |
|---|
| >KOG0741 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF04665 Pox_A32: Poxvirus A32 protein; InterPro: IPR006758 This entry contains uncharacterised proteins belonging to the B354L family which include the pox virus A32 protein | Back alignment and domain information |
|---|
| >TIGR03345 VI_ClpV1 type VI secretion ATPase, ClpV1 family | Back alignment and domain information |
|---|
| >PRK06090 DNA polymerase III subunit delta'; Validated | Back alignment and domain information |
|---|
| >COG0542 clpA ATP-binding subunits of Clp protease and DnaK/DnaJ chaperones [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK14974 cell division protein FtsY; Provisional | Back alignment and domain information |
|---|
| >CHL00095 clpC Clp protease ATP binding subunit | Back alignment and domain information |
|---|
| >cd01133 F1-ATPase_beta F1 ATP synthase beta subunit, nucleotide-binding domain | Back alignment and domain information |
|---|
| >PF02562 PhoH: PhoH-like protein; InterPro: IPR003714 PhoH is a cytoplasmic protein and predicted ATPase that is induced by phosphate starvation and belongings to the phosphate regulon (pho) in Escherichia coli [] | Back alignment and domain information |
|---|
| >smart00763 AAA_PrkA PrkA AAA domain | Back alignment and domain information |
|---|
| >cd01131 PilT Pilus retraction ATPase PilT | Back alignment and domain information |
|---|
| >PF13207 AAA_17: AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6_G 2QT1_A 2QSZ_A 2QSY_A 2QT0_A 2QG6_A 2P0E_A | Back alignment and domain information |
|---|
| >PRK06835 DNA replication protein DnaC; Validated | Back alignment and domain information |
|---|
| >PRK07261 topology modulation protein; Provisional | Back alignment and domain information |
|---|
| >PRK10416 signal recognition particle-docking protein FtsY; Provisional | Back alignment and domain information |
|---|
| >KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] | Back alignment and domain information |
|---|
| >PRK08058 DNA polymerase III subunit delta'; Validated | Back alignment and domain information |
|---|
| >KOG0731 consensus AAA+-type ATPase containing the peptidase M41 domain [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >COG1618 Predicted nucleotide kinase [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >COG0470 HolB ATPase involved in DNA replication [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >COG0488 Uup ATPase components of ABC transporters with duplicated ATPase domains [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR00064 ftsY signal recognition particle-docking protein FtsY | Back alignment and domain information |
|---|
| >PF08357 SEFIR: SEFIR domain; InterPro: IPR013568 This domain is found in IL17 receptors (IL17Rs, e | Back alignment and domain information |
|---|
| >PRK10733 hflB ATP-dependent metalloprotease; Reviewed | Back alignment and domain information |
|---|
| >PRK06964 DNA polymerase III subunit delta'; Validated | Back alignment and domain information |
|---|
| >PRK07993 DNA polymerase III subunit delta'; Validated | Back alignment and domain information |
|---|
| >PRK04132 replication factor C small subunit; Provisional | Back alignment and domain information |
|---|
| >PRK05541 adenylylsulfate kinase; Provisional | Back alignment and domain information |
|---|
| >PRK12608 transcription termination factor Rho; Provisional | Back alignment and domain information |
|---|
| >KOG2228 consensus Origin recognition complex, subunit 4 [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >TIGR00959 ffh signal recognition particle protein | Back alignment and domain information |
|---|
| >PRK06871 DNA polymerase III subunit delta'; Validated | Back alignment and domain information |
|---|
| >PRK11034 clpA ATP-dependent Clp protease ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >KOG0730 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK12724 flagellar biosynthesis regulator FlhF; Provisional | Back alignment and domain information |
|---|
| >PRK08939 primosomal protein DnaI; Reviewed | Back alignment and domain information |
|---|
| >PRK05703 flhF flagellar biosynthesis regulator FlhF; Validated | Back alignment and domain information |
|---|
| >PRK06696 uridine kinase; Validated | Back alignment and domain information |
|---|
| >KOG0733 consensus Nuclear AAA ATPase (VCP subfamily) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >cd01120 RecA-like_NTPases RecA-like NTPases | Back alignment and domain information |
|---|
| >COG1484 DnaC DNA replication protein [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PRK07667 uridine kinase; Provisional | Back alignment and domain information |
|---|
| >KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR01425 SRP54_euk signal recognition particle protein SRP54 | Back alignment and domain information |
|---|
| >PRK09361 radB DNA repair and recombination protein RadB; Provisional | Back alignment and domain information |
|---|
| >TIGR02902 spore_lonB ATP-dependent protease LonB | Back alignment and domain information |
|---|
| >PHA00729 NTP-binding motif containing protein | Back alignment and domain information |
|---|
| >PF00448 SRP54: SRP54-type protein, GTPase domain; InterPro: IPR000897 The signal recognition particle (SRP) is a multimeric protein, which along with its conjugate receptor (SR), is involved in targeting secretory proteins to the rough endoplasmic reticulum (RER) membrane in eukaryotes, or to the plasma membrane in prokaryotes [, ] | Back alignment and domain information |
|---|
| >KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] | Back alignment and domain information |
|---|
| >PRK04296 thymidine kinase; Provisional | Back alignment and domain information |
|---|
| >cd01394 radB RadB | Back alignment and domain information |
|---|
| >PRK11608 pspF phage shock protein operon transcriptional activator; Provisional | Back alignment and domain information |
|---|
| >cd03221 ABCF_EF-3 ABCF_EF-3 Elongation factor 3 (EF-3) is a cytosolic protein required by fungal ribosomes for in vitro protein synthesis and for in vivo growth | Back alignment and domain information |
|---|
| >PF13177 DNA_pol3_delta2: DNA polymerase III, delta subunit; PDB: 1NJF_B 3GLG_G 1XXH_I 1NJG_A 3GLF_B 3GLI_G 1IQP_E 2GNO_A 1SXJ_E 1A5T_A | Back alignment and domain information |
|---|
| >PF07693 KAP_NTPase: KAP family P-loop domain; InterPro: IPR011646 The KAP (after Kidins220/ARMS and PifA) family of predicted NTPases are sporadically distributed across a wide phylogenetic range in bacteria and in animals | Back alignment and domain information |
|---|
| >PRK12337 2-phosphoglycerate kinase; Provisional | Back alignment and domain information |
|---|
| >KOG2123 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >TIGR01359 UMP_CMP_kin_fam UMP-CMP kinase family | Back alignment and domain information |
|---|
| >COG2607 Predicted ATPase (AAA+ superfamily) [General function prediction only] | Back alignment and domain information |
|---|
| >cd00561 CobA_CobO_BtuR ATP:corrinoid adenosyltransferase BtuR/CobO/CobP | Back alignment and domain information |
|---|
| >cd01121 Sms Sms (bacterial radA) DNA repair protein | Back alignment and domain information |
|---|
| >KOG0728 consensus 26S proteasome regulatory complex, ATPase RPT6 [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >COG2812 DnaX DNA polymerase III, gamma/tau subunits [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PRK10867 signal recognition particle protein; Provisional | Back alignment and domain information |
|---|
| >KOG0733 consensus Nuclear AAA ATPase (VCP subfamily) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >TIGR02237 recomb_radB DNA repair and recombination protein RadB | Back alignment and domain information |
|---|
| >COG0464 SpoVK ATPases of the AAA+ class [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >TIGR01817 nifA Nif-specific regulatory protein | Back alignment and domain information |
|---|
| >KOG1514 consensus Origin recognition complex, subunit 1, and related proteins [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] | Back alignment and domain information |
|---|
| >PF01583 APS_kinase: Adenylylsulphate kinase; InterPro: IPR002891 Protein phosphorylation, which plays a key role in most cellular activities, is a reversible process mediated by protein kinases and phosphoprotein phosphatases | Back alignment and domain information |
|---|
| >cd03214 ABC_Iron-Siderophores_B12_Hemin ABC transporters, involved in the uptake of siderophores, heme, and vitamin B12, are widely conserved in bacteria and archaea | Back alignment and domain information |
|---|
| >PF13238 AAA_18: AAA domain; PDB: 3IIK_A 3IIJ_A 3IIL_A 1RKB_A 3IIM_A 2AXP_A 3KB2_A 1KHT_A 1NKS_A 3H86_C | Back alignment and domain information |
|---|
| >PRK00625 shikimate kinase; Provisional | Back alignment and domain information |
|---|
| >cd01393 recA_like RecA is a bacterial enzyme which has roles in homologous recombination, DNA repair, and the induction of the SOS response | Back alignment and domain information |
|---|
| >PRK15455 PrkA family serine protein kinase; Provisional | Back alignment and domain information |
|---|
| >PRK12723 flagellar biosynthesis regulator FlhF; Provisional | Back alignment and domain information |
|---|
| >PRK15429 formate hydrogenlyase transcriptional activator FhlA; Provisional | Back alignment and domain information |
|---|
| >PF00406 ADK: Adenylate kinase; InterPro: IPR000850 Adenylate kinases (ADK) are phosphotransferases that catalyse the reversible reaction |
Back alignment and domain information |
|---|
| >KOG2035 consensus Replication factor C, subunit RFC3 [Cell cycle control, cell division, chromosome partitioning; Replication, recombination and repair] | Back alignment and domain information |
|---|
| >PF00485 PRK: Phosphoribulokinase / Uridine kinase family; InterPro: IPR006083 Phosphoribulokinase (PRK) 2 | Back alignment and domain information |
|---|
| >KOG1969 consensus DNA replication checkpoint protein CHL12/CTF18 [Cell cycle control, cell division, chromosome partitioning; Replication, recombination and repair] | Back alignment and domain information |
|---|
| >PRK14722 flhF flagellar biosynthesis regulator FlhF; Provisional | Back alignment and domain information |
|---|
| >KOG0743 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >TIGR01420 pilT_fam pilus retraction protein PilT | Back alignment and domain information |
|---|
| >PRK12727 flagellar biosynthesis regulator FlhF; Provisional | Back alignment and domain information |
|---|
| >PRK08699 DNA polymerase III subunit delta'; Validated | Back alignment and domain information |
|---|
| >PRK06067 flagellar accessory protein FlaH; Validated | Back alignment and domain information |
|---|
| >cd03223 ABCD_peroxisomal_ALDP Peroxisomal ATP-binding cassette transporter (Pat) is involved in the import of very long-chain fatty acids (VLCFA) into the peroxisome | Back alignment and domain information |
|---|
| >PF14532 Sigma54_activ_2: Sigma-54 interaction domain; PDB: 3CO5_B 3N70_H | Back alignment and domain information |
|---|
| >TIGR02974 phageshock_pspF psp operon transcriptional activator PspF | Back alignment and domain information |
|---|
| >TIGR03499 FlhF flagellar biosynthetic protein FlhF | Back alignment and domain information |
|---|
| >PRK05022 anaerobic nitric oxide reductase transcription regulator; Provisional | Back alignment and domain information |
|---|
| >PRK11823 DNA repair protein RadA; Provisional | Back alignment and domain information |
|---|
| >PF07726 AAA_3: ATPase family associated with various cellular activities (AAA); InterPro: IPR011703 This entry includes some of the AAA proteins not detected by the IPR003959 from INTERPRO model | Back alignment and domain information |
|---|
| >COG0542 clpA ATP-binding subunits of Clp protease and DnaK/DnaJ chaperones [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PTZ00301 uridine kinase; Provisional | Back alignment and domain information |
|---|
| >PRK12726 flagellar biosynthesis regulator FlhF; Provisional | Back alignment and domain information |
|---|
| >PF08433 KTI12: Chromatin associated protein KTI12 ; InterPro: IPR013641 This is a family of chromatin associated proteins which interact with the Elongator complex, a component of the elongating form of RNA polymerase II [] | Back alignment and domain information |
|---|
| >TIGR03574 selen_PSTK L-seryl-tRNA(Sec) kinase, archaeal | Back alignment and domain information |
|---|
| >cd02019 NK Nucleoside/nucleotide kinase (NK) is a protein superfamily consisting of multiple families of enzymes that share structural similarity and are functionally related to the catalysis of the reversible phosphate group transfer from nucleoside triphosphates to nucleosides/nucleotides, nucleoside monophosphates, or sugars | Back alignment and domain information |
|---|
| >PRK03839 putative kinase; Provisional | Back alignment and domain information |
|---|
| >PRK13531 regulatory ATPase RavA; Provisional | Back alignment and domain information |
|---|
| >cd01129 PulE-GspE PulE/GspE The type II secretory pathway is the main terminal branch of the general secretory pathway (GSP) | Back alignment and domain information |
|---|
| >PRK08356 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >cd03222 ABC_RNaseL_inhibitor The ABC ATPase RNase L inhibitor (RLI) is a key enzyme in ribosomal biogenesis, formation of translation preinitiation complexes, and assembly of HIV capsids | Back alignment and domain information |
|---|
| >cd03216 ABC_Carb_Monos_I This family represents the domain I of the carbohydrate uptake proteins that transport only monosaccharides (Monos) | Back alignment and domain information |
|---|
| >TIGR00416 sms DNA repair protein RadA | Back alignment and domain information |
|---|
| >COG4608 AppF ABC-type oligopeptide transport system, ATPase component [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >cd03228 ABCC_MRP_Like The MRP (Mutidrug Resistance Protein)-like transporters are involved in drug, peptide, and lipid export | Back alignment and domain information |
|---|
| >KOG2123 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >PRK06762 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >cd01122 GP4d_helicase GP4d_helicase is a homohexameric 5'-3' helicases | Back alignment and domain information |
|---|
| >PF13604 AAA_30: AAA domain; PDB: 1W36_G 3K70_G 3UPU_B 3GPL_A 3E1S_A 3GP8_A | Back alignment and domain information |
|---|
| >PRK08233 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >COG4088 Predicted nucleotide kinase [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >KOG0727 consensus 26S proteasome regulatory complex, ATPase RPT3 [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >cd00544 CobU Adenosylcobinamide kinase / adenosylcobinamide phosphate guanyltransferase (CobU) | Back alignment and domain information |
|---|
| >cd03115 SRP The signal recognition particle (SRP) mediates the transport to or across the plasma membrane in bacteria and the endoplasmic reticulum in eukaryotes | Back alignment and domain information |
|---|
| >PF00910 RNA_helicase: RNA helicase; InterPro: IPR000605 Helicases have been classified in 5 superfamilies (SF1-SF5) | Back alignment and domain information |
|---|
| >COG0563 Adk Adenylate kinase and related kinases [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >KOG0651 consensus 26S proteasome regulatory complex, ATPase RPT4 [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK05480 uridine/cytidine kinase; Provisional | Back alignment and domain information |
|---|
| >COG0572 Udk Uridine kinase [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] | Back alignment and domain information |
|---|
| >PTZ00088 adenylate kinase 1; Provisional | Back alignment and domain information |
|---|
| >PRK04040 adenylate kinase; Provisional | Back alignment and domain information |
|---|
| >KOG0734 consensus AAA+-type ATPase containing the peptidase M41 domain [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF13671 AAA_33: AAA domain; PDB: 1LTQ_A 2IA5_K 1RC8_A 1LY1_A 1RRC_A 1RPZ_A 3ZVM_A 1YJ5_A 3ZVL_A 3U7E_B | Back alignment and domain information |
|---|
| >KOG1051 consensus Chaperone HSP104 and related ATP-dependent Clp proteases [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >TIGR03600 phage_DnaB phage replicative helicase, DnaB family, HK022 subfamily | Back alignment and domain information |
|---|
| >TIGR00235 udk uridine kinase | Back alignment and domain information |
|---|
| >cd02027 APSK Adenosine 5'-phosphosulfate kinase (APSK) catalyzes the phosphorylation of adenosine 5'-phosphosulfate to form 3'-phosphoadenosine 5'-phosphosulfate (PAPS) | Back alignment and domain information |
|---|
| >KOG1970 consensus Checkpoint RAD17-RFC complex, RAD17/RAD24 component [Cell cycle control, cell division, chromosome partitioning; Replication, recombination and repair] | Back alignment and domain information |
|---|
| >cd03247 ABCC_cytochrome_bd The CYD subfamily implicated in cytochrome bd biogenesis | Back alignment and domain information |
|---|
| >PRK06995 flhF flagellar biosynthesis regulator FlhF; Validated | Back alignment and domain information |
|---|
| >TIGR01360 aden_kin_iso1 adenylate kinase, isozyme 1 subfamily | Back alignment and domain information |
|---|
| >PRK09270 nucleoside triphosphate hydrolase domain-containing protein; Reviewed | Back alignment and domain information |
|---|
| >cd03230 ABC_DR_subfamily_A This family of ATP-binding proteins belongs to a multisubunit transporter involved in drug resistance (BcrA and DrrA), nodulation, lipid transport, and lantibiotic immunity | Back alignment and domain information |
|---|
| >PF03308 ArgK: ArgK protein; InterPro: IPR005129 Bacterial periplasmic transport systems require the function of a specific substrate-binding protein, located in the periplasm, and several cytoplasmic membrane transport components | Back alignment and domain information |
|---|
| >COG1121 ZnuC ABC-type Mn/Zn transport systems, ATPase component [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >KOG0652 consensus 26S proteasome regulatory complex, ATPase RPT5 [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG2004 consensus Mitochondrial ATP-dependent protease PIM1/LON [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >TIGR01351 adk adenylate kinases | Back alignment and domain information |
|---|
| >PRK00131 aroK shikimate kinase; Reviewed | Back alignment and domain information |
|---|
| >PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] | Back alignment and domain information |
|---|
| >COG0703 AroK Shikimate kinase [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PRK06217 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >TIGR02858 spore_III_AA stage III sporulation protein AA | Back alignment and domain information |
|---|
| >cd03238 ABC_UvrA The excision repair protein UvrA; Nucleotide excision repair in eubacteria is a process that repairs DNA damage by the removal of a 12-13-mer oligonucleotide containing the lesion | Back alignment and domain information |
|---|
| >TIGR00150 HI0065_YjeE ATPase, YjeE family | Back alignment and domain information |
|---|
| >TIGR02788 VirB11 P-type DNA transfer ATPase VirB11 | Back alignment and domain information |
|---|
| >cd00267 ABC_ATPase ABC (ATP-binding cassette) transporter nucleotide-binding domain; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules | Back alignment and domain information |
|---|
| >PRK13947 shikimate kinase; Provisional | Back alignment and domain information |
|---|
| >cd01123 Rad51_DMC1_radA Rad51_DMC1_radA,B | Back alignment and domain information |
|---|
| >cd03232 ABC_PDR_domain2 The pleiotropic drug resistance-like (PDR) family of ATP-binding cassette (ABC) transporters | Back alignment and domain information |
|---|
| >PRK10820 DNA-binding transcriptional regulator TyrR; Provisional | Back alignment and domain information |
|---|
| >PRK06547 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK14526 adenylate kinase; Provisional | Back alignment and domain information |
|---|
| >PF07728 AAA_5: AAA domain (dynein-related subfamily); InterPro: IPR011704 The ATPases Associated to a variety of cellular Activities (AAA) are a family distinguished by a highly conserved module of 230 amino acids [] | Back alignment and domain information |
|---|
| >cd03240 ABC_Rad50 The catalytic domains of Rad50 are similar to the ATP-binding cassette of ABC transporters, but are not associated with membrane-spanning domains | Back alignment and domain information |
|---|
| >COG1066 Sms Predicted ATP-dependent serine protease [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0729 consensus 26S proteasome regulatory complex, ATPase RPT1 [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >cd03246 ABCC_Protease_Secretion This family represents the ABC component of the protease secretion system PrtD, a 60-kDa integral membrane protein sharing 37% identity with HlyB, the ABC component of the alpha-hemolysin secretion pathway, in the C-terminal domain | Back alignment and domain information |
|---|
| >PRK14528 adenylate kinase; Provisional | Back alignment and domain information |
|---|
| >COG2884 FtsE Predicted ATPase involved in cell division [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >PRK00889 adenylylsulfate kinase; Provisional | Back alignment and domain information |
|---|
| >cd00227 CPT Chloramphenicol (Cm) phosphotransferase (CPT) | Back alignment and domain information |
|---|
| >COG1120 FepC ABC-type cobalamin/Fe3+-siderophores transport systems, ATPase components [Inorganic ion transport and metabolism / Coenzyme metabolism] | Back alignment and domain information |
|---|
| >PRK00279 adk adenylate kinase; Reviewed | Back alignment and domain information |
|---|
| >PRK01184 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >COG5635 Predicted NTPase (NACHT family) [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PRK09354 recA recombinase A; Provisional | Back alignment and domain information |
|---|
| >COG2019 AdkA Archaeal adenylate kinase [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >PRK10463 hydrogenase nickel incorporation protein HypB; Provisional | Back alignment and domain information |
|---|
| >TIGR00708 cobA cob(I)alamin adenosyltransferase | Back alignment and domain information |
|---|
| >cd02028 UMPK_like Uridine monophosphate kinase_like (UMPK_like) is a family of proteins highly similar to the uridine monophosphate kinase (UMPK, EC 2 | Back alignment and domain information |
|---|
| >COG0467 RAD55 RecA-superfamily ATPases implicated in signal transduction [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >COG0541 Ffh Signal recognition particle GTPase [Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >PRK06731 flhF flagellar biosynthesis regulator FlhF; Validated | Back alignment and domain information |
|---|
| >PRK03846 adenylylsulfate kinase; Provisional | Back alignment and domain information |
|---|
| >PRK14531 adenylate kinase; Provisional | Back alignment and domain information |
|---|
| >PRK11388 DNA-binding transcriptional regulator DhaR; Provisional | Back alignment and domain information |
|---|
| >COG1875 NYN ribonuclease and ATPase of PhoH family domains [General function prediction only] | Back alignment and domain information |
|---|
| >cd01130 VirB11-like_ATPase Type IV secretory pathway component VirB11, and related ATPases | Back alignment and domain information |
|---|
| >TIGR01069 mutS2 MutS2 family protein | Back alignment and domain information |
|---|
| >cd03233 ABC_PDR_domain1 The pleiotropic drug resistance (PDR) family of ATP-binding cassette (ABC) transporters | Back alignment and domain information |
|---|
| >TIGR00390 hslU ATP-dependent protease HslVU, ATPase subunit | Back alignment and domain information |
|---|
| >PF03266 NTPase_1: NTPase; InterPro: IPR004948 This entry represents a family of nucleoside-triphosphatases which have activity towards ATP, GTP, CTP, TTP and UTP and may hydrolyse nucleoside diphosphates with lower efficiency [] | Back alignment and domain information |
|---|
| >cd02025 PanK Pantothenate kinase (PanK) catalyzes the phosphorylation of pantothenic acid to form 4'-phosphopantothenic, which is the first of five steps in coenzyme A (CoA) biosynthetic pathway | Back alignment and domain information |
|---|
| >cd02024 NRK1 Nicotinamide riboside kinase (NRK) is an enzyme involved in the metabolism of nicotinamide adenine dinucleotide (NAD+) | Back alignment and domain information |
|---|
| >PF07724 AAA_2: AAA domain (Cdc48 subfamily); InterPro: IPR013093 ATPases Associated to a variety of cellular Activities (AAA) are a family distinguished by a highly conserved module of 230 amino acids [] | Back alignment and domain information |
|---|
| >cd01428 ADK Adenylate kinase (ADK) catalyzes the reversible phosphoryl transfer from adenosine triphosphates (ATP) to adenosine monophosphates (AMP) and to yield adenosine diphosphates (ADP) | Back alignment and domain information |
|---|
| >PRK13949 shikimate kinase; Provisional | Back alignment and domain information |
|---|
| >PRK14529 adenylate kinase; Provisional | Back alignment and domain information |
|---|
| >TIGR02655 circ_KaiC circadian clock protein KaiC | Back alignment and domain information |
|---|
| >COG1428 Deoxynucleoside kinases [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >cd01858 NGP_1 NGP-1 | Back alignment and domain information |
|---|
| >cd01125 repA Hexameric Replicative Helicase RepA | Back alignment and domain information |
|---|
| >PRK05201 hslU ATP-dependent protease ATP-binding subunit HslU; Provisional | Back alignment and domain information |
|---|
| >COG0468 RecA RecA/RadA recombinase [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >cd03281 ABC_MSH5_euk MutS5 homolog in eukaryotes | Back alignment and domain information |
|---|
| >KOG3928 consensus Mitochondrial ribosome small subunit component, mediator of apoptosis DAP3 [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >KOG4308 consensus LRR-containing protein [Function unknown] | Back alignment and domain information |
|---|
| >cd02023 UMPK Uridine monophosphate kinase (UMPK, EC 2 | Back alignment and domain information |
|---|
| >KOG0739 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF00437 T2SE: Type II/IV secretion system protein; InterPro: IPR001482 A number of bacterial proteins, some of which are involved in a general secretion pathway (GSP) for the export of proteins (also called the type II pathway) belong to this group [, ] | Back alignment and domain information |
|---|
| >COG0488 Uup ATPase components of ABC transporters with duplicated ATPase domains [General function prediction only] | Back alignment and domain information |
|---|
| >PRK10923 glnG nitrogen regulation protein NR(I); Provisional | Back alignment and domain information |
|---|
| >cd00464 SK Shikimate kinase (SK) is the fifth enzyme in the shikimate pathway, a seven-step biosynthetic pathway which converts erythrose-4-phosphate to chorismic acid, found in bacteria, fungi and plants | Back alignment and domain information |
|---|
| >TIGR03877 thermo_KaiC_1 KaiC domain protein, Ph0284 family | Back alignment and domain information |
|---|
| >PRK05439 pantothenate kinase; Provisional | Back alignment and domain information |
|---|
| >cd02020 CMPK Cytidine monophosphate kinase (CMPK) catalyzes the reversible phosphorylation of cytidine monophosphate (CMP) to produce cytidine diphosphate (CDP), using ATP as the preferred phosphoryl donor | Back alignment and domain information |
|---|
| >PF03205 MobB: Molybdopterin guanine dinucleotide synthesis protein B; PDB: 2F1R_B 1P9N_A 1NP6_B 2NPI_A 1XJC_A | Back alignment and domain information |
|---|
| >COG1936 Predicted nucleotide kinase (related to CMP and AMP kinases) [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR02782 TrbB_P P-type conjugative transfer ATPase TrbB | Back alignment and domain information |
|---|
| >TIGR02322 phosphon_PhnN phosphonate metabolism protein/1,5-bisphosphokinase (PRPP-forming) PhnN | Back alignment and domain information |
|---|
| >PF10236 DAP3: Mitochondrial ribosomal death-associated protein 3; InterPro: IPR019368 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms | Back alignment and domain information |
|---|
| >COG0396 sufC Cysteine desulfurase activator ATPase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >cd02021 GntK Gluconate kinase (GntK) catalyzes the phosphoryl transfer from ATP to gluconate | Back alignment and domain information |
|---|
| >PRK13948 shikimate kinase; Provisional | Back alignment and domain information |
|---|
| >COG1703 ArgK Putative periplasmic protein kinase ArgK and related GTPases of G3E family [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PRK13765 ATP-dependent protease Lon; Provisional | Back alignment and domain information |
|---|
| >PRK13946 shikimate kinase; Provisional | Back alignment and domain information |
|---|
| >KOG1532 consensus GTPase XAB1, interacts with DNA repair protein XPA [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >TIGR02524 dot_icm_DotB Dot/Icm secretion system ATPase DotB | Back alignment and domain information |
|---|
| >KOG0736 consensus Peroxisome assembly factor 2 containing the AAA+-type ATPase domain [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF03969 AFG1_ATPase: AFG1-like ATPase; InterPro: IPR005654 ATPase family gene 1 (AFG1) ATPase is a 377 amino acid putative protein with an ATPase motif typical of the protein family including SEC18p PAS1, CDC48-VCP and TBP | Back alignment and domain information |
|---|
| >cd00071 GMPK Guanosine monophosphate kinase (GMPK, EC 2 | Back alignment and domain information |
|---|
| >PRK10751 molybdopterin-guanine dinucleotide biosynthesis protein B; Provisional | Back alignment and domain information |
|---|
| >TIGR00455 apsK adenylylsulfate kinase (apsK) | Back alignment and domain information |
|---|
| >TIGR03878 thermo_KaiC_2 KaiC domain protein, AF_0795 family | Back alignment and domain information |
|---|
| >PRK07132 DNA polymerase III subunit delta'; Validated | Back alignment and domain information |
|---|
| >PF06068 TIP49: TIP49 C-terminus; InterPro: IPR010339 This family consists of the C-terminal region of several eukaryotic and archaeal RuvB-like 1 (Pontin or TIP49a) and RuvB-like 2 (Reptin or TIP49b) proteins | Back alignment and domain information |
|---|
| >COG0003 ArsA Predicted ATPase involved in chromosome partitioning [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >PRK14723 flhF flagellar biosynthesis regulator FlhF; Provisional | Back alignment and domain information |
|---|
| >PF13481 AAA_25: AAA domain; PDB: 1G8Y_J 1OLO_A 1NLF_C | Back alignment and domain information |
|---|
| >COG0465 HflB ATP-dependent Zn proteases [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK13975 thymidylate kinase; Provisional | Back alignment and domain information |
|---|
| >PRK05057 aroK shikimate kinase I; Reviewed | Back alignment and domain information |
|---|
| >COG1102 Cmk Cytidylate kinase [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR00176 mobB molybdopterin-guanine dinucleotide biosynthesis protein MobB | Back alignment and domain information |
|---|
| >PRK14530 adenylate kinase; Provisional | Back alignment and domain information |
|---|
| >COG1136 SalX ABC-type antimicrobial peptide transport system, ATPase component [Defense mechanisms] | Back alignment and domain information |
|---|
| >PHA02244 ATPase-like protein | Back alignment and domain information |
|---|
| >cd03217 ABC_FeS_Assembly ABC-type transport system involved in Fe-S cluster assembly, ATPase component | Back alignment and domain information |
|---|
| >PRK12339 2-phosphoglycerate kinase; Provisional | Back alignment and domain information |
|---|
| >KOG0726 consensus 26S proteasome regulatory complex, ATPase RPT2 [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK05986 cob(I)alamin adenolsyltransferase/cobinamide ATP-dependent adenolsyltransferase; Validated | Back alignment and domain information |
|---|
| >PF08423 Rad51: Rad51; InterPro: IPR013632 This domain is found at the C terminus of the DNA repair and recombination protein Rad51 | Back alignment and domain information |
|---|
| >PLN02674 adenylate kinase | Back alignment and domain information |
|---|
| >PRK09435 membrane ATPase/protein kinase; Provisional | Back alignment and domain information |
|---|
| >cd01124 KaiC KaiC is a circadian clock protein primarily found in cyanobacteria KaiC is a RecA-like ATPase, having both Walker A and Walker B motifs | Back alignment and domain information |
|---|
| >PRK05800 cobU adenosylcobinamide kinase/adenosylcobinamide-phosphate guanylyltransferase; Validated | Back alignment and domain information |
|---|
| >PRK12678 transcription termination factor Rho; Provisional | Back alignment and domain information |
|---|
| >CHL00206 ycf2 Ycf2; Provisional | Back alignment and domain information |
|---|
| >PLN02318 phosphoribulokinase/uridine kinase | Back alignment and domain information |
|---|
| >PF01078 Mg_chelatase: Magnesium chelatase, subunit ChlI; InterPro: IPR000523 Magnesium-chelatase is a three-component enzyme that catalyses the insertion of Mg2+ into protoporphyrin IX | Back alignment and domain information |
|---|
| >COG1224 TIP49 DNA helicase TIP49, TBP-interacting protein [Transcription] | Back alignment and domain information |
|---|
| >cd03243 ABC_MutS_homologs The MutS protein initiates DNA mismatch repair by recognizing mispaired and unpaired bases embedded in duplex DNA and activating endo- and exonucleases to remove the mismatch | Back alignment and domain information |
|---|
| >KOG0738 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >TIGR00764 lon_rel lon-related putative ATP-dependent protease | Back alignment and domain information |
|---|
| >PLN02459 probable adenylate kinase | Back alignment and domain information |
|---|
| >COG2274 SunT ABC-type bacteriocin/lantibiotic exporters, contain an N-terminal double-glycine peptidase domain [Defense mechanisms] | Back alignment and domain information |
|---|
| >COG2401 ABC-type ATPase fused to a predicted acetyltransferase domain [General function prediction only] | Back alignment and domain information |
|---|
| >PRK05973 replicative DNA helicase; Provisional | Back alignment and domain information |
|---|
| >KOG0927 consensus Predicted transporter (ABC superfamily) [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR03263 guanyl_kin guanylate kinase | Back alignment and domain information |
|---|
| >COG0529 CysC Adenylylsulfate kinase and related kinases [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A | Back alignment and domain information |
|---|
| >PF00158 Sigma54_activat: Sigma-54 interaction domain; InterPro: IPR002078 Some bacterial regulatory proteins activate the expression of genes from promoters recognised by core RNA polymerase associated with the alternative sigma-54 factor | Back alignment and domain information |
|---|
| >COG2842 Uncharacterized ATPase, putative transposase [General function prediction only] | Back alignment and domain information |
|---|
| >cd03213 ABCG_EPDR ABCG transporters are involved in eye pigment (EP) precursor transport, regulation of lipid-trafficking mechanisms, and pleiotropic drug resistance (DR) | Back alignment and domain information |
|---|
| >PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A | Back alignment and domain information |
|---|
| >smart00534 MUTSac ATPase domain of DNA mismatch repair MUTS family | Back alignment and domain information |
|---|
| >PRK05342 clpX ATP-dependent protease ATP-binding subunit ClpX; Provisional | Back alignment and domain information |
|---|
| >PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D | Back alignment and domain information |
|---|
| >PRK14493 putative bifunctional molybdopterin-guanine dinucleotide biosynthesis protein MobB/MoaE; Provisional | Back alignment and domain information |
|---|
| >PRK03731 aroL shikimate kinase II; Reviewed | Back alignment and domain information |
|---|
| >TIGR00554 panK_bact pantothenate kinase, bacterial type | Back alignment and domain information |
|---|
| >TIGR01313 therm_gnt_kin carbohydrate kinase, thermoresistant glucokinase family | Back alignment and domain information |
|---|
| >PF00625 Guanylate_kin: Guanylate kinase; InterPro: IPR008144 Guanylate kinase (2 | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST
Original result of BLAST against Protein Data Bank
| ID | Alignment Graph | Length |
Definition |
E-value | |
| Query | 1223 | ||||
| 3jrn_A | 176 | Crystal Structure Of Tir Domain From Arabidopsis Th | 4e-33 | ||
| 3ozi_A | 204 | Crystal Structure Of The Tir Domain From The Flax D | 2e-30 | ||
| 4fcg_A | 328 | Structure Of The Leucine-Rich Repeat Domain Of The | 2e-15 | ||
| 1p8t_A | 285 | Crystal Structure Of Nogo-66 Receptor Length = 285 | 2e-05 | ||
| 1ozn_A | 285 | 1.5a Crystal Structure Of The Nogo Receptor Ligand | 2e-05 | ||
| 3kj4_A | 286 | Structure Of Rat Nogo Receptor Bound To 1d9 Antagon | 2e-05 | ||
| 1xwd_C | 252 | Crystal Structure Of Human Follicle Stimulating Hor | 9e-05 | ||
| 2z63_A | 570 | Crystal Structure Of The Tv8 Hybrid Of Human Tlr4 A | 1e-04 | ||
| 3riz_A | 772 | Crystal Structure Of The Plant Steroid Receptor Bri | 2e-04 | ||
| 4ay9_X | 350 | Structure Of Follicle-Stimulating Hormone In Comple | 3e-04 | ||
| 3rgx_A | 768 | Structural Insight Into Brassinosteroid Perception | 4e-04 | ||
| 1g9u_A | 454 | Crystal Structure Of Yopm-leucine Rich Effector Pro | 4e-04 | ||
| 3fxi_A | 605 | Crystal Structure Of The Human Tlr4-Human Md-2-E.Co | 7e-04 | ||
| 4g8a_A | 635 | Crystal Structure Of Human Tlr4 Polymorphic Variant | 8e-04 | ||
| 3rfj_A | 279 | Design Of A Binding Scaffold Based On Variable Lymp | 8e-04 |
| >pdb|3JRN|A Chain A, Crystal Structure Of Tir Domain From Arabidopsis Thaliana Length = 176 | Back alignment and structure |
|
| >pdb|3OZI|A Chain A, Crystal Structure Of The Tir Domain From The Flax Disease Resistance Protein L6 Length = 204 | Back alignment and structure |
| >pdb|4FCG|A Chain A, Structure Of The Leucine-Rich Repeat Domain Of The Type Iii Effector Xcv3220 (Xopl) Length = 328 | Back alignment and structure |
| >pdb|1P8T|A Chain A, Crystal Structure Of Nogo-66 Receptor Length = 285 | Back alignment and structure |
| >pdb|1OZN|A Chain A, 1.5a Crystal Structure Of The Nogo Receptor Ligand Binding Domain Reveals A Convergent Recognition Scaffold Mediating Inhibition Of Myelination Length = 285 | Back alignment and structure |
| >pdb|3KJ4|A Chain A, Structure Of Rat Nogo Receptor Bound To 1d9 Antagonist Antibody Length = 286 | Back alignment and structure |
| >pdb|1XWD|C Chain C, Crystal Structure Of Human Follicle Stimulating Hormone Complexed With Its Receptor Length = 252 | Back alignment and structure |
| >pdb|2Z63|A Chain A, Crystal Structure Of The Tv8 Hybrid Of Human Tlr4 And Hagfish Vlrb.61 Length = 570 | Back alignment and structure |
| >pdb|3RIZ|A Chain A, Crystal Structure Of The Plant Steroid Receptor Bri1 Ectodomain Length = 772 | Back alignment and structure |
| >pdb|4AY9|X Chain X, Structure Of Follicle-Stimulating Hormone In Complex With The Entire Ectodomain Of Its Receptor Length = 350 | Back alignment and structure |
| >pdb|3RGX|A Chain A, Structural Insight Into Brassinosteroid Perception By Bri1 Length = 768 | Back alignment and structure |
| >pdb|1G9U|A Chain A, Crystal Structure Of Yopm-leucine Rich Effector Protein From Yersinia Pestis Length = 454 | Back alignment and structure |
| >pdb|3FXI|A Chain A, Crystal Structure Of The Human Tlr4-Human Md-2-E.Coli Lps Ra Complex Length = 605 | Back alignment and structure |
| >pdb|4G8A|A Chain A, Crystal Structure Of Human Tlr4 Polymorphic Variant D299g And T399i In Complex With Md-2 And Lps Length = 635 | Back alignment and structure |
| >pdb|3RFJ|A Chain A, Design Of A Binding Scaffold Based On Variable Lymphocyte Receptors Of Jawless Vertebrates By Module Engineering Length = 279 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST
Original result of RPS-BLAST against PDB70 database
| >3ozi_A L6TR; plant TIR domain, plant protein; 2.30A {Linum usitatissimum} Length = 204 | Back alignment and structure |
|---|
Score = 308 bits (791), Expect = 1e-97
Identities = 72/183 (39%), Positives = 107/183 (58%), Gaps = 4/183 (2%)
Query: 54 AASSSCLAAQCKYDVFVSFRGEDTRDNFTSHLVAALCRKKIKTFID-EQLDRGDDISPAL 112
+ + S +Y+VF+SFRG DTR+ FT L +L R KI TF D ++L +G +I P L
Sbjct: 24 STNPSGSFPSVEYEVFLSFRGPDTREQFTDFLYQSLRRYKIHTFRDDDELLKGKEIGPNL 83
Query: 113 LDAIERSKISVIIFSENYASSKWCLDELVKILEC-KNKNAQMVVPVFYHVDPSDVRKQTG 171
L AI++SKI V I S YA SKWCL EL +I+ + ++++P+FY VDPSDVR QTG
Sbjct: 84 LRAIDQSKIYVPIISSGYADSKWCLMELAEIVRRQEEDPRRIILPIFYMVDPSDVRHQTG 143
Query: 172 SFGDAFVKHEKQFKGIPEKVQKWRVVLTEASNLSGWDSMNIRPEAKLVDEIIEDILKKLK 231
+ AF KH +F + +Q W+ L + +L GW + + D++ DI +
Sbjct: 144 CYKKAFRKHANKFD--GQTIQNWKDALKKVGDLKGWHIGKNDKQGAIADKVSADIWSHIS 201
Query: 232 DKS 234
++
Sbjct: 202 KEN 204
|
| >3jrn_A AT1G72930 protein; TIR domain arabidopsis thaliana, plant protein; 2.00A {Arabidopsis thaliana} Length = 176 | Back alignment and structure |
|---|
| >3h16_A TIR protein; bacteria TIR domain, signaling protein; 2.50A {Paracoccus denitrificans PD1222} Length = 154 | Back alignment and structure |
|---|
| >4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 | Back alignment and structure |
|---|
| >4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 | Back alignment and structure |
|---|
| >4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 | Back alignment and structure |
|---|
| >4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 | Back alignment and structure |
|---|
| >4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 | Back alignment and structure |
|---|
| >4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 | Back alignment and structure |
|---|
| >4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 | Back alignment and structure |
|---|
| >1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 | Back alignment and structure |
|---|
| >1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 | Back alignment and structure |
|---|
| >1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 | Back alignment and structure |
|---|
| >2a5y_B CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis elegans} SCOP: a.4.5.80 a.77.1.3 c.37.1.20 PDB: 3lqq_A* 3lqr_A* Length = 549 | Back alignment and structure |
|---|
| >1z6t_A APAF-1, apoptotic protease activating factor 1; caspase activation, ADP, nucleotide binding, CARD, apoptosis; HET: ADP; 2.21A {Homo sapiens} Length = 591 | Back alignment and structure |
|---|
| >4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 | Back alignment and structure |
|---|
| >4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 | Back alignment and structure |
|---|
| >4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 | Back alignment and structure |
|---|
| >4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 | Back alignment and structure |
|---|
| >4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 | Back alignment and structure |
|---|
| >4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 | Back alignment and structure |
|---|
| >4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 | Back alignment and structure |
|---|
| >4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 | Back alignment and structure |
|---|
| >4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 | Back alignment and structure |
|---|
| >4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 | Back alignment and structure |
|---|
| >4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 | Back alignment and structure |
|---|
| >4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 | Back alignment and structure |
|---|
| >4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 | Back alignment and structure |
|---|
| >3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 | Back alignment and structure |
|---|
| >3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 | Back alignment and structure |
|---|
| >3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 | Back alignment and structure |
|---|
| >1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 | Back alignment and structure |
|---|
| >1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 | Back alignment and structure |
|---|
| >1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 | Back alignment and structure |
|---|
| >1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 | Back alignment and structure |
|---|
| >1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 | Back alignment and structure |
|---|
| >1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 | Back alignment and structure |
|---|
| >3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 | Back alignment and structure |
|---|
| >3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 | Back alignment and structure |
|---|
| >3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 | Back alignment and structure |
|---|
| >3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* Length = 1249 | Back alignment and structure |
|---|
| >3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 | Back alignment and structure |
|---|
| >3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 | Back alignment and structure |
|---|
| >3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 | Back alignment and structure |
|---|
| >3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 | Back alignment and structure |
|---|
| >3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 | Back alignment and structure |
|---|
| >3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 | Back alignment and structure |
|---|
| >3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 | Back alignment and structure |
|---|
| >3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 | Back alignment and structure |
|---|
| >3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 | Back alignment and structure |
|---|
| >3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 | Back alignment and structure |
|---|
| >3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 | Back alignment and structure |
|---|
| >3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 | Back alignment and structure |
|---|
| >3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 | Back alignment and structure |
|---|
| >3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 | Back alignment and structure |
|---|
| >3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 | Back alignment and structure |
|---|
| >3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 | Back alignment and structure |
|---|
| >3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 | Back alignment and structure |
|---|
| >3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 | Back alignment and structure |
|---|
| >3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 | Back alignment and structure |
|---|
| >3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 | Back alignment and structure |
|---|
| >3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 | Back alignment and structure |
|---|
| >3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 | Back alignment and structure |
|---|
| >3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 | Back alignment and structure |
|---|
| >3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 | Back alignment and structure |
|---|
| >3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 | Back alignment and structure |
|---|
| >3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 | Back alignment and structure |
|---|
| >3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 | Back alignment and structure |
|---|
| >3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 | Back alignment and structure |
|---|
| >3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 | Back alignment and structure |
|---|
| >3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 | Back alignment and structure |
|---|
| >3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 | Back alignment and structure |
|---|
| >3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 | Back alignment and structure |
|---|
| >3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 | Back alignment and structure |
|---|
| >1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 | Back alignment and structure |
|---|
| >1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 | Back alignment and structure |
|---|
| >1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 | Back alignment and structure |
|---|
| >1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 | Back alignment and structure |
|---|
| >1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 | Back alignment and structure |
|---|
| >2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 | Back alignment and structure |
|---|
| >2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 | Back alignment and structure |
|---|
| >2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 | Back alignment and structure |
|---|
| >2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 | Back alignment and structure |
|---|
| >2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 | Back alignment and structure |
|---|
| >3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 | Back alignment and structure |
|---|
| >3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 | Back alignment and structure |
|---|
| >3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 | Back alignment and structure |
|---|
| >3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 | Back alignment and structure |
|---|
| >2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 | Back alignment and structure |
|---|
| >2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 | Back alignment and structure |
|---|
| >2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 | Back alignment and structure |
|---|
| >2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 | Back alignment and structure |
|---|
| >3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 | Back alignment and structure |
|---|
| >3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 | Back alignment and structure |
|---|
| >3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 | Back alignment and structure |
|---|
| >1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 | Back alignment and structure |
|---|
| >1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 | Back alignment and structure |
|---|
| >1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 | Back alignment and structure |
|---|
| >3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 | Back alignment and structure |
|---|
| >3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 | Back alignment and structure |
|---|
| >3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 | Back alignment and structure |
|---|
| >2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 | Back alignment and structure |
|---|
| >2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 | Back alignment and structure |
|---|
| >2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 | Back alignment and structure |
|---|
| >1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 | Back alignment and structure |
|---|
| >1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 | Back alignment and structure |
|---|
| >2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 | Back alignment and structure |
|---|
| >2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 | Back alignment and structure |
|---|
| >2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 | Back alignment and structure |
|---|
| >2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 | Back alignment and structure |
|---|
| >1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 | Back alignment and structure |
|---|
| >1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 | Back alignment and structure |
|---|
| >1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 | Back alignment and structure |
|---|
| >3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 | Back alignment and structure |
|---|
| >3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 | Back alignment and structure |
|---|
| >3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 | Back alignment and structure |
|---|
| >4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 | Back alignment and structure |
|---|
| >4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 | Back alignment and structure |
|---|
| >4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 | Back alignment and structure |
|---|
| >1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 | Back alignment and structure |
|---|
| >1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 | Back alignment and structure |
|---|
| >1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 | Back alignment and structure |
|---|
| >1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 | Back alignment and structure |
|---|
| >1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 | Back alignment and structure |
|---|
| >2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 | Back alignment and structure |
|---|
| >2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 | Back alignment and structure |
|---|
| >2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 | Back alignment and structure |
|---|
| >2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 | Back alignment and structure |
|---|
| >1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 | Back alignment and structure |
|---|
| >1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 | Back alignment and structure |
|---|
| >1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 | Back alignment and structure |
|---|
| >2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 | Back alignment and structure |
|---|
| >2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 | Back alignment and structure |
|---|
| >2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 | Back alignment and structure |
|---|
| >2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 | Back alignment and structure |
|---|
| >2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 | Back alignment and structure |
|---|
| >2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 | Back alignment and structure |
|---|
| >2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 | Back alignment and structure |
|---|
| >2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 | Back alignment and structure |
|---|
| >3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 | Back alignment and structure |
|---|
| >3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 | Back alignment and structure |
|---|
| >3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 | Back alignment and structure |
|---|
| >3ub2_A TOLL/interleukin-1 receptor domain-containing ADA protein; TIR domain, TLRS adaptor, immune system; 2.40A {Homo sapiens} PDB: 3ub3_A 3ub4_A 2y92_A Length = 146 | Back alignment and structure |
|---|
| >2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 | Back alignment and structure |
|---|
| >2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 | Back alignment and structure |
|---|
| >2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 | Back alignment and structure |
|---|
| >2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 | Back alignment and structure |
|---|
| >2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 | Back alignment and structure |
|---|
| >1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 | Back alignment and structure |
|---|
| >1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 | Back alignment and structure |
|---|
| >1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 | Back alignment and structure |
|---|
| >1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 | Back alignment and structure |
|---|
| >4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 | Back alignment and structure |
|---|
| >4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 | Back alignment and structure |
|---|
| >4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 | Back alignment and structure |
|---|
| >4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 | Back alignment and structure |
|---|
| >2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 | Back alignment and structure |
|---|
| >1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 | Back alignment and structure |
|---|
| >1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 | Back alignment and structure |
|---|
| >1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 | Back alignment and structure |
|---|
| >1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 | Back alignment and structure |
|---|
| >1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 | Back alignment and structure |
|---|
| >1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 | Back alignment and structure |
|---|
| >1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 | Back alignment and structure |
|---|
| >1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 | Back alignment and structure |
|---|
| >3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 | Back alignment and structure |
|---|
| >3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 | Back alignment and structure |
|---|
| >3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 | Back alignment and structure |
|---|
| >3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 | Back alignment and structure |
|---|
| >3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 | Back alignment and structure |
|---|
| >2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336 | Back alignment and structure |
|---|
| >2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 | Back alignment and structure |
|---|
| >2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 | Back alignment and structure |
|---|
| >2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362 | Back alignment and structure |
|---|
| >2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 | Back alignment and structure |
|---|
| >1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 | Back alignment and structure |
|---|
| >1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 | Back alignment and structure |
|---|
| >2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 | Back alignment and structure |
|---|
| >2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 | Back alignment and structure |
|---|
| >2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 | Back alignment and structure |
|---|
| >2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 | Back alignment and structure |
|---|
| >2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 | Back alignment and structure |
|---|
| >2j67_A TOLL like receptor 10; TIR, IL-1, TLR10, membrane, innate immunity, immune response, leucine-rich repeat, glycoprotein, transmembrane; 2.20A {Homo sapiens} PDB: 1fyv_A Length = 178 | Back alignment and structure |
|---|
| >1t3g_A X-linked interleukin-1 receptor accessory protein-like 1; TIR, IL-1RAPL, IL-1R, TLR, membrane protein; 2.30A {Homo sapiens} Length = 159 | Back alignment and structure |
|---|
| >1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 | Back alignment and structure |
|---|
| >1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 | Back alignment and structure |
|---|
| >1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 | Back alignment and structure |
|---|
| >2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 | Back alignment and structure |
|---|
| >1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 | Back alignment and structure |
|---|
| >1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 | Back alignment and structure |
|---|
| >1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 | Back alignment and structure |
|---|
| >1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 | Back alignment and structure |
|---|
| >2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 | Back alignment and structure |
|---|
| >2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 | Back alignment and structure |
|---|
| >2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 | Back alignment and structure |
|---|
| >2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 | Back alignment and structure |
|---|
| >2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 | Back alignment and structure |
|---|
| >2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 | Back alignment and structure |
|---|
| >2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 | Back alignment and structure |
|---|
| >2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 | Back alignment and structure |
|---|
| >2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 | Back alignment and structure |
|---|
| >2js7_A Myeloid differentiation primary response protein MYD88; MYD88_human, TIR domain, TOLL like receptor adaptor domain, innate immune signaling; NMR {Homo sapiens} PDB: 2z5v_A Length = 160 | Back alignment and structure |
|---|
| >3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 | Back alignment and structure |
|---|
| >2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 | Back alignment and structure |
|---|
| >1fyx_A TOLL-like receptor 2; beta-alpha-beta fold, signaling protein; 2.80A {Homo sapiens} SCOP: c.23.2.1 PDB: 1fyw_A 1o77_A Length = 149 | Back alignment and structure |
|---|
| >3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 | Back alignment and structure |
|---|
| >3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Length = 176 | Back alignment and structure |
|---|
| >3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 | Back alignment and structure |
|---|
| >2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch
Original result of HHsearch against PDB70 database
No hit with probability above 80.00
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST
Original result of RPS-BLAST against SCOP70(version1.75) database
| ID | Alignment Graph | Length |
Definition |
E-value |
| 1223 | ||||
| d2a5yb3 | 277 | c.37.1.20 (B:109-385) CED-4, NB-ARC domain {Caenor | 1e-35 | |
| d1fyva_ | 161 | c.23.2.1 (A:) Toll-like receptor 1, TLR1 {Human (H | 1e-19 | |
| d1fyxa_ | 149 | c.23.2.1 (A:) Toll-like receptor 2, TLR2 {Human (H | 7e-18 | |
| d1xkua_ | 305 | c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 | 1e-17 | |
| d1xkua_ | 305 | c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 | 7e-13 | |
| d2omza2 | 384 | c.10.2.1 (A:33-416) Internalin A {Listeria monocyt | 5e-12 | |
| d2omza2 | 384 | c.10.2.1 (A:33-416) Internalin A {Listeria monocyt | 1e-10 | |
| d2omza2 | 384 | c.10.2.1 (A:33-416) Internalin A {Listeria monocyt | 1e-04 | |
| d1jl5a_ | 353 | c.10.2.6 (A:) Leucine rich effector protein YopM { | 1e-10 | |
| d1jl5a_ | 353 | c.10.2.6 (A:) Leucine rich effector protein YopM { | 2e-09 | |
| d1jl5a_ | 353 | c.10.2.6 (A:) Leucine rich effector protein YopM { | 6e-09 | |
| d1jl5a_ | 353 | c.10.2.6 (A:) Leucine rich effector protein YopM { | 1e-06 | |
| d1jl5a_ | 353 | c.10.2.6 (A:) Leucine rich effector protein YopM { | 4e-06 | |
| d1jl5a_ | 353 | c.10.2.6 (A:) Leucine rich effector protein YopM { | 5e-06 | |
| d1jl5a_ | 353 | c.10.2.6 (A:) Leucine rich effector protein YopM { | 7e-05 | |
| d1jl5a_ | 353 | c.10.2.6 (A:) Leucine rich effector protein YopM { | 4e-04 | |
| d1jl5a_ | 353 | c.10.2.6 (A:) Leucine rich effector protein YopM { | 0.004 | |
| d1p9ag_ | 266 | c.10.2.7 (G:) von Willebrand factor binding domain | 4e-09 | |
| d2astb2 | 284 | c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 | 4e-08 | |
| d2astb2 | 284 | c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 | 6e-07 | |
| d2astb2 | 284 | c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 | 2e-05 | |
| d2astb2 | 284 | c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 | 8e-04 | |
| d1ogqa_ | 313 | c.10.2.8 (A:) Polygalacturonase inhibiting protein | 4e-07 | |
| d1ozna_ | 284 | c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept | 6e-06 | |
| d1ozna_ | 284 | c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept | 0.002 | |
| d1dcea3 | 124 | c.10.2.2 (A:444-567) Rab geranylgeranyltransferase | 2e-05 | |
| d1dcea3 | 124 | c.10.2.2 (A:444-567) Rab geranylgeranyltransferase | 0.001 | |
| d1dcea3 | 124 | c.10.2.2 (A:444-567) Rab geranylgeranyltransferase | 0.003 | |
| d1a9na_ | 162 | c.10.2.4 (A:) Splicesomal U2A' protein {Human (Hom | 4e-05 | |
| d1a9na_ | 162 | c.10.2.4 (A:) Splicesomal U2A' protein {Human (Hom | 0.003 | |
| d1h6ua2 | 227 | c.10.2.1 (A:36-262) Internalin H {Listeria monocyt | 1e-04 | |
| d1h6ua2 | 227 | c.10.2.1 (A:36-262) Internalin H {Listeria monocyt | 1e-04 | |
| d2ca6a1 | 344 | c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom | 1e-04 | |
| d2ca6a1 | 344 | c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom | 6e-04 | |
| d2ca6a1 | 344 | c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom | 0.001 | |
| d2ca6a1 | 344 | c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom | 0.002 | |
| d1z7xw1 | 460 | c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( | 3e-04 | |
| d1z7xw1 | 460 | c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( | 0.003 | |
| d1h6ta2 | 210 | c.10.2.1 (A:31-240) Internalin B {Listeria monocyt | 0.003 | |
| d1m9la_ | 198 | c.10.3.1 (A:) Outer arm dynein light chain 1 {Gree | 0.003 |
| >d2a5yb3 c.37.1.20 (B:109-385) CED-4, NB-ARC domain {Caenorhabditis elegans [TaxId: 6239]} Length = 277 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: P-loop containing nucleoside triphosphate hydrolases superfamily: P-loop containing nucleoside triphosphate hydrolases family: Extended AAA-ATPase domain domain: CED-4, NB-ARC domain species: Caenorhabditis elegans [TaxId: 6239]
Score = 134 bits (339), Expect = 1e-35
Identities = 37/249 (14%), Positives = 81/249 (32%), Gaps = 19/249 (7%)
Query: 252 IKSLLCVGLPDFQIIGIWGMGGIGKTTIAGAIFNQ----ISNDFEGRCFMANVREESERG 307
IK L + D + + G G GK+ IA ++ I +++ ++ + +
Sbjct: 33 IKKLDEMCDLDSFFLFLHGRAGSGKSVIASQALSKSDQLIGINYDSIVWLKDSGTAPKST 92
Query: 308 GLVYLRERLYSEILEETLKIRTPSVP-------KCIKERLQQMKVFVVLDDVNKPEQLDY 360
++ L + ++ L + + + V DDV + E + +
Sbjct: 93 FDLFTDILLMLKSEDDLLNFPSVEHVTSVVLKRMICNALIDRPNTLFVFDDVVQEETIRW 152
Query: 361 LAGGLDRFGLGSRVVVTSRDRQVFDKCRVD-KIYEVEGLNQNEALEHFSNYAFRQNICPK 419
R +VT+RD ++ + + EV L +E + Y +
Sbjct: 153 AQEL------RLRCLVTTRDVEISNAASQTCEFIEVTSLEIDECYDFLEAYGMPMP-VGE 205
Query: 420 DFLVLSERIVFYANGNPLALKVLGSFLQRKCKLQWENALKNLTRISDPDIYDMLKISYNE 479
+ + + ++GNP L + + K + L + + SY
Sbjct: 206 KEEDVLNKTIELSSGNPATLMMFFKSCEPKTFEKMAQLNNKLESRGLVGVECITPYSYKS 265
Query: 480 LKQEEKSIF 488
L +
Sbjct: 266 LAMALQRCV 274
|
| >d1fyva_ c.23.2.1 (A:) Toll-like receptor 1, TLR1 {Human (Homo sapiens) [TaxId: 9606]} Length = 161 | Back information, alignment and structure |
|---|
| >d1fyxa_ c.23.2.1 (A:) Toll-like receptor 2, TLR2 {Human (Homo sapiens) [TaxId: 9606]} Length = 149 | Back information, alignment and structure |
|---|
| >d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 | Back information, alignment and structure |
|---|
| >d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 | Back information, alignment and structure |
|---|
| >d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 | Back information, alignment and structure |
|---|
| >d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 | Back information, alignment and structure |
|---|
| >d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 | Back information, alignment and structure |
|---|
| >d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 | Back information, alignment and structure |
|---|
| >d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 | Back information, alignment and structure |
|---|
| >d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 | Back information, alignment and structure |
|---|
| >d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 | Back information, alignment and structure |
|---|
| >d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 | Back information, alignment and structure |
|---|
| >d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 | Back information, alignment and structure |
|---|
| >d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 | Back information, alignment and structure |
|---|
| >d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 | Back information, alignment and structure |
|---|
| >d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 | Back information, alignment and structure |
|---|
| >d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 | Back information, alignment and structure |
|---|
| >d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 | Back information, alignment and structure |
|---|
| >d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 | Back information, alignment and structure |
|---|
| >d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 | Back information, alignment and structure |
|---|
| >d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 | Back information, alignment and structure |
|---|
| >d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 | Back information, alignment and structure |
|---|
| >d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 | Back information, alignment and structure |
|---|
| >d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 | Back information, alignment and structure |
|---|
| >d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 | Back information, alignment and structure |
|---|
| >d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 | Back information, alignment and structure |
|---|
| >d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 | Back information, alignment and structure |
|---|
| >d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Length = 162 | Back information, alignment and structure |
|---|
| >d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Length = 162 | Back information, alignment and structure |
|---|
| >d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 | Back information, alignment and structure |
|---|
| >d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 | Back information, alignment and structure |
|---|
| >d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344 | Back information, alignment and structure |
|---|
| >d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344 | Back information, alignment and structure |
|---|
| >d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344 | Back information, alignment and structure |
|---|
| >d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344 | Back information, alignment and structure |
|---|
| >d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 | Back information, alignment and structure |
|---|
| >d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 | Back information, alignment and structure |
|---|
| >d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 210 | Back information, alignment and structure |
|---|
| >d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Length = 198 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch
Original result of HHsearch against SCOP70(version1.75) database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 1223 | |||
| d2a5yb3 | 277 | CED-4, NB-ARC domain {Caenorhabditis elegans [TaxI | 100.0 | |
| d2omza2 | 384 | Internalin A {Listeria monocytogenes [TaxId: 1639] | 99.96 | |
| d2omza2 | 384 | Internalin A {Listeria monocytogenes [TaxId: 1639] | 99.95 | |
| d1ogqa_ | 313 | Polygalacturonase inhibiting protein PGIP {Kidney | 99.94 | |
| d1xkua_ | 305 | Decorin {Cow (Bos taurus) [TaxId: 9913]} | 99.92 | |
| d1ogqa_ | 313 | Polygalacturonase inhibiting protein PGIP {Kidney | 99.92 | |
| d1xkua_ | 305 | Decorin {Cow (Bos taurus) [TaxId: 9913]} | 99.92 | |
| d1jl5a_ | 353 | Leucine rich effector protein YopM {Yersinia pesti | 99.9 | |
| d1jl5a_ | 353 | Leucine rich effector protein YopM {Yersinia pesti | 99.88 | |
| d1p9ag_ | 266 | von Willebrand factor binding domain of glycoprote | 99.87 | |
| d1ozna_ | 284 | Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma | 99.85 | |
| d1p9ag_ | 266 | von Willebrand factor binding domain of glycoprote | 99.83 | |
| d1ozna_ | 284 | Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma | 99.83 | |
| d1h6ua2 | 227 | Internalin H {Listeria monocytogenes [TaxId: 1639] | 99.78 | |
| d1h6ua2 | 227 | Internalin H {Listeria monocytogenes [TaxId: 1639] | 99.71 | |
| d1fyva_ | 161 | Toll-like receptor 1, TLR1 {Human (Homo sapiens) [ | 99.7 | |
| d1xwdc1 | 242 | Follicle-stimulating hormone receptor {Human (Homo | 99.69 | |
| d1h6ta2 | 210 | Internalin B {Listeria monocytogenes [TaxId: 1639] | 99.69 | |
| d2omxa2 | 199 | Internalin B {Listeria monocytogenes [TaxId: 1639] | 99.68 | |
| d1xwdc1 | 242 | Follicle-stimulating hormone receptor {Human (Homo | 99.67 | |
| d1h6ta2 | 210 | Internalin B {Listeria monocytogenes [TaxId: 1639] | 99.66 | |
| d2omxa2 | 199 | Internalin B {Listeria monocytogenes [TaxId: 1639] | 99.64 | |
| d1fyxa_ | 149 | Toll-like receptor 2, TLR2 {Human (Homo sapiens) [ | 99.61 | |
| d2astb2 | 284 | Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa | 99.56 | |
| d1z7xw1 | 460 | Ribonuclease inhibitor {Human (Homo sapiens) [TaxI | 99.56 | |
| d2astb2 | 284 | Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa | 99.54 | |
| d2fnaa2 | 283 | Archaeal ATPase SSO1545 {Sulfolobus solfataricus [ | 99.42 | |
| d1w8aa_ | 192 | Slit {Fruit fly (Drosophila melanogaster) [TaxId: | 99.41 | |
| d2ca6a1 | 344 | Rna1p (RanGAP1), N-terminal domain {Fission yeast | 99.4 | |
| d1z7xw1 | 460 | Ribonuclease inhibitor {Human (Homo sapiens) [TaxI | 99.4 | |
| d1w8aa_ | 192 | Slit {Fruit fly (Drosophila melanogaster) [TaxId: | 99.33 | |
| d1a9na_ | 162 | Splicesomal U2A' protein {Human (Homo sapiens) [Ta | 99.32 | |
| d2ca6a1 | 344 | Rna1p (RanGAP1), N-terminal domain {Fission yeast | 99.28 | |
| d1a9na_ | 162 | Splicesomal U2A' protein {Human (Homo sapiens) [Ta | 99.2 | |
| d1dcea3 | 124 | Rab geranylgeranyltransferase alpha-subunit, C-ter | 99.17 | |
| d1dcea3 | 124 | Rab geranylgeranyltransferase alpha-subunit, C-ter | 99.13 | |
| d1m9la_ | 198 | Outer arm dynein light chain 1 {Green algae (Chlam | 99.08 | |
| d1fnna2 | 276 | CDC6, N-domain {Archaeon Pyrobaculum aerophilum [T | 99.03 | |
| d1m9la_ | 198 | Outer arm dynein light chain 1 {Green algae (Chlam | 99.03 | |
| d1sxjc2 | 227 | Replication factor C3 {Baker's yeast (Saccharomyce | 98.93 | |
| d1sxjb2 | 224 | Replication factor C4 {Baker's yeast (Saccharomyce | 98.93 | |
| d1sxjd2 | 237 | Replication factor C2 {Baker's yeast (Saccharomyce | 98.91 | |
| d2ifga3 | 156 | High affinity nerve growth factor receptor, N-term | 98.86 | |
| d1w5sa2 | 287 | CDC6-like protein APE0152, N-terminal domain {Aero | 98.86 | |
| d2ifga3 | 156 | High affinity nerve growth factor receptor, N-term | 98.85 | |
| d1njfa_ | 239 | delta prime subunit of DNA polymerase III, N-domai | 98.83 | |
| d1sxje2 | 252 | Replication factor C5 {Baker's yeast (Saccharomyce | 98.83 | |
| d1r6bx2 | 268 | ClpA, an Hsp100 chaperone, AAA+ modules {Escherich | 98.81 | |
| d1iqpa2 | 231 | Replication factor C {Archaeon Pyrococcus furiosus | 98.76 | |
| d1e32a2 | 258 | Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu | 98.68 | |
| d1ixza_ | 247 | AAA domain of cell division protein FtsH {Thermus | 98.55 | |
| d1qvra2 | 387 | ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 | 98.51 | |
| d1jbka_ | 195 | ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} | 98.5 | |
| d1d2na_ | 246 | Hexamerization domain of N-ethylmalemide-sensitive | 98.47 | |
| d1sxja2 | 253 | Replication factor C1 {Baker's yeast (Saccharomyce | 98.46 | |
| d1ixsb2 | 239 | Holliday junction helicase RuvB {Thermus thermophi | 98.41 | |
| d1lv7a_ | 256 | AAA domain of cell division protein FtsH {Escheric | 98.4 | |
| d1l8qa2 | 213 | Chromosomal replication initiation factor DnaA {Aq | 98.4 | |
| d1a5ta2 | 207 | delta prime subunit of DNA polymerase III, N-domai | 98.37 | |
| d1r7ra3 | 265 | Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu | 98.34 | |
| d1in4a2 | 238 | Holliday junction helicase RuvB {Thermotoga mariti | 98.24 | |
| d1koha1 | 162 | mRNA export factor tap {Human (Homo sapiens) [TaxI | 97.49 | |
| d2gnoa2 | 198 | gamma subunit of DNA polymerase III, N-domain {The | 97.19 | |
| d1ofha_ | 309 | HslU {Haemophilus influenzae [TaxId: 727]} | 96.99 | |
| d1pgva_ | 167 | Tropomodulin C-terminal domain {nematode (Caenorha | 96.89 | |
| d1rz3a_ | 198 | Hypothetical protein rbstp0775 {Bacillus stearothe | 96.81 | |
| d1pgva_ | 167 | Tropomodulin C-terminal domain {nematode (Caenorha | 96.81 | |
| d1m8pa3 | 183 | ATP sulfurylase C-terminal domain {Fungus (Penicil | 96.77 | |
| d1qvra3 | 315 | ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 | 96.76 | |
| d1gvnb_ | 273 | Plasmid maintenance system epsilon/zeta, toxin zet | 96.73 | |
| d1ny5a2 | 247 | Transcriptional activator sigm54 (NtrC1), C-termin | 96.7 | |
| d1lw7a2 | 192 | Transcriptional regulator NadR, ribosylnicotinamid | 96.61 | |
| d2i3ba1 | 189 | Cancer-related NTPase, C1orf57 {Human (Homo sapien | 96.48 | |
| d1x6va3 | 195 | Adenosine-5'phosphosulfate kinase (APS kinase) {Hu | 96.47 | |
| d1ls1a2 | 207 | GTPase domain of the signal sequence recognition p | 96.41 | |
| d1vmaa2 | 213 | GTPase domain of the signal recognition particle r | 96.35 | |
| d2qy9a2 | 211 | GTPase domain of the signal recognition particle r | 96.34 | |
| d1kaga_ | 169 | Shikimate kinase (AroK) {Escherichia coli [TaxId: | 96.25 | |
| d1svma_ | 362 | Papillomavirus large T antigen helicase domain {Si | 96.24 | |
| d1cp2a_ | 269 | Nitrogenase iron protein {Clostridium pasteurianum | 96.15 | |
| d1np6a_ | 170 | Molybdopterin-guanine dinucleotide biosynthesis pr | 96.13 | |
| d2bdta1 | 176 | Hypothetical protein BH3686 {Bacillus halodurans [ | 96.13 | |
| d1ihua2 | 279 | Arsenite-translocating ATPase ArsA {Escherichia co | 96.12 | |
| d2qm8a1 | 323 | Metallochaperone MeaB {Methylobacterium extorquens | 96.1 | |
| d1w44a_ | 321 | NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} | 96.0 | |
| d2p67a1 | 327 | LAO/AO transport system kinase ArgK {Escherichia c | 96.0 | |
| d1rkba_ | 173 | Adenylate kinase {Human (Homo sapiens), isoenzyme | 95.98 | |
| d1khta_ | 190 | Adenylate kinase {Archaeon Methanococcus voltae [T | 95.9 | |
| d1knqa_ | 171 | Gluconate kinase {Escherichia coli [TaxId: 562]} | 95.89 | |
| d1ly1a_ | 152 | Polynucleotide kinase, kinase domain {Bacteriophag | 95.87 | |
| d2iyva1 | 165 | Shikimate kinase (AroK) {Mycobacterium tuberculosi | 95.86 | |
| d1qhxa_ | 178 | Chloramphenicol phosphotransferase {Streptomyces v | 95.83 | |
| d1tf7a2 | 242 | Circadian clock protein KaiC {Synechococcus sp. st | 95.82 | |
| d1j8yf2 | 211 | GTPase domain of the signal sequence recognition p | 95.8 | |
| d1r6bx3 | 315 | ClpA, an Hsp100 chaperone, AAA+ modules {Escherich | 95.78 | |
| d1u94a1 | 263 | RecA protein, ATPase-domain {Escherichia coli [Tax | 95.76 | |
| d1bifa1 | 213 | 6-phosphofructo-2-kinase/fructose-2,6-bisphosphata | 95.75 | |
| d1viaa_ | 161 | Shikimate kinase (AroK) {Campylobacter jejuni [Tax | 95.72 | |
| d1m7ga_ | 208 | Adenosine-5'phosphosulfate kinase (APS kinase) {Fu | 95.65 | |
| d1nksa_ | 194 | Adenylate kinase {Archaeon Sulfolobus acidocaldari | 95.62 | |
| d1okkd2 | 207 | GTPase domain of the signal recognition particle r | 95.61 | |
| d1ukza_ | 196 | Uridylate kinase {Baker's yeast (Saccharomyces cer | 95.6 | |
| d2afhe1 | 289 | Nitrogenase iron protein {Azotobacter vinelandii [ | 95.56 | |
| d1xjca_ | 165 | Molybdopterin-guanine dinucleotide biosynthesis pr | 95.54 | |
| d1sq5a_ | 308 | Pantothenate kinase PanK {Escherichia coli [TaxId: | 95.53 | |
| d1qf9a_ | 194 | UMP/CMP kinase {Dictyostelium discoideum [TaxId: 4 | 95.47 | |
| d1e6ca_ | 170 | Shikimate kinase (AroK) {Erwinia chrysanthemi [Tax | 95.43 | |
| d3b60a1 | 253 | Multidrug resistance ABC transporter MsbA, C-termi | 95.41 | |
| d1uj2a_ | 213 | Uridine-cytidine kinase 2 {Human (Homo sapiens) [T | 95.32 | |
| d1odfa_ | 286 | Hypothetical protein Ygr205W {Baker's yeast (Sacch | 95.29 | |
| d1y63a_ | 174 | Probable kinase LmjF30.1890 {Leishmania major [Tax | 95.28 | |
| d1mo6a1 | 269 | RecA protein, ATPase-domain {Mycobacterium tubercu | 95.2 | |
| d1zp6a1 | 176 | Hypothetical protein Atu3015 {Agrobacterium tumefa | 95.14 | |
| d1ye8a1 | 178 | Hypothetical kinase-like protein Aq_1292 {Aquifex | 95.11 | |
| d1ihua1 | 296 | Arsenite-translocating ATPase ArsA {Escherichia co | 95.11 | |
| d1teva_ | 194 | UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606] | 95.05 | |
| d1io0a_ | 166 | Tropomodulin C-terminal domain {Chicken (Gallus ga | 94.95 | |
| d1ckea_ | 225 | CMP kinase {Escherichia coli [TaxId: 562]} | 94.92 | |
| d1lvga_ | 190 | Guanylate kinase {Mouse (Mus musculus) [TaxId: 100 | 94.81 | |
| d1ak2a1 | 190 | Adenylate kinase {Cow (Bos taurus), mitochondrial | 94.76 | |
| d2jdid3 | 276 | Central domain of beta subunit of F1 ATP synthase | 94.73 | |
| d1g8pa_ | 333 | ATPase subunit of magnesium chelatase, BchI {Rhodo | 94.73 | |
| d1q3ta_ | 223 | CMP kinase {Streptococcus pneumoniae [TaxId: 1313] | 94.63 | |
| d1yj5a2 | 172 | 5' polynucleotide kinase-3' phosphatase, C-termina | 94.52 | |
| d1hyqa_ | 232 | Cell division regulator MinD {Archaeon Archaeoglob | 94.48 | |
| d1gkya_ | 186 | Guanylate kinase {Baker's yeast (Saccharomyces cer | 94.45 | |
| d1xp8a1 | 268 | RecA protein, ATPase-domain {Deinococcus radiodura | 94.44 | |
| d1xpua3 | 289 | Transcription termination factor Rho, ATPase domai | 94.26 | |
| d1kgda_ | 178 | Guanylate kinase-like domain of Cask {Human (Homo | 94.21 | |
| d1v5wa_ | 258 | Meiotic recombination protein DMC1/LIM15 homolog { | 94.2 | |
| d1g3qa_ | 237 | Cell division regulator MinD {Archaeon Pyrococcus | 93.89 | |
| d1zaka1 | 189 | Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} | 93.81 | |
| d1pzna2 | 254 | DNA repair protein Rad51, catalytic domain {Archae | 93.79 | |
| d1akya1 | 180 | Adenylate kinase {Baker's yeast (Saccharomyces cer | 93.77 | |
| d1zina1 | 182 | Adenylate kinase {Bacillus stearothermophilus [Tax | 93.73 | |
| d2cdna1 | 181 | Adenylate kinase {Mycobacterium tuberculosis [TaxI | 93.67 | |
| d2hyda1 | 255 | Putative multidrug export ATP-binding/permease pro | 93.66 | |
| d2ak3a1 | 189 | Adenylate kinase {Cow (Bos taurus), mitochondrial | 93.52 | |
| d1uf9a_ | 191 | Dephospho-CoA kinase {Thermus thermophilus [TaxId: | 93.5 | |
| d1um8a_ | 364 | ClpX {Helicobacter pylori [TaxId: 210]} | 93.44 | |
| d1nn5a_ | 209 | Thymidylate kinase {Human (Homo sapiens) [TaxId: 9 | 93.36 | |
| d1znwa1 | 182 | Guanylate kinase {Mycobacterium tuberculosis [TaxI | 93.35 | |
| d3adka_ | 194 | Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} | 93.32 | |
| d1s3ga1 | 182 | Adenylate kinase {Bacillus globisporus [TaxId: 145 | 93.23 | |
| d1a7ja_ | 288 | Phosphoribulokinase {Rhodobacter sphaeroides [TaxI | 93.2 | |
| d2ocpa1 | 241 | Deoxyguanosine kinase {Human (Homo sapiens) [TaxId | 93.02 | |
| d1yrba1 | 244 | ATP(GTP)-binding protein PAB0955 {Pyrococcus abyss | 92.83 | |
| d1gsia_ | 208 | Thymidylate kinase {Mycobacterium tuberculosis [Ta | 92.81 | |
| d2i1qa2 | 258 | DNA repair protein Rad51, catalytic domain {Archae | 92.68 | |
| d1g41a_ | 443 | HslU {Haemophilus influenzae [TaxId: 727]} | 92.63 | |
| d1n0wa_ | 242 | DNA repair protein Rad51, catalytic domain {Human | 92.53 | |
| d1e4va1 | 179 | Adenylate kinase {Escherichia coli [TaxId: 562]} | 92.44 | |
| d1p9ra_ | 401 | Extracellular secretion NTPase EpsE {Vibrio choler | 92.38 | |
| d1tf7a1 | 242 | Circadian clock protein KaiC {Synechococcus sp. st | 91.92 | |
| d1s96a_ | 205 | Guanylate kinase {Escherichia coli [TaxId: 562]} | 91.91 | |
| d2vp4a1 | 197 | Deoxyribonucleoside kinase {Fruit fly (Drosophila | 91.79 | |
| d1szpa2 | 251 | DNA repair protein Rad51, catalytic domain {Baker' | 91.73 | |
| d1fx0a3 | 276 | Central domain of alpha subunit of F1 ATP synthase | 91.62 | |
| d1w36d1 | 359 | Exodeoxyribonuclease V alpha chain (RecD) {Escheri | 91.57 | |
| d1byia_ | 224 | Dethiobiotin synthetase {Escherichia coli [TaxId: | 91.56 | |
| d1vhta_ | 208 | Dephospho-CoA kinase {Escherichia coli [TaxId: 562 | 90.97 | |
| d1cr2a_ | 277 | Gene 4 protein (g4p, DNA primase), helicase domain | 90.61 | |
| d1p5zb_ | 241 | Deoxycytidine kinase {Human (Homo sapiens) [TaxId: | 90.59 | |
| d1g2912 | 240 | Maltose transport protein MalK, N-terminal domain | 90.55 | |
| d1tmka_ | 214 | Thymidylate kinase {Baker's yeast (Saccharomyces c | 90.54 | |
| d1f6ba_ | 186 | SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: | 90.5 | |
| d2jdia3 | 285 | Central domain of alpha subunit of F1 ATP synthase | 90.46 | |
| d1r0wa_ | 281 | Cystic fibrosis transmembrane conductance regulato | 90.38 | |
| d1b0ua_ | 258 | ATP-binding subunit of the histidine permease {Sal | 90.34 | |
| d1g6oa_ | 323 | Hexameric traffic ATPase, HP0525 {Helicobacter pyl | 90.33 | |
| d1nlfa_ | 274 | Hexameric replicative helicase repA {Escherichia c | 90.24 | |
| d1p6xa_ | 333 | Thymidine kinase {Equine herpesvirus type 4 [TaxId | 90.13 | |
| d1jjva_ | 205 | Dephospho-CoA kinase {Haemophilus influenzae [TaxI | 90.07 | |
| d4tmka_ | 210 | Thymidylate kinase {Escherichia coli [TaxId: 562]} | 90.0 | |
| d3dhwc1 | 240 | Methionine import ATP-binding protein MetN {Escher | 89.83 | |
| d1deka_ | 241 | Deoxynucleoside monophosphate kinase {Bacteriophag | 89.81 | |
| d2pmka1 | 241 | Haemolysin B ATP-binding protein {Escherichia coli | 89.63 | |
| d1l2ta_ | 230 | MJ0796 {Archaeon Methanococcus jannaschii [TaxId: | 89.55 | |
| d1v43a3 | 239 | Hypothetical protein PH0022, N-terminal domain {Py | 89.45 | |
| d2awna2 | 232 | Maltose transport protein MalK, N-terminal domain | 89.37 | |
| d1mv5a_ | 242 | Multidrug resistance ABC transporter LmrA, C-termi | 89.3 | |
| d1sgwa_ | 200 | Putative ABC transporter PF0895 {Pyrococcus furios | 89.16 | |
| d1jj7a_ | 251 | Peptide transporter Tap1, C-terminal ABC domain {H | 89.13 | |
| d2onka1 | 240 | Molybdate/tungstate import ATP-binding protein Wtp | 88.83 | |
| d1r8sa_ | 160 | ADP-ribosylation factor {Human (Homo sapiens), ARF | 87.89 | |
| d3d31a2 | 229 | Sulfate/molybdate ABC transporter, ATP-binding pro | 87.8 | |
| d1fzqa_ | 176 | ADP-ribosylation factor {Mouse (Mus musculus), ARL | 87.53 | |
| d1u0ja_ | 267 | Rep 40 protein helicase domain {Adeno-associated v | 87.51 | |
| d2bv3a2 | 276 | Elongation factor G (EF-G), N-terminal (G) domain | 87.35 | |
| d2a5ja1 | 173 | Rab2b {Human (Homo sapiens) [TaxId: 9606]} | 87.26 | |
| d1g6ha_ | 254 | MJ1267 {Archaeon Methanococcus jannaschii [TaxId: | 87.2 | |
| d1z06a1 | 165 | Rab-33b {Mouse (Mus musculus) [TaxId: 10090]} | 87.04 | |
| d1z2aa1 | 164 | Rab23 {Mouse (Mus musculus) [TaxId: 10090]} | 86.83 | |
| d1ji0a_ | 240 | Branched chain aminoacid ABC transporter {Thermoto | 86.81 | |
| d1z0fa1 | 166 | Rab14 {Human (Homo sapiens) [TaxId: 9606]} | 86.81 | |
| d1vpla_ | 238 | Putative ABC transporter TM0544 {Thermotoga mariti | 86.8 | |
| d1osna_ | 331 | Thymidine kinase {Varicella-zoster virus [TaxId: 1 | 86.69 | |
| d1upta_ | 169 | ADP-ribosylation factor {Human (Homo sapiens), ARL | 86.57 | |
| d3raba_ | 169 | Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} | 86.19 | |
| d1oxxk2 | 242 | Glucose transport protein GlcV, N-terminal domain | 86.19 | |
| d2ew1a1 | 171 | Rab30 {Human (Homo sapiens) [TaxId: 9606]} | 86.15 | |
| d1nija1 | 222 | Hypothetical protein YjiA, N-terminal domain {Esch | 86.09 | |
| d1mkya1 | 171 | Probable GTPase Der, N-terminal and middle domains | 86.01 | |
| d1svia_ | 195 | Probable GTPase EngB {Bacillus subtilis [TaxId: 14 | 85.99 | |
| d2fh5b1 | 207 | Signal recognition particle receptor beta-subunit | 85.9 | |
| d1z08a1 | 167 | Rab21 {Human (Homo sapiens) [TaxId: 9606]} | 85.89 | |
| d1mh1a_ | 183 | Rac {Human (Homo sapiens) [TaxId: 9606]} | 85.85 | |
| d1yzqa1 | 164 | Rab6 {Human (Homo sapiens) [TaxId: 9606]} | 85.78 | |
| d1r2qa_ | 170 | Rab5a {Human (Homo sapiens) [TaxId: 9606]} | 85.65 | |
| d2fn4a1 | 173 | r-Ras {Human (Homo sapiens) [TaxId: 9606]} | 85.46 | |
| d1moza_ | 182 | ADP-ribosylation factor {Baker's yeast (Saccharomy | 85.42 | |
| d1htwa_ | 158 | Hypothetical protein HI0065 {Haemophilus influenza | 85.39 | |
| d2erxa1 | 171 | di-Ras2 {Human (Homo sapiens) [TaxId: 9606]} | 85.31 | |
| d2f7sa1 | 186 | Rab27b {Human (Homo sapiens) [TaxId: 9606]} | 85.29 | |
| d1z0ja1 | 167 | Rab-22a {Mouse (Mus musculus) [TaxId: 10090]} | 85.22 | |
| d2bcgy1 | 194 | GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisi | 85.21 | |
| d1kmqa_ | 177 | RhoA {Human (Homo sapiens) [TaxId: 9606]} | 85.2 | |
| d2atva1 | 168 | Ras-like estrogen-regulated growth inhibitor, RERG | 85.19 | |
| d1kaoa_ | 167 | Rap2a {Human (Homo sapiens) [TaxId: 9606]} | 85.17 | |
| d1g16a_ | 166 | Rab-related protein Sec4 {Baker's yeast (Saccharom | 85.12 | |
| d1u0la2 | 225 | Probable GTPase EngC (YjeQ), C-terminal domain {Th | 85.0 | |
| d1ky3a_ | 175 | Rab-related protein ypt7p {Baker's yeast (Saccharo | 84.98 | |
| d2dy1a2 | 267 | Elongation factor G (EF-G), N-terminal (G) domain | 84.95 | |
| d2bmea1 | 174 | Rab4a {Human (Homo sapiens) [TaxId: 9606]} | 84.95 | |
| d2gjsa1 | 168 | Rad {Human (Homo sapiens) [TaxId: 9606]} | 84.87 | |
| d1wf3a1 | 178 | GTPase Era, N-terminal domain {Thermus thermophilu | 84.81 | |
| d1h65a_ | 257 | Chloroplast protein translocon GTPase Toc34 {Garde | 84.75 | |
| d2atxa1 | 185 | RhoQ {Human (Homo sapiens) [TaxId: 9606]} | 84.7 | |
| d2erya1 | 171 | r-Ras2 {Human (Homo sapiens) [TaxId: 9606]} | 84.47 | |
| d1ksha_ | 165 | ADP-ribosylation factor {Mouse (Mus musculus), ARL | 84.33 | |
| d1zcba2 | 200 | Transducin (alpha subunit) {Mouse (Mus musculus) [ | 84.33 | |
| d1l7vc_ | 231 | ABC transporter involved in vitamin B12 uptake, Bt | 84.32 | |
| d1kkma_ | 176 | HPr kinase HprK C-terminal domain {Lactobacillus c | 84.32 | |
| d2f9la1 | 175 | Rab11b {Human (Homo sapiens) [TaxId: 9606]} | 84.22 | |
| d1c1ya_ | 167 | Rap1A {Human (Homo sapiens) [TaxId: 9606]} | 84.15 | |
| d1m7ba_ | 179 | RhoE (RND3) {Mouse (Mus musculus) [TaxId: 10090]} | 84.09 | |
| d2g6ba1 | 170 | Rab26 {Human (Homo sapiens) [TaxId: 9606]} | 84.07 | |
| d1xtqa1 | 167 | GTP-binding protein RheB {Human (Homo sapiens) [Ta | 84.04 | |
| d1nrjb_ | 209 | Signal recognition particle receptor beta-subunit | 84.02 | |
| d1svsa1 | 195 | Transducin (alpha subunit) {Rat (Rattus norvegicus | 83.91 | |
| d1vg8a_ | 184 | Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]} | 83.83 | |
| d1ek0a_ | 170 | Ypt51 {Baker's yeast (Saccharomyces cerevisiae) [T | 83.58 | |
| d2ngra_ | 191 | CDC42 {Human (Homo sapiens) [TaxId: 9606]} | 83.52 | |
| d1azta2 | 221 | Transducin (alpha subunit) {Cow (Bos taurus) [TaxI | 83.27 | |
| d1egaa1 | 179 | GTPase Era, N-terminal domain {Escherichia coli [T | 83.26 | |
| d1tuea_ | 205 | Replication protein E1 helicase domain {Human papi | 82.94 | |
| d2g3ya1 | 172 | GTP-binding protein GEM {Human (Homo sapiens) [Tax | 82.82 | |
| d2bcjq2 | 200 | Transducin (alpha subunit) {Mouse (Mus musculus) [ | 82.81 | |
| d1x3sa1 | 177 | Rab18 {Human (Homo sapiens) [TaxId: 9606]} | 82.8 | |
| d1ctqa_ | 166 | cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9 | 82.77 | |
| d1e2ka_ | 329 | Thymidine kinase {Herpes simplex virus type 1, dif | 82.69 | |
| d1ko7a2 | 169 | HPr kinase HprK C-terminal domain {Staphylococcus | 82.64 | |
| d1u8za_ | 168 | Ras-related protein RalA {Cotton-top tamarin (Sagu | 82.54 | |
| d1udxa2 | 180 | Obg GTP-binding protein middle domain {Thermus the | 82.41 | |
| d1knxa2 | 177 | HPr kinase HprK C-terminal domain {Mycoplasma pneu | 82.08 | |
| d1zd9a1 | 164 | ADP-ribosylation factor {Human (Homo sapiens), ARL | 82.01 | |
| d1x1ra1 | 169 | Ras-related protein M-Ras (XRas) {Mouse (Mus muscu | 81.73 | |
| d1wmsa_ | 174 | Rab9a {Human (Homo sapiens) [TaxId: 9606]} | 81.68 | |
| d1zj6a1 | 177 | ADP-ribosylation factor {Human (Homo sapiens), ARL | 81.6 | |
| d2bmja1 | 175 | Centaurin gamma 1, G domain {Human (Homo sapiens) | 81.56 | |
| d2qtvb1 | 166 | SAR1 {Baker's yeast (Saccharomyces cerevisiae) [Ta | 81.25 | |
| d2cxxa1 | 184 | GTP-binding protein engB {Pyrococcus horikoshii [T | 81.06 | |
| d1lnza2 | 185 | Obg GTP-binding protein middle domain {Bacillus su | 80.84 | |
| d1n0ua2 | 341 | Elongation factor 2 (eEF-2), N-terminal (G) domain | 80.39 |
| >d2a5yb3 c.37.1.20 (B:109-385) CED-4, NB-ARC domain {Caenorhabditis elegans [TaxId: 6239]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: P-loop containing nucleoside triphosphate hydrolases superfamily: P-loop containing nucleoside triphosphate hydrolases family: Extended AAA-ATPase domain domain: CED-4, NB-ARC domain species: Caenorhabditis elegans [TaxId: 6239]
Probab=100.00 E-value=1.1e-42 Score=295.18 Aligned_cols=244 Identities=16% Similarity=0.158 Sum_probs=193.8
Q ss_pred CCCCCCEEHHHHHHHHHHHHHC-CCCCEEEEEEECCCCCCHHHHHHHHHHH----HHHCCCCCEEEEECHHHHCCCCHHH
Q ss_conf 7778721002279999996605-9999099999705998267999999998----7604685034320034430379799
Q 000922 237 SDFEGLVGIYSRIEQIKSLLCV-GLPDFQIIGIWGMGGIGKTTIAGAIFNQ----ISNDFEGRCFMANVREESERGGLVY 311 (1223)
Q Consensus 237 ~~~~~~vGr~~~~~~l~~~L~~-~~~~~~vv~I~G~gGiGKTtLA~~v~~~----~~~~F~~~~~~~~~~~~s~~~~l~~ 311 (1223)
+....++||+.++++|.++|.. .+.+.++|+|+|||||||||||+++|++ ....|++++|+.. +.......
T Consensus 17 p~~~~~~gR~~~~~~i~~~L~~~~~~~~~~v~I~GmgGiGKTtLA~~v~~~~~~~~~~~f~~~~Wv~v----s~~~~~~~ 92 (277)
T d2a5yb3 17 PKQMTCYIREYHVDRVIKKLDEMCDLDSFFLFLHGRAGSGKSVIASQALSKSDQLIGINYDSIVWLKD----SGTAPKST 92 (277)
T ss_dssp BCCCCSCCCHHHHHHHHHHHHHHTTSSSEEEEEECSTTSSHHHHHHHHHHHCSSTBTTTBSEEEEEEC----CCCSTTHH
T ss_pred CCCCCEECCHHHHHHHHHHHHHCCCCCCEEEEEECCCCCCHHHHHHHHHHHHHHHHHHCCCEEEEEEE----CCCCCHHH
T ss_conf 99886237399999999998734687840899977997888999999998556554012764899993----68777778
Q ss_pred HHHH---HHHHHHHHCC-CCC-CCCC------HHHHHHHHHCCEEEEEECCCCCHHHHHHHHCCCCCCCCCCEEEEEECC
Q ss_conf 9999---9999852103-767-9993------689999980690899961899988899984488987999779999289
Q 000922 312 LRER---LYSEILEETL-KIR-TPSV------PKCIKERLQQMKVFVVLDDVNKPEQLDYLAGGLDRFGLGSRVVVTSRD 380 (1223)
Q Consensus 312 l~~~---ll~~~~~~~~-~~~-~~~~------~~~l~~~L~~kr~LiVLDdv~~~~~~~~l~~~~~~~~~gs~IIiTTR~ 380 (1223)
+... ++........ ... .... ...+.+.+.++|+|+||||||+..+++.+. ..||+||||||+
T Consensus 93 l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~L~~kr~LlVLDDv~~~~~~~~~~------~~~srilvTTR~ 166 (277)
T d2a5yb3 93 FDLFTDILLMLKSEDDLLNFPSVEHVTSVVLKRMICNALIDRPNTLFVFDDVVQEETIRWAQ------ELRLRCLVTTRD 166 (277)
T ss_dssp HHHHHHHHHHHTTTSCCTTCCCCTTCCHHHHHHHHHHHHTTSTTEEEEEEEECCHHHHHHHH------HTTCEEEEEESB
T ss_pred HHHHHHHHHHHHCCHHHCCCCCCHHHHHHHHHHHHHHHHHCCCCEEEECCHHHHHHHHHHHC------CCCCEEEEEEEH
T ss_conf 99999999987220220278632123369999999999844688167525066776655520------457559999644
Q ss_pred HHHHHHCCCC-CEEEECCCCHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHHCCCCHHHHHHHHHHCCCCHHHHHHHHH
Q ss_conf 1233104988-269906899888999998834208999824999999999992899247899875412679899999986
Q 000922 381 RQVFDKCRVD-KIYEVEGLNQNEALEHFSNYAFRQNICPKDFLVLSERIVFYANGNPLALKVLGSFLQRKCKLQWENALK 459 (1223)
Q Consensus 381 ~~v~~~~~~~-~~~~l~~L~~~ea~~Lf~~~af~~~~~~~~~~~l~~~i~~~~~G~PLal~~lg~~L~~~~~~~w~~~l~ 459 (1223)
+.++..+... .+|++++|+.+||++||+.++|....+. ..++++++|+++|+|+|||++++|+.|+.++.++|.....
T Consensus 167 ~~v~~~~~~~~~~~~l~~L~~~ea~~Lf~~~~~~~~~~~-~~~~~~~~iv~~c~GlPLAl~~ig~~l~~k~~~~~~~~~~ 245 (277)
T d2a5yb3 167 VEISNAASQTCEFIEVTSLEIDECYDFLEAYGMPMPVGE-KEEDVLNKTIELSSGNPATLMMFFKSCEPKTFEKMAQLNN 245 (277)
T ss_dssp GGGGGGCCSCEEEEECCCCCHHHHHHHHHHTSCCCC--C-HHHHHHHHHHHHHTTCHHHHHHHHTTCCSSSHHHHHHHHH
T ss_pred HHHHHHCCCCCCEEECCCCCHHHHHHHHHHHHCCCCCCH-HHHHHHHHHHHHHCCCHHHHHHHHHHHCCCCHHHHHHHHH
T ss_conf 899986378871687788997999999999847766742-5679999999995899899999999865598999999999
Q ss_pred HHCCCCCCCHHHHHHHHHHCCCHHHHHHHHEE
Q ss_conf 20149987377699885720418678674102
Q 000922 460 NLTRISDPDIYDMLKISYNELKQEEKSIFLDI 491 (1223)
Q Consensus 460 ~l~~~~~~~i~~~l~~sy~~L~~~~k~~fl~~ 491 (1223)
.+.......+..++..||+.||.+.|.||-++
T Consensus 246 ~L~~~~~~~v~~il~~sY~~L~~~lk~c~~~l 277 (277)
T d2a5yb3 246 KLESRGLVGVECITPYSYKSLAMALQRCVEVL 277 (277)
T ss_dssp HHHHHCSSTTCCCSSSSSSSHHHHHHHHHHTS
T ss_pred HHHCCCHHHHHHHHHHHHHCCCHHHHHHHHHC
T ss_conf 97348678899999998851269999999739
|
| >d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} | Back information, alignment and structure |
|---|
| >d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} | Back information, alignment and structure |
|---|
| >d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} | Back information, alignment and structure |
|---|
| >d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} | Back information, alignment and structure |
|---|
| >d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d1fyva_ c.23.2.1 (A:) Toll-like receptor 1, TLR1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d1fyxa_ c.23.2.1 (A:) Toll-like receptor 2, TLR2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2fnaa2 c.37.1.20 (A:1-283) Archaeal ATPase SSO1545 {Sulfolobus solfataricus [TaxId: 2287]} | Back information, alignment and structure |
|---|
| >d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} | Back information, alignment and structure |
|---|
| >d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} | Back information, alignment and structure |
|---|
| >d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} | Back information, alignment and structure |
|---|
| >d1fnna2 c.37.1.20 (A:1-276) CDC6, N-domain {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} | Back information, alignment and structure |
|---|
| >d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} | Back information, alignment and structure |
|---|
| >d1sxjc2 c.37.1.20 (C:12-238) Replication factor C3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1sxjb2 c.37.1.20 (B:7-230) Replication factor C4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1sxjd2 c.37.1.20 (D:26-262) Replication factor C2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1w5sa2 c.37.1.20 (A:7-293) CDC6-like protein APE0152, N-terminal domain {Aeropyrum pernix [TaxId: 56636]} | Back information, alignment and structure |
|---|
| >d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1njfa_ c.37.1.20 (A:) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1sxje2 c.37.1.20 (E:4-255) Replication factor C5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1r6bx2 c.37.1.20 (X:169-436) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1iqpa2 c.37.1.20 (A:2-232) Replication factor C {Archaeon Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d1e32a2 c.37.1.20 (A:201-458) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1ixza_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1qvra2 c.37.1.20 (A:149-535) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1jbka_ c.37.1.20 (A:) ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1d2na_ c.37.1.20 (A:) Hexamerization domain of N-ethylmalemide-sensitive fusion (NSF) protein {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} | Back information, alignment and structure |
|---|
| >d1sxja2 c.37.1.20 (A:295-547) Replication factor C1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1ixsb2 c.37.1.20 (B:4-242) Holliday junction helicase RuvB {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1lv7a_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1l8qa2 c.37.1.20 (A:77-289) Chromosomal replication initiation factor DnaA {Aquifex aeolicus [TaxId: 63363]} | Back information, alignment and structure |
|---|
| >d1a5ta2 c.37.1.20 (A:1-207) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1r7ra3 c.37.1.20 (A:471-735) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1in4a2 c.37.1.20 (A:17-254) Holliday junction helicase RuvB {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2gnoa2 c.37.1.20 (A:11-208) gamma subunit of DNA polymerase III, N-domain {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1ofha_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d1rz3a_ c.37.1.6 (A:) Hypothetical protein rbstp0775 {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d1m8pa3 c.37.1.15 (A:391-573) ATP sulfurylase C-terminal domain {Fungus (Penicillium chrysogenum) [TaxId: 5076]} | Back information, alignment and structure |
|---|
| >d1qvra3 c.37.1.20 (A:536-850) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1gvnb_ c.37.1.21 (B:) Plasmid maintenance system epsilon/zeta, toxin zeta subunit {Streptococcus pyogenes [TaxId: 1314]} | Back information, alignment and structure |
|---|
| >d1ny5a2 c.37.1.20 (A:138-384) Transcriptional activator sigm54 (NtrC1), C-terminal domain {Aquifex aeolicus [TaxId: 63363]} | Back information, alignment and structure |
|---|
| >d1lw7a2 c.37.1.1 (A:220-411) Transcriptional regulator NadR, ribosylnicotinamide kinase domain {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d2i3ba1 c.37.1.11 (A:1-189) Cancer-related NTPase, C1orf57 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x6va3 c.37.1.4 (A:34-228) Adenosine-5'phosphosulfate kinase (APS kinase) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ls1a2 c.37.1.10 (A:89-295) GTPase domain of the signal sequence recognition protein Ffh {Thermus aquaticus [TaxId: 271]} | Back information, alignment and structure |
|---|
| >d1vmaa2 c.37.1.10 (A:82-294) GTPase domain of the signal recognition particle receptor FtsY {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d2qy9a2 c.37.1.10 (A:285-495) GTPase domain of the signal recognition particle receptor FtsY {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1kaga_ c.37.1.2 (A:) Shikimate kinase (AroK) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1svma_ c.37.1.20 (A:) Papillomavirus large T antigen helicase domain {Simian virus 40 [TaxId: 10633]} | Back information, alignment and structure |
|---|
| >d1cp2a_ c.37.1.10 (A:) Nitrogenase iron protein {Clostridium pasteurianum [TaxId: 1501]} | Back information, alignment and structure |
|---|
| >d1np6a_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2bdta1 c.37.1.25 (A:1-176) Hypothetical protein BH3686 {Bacillus halodurans [TaxId: 86665]} | Back information, alignment and structure |
|---|
| >d1ihua2 c.37.1.10 (A:308-586) Arsenite-translocating ATPase ArsA {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2qm8a1 c.37.1.10 (A:5-327) Metallochaperone MeaB {Methylobacterium extorquens [TaxId: 408]} | Back information, alignment and structure |
|---|
| >d1w44a_ c.37.1.11 (A:) NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} | Back information, alignment and structure |
|---|
| >d2p67a1 c.37.1.10 (A:1-327) LAO/AO transport system kinase ArgK {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1rkba_ c.37.1.1 (A:) Adenylate kinase {Human (Homo sapiens), isoenzyme 6 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1khta_ c.37.1.1 (A:) Adenylate kinase {Archaeon Methanococcus voltae [TaxId: 2188]} | Back information, alignment and structure |
|---|
| >d1knqa_ c.37.1.17 (A:) Gluconate kinase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1ly1a_ c.37.1.1 (A:) Polynucleotide kinase, kinase domain {Bacteriophage T4 [TaxId: 10665]} | Back information, alignment and structure |
|---|
| >d2iyva1 c.37.1.2 (A:2-166) Shikimate kinase (AroK) {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1qhxa_ c.37.1.3 (A:) Chloramphenicol phosphotransferase {Streptomyces venezuelae [TaxId: 54571]} | Back information, alignment and structure |
|---|
| >d1tf7a2 c.37.1.11 (A:256-497) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} | Back information, alignment and structure |
|---|
| >d1j8yf2 c.37.1.10 (F:87-297) GTPase domain of the signal sequence recognition protein Ffh {Archaeon Acidianus ambivalens [TaxId: 2283]} | Back information, alignment and structure |
|---|
| >d1r6bx3 c.37.1.20 (X:437-751) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1u94a1 c.37.1.11 (A:6-268) RecA protein, ATPase-domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1bifa1 c.37.1.7 (A:37-249) 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase, kinase domain {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1viaa_ c.37.1.2 (A:) Shikimate kinase (AroK) {Campylobacter jejuni [TaxId: 197]} | Back information, alignment and structure |
|---|
| >d1m7ga_ c.37.1.4 (A:) Adenosine-5'phosphosulfate kinase (APS kinase) {Fungus (Penicillium chrysogenum) [TaxId: 5076]} | Back information, alignment and structure |
|---|
| >d1nksa_ c.37.1.1 (A:) Adenylate kinase {Archaeon Sulfolobus acidocaldarius [TaxId: 2285]} | Back information, alignment and structure |
|---|
| >d1okkd2 c.37.1.10 (D:97-303) GTPase domain of the signal recognition particle receptor FtsY {Thermus aquaticus [TaxId: 271]} | Back information, alignment and structure |
|---|
| >d1ukza_ c.37.1.1 (A:) Uridylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2afhe1 c.37.1.10 (E:1-289) Nitrogenase iron protein {Azotobacter vinelandii [TaxId: 354]} | Back information, alignment and structure |
|---|
| >d1xjca_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1sq5a_ c.37.1.6 (A:) Pantothenate kinase PanK {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1qf9a_ c.37.1.1 (A:) UMP/CMP kinase {Dictyostelium discoideum [TaxId: 44689]} | Back information, alignment and structure |
|---|
| >d1e6ca_ c.37.1.2 (A:) Shikimate kinase (AroK) {Erwinia chrysanthemi [TaxId: 556]} | Back information, alignment and structure |
|---|
| >d3b60a1 c.37.1.12 (A:329-581) Multidrug resistance ABC transporter MsbA, C-terminal domain {Salmonella typhimurium [TaxId: 90371]} | Back information, alignment and structure |
|---|
| >d1uj2a_ c.37.1.6 (A:) Uridine-cytidine kinase 2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1odfa_ c.37.1.6 (A:) Hypothetical protein Ygr205W {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1y63a_ c.37.1.1 (A:) Probable kinase LmjF30.1890 {Leishmania major [TaxId: 5664]} | Back information, alignment and structure |
|---|
| >d1mo6a1 c.37.1.11 (A:1-269) RecA protein, ATPase-domain {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1zp6a1 c.37.1.25 (A:6-181) Hypothetical protein Atu3015 {Agrobacterium tumefaciens [TaxId: 358]} | Back information, alignment and structure |
|---|
| >d1ye8a1 c.37.1.11 (A:1-178) Hypothetical kinase-like protein Aq_1292 {Aquifex aeolicus [TaxId: 63363]} | Back information, alignment and structure |
|---|
| >d1ihua1 c.37.1.10 (A:1-296) Arsenite-translocating ATPase ArsA {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1teva_ c.37.1.1 (A:) UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1ckea_ c.37.1.1 (A:) CMP kinase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1lvga_ c.37.1.1 (A:) Guanylate kinase {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1ak2a1 c.37.1.1 (A:14-146,A:177-233) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-2 [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d2jdid3 c.37.1.11 (D:82-357) Central domain of beta subunit of F1 ATP synthase {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1g8pa_ c.37.1.20 (A:) ATPase subunit of magnesium chelatase, BchI {Rhodobacter capsulatus [TaxId: 1061]} | Back information, alignment and structure |
|---|
| >d1q3ta_ c.37.1.1 (A:) CMP kinase {Streptococcus pneumoniae [TaxId: 1313]} | Back information, alignment and structure |
|---|
| >d1yj5a2 c.37.1.1 (A:351-522) 5' polynucleotide kinase-3' phosphatase, C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1hyqa_ c.37.1.10 (A:) Cell division regulator MinD {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d1gkya_ c.37.1.1 (A:) Guanylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1xp8a1 c.37.1.11 (A:15-282) RecA protein, ATPase-domain {Deinococcus radiodurans [TaxId: 1299]} | Back information, alignment and structure |
|---|
| >d1xpua3 c.37.1.11 (A:129-417) Transcription termination factor Rho, ATPase domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1kgda_ c.37.1.1 (A:) Guanylate kinase-like domain of Cask {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1v5wa_ c.37.1.11 (A:) Meiotic recombination protein DMC1/LIM15 homolog {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1g3qa_ c.37.1.10 (A:) Cell division regulator MinD {Archaeon Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d1zaka1 c.37.1.1 (A:3-127,A:159-222) Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} | Back information, alignment and structure |
|---|
| >d1pzna2 c.37.1.11 (A:96-349) DNA repair protein Rad51, catalytic domain {Archaeon Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d1akya1 c.37.1.1 (A:3-130,A:169-220) Adenylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1zina1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d2cdna1 c.37.1.1 (A:1-181) Adenylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d2hyda1 c.37.1.12 (A:324-578) Putative multidrug export ATP-binding/permease protein SAV1866 {Staphylococcus aureus [TaxId: 1280]} | Back information, alignment and structure |
|---|
| >d2ak3a1 c.37.1.1 (A:0-124,A:162-225) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-3 [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1uf9a_ c.37.1.1 (A:) Dephospho-CoA kinase {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1um8a_ c.37.1.20 (A:) ClpX {Helicobacter pylori [TaxId: 210]} | Back information, alignment and structure |
|---|
| >d1nn5a_ c.37.1.1 (A:) Thymidylate kinase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1znwa1 c.37.1.1 (A:20-201) Guanylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d3adka_ c.37.1.1 (A:) Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d1s3ga1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus globisporus [TaxId: 1459]} | Back information, alignment and structure |
|---|
| >d1a7ja_ c.37.1.6 (A:) Phosphoribulokinase {Rhodobacter sphaeroides [TaxId: 1063]} | Back information, alignment and structure |
|---|
| >d2ocpa1 c.37.1.1 (A:37-277) Deoxyguanosine kinase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1yrba1 c.37.1.10 (A:1-244) ATP(GTP)-binding protein PAB0955 {Pyrococcus abyssi [TaxId: 29292]} | Back information, alignment and structure |
|---|
| >d1gsia_ c.37.1.1 (A:) Thymidylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d2i1qa2 c.37.1.11 (A:65-322) DNA repair protein Rad51, catalytic domain {Archaeon Methanococcus voltae [TaxId: 2188]} | Back information, alignment and structure |
|---|
| >d1g41a_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1n0wa_ c.37.1.11 (A:) DNA repair protein Rad51, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1e4va1 c.37.1.1 (A:1-121,A:157-214) Adenylate kinase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1p9ra_ c.37.1.11 (A:) Extracellular secretion NTPase EpsE {Vibrio cholerae [TaxId: 666]} | Back information, alignment and structure |
|---|
| >d1tf7a1 c.37.1.11 (A:14-255) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} | Back information, alignment and structure |
|---|
| >d1s96a_ c.37.1.1 (A:) Guanylate kinase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2vp4a1 c.37.1.1 (A:12-208) Deoxyribonucleoside kinase {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1szpa2 c.37.1.11 (A:145-395) DNA repair protein Rad51, catalytic domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1fx0a3 c.37.1.11 (A:97-372) Central domain of alpha subunit of F1 ATP synthase {Spinach (Spinacia oleracea), chloroplast [TaxId: 3562]} | Back information, alignment and structure |
|---|
| >d1w36d1 c.37.1.19 (D:2-360) Exodeoxyribonuclease V alpha chain (RecD) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1byia_ c.37.1.10 (A:) Dethiobiotin synthetase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1vhta_ c.37.1.1 (A:) Dephospho-CoA kinase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1cr2a_ c.37.1.11 (A:) Gene 4 protein (g4p, DNA primase), helicase domain {Bacteriophage T7 [TaxId: 10760]} | Back information, alignment and structure |
|---|
| >d1p5zb_ c.37.1.1 (B:) Deoxycytidine kinase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1g2912 c.37.1.12 (1:1-240) Maltose transport protein MalK, N-terminal domain {Archaeon Thermococcus litoralis [TaxId: 2265]} | Back information, alignment and structure |
|---|
| >d1tmka_ c.37.1.1 (A:) Thymidylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1f6ba_ c.37.1.8 (A:) SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} | Back information, alignment and structure |
|---|
| >d2jdia3 c.37.1.11 (A:95-379) Central domain of alpha subunit of F1 ATP synthase {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1r0wa_ c.37.1.12 (A:) Cystic fibrosis transmembrane conductance regulator, CFTR, nucleotide-binding domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1b0ua_ c.37.1.12 (A:) ATP-binding subunit of the histidine permease {Salmonella typhimurium [TaxId: 90371]} | Back information, alignment and structure |
|---|
| >d1g6oa_ c.37.1.11 (A:) Hexameric traffic ATPase, HP0525 {Helicobacter pylori [TaxId: 210]} | Back information, alignment and structure |
|---|
| >d1nlfa_ c.37.1.11 (A:) Hexameric replicative helicase repA {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1p6xa_ c.37.1.1 (A:) Thymidine kinase {Equine herpesvirus type 4 [TaxId: 10331]} | Back information, alignment and structure |
|---|
| >d1jjva_ c.37.1.1 (A:) Dephospho-CoA kinase {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d4tmka_ c.37.1.1 (A:) Thymidylate kinase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d3dhwc1 c.37.1.12 (C:1-240) Methionine import ATP-binding protein MetN {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1deka_ c.37.1.1 (A:) Deoxynucleoside monophosphate kinase {Bacteriophage T4 [TaxId: 10665]} | Back information, alignment and structure |
|---|
| >d2pmka1 c.37.1.12 (A:467-707) Haemolysin B ATP-binding protein {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1l2ta_ c.37.1.12 (A:) MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d1v43a3 c.37.1.12 (A:7-245) Hypothetical protein PH0022, N-terminal domain {Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d2awna2 c.37.1.12 (A:4-235) Maltose transport protein MalK, N-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1mv5a_ c.37.1.12 (A:) Multidrug resistance ABC transporter LmrA, C-terminal domain {Lactococcus lactis [TaxId: 1358]} | Back information, alignment and structure |
|---|
| >d1sgwa_ c.37.1.12 (A:) Putative ABC transporter PF0895 {Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d1jj7a_ c.37.1.12 (A:) Peptide transporter Tap1, C-terminal ABC domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2onka1 c.37.1.12 (A:1-240) Molybdate/tungstate import ATP-binding protein WtpC (ModC) {Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d1r8sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF1 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d3d31a2 c.37.1.12 (A:1-229) Sulfate/molybdate ABC transporter, ATP-binding protein {Methanosarcina acetivorans [TaxId: 2214]} | Back information, alignment and structure |
|---|
| >d1fzqa_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL3 [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1u0ja_ c.37.1.20 (A:) Rep 40 protein helicase domain {Adeno-associated virus 2, AAV2 [TaxId: 10804]} | Back information, alignment and structure |
|---|
| >d2bv3a2 c.37.1.8 (A:7-282) Elongation factor G (EF-G), N-terminal (G) domain {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d2a5ja1 c.37.1.8 (A:9-181) Rab2b {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1g6ha_ c.37.1.12 (A:) MJ1267 {Archaeon Methanococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d1z06a1 c.37.1.8 (A:32-196) Rab-33b {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1z2aa1 c.37.1.8 (A:8-171) Rab23 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1ji0a_ c.37.1.12 (A:) Branched chain aminoacid ABC transporter {Thermotoga maritima, TM1139 [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1z0fa1 c.37.1.8 (A:8-173) Rab14 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1vpla_ c.37.1.12 (A:) Putative ABC transporter TM0544 {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1osna_ c.37.1.1 (A:) Thymidine kinase {Varicella-zoster virus [TaxId: 10335]} | Back information, alignment and structure |
|---|
| >d1upta_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARL1 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d3raba_ c.37.1.8 (A:) Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1oxxk2 c.37.1.12 (K:1-242) Glucose transport protein GlcV, N-terminal domain {Archaeon Sulfolobus solfataricus [TaxId: 2287]} | Back information, alignment and structure |
|---|
| >d2ew1a1 c.37.1.8 (A:4-174) Rab30 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1nija1 c.37.1.10 (A:2-223) Hypothetical protein YjiA, N-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1mkya1 c.37.1.8 (A:2-172) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1svia_ c.37.1.8 (A:) Probable GTPase EngB {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d2fh5b1 c.37.1.8 (B:63-269) Signal recognition particle receptor beta-subunit {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1z08a1 c.37.1.8 (A:17-183) Rab21 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1mh1a_ c.37.1.8 (A:) Rac {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1yzqa1 c.37.1.8 (A:14-177) Rab6 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1r2qa_ c.37.1.8 (A:) Rab5a {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2fn4a1 c.37.1.8 (A:24-196) r-Ras {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1moza_ c.37.1.8 (A:) ADP-ribosylation factor {Baker's yeast (Saccharomyces cerevisiae), ARL1 [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1htwa_ c.37.1.18 (A:) Hypothetical protein HI0065 {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d2erxa1 c.37.1.8 (A:6-176) di-Ras2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2f7sa1 c.37.1.8 (A:5-190) Rab27b {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1z0ja1 c.37.1.8 (A:2-168) Rab-22a {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2bcgy1 c.37.1.8 (Y:3-196) GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1kmqa_ c.37.1.8 (A:) RhoA {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2atva1 c.37.1.8 (A:5-172) Ras-like estrogen-regulated growth inhibitor, RERG {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1kaoa_ c.37.1.8 (A:) Rap2a {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1g16a_ c.37.1.8 (A:) Rab-related protein Sec4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1u0la2 c.37.1.8 (A:69-293) Probable GTPase EngC (YjeQ), C-terminal domain {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1ky3a_ c.37.1.8 (A:) Rab-related protein ypt7p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2dy1a2 c.37.1.8 (A:8-274) Elongation factor G (EF-G), N-terminal (G) domain {Thermus thermophilus, EF-G-2 [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d2bmea1 c.37.1.8 (A:6-179) Rab4a {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2gjsa1 c.37.1.8 (A:91-258) Rad {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wf3a1 c.37.1.8 (A:3-180) GTPase Era, N-terminal domain {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1h65a_ c.37.1.8 (A:) Chloroplast protein translocon GTPase Toc34 {Garden pea (Pisum sativum) [TaxId: 3888]} | Back information, alignment and structure |
|---|
| >d2atxa1 c.37.1.8 (A:9-193) RhoQ {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2erya1 c.37.1.8 (A:10-180) r-Ras2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ksha_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL2 [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1zcba2 c.37.1.8 (A:47-75,A:202-372) Transducin (alpha subunit) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1l7vc_ c.37.1.12 (C:) ABC transporter involved in vitamin B12 uptake, BtuD {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1kkma_ c.91.1.2 (A:) HPr kinase HprK C-terminal domain {Lactobacillus casei [TaxId: 1582]} | Back information, alignment and structure |
|---|
| >d2f9la1 c.37.1.8 (A:8-182) Rab11b {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1c1ya_ c.37.1.8 (A:) Rap1A {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1m7ba_ c.37.1.8 (A:) RhoE (RND3) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2g6ba1 c.37.1.8 (A:58-227) Rab26 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xtqa1 c.37.1.8 (A:3-169) GTP-binding protein RheB {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1nrjb_ c.37.1.8 (B:) Signal recognition particle receptor beta-subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1svsa1 c.37.1.8 (A:32-60,A:182-347) Transducin (alpha subunit) {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1vg8a_ c.37.1.8 (A:) Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1ek0a_ c.37.1.8 (A:) Ypt51 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2ngra_ c.37.1.8 (A:) CDC42 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1azta2 c.37.1.8 (A:35-65,A:202-391) Transducin (alpha subunit) {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1egaa1 c.37.1.8 (A:4-182) GTPase Era, N-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1tuea_ c.37.1.20 (A:) Replication protein E1 helicase domain {Human papillomavirus type 18 [TaxId: 333761]} | Back information, alignment and structure |
|---|
| >d2g3ya1 c.37.1.8 (A:73-244) GTP-binding protein GEM {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2bcjq2 c.37.1.8 (Q:38-66,Q:184-354) Transducin (alpha subunit) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1x3sa1 c.37.1.8 (A:2-178) Rab18 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ctqa_ c.37.1.8 (A:) cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1e2ka_ c.37.1.1 (A:) Thymidine kinase {Herpes simplex virus type 1, different strains [TaxId: 10298]} | Back information, alignment and structure |
|---|
| >d1ko7a2 c.91.1.2 (A:130-298) HPr kinase HprK C-terminal domain {Staphylococcus xylosus [TaxId: 1288]} | Back information, alignment and structure |
|---|
| >d1u8za_ c.37.1.8 (A:) Ras-related protein RalA {Cotton-top tamarin (Saguinus oedipus) [TaxId: 9490]} | Back information, alignment and structure |
|---|
| >d1udxa2 c.37.1.8 (A:157-336) Obg GTP-binding protein middle domain {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1knxa2 c.91.1.2 (A:133-309) HPr kinase HprK C-terminal domain {Mycoplasma pneumoniae [TaxId: 2104]} | Back information, alignment and structure |
|---|
| >d1zd9a1 c.37.1.8 (A:18-181) ADP-ribosylation factor {Human (Homo sapiens), ARL8A [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x1ra1 c.37.1.8 (A:10-178) Ras-related protein M-Ras (XRas) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1wmsa_ c.37.1.8 (A:) Rab9a {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1zj6a1 c.37.1.8 (A:2-178) ADP-ribosylation factor {Human (Homo sapiens), ARL5A [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2bmja1 c.37.1.8 (A:66-240) Centaurin gamma 1, G domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2qtvb1 c.37.1.8 (B:24-189) SAR1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2cxxa1 c.37.1.8 (A:2-185) GTP-binding protein engB {Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d1lnza2 c.37.1.8 (A:158-342) Obg GTP-binding protein middle domain {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1n0ua2 c.37.1.8 (A:3-343) Elongation factor 2 (eEF-2), N-terminal (G) domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|