Citrus Sinensis ID: 001026
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
|
|
Close Homologs for Annotation Transfer
Close Homologs in SWISS-PROT Database Detected by BLAST 
Original result of BLAST against SWISS-PROT Database
| ID | Alignment graph | Length |
Definition |
RBH(Q2H) |
RBH(H2Q) |
Q cover |
H cover |
Identity |
E-value |
| Query | 1184 | 2.2.26 [Sep-21-2011] | |||||||
| Q6ZCX3 | 1364 | Formin-like protein 6 OS= | yes | no | 0.408 | 0.354 | 0.547 | 1e-177 | |
| Q9SK28 | 1111 | Formin-like protein 18 OS | yes | no | 0.423 | 0.451 | 0.561 | 1e-174 | |
| Q9LVN1 | 1266 | Formin-like protein 13 OS | no | no | 0.312 | 0.292 | 0.628 | 1e-154 | |
| Q9FLQ7 | 1649 | Formin-like protein 20 OS | no | no | 0.262 | 0.188 | 0.645 | 1e-135 | |
| Q84ZL0 | 1627 | Formin-like protein 5 OS= | yes | no | 0.290 | 0.211 | 0.529 | 1e-119 | |
| Q9C6S1 | 1230 | Formin-like protein 14 OS | no | no | 0.311 | 0.3 | 0.495 | 1e-119 | |
| Q6K8Z4 | 1385 | Formin-like protein 7 OS= | yes | no | 0.266 | 0.228 | 0.5 | 1e-108 | |
| Q7G6K7 | 1234 | Formin-like protein 3 OS= | no | no | 0.292 | 0.280 | 0.478 | 1e-106 | |
| Q7XWS7 | 1669 | Formin-like protein 12 OS | no | no | 0.298 | 0.211 | 0.506 | 1e-105 | |
| Q9LH02 | 495 | Formin-like protein 17 OS | no | no | 0.211 | 0.507 | 0.572 | 2e-96 |
| >sp|Q6ZCX3|FH6_ORYSJ Formin-like protein 6 OS=Oryza sativa subsp. japonica GN=FH6 PE=2 SV=2 | Back alignment and function desciption |
|---|
Score = 624 bits (1609), Expect = e-177, Method: Compositional matrix adjust.
Identities = 320/584 (54%), Positives = 384/584 (65%), Gaps = 100/584 (17%)
Query: 1 MALFRKFFYRKPPDGLLEISERVFVFDCCFTTDILEEEEYKEYLGGIVGQLREYFPEASF 60
MALFRKFFYRKPPDGLLEI+ERV+VFD CFTTD+ +++Y++Y+G IV QL+ +F +ASF
Sbjct: 1 MALFRKFFYRKPPDGLLEITERVYVFDSCFTTDVFNDDKYQDYIGDIVAQLQCHFADASF 60
Query: 61 MVFNFREGEHQSQIGQVLSEYDMTVMDYPRHYEGCPLLTMETVHHFLRSSESWLSLGHQN 120
MVFNFREGE QS + +LS Y+M VMDYPR YEGCPL+T+E +HHFLRS ESWLSL QN
Sbjct: 61 MVFNFREGESQSLLANILSSYEMVVMDYPRQYEGCPLVTIEMIHHFLRSGESWLSLSQQN 120
Query: 121 VLLMHCERGGWPVLAFMLAALLIYRKQFTGEQKTLDMIYKQAPRELLQLMSPLNPLPSQ- 179
VL+MHCERGGW VLAFMLA LL+YRKQ+ GEQ+TL+MIY+QAPREL+QL+SPLNP+PSQ
Sbjct: 121 VLIMHCERGGWAVLAFMLAGLLLYRKQYIGEQRTLEMIYRQAPRELIQLLSPLNPIPSQI 180
Query: 180 ----------------------------LRVIPNFDGEGGCCPIFRIYGQDPLMVADRTP 211
LR IP F+GEGGC PIFRIYG+DPL+ TP
Sbjct: 181 RYLHYISRRNVSAVWPPGDRALTLDCVILRNIPGFNGEGGCRPIFRIYGKDPLLATSNTP 240
Query: 212 KVLFSTPKRSKLVRHYKQADCELVKIDIHCHIQGDVVLECISLDSDQEREEMMFRVMFNT 271
KVLFSTPKRSK VR YK+ DCEL+KIDIHCHIQGDVVLECISLD+DQ+REEM+FRVMFNT
Sbjct: 241 KVLFSTPKRSKYVRLYKKVDCELIKIDIHCHIQGDVVLECISLDADQQREEMIFRVMFNT 300
Query: 272 AFIRSNILMLNRDEIDILWNSKDLFSKEFRAEVLFSEMDAATSLVSVDLPGIEEKDGLPI 331
AFIRSNILMLNRDEIDILW++KD F KEFRAEVLFSEMD+ L S+++ GI EK+GLP+
Sbjct: 301 AFIRSNILMLNRDEIDILWDAKDRFPKEFRAEVLFSEMDSVNQLDSMEVGGIGEKEGLPV 360
Query: 332 EAFAKVQEIFSNVDWLDPKLDVAVNMLQHFTPSNFIQ----------------------- 368
EAFAKVQE+FSNVDWLDP D A + Q T S IQ
Sbjct: 361 EAFAKVQEMFSNVDWLDPTADAAALLFQQLTSSENIQLRKGLLSPNKKDFHLSSISPTKK 420
Query: 369 --ENLETAL-NAEKGSIMIESALEKDKE----QLKLKAPD-------------------- 401
+N+E L NAE +I + D + Q + PD
Sbjct: 421 QSDNVEDKLSNAELSTIYVHKQENNDVQGLIPQKQATIPDEKSGSSVIHEKMISLVHEEI 480
Query: 402 ------NIGGLASISQGKP-FMPSVKPAL-DANSFKKKNEPKELLVSLQQPAQPKIISPR 453
N G L+S+ P M S +P L D NS + + SLQ + I+S +
Sbjct: 481 TQVVDINTGCLSSLDMTVPSTMNSSRPVLIDQNS-----KLDDQFGSLQSSSPTMIMSQQ 535
Query: 454 LPQTSSSASQG--------SPISRYHSAPSSLGITALLHDHDKY 489
P + SS+ S R+HSAPS+LGITALL DH +
Sbjct: 536 FPVSRSSSVLSSDFSPRLLSACPRFHSAPSALGITALLEDHAAF 579
|
Oryza sativa subsp. japonica (taxid: 39947) |
| >sp|Q9SK28|FH18_ARATH Formin-like protein 18 OS=Arabidopsis thaliana GN=FH18 PE=2 SV=2 | Back alignment and function description |
|---|
| >sp|Q9LVN1|FH13_ARATH Formin-like protein 13 OS=Arabidopsis thaliana GN=FH13 PE=2 SV=3 | Back alignment and function description |
|---|
| >sp|Q9FLQ7|FH20_ARATH Formin-like protein 20 OS=Arabidopsis thaliana GN=FH20 PE=2 SV=3 | Back alignment and function description |
|---|
| >sp|Q84ZL0|FH5_ORYSJ Formin-like protein 5 OS=Oryza sativa subsp. japonica GN=FH5 PE=2 SV=2 | Back alignment and function description |
|---|
| >sp|Q9C6S1|FH14_ARATH Formin-like protein 14 OS=Arabidopsis thaliana GN=FH14 PE=3 SV=3 | Back alignment and function description |
|---|
| >sp|Q6K8Z4|FH7_ORYSJ Formin-like protein 7 OS=Oryza sativa subsp. japonica GN=FH7 PE=2 SV=2 | Back alignment and function description |
|---|
| >sp|Q7G6K7|FH3_ORYSJ Formin-like protein 3 OS=Oryza sativa subsp. japonica GN=FH3 PE=2 SV=2 | Back alignment and function description |
|---|
| >sp|Q7XWS7|FH12_ORYSJ Formin-like protein 12 OS=Oryza sativa subsp. japonica GN=FH12 PE=3 SV=3 | Back alignment and function description |
|---|
| >sp|Q9LH02|FH17_ARATH Formin-like protein 17 OS=Arabidopsis thaliana GN=FH17 PE=2 SV=2 | Back alignment and function description |
|---|
Close Homologs in the Non-Redundant Database Detected by BLAST
Original result of BLAST against Nonredundant Database
| GI | Alignment Graph | Length |
Definition |
Q cover |
H cover |
Identity |
E-value |
| Query | 1184 | ||||||
| 359476177 | 1187 | PREDICTED: uncharacterized protein LOC10 | 0.409 | 0.408 | 0.732 | 0.0 | |
| 296082128 | 1642 | unnamed protein product [Vitis vinifera] | 0.409 | 0.295 | 0.732 | 0.0 | |
| 449455693 | 1396 | PREDICTED: formin-like protein 18-like [ | 0.478 | 0.405 | 0.630 | 0.0 | |
| 449532675 | 683 | PREDICTED: formin-like protein 6-like [C | 0.478 | 0.828 | 0.629 | 0.0 | |
| 255548750 | 1266 | DNA binding protein, putative [Ricinus c | 0.483 | 0.451 | 0.607 | 0.0 | |
| 224143299 | 1092 | predicted protein [Populus trichocarpa] | 0.488 | 0.529 | 0.534 | 0.0 | |
| 359494891 | 1149 | PREDICTED: formin-like protein 13-like [ | 0.435 | 0.449 | 0.565 | 0.0 | |
| 356562131 | 1362 | PREDICTED: formin-like protein 18-like [ | 0.373 | 0.324 | 0.618 | 0.0 | |
| 357437113 | 1824 | Formin 2B [Medicago truncatula] gi|35547 | 0.325 | 0.211 | 0.653 | 0.0 | |
| 356554141 | 1659 | PREDICTED: LOW QUALITY PROTEIN: formin-l | 0.355 | 0.253 | 0.662 | 1e-177 |
| >gi|359476177|ref|XP_002283272.2| PREDICTED: uncharacterized protein LOC100249142 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
Score = 763 bits (1970), Expect = 0.0, Method: Compositional matrix adjust.
Identities = 386/527 (73%), Positives = 431/527 (81%), Gaps = 42/527 (7%)
Query: 1 MALFRKFFYRKPPDGLLEISERVFVFDCCFTTDILEEEEYKEYLGGIVGQLREYFPEASF 60
MALFRKFFYRKPPDGLLEISERV+VFDCCFTTD+LE+EEYK Y+G IVGQLRE+FP+ASF
Sbjct: 1 MALFRKFFYRKPPDGLLEISERVYVFDCCFTTDVLEDEEYKVYMGSIVGQLREHFPDASF 60
Query: 61 MVFNFREGEHQSQIGQVLSEYDMTVMDYPRHYEGCPLLTMETVHHFLRSSESWLSLGHQN 120
MVFNFREG+ QSQI +LSEYDMTVMDYPRHYEGCPLLTME +HHFLRSSESWLSLG QN
Sbjct: 61 MVFNFREGDSQSQISSILSEYDMTVMDYPRHYEGCPLLTMEMIHHFLRSSESWLSLGQQN 120
Query: 121 VLLMHCERGGWPVLAFMLAALLIYRKQFTGEQKTLDMIYKQAPRELLQLMSPLNPLPSQL 180
VLLMHCER GWP+LAFMLAALLIYRKQ+TGEQKTLDMIYKQAPRELLQLMSPLNPLPSQL
Sbjct: 121 VLLMHCERSGWPILAFMLAALLIYRKQYTGEQKTLDMIYKQAPRELLQLMSPLNPLPSQL 180
Query: 181 R-----------------------------VIPNFDGEGGCCPIFRIYGQDPLMVADRTP 211
R +IPN DGEGGC PIFRIYGQDP MVADRTP
Sbjct: 181 RYLQYVSRRNVGSEWPPLDRALTLDCVILRIIPNLDGEGGCRPIFRIYGQDPFMVADRTP 240
Query: 212 KVLFSTPKRSKLVRHYKQADCELVKIDIHCHIQGDVVLECISLDSDQEREEMMFRVMFNT 271
KVLFSTPKRSK VRHYKQ DCELVKIDIHCHIQGDVVLECISL+ D EREEMMFRVMFNT
Sbjct: 241 KVLFSTPKRSKTVRHYKQEDCELVKIDIHCHIQGDVVLECISLEEDMEREEMMFRVMFNT 300
Query: 272 AFIRSNILMLNRDEIDILWNSKDLFSKEFRAEVLFSEMDAATSLVSVDLPGIEEKDGLPI 331
AFIRSNILMLNRDEIDILWNSKD F K+FRAEVLFSEMD+ SL+++DL G+EEKDGLP+
Sbjct: 301 AFIRSNILMLNRDEIDILWNSKDQFPKDFRAEVLFSEMDSGNSLITIDLEGVEEKDGLPM 360
Query: 332 EAFAKVQEIFSNVDWLDPKLDVAVNMLQHFTPSNFIQENLET--ALNAEKGSIMIESALE 389
EAFAKVQEIFSNVDWLDPK DVA N+LQ T SN +QE LET A + E ++ E + E
Sbjct: 361 EAFAKVQEIFSNVDWLDPKTDVAFNVLQQITASNVLQE-LETDSAQSGETVGLLQELSPE 419
Query: 390 KDKEQLKLKAPD-NIGGLASISQGKPFMPSVKPALDANSFKKKNEPKELLVSLQQPAQPK 448
K +++ K KA + NI S++ GK M S KP++DAN ++K +P+EL V+LQ+PAQ K
Sbjct: 420 KVEDKPKPKAAENNISSTTSMALGKQHMTSAKPSVDANLIRRKIDPQELQVALQRPAQSK 479
Query: 449 IISPRLPQT-------SSSASQGS--PISRYHSAPSSLGITALLHDH 486
IIS R+PQT +S++ QGS PISRYHSAPS+LGITALLHDH
Sbjct: 480 IISQRIPQTPISNPVSNSNSLQGSPVPISRYHSAPSALGITALLHDH 526
|
Source: Vitis vinifera Species: Vitis vinifera Genus: Vitis Family: Vitaceae Order: Vitales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|296082128|emb|CBI21133.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|449455693|ref|XP_004145586.1| PREDICTED: formin-like protein 18-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|449532675|ref|XP_004173306.1| PREDICTED: formin-like protein 6-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|255548750|ref|XP_002515431.1| DNA binding protein, putative [Ricinus communis] gi|223545375|gb|EEF46880.1| DNA binding protein, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|224143299|ref|XP_002324908.1| predicted protein [Populus trichocarpa] gi|222866342|gb|EEF03473.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|359494891|ref|XP_002265146.2| PREDICTED: formin-like protein 13-like [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|356562131|ref|XP_003549327.1| PREDICTED: formin-like protein 18-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|357437113|ref|XP_003588832.1| Formin 2B [Medicago truncatula] gi|355477880|gb|AES59083.1| Formin 2B [Medicago truncatula] | Back alignment and taxonomy information |
|---|
| >gi|356554141|ref|XP_003545407.1| PREDICTED: LOW QUALITY PROTEIN: formin-like protein 6-like [Glycine max] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST
Original result of BLAST against Gene Ontology (AMIGO)
| ID |
Alignment graph |
Length |
Definition |
Q cover |
H cover |
Identity |
E-value |
| Query | 1184 | ||||||
| TAIR|locus:2034471 | 1230 | AFH14 "Formin Homology 14" [Ar | 0.154 | 0.148 | 0.538 | 3.1e-167 | |
| TAIR|locus:2177801 | 464 | FH19 "formin homolog 19" [Arab | 0.103 | 0.262 | 0.6 | 8.1e-38 | |
| TAIR|locus:2160329 | 722 | AT5G07770 [Arabidopsis thalian | 0.097 | 0.159 | 0.6 | 5.6e-29 | |
| TAIR|locus:504955862 | 232 | AT3G32410 "AT3G32410" [Arabido | 0.154 | 0.788 | 0.436 | 5.8e-29 | |
| TAIR|locus:2009869 | 299 | AT1G42980 "AT1G42980" [Arabido | 0.171 | 0.678 | 0.304 | 3.9e-16 | |
| DICTYBASE|DDB_G0289763 | 1220 | forF "formin homology domain-c | 0.074 | 0.072 | 0.378 | 4.5e-15 | |
| UNIPROTKB|C9IZY8 | 461 | FMNL2 "Formin-like protein 2" | 0.160 | 0.412 | 0.301 | 2.5e-14 | |
| MGI|MGI:1918659 | 1086 | Fmnl2 "formin-like 2" [Mus mus | 0.160 | 0.174 | 0.306 | 8.1e-14 | |
| UNIPROTKB|J9P0X6 | 1013 | FMNL2 "Uncharacterized protein | 0.160 | 0.187 | 0.301 | 2.9e-13 | |
| UNIPROTKB|F1RQH3 | 1047 | FMNL2 "Uncharacterized protein | 0.160 | 0.181 | 0.301 | 3.2e-13 |
| TAIR|locus:2034471 AFH14 "Formin Homology 14" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 572 (206.4 bits), Expect = 3.1e-167, Sum P(6) = 3.1e-167
Identities = 99/184 (53%), Positives = 139/184 (75%)
Query: 1 MALFRKFFYRKPPDGLLEISERVFVFDCCFTTDXXXXXXXXXXXXXXVGQLREYFPEASF 60
M+L +FFY++PPDGLLE ++RV+VFD CF T+ + L E FPE+SF
Sbjct: 1 MSLLSRFFYKRPPDGLLEFADRVYVFDSCFCTEVLADSLYQIFLHEVINDLHEEFPESSF 60
Query: 61 MVFNFREGEHQSQIGQVLSEYDMTVMDYPRHYEGCPLLTMETVHHFLRSSESWLSLGH-Q 119
+ FNFREGE +S + L EYD+TV++YPR YEGCP+L + + HFLR ESWL+ G+ Q
Sbjct: 61 LAFNFREGEKKSVFAETLCEYDVTVLEYPRQYEGCPMLPLSLIQHFLRVCESWLARGNRQ 120
Query: 120 NVLLMHCERGGWPVLAFMLAALLIYRKQFTGEQKTLDMIYKQAPRELLQLMSPLNPLPSQ 179
+V+L+HCERGGWP+LAF+LA+ LI+RK +GE++TL++++++AP+ LLQL+SPLNP PSQ
Sbjct: 121 DVILLHCERGGWPLLAFILASFLIFRKVHSGERRTLEIVHREAPKGLLQLLSPLNPFPSQ 180
Query: 180 LRVI 183
LR +
Sbjct: 181 LRYL 184
|
|
| TAIR|locus:2177801 FH19 "formin homolog 19" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2160329 AT5G07770 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:504955862 AT3G32410 "AT3G32410" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2009869 AT1G42980 "AT1G42980" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| DICTYBASE|DDB_G0289763 forF "formin homology domain-containing protein" [Dictyostelium discoideum (taxid:44689)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|C9IZY8 FMNL2 "Formin-like protein 2" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:1918659 Fmnl2 "formin-like 2" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|J9P0X6 FMNL2 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1RQH3 FMNL2 "Uncharacterized protein" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Annotation Transfer from SWISS-PROT Entries
Original result of BLAST against SWISS-PROT
No confident hit for EC number transfering in SWISSPROT detected by BLAST
EC Number Prediction by Ezypred Server
Original result from Ezypred Server
Fail to connect to Ezypred Server
EC Number Prediction by EFICAz Software
No EC number assignment, probably not an enzyme!
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING
Original result from the STRING server
Fail to connect to STRING server
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST
Original result of RPS-BLAST against CDD database part I
| ID | Alignment Graph | Length |
Definition |
E-value |
| Query | 1184 | |||
| pfam02181 | 372 | pfam02181, FH2, Formin Homology 2 Domain | 1e-59 | |
| pfam10409 | 129 | pfam10409, PTEN_C2, C2 domain of PTEN tumour-suppr | 4e-35 | |
| smart00498 | 392 | smart00498, FH2, Formin Homology 2 Domain | 4e-30 | |
| PHA03247 | 3151 | PHA03247, PHA03247, large tegument protein UL36; P | 5e-25 | |
| PHA03247 | 3151 | PHA03247, PHA03247, large tegument protein UL36; P | 1e-24 | |
| PHA03247 | 3151 | PHA03247, PHA03247, large tegument protein UL36; P | 5e-21 | |
| PHA03307 | 1352 | PHA03307, PHA03307, transcriptional regulator ICP4 | 2e-17 | |
| PHA03247 | 3151 | PHA03247, PHA03247, large tegument protein UL36; P | 6e-17 | |
| PHA03307 | 1352 | PHA03307, PHA03307, transcriptional regulator ICP4 | 2e-15 | |
| PHA03247 | 3151 | PHA03247, PHA03247, large tegument protein UL36; P | 5e-15 | |
| PHA03307 | 1352 | PHA03307, PHA03307, transcriptional regulator ICP4 | 1e-14 | |
| pfam03154 | 979 | pfam03154, Atrophin-1, Atrophin-1 family | 2e-12 | |
| pfam04652 | 315 | pfam04652, DUF605, Vta1 like | 3e-10 | |
| pfam03154 | 979 | pfam03154, Atrophin-1, Atrophin-1 family | 4e-10 | |
| pfam03154 | 979 | pfam03154, Atrophin-1, Atrophin-1 family | 2e-09 | |
| pfam04652 | 315 | pfam04652, DUF605, Vta1 like | 3e-09 | |
| PRK12323 | 700 | PRK12323, PRK12323, DNA polymerase III subunits ga | 7e-09 | |
| pfam04652 | 315 | pfam04652, DUF605, Vta1 like | 1e-08 | |
| PRK07764 | 824 | PRK07764, PRK07764, DNA polymerase III subunits ga | 2e-08 | |
| pfam05109 | 830 | pfam05109, Herpes_BLLF1, Herpes virus major outer | 2e-08 | |
| pfam04652 | 315 | pfam04652, DUF605, Vta1 like | 7e-08 | |
| pfam03154 | 979 | pfam03154, Atrophin-1, Atrophin-1 family | 8e-08 | |
| PHA03247 | 3151 | PHA03247, PHA03247, large tegument protein UL36; P | 9e-08 | |
| PHA03307 | 1352 | PHA03307, PHA03307, transcriptional regulator ICP4 | 1e-07 | |
| PRK14948 | 620 | PRK14948, PRK14948, DNA polymerase III subunits ga | 1e-07 | |
| pfam03154 | 979 | pfam03154, Atrophin-1, Atrophin-1 family | 2e-07 | |
| pfam04652 | 315 | pfam04652, DUF605, Vta1 like | 2e-07 | |
| PRK07764 | 824 | PRK07764, PRK07764, DNA polymerase III subunits ga | 2e-07 | |
| PRK14950 | 585 | PRK14950, PRK14950, DNA polymerase III subunits ga | 3e-07 | |
| pfam04652 | 315 | pfam04652, DUF605, Vta1 like | 4e-07 | |
| PRK12323 | 700 | PRK12323, PRK12323, DNA polymerase III subunits ga | 4e-07 | |
| PRK07764 | 824 | PRK07764, PRK07764, DNA polymerase III subunits ga | 7e-07 | |
| PHA03247 | 3151 | PHA03247, PHA03247, large tegument protein UL36; P | 1e-06 | |
| PRK12323 | 700 | PRK12323, PRK12323, DNA polymerase III subunits ga | 2e-06 | |
| pfam05109 | 830 | pfam05109, Herpes_BLLF1, Herpes virus major outer | 2e-06 | |
| PRK07764 | 824 | PRK07764, PRK07764, DNA polymerase III subunits ga | 4e-06 | |
| PRK14971 | 614 | PRK14971, PRK14971, DNA polymerase III subunits ga | 4e-06 | |
| PRK14951 | 618 | PRK14951, PRK14951, DNA polymerase III subunits ga | 4e-06 | |
| PRK14948 | 620 | PRK14948, PRK14948, DNA polymerase III subunits ga | 5e-06 | |
| PRK07003 | 830 | PRK07003, PRK07003, DNA polymerase III subunits ga | 5e-06 | |
| pfam09770 | 804 | pfam09770, PAT1, Topoisomerase II-associated prote | 6e-06 | |
| PRK12323 | 700 | PRK12323, PRK12323, DNA polymerase III subunits ga | 7e-06 | |
| pfam09770 | 804 | pfam09770, PAT1, Topoisomerase II-associated prote | 7e-06 | |
| PRK14951 | 618 | PRK14951, PRK14951, DNA polymerase III subunits ga | 9e-06 | |
| PRK14951 | 618 | PRK14951, PRK14951, DNA polymerase III subunits ga | 1e-05 | |
| PHA03247 | 3151 | PHA03247, PHA03247, large tegument protein UL36; P | 2e-05 | |
| PRK07764 | 824 | PRK07764, PRK07764, DNA polymerase III subunits ga | 2e-05 | |
| PRK07764 | 824 | PRK07764, PRK07764, DNA polymerase III subunits ga | 2e-05 | |
| pfam05109 | 830 | pfam05109, Herpes_BLLF1, Herpes virus major outer | 2e-05 | |
| PRK14951 | 618 | PRK14951, PRK14951, DNA polymerase III subunits ga | 2e-05 | |
| PRK07994 | 647 | PRK07994, PRK07994, DNA polymerase III subunits ga | 2e-05 | |
| PHA03247 | 3151 | PHA03247, PHA03247, large tegument protein UL36; P | 3e-05 | |
| PHA03307 | 1352 | PHA03307, PHA03307, transcriptional regulator ICP4 | 3e-05 | |
| pfam11725 | 1771 | pfam11725, AvrE, Pathogenicity factor | 3e-05 | |
| pfam07223 | 357 | pfam07223, DUF1421, Protein of unknown function (D | 3e-05 | |
| PRK12323 | 700 | PRK12323, PRK12323, DNA polymerase III subunits ga | 4e-05 | |
| pfam09770 | 804 | pfam09770, PAT1, Topoisomerase II-associated prote | 4e-05 | |
| PHA03378 | 991 | PHA03378, PHA03378, EBNA-3B; Provisional | 4e-05 | |
| COG5099 | 777 | COG5099, COG5099, RNA-binding protein of the Puf f | 4e-05 | |
| PRK07764 | 824 | PRK07764, PRK07764, DNA polymerase III subunits ga | 5e-05 | |
| pfam12737 | 418 | pfam12737, Mating_C, C-terminal domain of homeodom | 5e-05 | |
| PRK07764 | 824 | PRK07764, PRK07764, DNA polymerase III subunits ga | 6e-05 | |
| PRK14951 | 618 | PRK14951, PRK14951, DNA polymerase III subunits ga | 6e-05 | |
| PHA03132 | 580 | PHA03132, PHA03132, thymidine kinase; Provisional | 6e-05 | |
| PRK14950 | 585 | PRK14950, PRK14950, DNA polymerase III subunits ga | 7e-05 | |
| PHA03247 | 3151 | PHA03247, PHA03247, large tegument protein UL36; P | 1e-04 | |
| PRK14948 | 620 | PRK14948, PRK14948, DNA polymerase III subunits ga | 1e-04 | |
| PRK14950 | 585 | PRK14950, PRK14950, DNA polymerase III subunits ga | 1e-04 | |
| PRK14950 | 585 | PRK14950, PRK14950, DNA polymerase III subunits ga | 1e-04 | |
| PRK07994 | 647 | PRK07994, PRK07994, DNA polymerase III subunits ga | 1e-04 | |
| pfam07223 | 357 | pfam07223, DUF1421, Protein of unknown function (D | 1e-04 | |
| pfam03251 | 458 | pfam03251, Tymo_45kd_70kd, Tymovirus 45/70Kd prote | 1e-04 | |
| PLN03209 | 576 | PLN03209, PLN03209, translocon at the inner envelo | 1e-04 | |
| PHA03247 | 3151 | PHA03247, PHA03247, large tegument protein UL36; P | 2e-04 | |
| pfam09770 | 804 | pfam09770, PAT1, Topoisomerase II-associated prote | 2e-04 | |
| PRK07994 | 647 | PRK07994, PRK07994, DNA polymerase III subunits ga | 2e-04 | |
| PHA03132 | 580 | PHA03132, PHA03132, thymidine kinase; Provisional | 2e-04 | |
| pfam05539 | 408 | pfam05539, Pneumo_att_G, Pneumovirinae attachment | 2e-04 | |
| pfam07174 | 297 | pfam07174, FAP, Fibronectin-attachment protein (FA | 2e-04 | |
| PRK07764 | 824 | PRK07764, PRK07764, DNA polymerase III subunits ga | 3e-04 | |
| PRK14948 | 620 | PRK14948, PRK14948, DNA polymerase III subunits ga | 3e-04 | |
| PRK14948 | 620 | PRK14948, PRK14948, DNA polymerase III subunits ga | 3e-04 | |
| PRK07003 | 830 | PRK07003, PRK07003, DNA polymerase III subunits ga | 3e-04 | |
| pfam12737 | 418 | pfam12737, Mating_C, C-terminal domain of homeodom | 3e-04 | |
| PLN03209 | 576 | PLN03209, PLN03209, translocon at the inner envelo | 3e-04 | |
| PRK07764 | 824 | PRK07764, PRK07764, DNA polymerase III subunits ga | 4e-04 | |
| PRK07003 | 830 | PRK07003, PRK07003, DNA polymerase III subunits ga | 4e-04 | |
| PRK07994 | 647 | PRK07994, PRK07994, DNA polymerase III subunits ga | 4e-04 | |
| PRK14971 | 614 | PRK14971, PRK14971, DNA polymerase III subunits ga | 5e-04 | |
| PRK12270 | 1228 | PRK12270, kgd, alpha-ketoglutarate decarboxylase; | 5e-04 | |
| COG5048 | 467 | COG5048, COG5048, FOG: Zn-finger [General function | 6e-04 | |
| pfam04502 | 321 | pfam04502, DUF572, Family of unknown function (DUF | 6e-04 | |
| PRK14948 | 620 | PRK14948, PRK14948, DNA polymerase III subunits ga | 7e-04 | |
| pfam05518 | 753 | pfam05518, Totivirus_coat, Totivirus coat protein | 7e-04 | |
| PRK12270 | 1228 | PRK12270, kgd, alpha-ketoglutarate decarboxylase; | 8e-04 | |
| PRK14954 | 620 | PRK14954, PRK14954, DNA polymerase III subunits ga | 8e-04 | |
| PLN02258 | 590 | PLN02258, PLN02258, 9-cis-epoxycarotenoid dioxygen | 9e-04 | |
| pfam03276 | 582 | pfam03276, Gag_spuma, Spumavirus gag protein | 9e-04 | |
| PHA03307 | 1352 | PHA03307, PHA03307, transcriptional regulator ICP4 | 0.001 | |
| pfam09770 | 804 | pfam09770, PAT1, Topoisomerase II-associated prote | 0.001 | |
| PLN03209 | 576 | PLN03209, PLN03209, translocon at the inner envelo | 0.001 | |
| pfam07174 | 297 | pfam07174, FAP, Fibronectin-attachment protein (FA | 0.001 | |
| pfam05518 | 753 | pfam05518, Totivirus_coat, Totivirus coat protein | 0.001 | |
| pfam05518 | 753 | pfam05518, Totivirus_coat, Totivirus coat protein | 0.001 | |
| PRK11633 | 226 | PRK11633, PRK11633, cell division protein DedD; Pr | 0.001 | |
| COG5178 | 2365 | COG5178, PRP8, U5 snRNP spliceosome subunit [RNA p | 0.001 | |
| pfam10428 | 419 | pfam10428, SOG2, RAM signalling pathway protein | 0.001 | |
| pfam09849 | 234 | pfam09849, DUF2076, Uncharacterized protein conser | 0.001 | |
| PRK07003 | 830 | PRK07003, PRK07003, DNA polymerase III subunits ga | 0.002 | |
| PHA03378 | 991 | PHA03378, PHA03378, EBNA-3B; Provisional | 0.002 | |
| pfam05539 | 408 | pfam05539, Pneumo_att_G, Pneumovirinae attachment | 0.002 | |
| PRK13729 | 475 | PRK13729, PRK13729, conjugal transfer pilus assemb | 0.002 | |
| PRK14086 | 617 | PRK14086, dnaA, chromosomal replication initiation | 0.002 | |
| pfam08580 | 626 | pfam08580, KAR9, Yeast cortical protein KAR9 | 0.002 | |
| pfam03326 | 500 | pfam03326, Herpes_TAF50, Herpesvirus transcription | 0.002 | |
| PRK07764 | 824 | PRK07764, PRK07764, DNA polymerase III subunits ga | 0.003 | |
| PRK07764 | 824 | PRK07764, PRK07764, DNA polymerase III subunits ga | 0.003 | |
| PRK14971 | 614 | PRK14971, PRK14971, DNA polymerase III subunits ga | 0.003 | |
| PRK14951 | 618 | PRK14951, PRK14951, DNA polymerase III subunits ga | 0.003 | |
| PRK12270 | 1228 | PRK12270, kgd, alpha-ketoglutarate decarboxylase; | 0.003 | |
| pfam05518 | 753 | pfam05518, Totivirus_coat, Totivirus coat protein | 0.003 | |
| PRK14954 | 620 | PRK14954, PRK14954, DNA polymerase III subunits ga | 0.003 | |
| PHA03379 | 935 | PHA03379, PHA03379, EBNA-3A; Provisional | 0.003 | |
| pfam13388 | 422 | pfam13388, DUF4106, Protein of unknown function (D | 0.003 | |
| pfam03153 | 332 | pfam03153, TFIIA, Transcription factor IIA, alpha/ | 0.003 | |
| pfam05308 | 248 | pfam05308, Mito_fiss_reg, Mitochondrial fission re | 0.003 | |
| PHA03132 | 580 | PHA03132, PHA03132, thymidine kinase; Provisional | 0.004 | |
| pfam05044 | 908 | pfam05044, Prox1, Homeobox prospero-like protein ( | 0.004 |
| >gnl|CDD|216919 pfam02181, FH2, Formin Homology 2 Domain | Back alignment and domain information |
|---|
Score = 209 bits (534), Expect = 1e-59
Identities = 84/294 (28%), Positives = 131/294 (44%), Gaps = 88/294 (29%)
Query: 931 IELRRANNCEIMLTKVKIPLPDLM------------------------------------ 954
++ +R+ N I+L K+K+P +++
Sbjct: 78 LDPKRSQNIAILLRKLKLPPEEIVQAILEMDESVLGLELLENLLKMAPTKEELKKLKEYK 137
Query: 955 -----------FFLELMKVPRVESKLRVFSFKIQFQTQV-----------------RNSI 986
F LEL K+PR+E +L FK F+ +V R S
Sbjct: 138 GDPSKLGRAEQFLLELSKIPRLEERLEALLFKSTFEEEVEELKPSLETLEAASEELRESR 197
Query: 987 KLKRIMQTILSLGNALNHGTARGSAVGFRLDSLLKLTDTRARNNKMTLMHYLC------- 1039
K K++++ IL+LGN +N GT RG+A GF+L SLLKL+DT++ +NK TL+HYL
Sbjct: 198 KFKKLLELILALGNYMNSGTRRGNAKGFKLSSLLKLSDTKSTDNKTTLLHYLVKIIREKL 257
Query: 1040 -----------------KIQLKFLAEEMQAISKGLEKVVQELTASENDGEVSGNFCKLLK 1082
K+ L+ L ++++ + KGL+K+ +EL S D F + +K
Sbjct: 258 PDLLDFSSELSHVEKAAKVDLEQLEKDVKELEKGLKKLERELELSALDEHPDDKFVEKMK 317
Query: 1083 EFLSYAEGEVRSLALLYSSVGRNADALAQYFGEDPARCPFEQVVSTLLNFVKMF 1136
EFL AE ++ L L L +YFGEDP E+ L +F++MF
Sbjct: 318 EFLEEAEEKLDKLESLLKEAMELFKELTEYFGEDPKETSPEEFFKILRDFLRMF 371
|
Length = 372 |
| >gnl|CDD|220736 pfam10409, PTEN_C2, C2 domain of PTEN tumour-suppressor protein | Back alignment and domain information |
|---|
| >gnl|CDD|214697 smart00498, FH2, Formin Homology 2 Domain | Back alignment and domain information |
|---|
| >gnl|CDD|223021 PHA03247, PHA03247, large tegument protein UL36; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223021 PHA03247, PHA03247, large tegument protein UL36; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223021 PHA03247, PHA03247, large tegument protein UL36; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223039 PHA03307, PHA03307, transcriptional regulator ICP4; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223021 PHA03247, PHA03247, large tegument protein UL36; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223039 PHA03307, PHA03307, transcriptional regulator ICP4; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223021 PHA03247, PHA03247, large tegument protein UL36; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223039 PHA03307, PHA03307, transcriptional regulator ICP4; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|217393 pfam03154, Atrophin-1, Atrophin-1 family | Back alignment and domain information |
|---|
| >gnl|CDD|218191 pfam04652, DUF605, Vta1 like | Back alignment and domain information |
|---|
| >gnl|CDD|217393 pfam03154, Atrophin-1, Atrophin-1 family | Back alignment and domain information |
|---|
| >gnl|CDD|217393 pfam03154, Atrophin-1, Atrophin-1 family | Back alignment and domain information |
|---|
| >gnl|CDD|218191 pfam04652, DUF605, Vta1 like | Back alignment and domain information |
|---|
| >gnl|CDD|237057 PRK12323, PRK12323, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|218191 pfam04652, DUF605, Vta1 like | Back alignment and domain information |
|---|
| >gnl|CDD|236090 PRK07764, PRK07764, DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|218439 pfam05109, Herpes_BLLF1, Herpes virus major outer envelope glycoprotein (BLLF1) | Back alignment and domain information |
|---|
| >gnl|CDD|218191 pfam04652, DUF605, Vta1 like | Back alignment and domain information |
|---|
| >gnl|CDD|217393 pfam03154, Atrophin-1, Atrophin-1 family | Back alignment and domain information |
|---|
| >gnl|CDD|223021 PHA03247, PHA03247, large tegument protein UL36; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223039 PHA03307, PHA03307, transcriptional regulator ICP4; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237862 PRK14948, PRK14948, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|217393 pfam03154, Atrophin-1, Atrophin-1 family | Back alignment and domain information |
|---|
| >gnl|CDD|218191 pfam04652, DUF605, Vta1 like | Back alignment and domain information |
|---|
| >gnl|CDD|236090 PRK07764, PRK07764, DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|237864 PRK14950, PRK14950, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|218191 pfam04652, DUF605, Vta1 like | Back alignment and domain information |
|---|
| >gnl|CDD|237057 PRK12323, PRK12323, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236090 PRK07764, PRK07764, DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|223021 PHA03247, PHA03247, large tegument protein UL36; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237057 PRK12323, PRK12323, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|218439 pfam05109, Herpes_BLLF1, Herpes virus major outer envelope glycoprotein (BLLF1) | Back alignment and domain information |
|---|
| >gnl|CDD|236090 PRK07764, PRK07764, DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|237874 PRK14971, PRK14971, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237865 PRK14951, PRK14951, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237862 PRK14948, PRK14948, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235906 PRK07003, PRK07003, DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|220392 pfam09770, PAT1, Topoisomerase II-associated protein PAT1 | Back alignment and domain information |
|---|
| >gnl|CDD|237057 PRK12323, PRK12323, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|220392 pfam09770, PAT1, Topoisomerase II-associated protein PAT1 | Back alignment and domain information |
|---|
| >gnl|CDD|237865 PRK14951, PRK14951, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237865 PRK14951, PRK14951, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223021 PHA03247, PHA03247, large tegument protein UL36; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236090 PRK07764, PRK07764, DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|236090 PRK07764, PRK07764, DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|218439 pfam05109, Herpes_BLLF1, Herpes virus major outer envelope glycoprotein (BLLF1) | Back alignment and domain information |
|---|
| >gnl|CDD|237865 PRK14951, PRK14951, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236138 PRK07994, PRK07994, DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|223021 PHA03247, PHA03247, large tegument protein UL36; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223039 PHA03307, PHA03307, transcriptional regulator ICP4; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|221188 pfam11725, AvrE, Pathogenicity factor | Back alignment and domain information |
|---|
| >gnl|CDD|219339 pfam07223, DUF1421, Protein of unknown function (DUF1421) | Back alignment and domain information |
|---|
| >gnl|CDD|237057 PRK12323, PRK12323, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|220392 pfam09770, PAT1, Topoisomerase II-associated protein PAT1 | Back alignment and domain information |
|---|
| >gnl|CDD|223065 PHA03378, PHA03378, EBNA-3B; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|227430 COG5099, COG5099, RNA-binding protein of the Puf family, translational repressor [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >gnl|CDD|236090 PRK07764, PRK07764, DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|221745 pfam12737, Mating_C, C-terminal domain of homeodomain 1 | Back alignment and domain information |
|---|
| >gnl|CDD|236090 PRK07764, PRK07764, DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|237865 PRK14951, PRK14951, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|222997 PHA03132, PHA03132, thymidine kinase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237864 PRK14950, PRK14950, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223021 PHA03247, PHA03247, large tegument protein UL36; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237862 PRK14948, PRK14948, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237864 PRK14950, PRK14950, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237864 PRK14950, PRK14950, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236138 PRK07994, PRK07994, DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|219339 pfam07223, DUF1421, Protein of unknown function (DUF1421) | Back alignment and domain information |
|---|
| >gnl|CDD|217453 pfam03251, Tymo_45kd_70kd, Tymovirus 45/70Kd protein | Back alignment and domain information |
|---|
| >gnl|CDD|178748 PLN03209, PLN03209, translocon at the inner envelope of chloroplast subunit 62; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223021 PHA03247, PHA03247, large tegument protein UL36; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|220392 pfam09770, PAT1, Topoisomerase II-associated protein PAT1 | Back alignment and domain information |
|---|
| >gnl|CDD|236138 PRK07994, PRK07994, DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|222997 PHA03132, PHA03132, thymidine kinase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|114270 pfam05539, Pneumo_att_G, Pneumovirinae attachment membrane glycoprotein G | Back alignment and domain information |
|---|
| >gnl|CDD|219321 pfam07174, FAP, Fibronectin-attachment protein (FAP) | Back alignment and domain information |
|---|
| >gnl|CDD|236090 PRK07764, PRK07764, DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|237862 PRK14948, PRK14948, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237862 PRK14948, PRK14948, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235906 PRK07003, PRK07003, DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|221745 pfam12737, Mating_C, C-terminal domain of homeodomain 1 | Back alignment and domain information |
|---|
| >gnl|CDD|178748 PLN03209, PLN03209, translocon at the inner envelope of chloroplast subunit 62; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236090 PRK07764, PRK07764, DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|235906 PRK07003, PRK07003, DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|236138 PRK07994, PRK07994, DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|237874 PRK14971, PRK14971, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237030 PRK12270, kgd, alpha-ketoglutarate decarboxylase; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|227381 COG5048, COG5048, FOG: Zn-finger [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|218115 pfam04502, DUF572, Family of unknown function (DUF572) | Back alignment and domain information |
|---|
| >gnl|CDD|237862 PRK14948, PRK14948, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|218621 pfam05518, Totivirus_coat, Totivirus coat protein | Back alignment and domain information |
|---|
| >gnl|CDD|237030 PRK12270, kgd, alpha-ketoglutarate decarboxylase; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|184918 PRK14954, PRK14954, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|215145 PLN02258, PLN02258, 9-cis-epoxycarotenoid dioxygenase NCED | Back alignment and domain information |
|---|
| >gnl|CDD|217469 pfam03276, Gag_spuma, Spumavirus gag protein | Back alignment and domain information |
|---|
| >gnl|CDD|223039 PHA03307, PHA03307, transcriptional regulator ICP4; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|220392 pfam09770, PAT1, Topoisomerase II-associated protein PAT1 | Back alignment and domain information |
|---|
| >gnl|CDD|178748 PLN03209, PLN03209, translocon at the inner envelope of chloroplast subunit 62; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|219321 pfam07174, FAP, Fibronectin-attachment protein (FAP) | Back alignment and domain information |
|---|
| >gnl|CDD|218621 pfam05518, Totivirus_coat, Totivirus coat protein | Back alignment and domain information |
|---|
| >gnl|CDD|218621 pfam05518, Totivirus_coat, Totivirus coat protein | Back alignment and domain information |
|---|
| >gnl|CDD|236940 PRK11633, PRK11633, cell division protein DedD; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|227505 COG5178, PRP8, U5 snRNP spliceosome subunit [RNA processing and modification] | Back alignment and domain information |
|---|
| >gnl|CDD|220749 pfam10428, SOG2, RAM signalling pathway protein | Back alignment and domain information |
|---|
| >gnl|CDD|220441 pfam09849, DUF2076, Uncharacterized protein conserved in bacteria (DUF2076) | Back alignment and domain information |
|---|
| >gnl|CDD|235906 PRK07003, PRK07003, DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|223065 PHA03378, PHA03378, EBNA-3B; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|114270 pfam05539, Pneumo_att_G, Pneumovirinae attachment membrane glycoprotein G | Back alignment and domain information |
|---|
| >gnl|CDD|184281 PRK13729, PRK13729, conjugal transfer pilus assembly protein TraB; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237605 PRK14086, dnaA, chromosomal replication initiation protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|219916 pfam08580, KAR9, Yeast cortical protein KAR9 | Back alignment and domain information |
|---|
| >gnl|CDD|217495 pfam03326, Herpes_TAF50, Herpesvirus transcription activation factor (transactivator) | Back alignment and domain information |
|---|
| >gnl|CDD|236090 PRK07764, PRK07764, DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|236090 PRK07764, PRK07764, DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|237874 PRK14971, PRK14971, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237865 PRK14951, PRK14951, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237030 PRK12270, kgd, alpha-ketoglutarate decarboxylase; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|218621 pfam05518, Totivirus_coat, Totivirus coat protein | Back alignment and domain information |
|---|
| >gnl|CDD|184918 PRK14954, PRK14954, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223066 PHA03379, PHA03379, EBNA-3A; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|222095 pfam13388, DUF4106, Protein of unknown function (DUF4106) | Back alignment and domain information |
|---|
| >gnl|CDD|217392 pfam03153, TFIIA, Transcription factor IIA, alpha/beta subunit | Back alignment and domain information |
|---|
| >gnl|CDD|218549 pfam05308, Mito_fiss_reg, Mitochondrial fission regulator | Back alignment and domain information |
|---|
| >gnl|CDD|222997 PHA03132, PHA03132, thymidine kinase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|218397 pfam05044, Prox1, Homeobox prospero-like protein (PROX1) | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch
Original result of HHsearch against CDD database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 1184 | |||
| KOG2283 | 434 | consensus Clathrin coat dissociation kinase GAK/PT | 100.0 | |
| KOG1924 | 1102 | consensus RhoA GTPase effector DIA/Diaphanous [Sig | 100.0 | |
| smart00498 | 432 | FH2 Formin Homology 2 Domain. FH proteins control | 100.0 | |
| PF02181 | 370 | FH2: Formin Homology 2 Domain; InterPro: IPR015425 | 100.0 | |
| KOG1923 | 830 | consensus Rac1 GTPase effector FRL [Signal transdu | 99.97 | |
| KOG1925 | 817 | consensus Rac1 GTPase effector FHOS [Signal transd | 99.93 | |
| KOG1922 | 833 | consensus Rho GTPase effector BNI1 and related for | 99.91 | |
| PF10409 | 134 | PTEN_C2: C2 domain of PTEN tumour-suppressor prote | 99.91 | |
| KOG1924 | 1102 | consensus RhoA GTPase effector DIA/Diaphanous [Sig | 99.74 | |
| PTZ00242 | 166 | protein tyrosine phosphatase; Provisional | 99.43 | |
| PTZ00393 | 241 | protein tyrosine phosphatase; Provisional | 99.15 | |
| PHA03247 | 3151 | large tegument protein UL36; Provisional | 99.11 | |
| KOG1720 | 225 | consensus Protein tyrosine phosphatase CDC14 [Defe | 99.07 | |
| PF05706 | 168 | CDKN3: Cyclin-dependent kinase inhibitor 3 (CDKN3) | 98.81 | |
| smart00195 | 138 | DSPc Dual specificity phosphatase, catalytic domai | 98.8 | |
| cd00127 | 139 | DSPc Dual specificity phosphatases (DSP); Ser/Thr | 98.58 | |
| PF00782 | 133 | DSPc: Dual specificity phosphatase, catalytic doma | 98.53 | |
| COG2453 | 180 | CDC14 Predicted protein-tyrosine phosphatase [Sign | 98.51 | |
| PRK12361 | 547 | hypothetical protein; Provisional | 98.41 | |
| smart00404 | 105 | PTPc_motif Protein tyrosine phosphatase, catalytic | 98.29 | |
| smart00012 | 105 | PTPc_DSPc Protein tyrosine phosphatase, catalytic | 98.29 | |
| KOG1719 | 183 | consensus Dual specificity phosphatase [Defense me | 98.2 | |
| KOG3671 | 569 | consensus Actin regulatory protein (Wiskott-Aldric | 97.94 | |
| PRK15375 | 535 | pathogenicity island 1 effector protein StpP; Prov | 97.73 | |
| KOG3671 | 569 | consensus Actin regulatory protein (Wiskott-Aldric | 97.64 | |
| KOG2836 | 173 | consensus Protein tyrosine phosphatase IVA1 [Signa | 97.49 | |
| cd00047 | 231 | PTPc Protein tyrosine phosphatases (PTP) catalyze | 97.48 | |
| smart00194 | 258 | PTPc Protein tyrosine phosphatase, catalytic domai | 97.34 | |
| PF03162 | 164 | Y_phosphatase2: Tyrosine phosphatase family; Inter | 97.03 | |
| PF00102 | 235 | Y_phosphatase: Protein-tyrosine phosphatase; Inter | 96.89 | |
| KOG2386 | 393 | consensus mRNA capping enzyme, guanylyltransferase | 96.8 | |
| PLN02727 | 986 | NAD kinase | 96.77 | |
| TIGR01244 | 135 | conserved hypothetical protein TIGR01244. No membe | 96.52 | |
| PHA02747 | 312 | protein tyrosine phosphatase; Provisional | 96.39 | |
| PF14566 | 149 | PTPlike_phytase: Inositol hexakisphosphate; PDB: 1 | 96.39 | |
| PHA02746 | 323 | protein tyrosine phosphatase; Provisional | 96.24 | |
| PF13350 | 164 | Y_phosphatase3: Tyrosine phosphatase family; PDB: | 96.16 | |
| PHA02738 | 320 | hypothetical protein; Provisional | 96.11 | |
| PHA02740 | 298 | protein tyrosine phosphatase; Provisional | 96.11 | |
| PHA02742 | 303 | protein tyrosine phosphatase; Provisional | 96.03 | |
| KOG0792 | 1144 | consensus Protein tyrosine phosphatase PTPMEG, con | 96.01 | |
| COG5599 | 302 | PTP2 Protein tyrosine phosphatase [Signal transduc | 95.79 | |
| KOG1716 | 285 | consensus Dual specificity phosphatase [Defense me | 95.54 | |
| KOG1572 | 249 | consensus Predicted protein tyrosine phosphatase [ | 94.98 | |
| KOG0790 | 600 | consensus Protein tyrosine phosphatase Corkscrew a | 94.92 | |
| KOG0791 | 374 | consensus Protein tyrosine phosphatase, contains f | 94.62 | |
| KOG0994 | 1758 | consensus Extracellular matrix glycoprotein Lamini | 94.52 | |
| COG2365 | 249 | Protein tyrosine/serine phosphatase [Signal transd | 94.37 | |
| PF04273 | 110 | DUF442: Putative phosphatase (DUF442); InterPro: I | 93.36 | |
| KOG1718 | 198 | consensus Dual specificity phosphatase [Defense me | 93.26 | |
| PRK11637 | 428 | AmiB activator; Provisional | 92.57 | |
| KOG1925 | 817 | consensus Rac1 GTPase effector FHOS [Signal transd | 92.38 | |
| KOG4228 | 1087 | consensus Protein tyrosine phosphatase [Signal tra | 92.2 | |
| KOG1717 | 343 | consensus Dual specificity phosphatase [Defense me | 92.19 | |
| KOG1923 | 830 | consensus Rac1 GTPase effector FRL [Signal transdu | 91.85 | |
| PF14671 | 141 | DSPn: Dual specificity protein phosphatase, N-term | 91.53 | |
| KOG2002 | 1018 | consensus TPR-containing nuclear phosphoprotein th | 91.33 | |
| PRK11637 | 428 | AmiB activator; Provisional | 91.31 | |
| KOG0789 | 415 | consensus Protein tyrosine phosphatase [Signal tra | 91.17 | |
| cd00179 | 151 | SynN Syntaxin N-terminus domain; syntaxins are ner | 90.31 | |
| PF12325 | 120 | TMF_TATA_bd: TATA element modulatory factor 1 TATA | 90.31 | |
| KOG0793 | 1004 | consensus Protein tyrosine phosphatase [Signal tra | 89.39 | |
| KOG1853 | 333 | consensus LIS1-interacting protein NUDE [Cytoskele | 88.44 | |
| PF10234 | 267 | Cluap1: Clusterin-associated protein-1; InterPro: | 87.86 | |
| cd07667 | 240 | BAR_SNX30 The Bin/Amphiphysin/Rvs (BAR) domain of | 87.66 | |
| KOG2007 | 586 | consensus Cysteinyl-tRNA synthetase [Translation, | 87.66 | |
| smart00498 | 432 | FH2 Formin Homology 2 Domain. FH proteins control | 87.6 | |
| COG5350 | 172 | Predicted protein tyrosine phosphatase [General fu | 86.87 | |
| KOG4228 | 1087 | consensus Protein tyrosine phosphatase [Signal tra | 86.87 | |
| KOG0243 | 1041 | consensus Kinesin-like protein [Cytoskeleton] | 86.71 | |
| KOG1830 | 518 | consensus Wiskott Aldrich syndrome proteins [Cytos | 86.28 | |
| cd07598 | 211 | BAR_FAM92 The Bin/Amphiphysin/Rvs (BAR) domain of | 86.26 | |
| PF04108 | 412 | APG17: Autophagy protein Apg17 ; InterPro: IPR0072 | 85.66 | |
| COG4942 | 420 | Membrane-bound metallopeptidase [Cell division and | 85.49 | |
| KOG1830 | 518 | consensus Wiskott Aldrich syndrome proteins [Cytos | 85.21 | |
| smart00806 | 426 | AIP3 Actin interacting protein 3. Aip3p/Bud6p is a | 84.23 | |
| PF06160 | 560 | EzrA: Septation ring formation regulator, EzrA ; I | 84.2 | |
| PF10168 | 717 | Nup88: Nuclear pore component; InterPro: IPR019321 | 83.67 | |
| KOG0976 | 1265 | consensus Rho/Rac1-interacting serine/threonine ki | 83.62 | |
| PF09726 | 697 | Macoilin: Transmembrane protein; InterPro: IPR0191 | 83.58 | |
| KOG0994 | 1758 | consensus Extracellular matrix glycoprotein Lamini | 83.47 | |
| KOG0163 | 1259 | consensus Myosin class VI heavy chain [Cytoskeleto | 82.95 | |
| PF09602 | 165 | PhaP_Bmeg: Polyhydroxyalkanoic acid inclusion prot | 82.0 | |
| smart00503 | 117 | SynN Syntaxin N-terminal domain. Three-helix domai | 81.69 | |
| KOG4673 | 961 | consensus Transcription factor TMF, TATA element m | 81.51 | |
| PF10147 | 217 | CR6_interact: Growth arrest and DNA-damage-inducib | 81.46 | |
| cd07637 | 200 | BAR_ACAP3 The Bin/Amphiphysin/Rvs (BAR) domain of | 81.33 | |
| PLN00047 | 283 | photosystem II biogenesis protein Psb29; Provision | 81.16 | |
| COG4372 | 499 | Uncharacterized protein conserved in bacteria with | 80.65 |
| >KOG2283 consensus Clathrin coat dissociation kinase GAK/PTEN/Auxilin and related tyrosine phosphatases [Signal transduction mechanisms; General function prediction only] | Back alignment and domain information |
|---|
Probab=100.00 E-value=3.2e-49 Score=459.47 Aligned_cols=274 Identities=20% Similarity=0.347 Sum_probs=220.4
Q ss_pred hhhhhccCCCCCceeeeCcEEEecCCCCCCcchhHHhhccHHHHHHHHhhhCCCCcEEEEEeccCCcCcccccccccCCc
Q 001026 4 FRKFFYRKPPDGLLEISERVFVFDCCFTTDILEEEEYKEYLGGIVGQLREYFPEASFMVFNFREGEHQSQIGQVLSEYDM 83 (1184)
Q Consensus 4 ~rr~~~~~~~lDLtyIT~RIiams~gfPa~~~~e~~YRN~i~dV~~fL~~~H~~~~y~V~Nl~ee~~~~~~~~~~~~f~~ 83 (1184)
-||+.+++.||||+|||+|||||+ ||++++ |+.|||+|+||++||+++|++| |+|||||.|+.|+ .++|++
T Consensus 3 k~r~~~~~~DLDltYIT~rIIams--fPa~~~-es~yRN~l~dV~~fL~s~H~~~-y~vyNL~~er~yd-----~~~f~g 73 (434)
T KOG2283|consen 3 KRRYNEGGFDLDLTYITSRIIAMS--FPAEGI-ESLYRNNLEDVVLFLDSKHKDH-YKVYNLSSERLYD-----PSRFHG 73 (434)
T ss_pred cchhhhccccccceeeeeeEEEEe--CCCCcc-hhhhcCCHHHHHHHHhhccCCc-eEEEecCccccCC-----cccccc
Confidence 478889999999999999999995 999988 8899999999999999999995 9999999776665 589999
Q ss_pred eEEecCCCCCCCCCCcHHHHHHHHHHHHHHHhcCCCcEEEEEecCCCCCchHHHHHHHHHHhhCCCcHHHHHHHHh----
Q 001026 84 TVMDYPRHYEGCPLLTMETVHHFLRSSESWLSLGHQNVLLMHCERGGWPVLAFMLAALLIYRKQFTGEQKTLDMIY---- 159 (1184)
Q Consensus 84 ~V~~~P~~~~~~p~p~L~~l~~~c~~i~~WL~~d~~NVvvvHCk~Gkgr~tg~mia~yLly~~~~~~~~~aL~~~~---- 159 (1184)
+|..| .|.+|++|+|++|+.||++|++||++|++||||||||+|||| ||+||||||+|++++.++++||++|.
T Consensus 74 ~V~~~--~~~Dh~~P~L~~l~~~c~~~~~WL~~d~~nVvvvHCk~Gkgr-tg~~icA~L~~~~~~~ta~eald~~~~kR~ 150 (434)
T KOG2283|consen 74 RVARF--GFDDHNPPPLELLCPFCKSMDNWLSEDPKNVVVVHCKAGKGR-TGVMICAYLIYSGISATAEEALDYFNEKRF 150 (434)
T ss_pred ceeec--CCCCCCCCcHHHHHHHHHCHHHHHhcCccceEEEEccCCCcc-eEEEEeHHHHhhhhcCCHHHHHHHHhhhhc
Confidence 99999 456778899999999999999999999999999999999999 89999999999999999999999984
Q ss_pred ---------hhchhhhhcccCC-C-------CCC--CCCc-----cccCCc-CCCCCceeEEEEEecCCCcccCCCCcEE
Q 001026 160 ---------KQAPRELLQLMSP-L-------NPL--PSQL-----RVIPNF-DGEGGCCPIFRIYGQDPLMVADRTPKVL 214 (1184)
Q Consensus 160 ---------~pSq~ryl~yfs~-L-------n~~--Psql-----r~VP~f-~~~~gcrP~l~Iy~~~~~~~~~~~~~~l 214 (1184)
+|||+|||+||+. | +.. +..| ..|+.| ..+.||++++.||+. .+.+
T Consensus 151 ~~~~~~~~~~PSq~RYv~Y~~~~l~~~~~~~~~~~~~~f~~~~~~~~ip~~~~~~~~~~~~~~v~~~---------k~~~ 221 (434)
T KOG2283|consen 151 DEGKSKGVTIPSQRRYVGYFSRVLLNGPLPPRSNSCPLFLHSFILISIPNFNSSRDGCRPAFPVYQG---------KKKV 221 (434)
T ss_pred cccccCCccCchhhHHHHHHHHHhhcCCcCcccccCceEeeeeeeeecCcccccCCCCCccceeeec---------ceee
Confidence 4899999999998 3 111 3333 567874 346899999999987 4667
Q ss_pred EeCccCccceeeecccCccEEEEeccccccCCeEEEEEecCCcCccc-------eeEEEEEeecccccCC--EEEecccc
Q 001026 215 FSTPKRSKLVRHYKQADCELVKIDIHCHIQGDVVLECISLDSDQERE-------EMMFRVMFNTAFIRSN--ILMLNRDE 285 (1184)
Q Consensus 215 fss~~~~~~~~~~~~~d~~~i~i~~~~~v~GDV~i~~~h~~~~~~~~-------~~~Fr~~FnT~FI~~~--~L~l~k~e 285 (1184)
|+..... .++.|.. + +.|+|++++.++ ++|||.+.....+ ...|.++|||+|+... .+.+...+
T Consensus 222 ~~~~s~~-~~~~~~~-~-g~~~i~~~~~~~----~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ 294 (434)
T KOG2283|consen 222 YSFSSDG-IMRLGEL-D-GKIVIPLGLRVD----VKCYHKRTSSGNRGILKDKEFKGCQIQFYTGPFPEDETVVRFFQAD 294 (434)
T ss_pred EEeccCC-ccccccc-c-cceecccccccc----eEEEeeccccCCcceeeccccceEEEeccCCCccccceeeeccccc
Confidence 7766555 6677766 4 468999998888 9999987554333 3467777778777543 44555555
Q ss_pred ccccccCCCcCCcccceEEEE
Q 001026 286 IDILWNSKDLFSKEFRAEVLF 306 (1184)
Q Consensus 286 LD~~~~~~~~fp~dF~vel~F 306 (1184)
++.-.+ ...+..-|.+.+.-
T Consensus 295 ~~~~~~-~e~~~~~~~~~~~~ 314 (434)
T KOG2283|consen 295 LPIYVS-NEFVFNFFQVSLEV 314 (434)
T ss_pred CCcccc-ccccccccceeeec
Confidence 554432 34444455555433
|
|
| >KOG1924 consensus RhoA GTPase effector DIA/Diaphanous [Signal transduction mechanisms; Cytoskeleton] | Back alignment and domain information |
|---|
| >smart00498 FH2 Formin Homology 2 Domain | Back alignment and domain information |
|---|
| >PF02181 FH2: Formin Homology 2 Domain; InterPro: IPR015425 Formin homology (FH) proteins play a crucial role in the reorganisation of the actin cytoskeleton, which mediates various functions of the cell cortex including motility, adhesion, and cytokinesis [] | Back alignment and domain information |
|---|
| >KOG1923 consensus Rac1 GTPase effector FRL [Signal transduction mechanisms; Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG1925 consensus Rac1 GTPase effector FHOS [Signal transduction mechanisms; Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG1922 consensus Rho GTPase effector BNI1 and related formins [Signal transduction mechanisms; Cytoskeleton] | Back alignment and domain information |
|---|
| >PF10409 PTEN_C2: C2 domain of PTEN tumour-suppressor protein; InterPro: IPR014020 Tensins constitute an eukaryotic family of lipid phosphatases that are defined by the presence of two adjacent domains: a lipid phosphatase domain and a C2-like domain | Back alignment and domain information |
|---|
| >KOG1924 consensus RhoA GTPase effector DIA/Diaphanous [Signal transduction mechanisms; Cytoskeleton] | Back alignment and domain information |
|---|
| >PTZ00242 protein tyrosine phosphatase; Provisional | Back alignment and domain information |
|---|
| >PTZ00393 protein tyrosine phosphatase; Provisional | Back alignment and domain information |
|---|
| >PHA03247 large tegument protein UL36; Provisional | Back alignment and domain information |
|---|
| >KOG1720 consensus Protein tyrosine phosphatase CDC14 [Defense mechanisms] | Back alignment and domain information |
|---|
| >PF05706 CDKN3: Cyclin-dependent kinase inhibitor 3 (CDKN3); InterPro: IPR022778 This entry represents a domain found in cyclin-dependent kinase inhibitor 3 or kinase associated phosphatase proteins from several mammalian species | Back alignment and domain information |
|---|
| >smart00195 DSPc Dual specificity phosphatase, catalytic domain | Back alignment and domain information |
|---|
| >cd00127 DSPc Dual specificity phosphatases (DSP); Ser/Thr and Tyr protein phosphatases | Back alignment and domain information |
|---|
| >PF00782 DSPc: Dual specificity phosphatase, catalytic domain; InterPro: IPR000340 Protein tyrosine (pTyr) phosphorylation is a common post-translational modification which can create novel recognition motifs for protein interactions and cellular localisation, affect protein stability, and regulate enzyme activity | Back alignment and domain information |
|---|
| >COG2453 CDC14 Predicted protein-tyrosine phosphatase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PRK12361 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >smart00404 PTPc_motif Protein tyrosine phosphatase, catalytic domain motif | Back alignment and domain information |
|---|
| >smart00012 PTPc_DSPc Protein tyrosine phosphatase, catalytic domain, undefined specificity | Back alignment and domain information |
|---|
| >KOG1719 consensus Dual specificity phosphatase [Defense mechanisms] | Back alignment and domain information |
|---|
| >KOG3671 consensus Actin regulatory protein (Wiskott-Aldrich syndrome protein) [Signal transduction mechanisms; Cytoskeleton] | Back alignment and domain information |
|---|
| >PRK15375 pathogenicity island 1 effector protein StpP; Provisional | Back alignment and domain information |
|---|
| >KOG3671 consensus Actin regulatory protein (Wiskott-Aldrich syndrome protein) [Signal transduction mechanisms; Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG2836 consensus Protein tyrosine phosphatase IVA1 [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >cd00047 PTPc Protein tyrosine phosphatases (PTP) catalyze the dephosphorylation of phosphotyrosine peptides; they regulate phosphotyrosine levels in signal transduction pathways | Back alignment and domain information |
|---|
| >smart00194 PTPc Protein tyrosine phosphatase, catalytic domain | Back alignment and domain information |
|---|
| >PF03162 Y_phosphatase2: Tyrosine phosphatase family; InterPro: IPR004861 Protein tyrosine (pTyr) phosphorylation is a common post-translational modification which can create novel recognition motifs for protein interactions and cellular localisation, affect protein stability, and regulate enzyme activity | Back alignment and domain information |
|---|
| >PF00102 Y_phosphatase: Protein-tyrosine phosphatase; InterPro: IPR000242 Protein tyrosine (pTyr) phosphorylation is a common post-translational modification which can create novel recognition motifs for protein interactions and cellular localisation, affect protein stability, and regulate enzyme activity | Back alignment and domain information |
|---|
| >KOG2386 consensus mRNA capping enzyme, guanylyltransferase (alpha) subunit [RNA processing and modification] | Back alignment and domain information |
|---|
| >PLN02727 NAD kinase | Back alignment and domain information |
|---|
| >TIGR01244 conserved hypothetical protein TIGR01244 | Back alignment and domain information |
|---|
| >PHA02747 protein tyrosine phosphatase; Provisional | Back alignment and domain information |
|---|
| >PF14566 PTPlike_phytase: Inositol hexakisphosphate; PDB: 1U24_A 2PSZ_B 3MOZ_A 3D1H_B 2B4P_B 3D1Q_A 2B4O_A 3MMJ_B 1U25_A 1U26_B | Back alignment and domain information |
|---|
| >PHA02746 protein tyrosine phosphatase; Provisional | Back alignment and domain information |
|---|
| >PF13350 Y_phosphatase3: Tyrosine phosphatase family; PDB: 1YWF_A 2OZ5_B | Back alignment and domain information |
|---|
| >PHA02738 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PHA02740 protein tyrosine phosphatase; Provisional | Back alignment and domain information |
|---|
| >PHA02742 protein tyrosine phosphatase; Provisional | Back alignment and domain information |
|---|
| >KOG0792 consensus Protein tyrosine phosphatase PTPMEG, contains FERM domain [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >COG5599 PTP2 Protein tyrosine phosphatase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG1716 consensus Dual specificity phosphatase [Defense mechanisms] | Back alignment and domain information |
|---|
| >KOG1572 consensus Predicted protein tyrosine phosphatase [Defense mechanisms] | Back alignment and domain information |
|---|
| >KOG0790 consensus Protein tyrosine phosphatase Corkscrew and related SH2 domain enzymes [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0791 consensus Protein tyrosine phosphatase, contains fn3 domain [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0994 consensus Extracellular matrix glycoprotein Laminin subunit beta [Extracellular structures] | Back alignment and domain information |
|---|
| >COG2365 Protein tyrosine/serine phosphatase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF04273 DUF442: Putative phosphatase (DUF442); InterPro: IPR005939 Although this domain is uncharacterised it seems likely that it performs a phosphatase function | Back alignment and domain information |
|---|
| >KOG1718 consensus Dual specificity phosphatase [Defense mechanisms] | Back alignment and domain information |
|---|
| >PRK11637 AmiB activator; Provisional | Back alignment and domain information |
|---|
| >KOG1925 consensus Rac1 GTPase effector FHOS [Signal transduction mechanisms; Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG4228 consensus Protein tyrosine phosphatase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG1717 consensus Dual specificity phosphatase [Defense mechanisms] | Back alignment and domain information |
|---|
| >KOG1923 consensus Rac1 GTPase effector FRL [Signal transduction mechanisms; Cytoskeleton] | Back alignment and domain information |
|---|
| >PF14671 DSPn: Dual specificity protein phosphatase, N-terminal half; PDB: 1OHD_A 1OHE_A 1OHC_A | Back alignment and domain information |
|---|
| >KOG2002 consensus TPR-containing nuclear phosphoprotein that regulates K(+) uptake [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PRK11637 AmiB activator; Provisional | Back alignment and domain information |
|---|
| >KOG0789 consensus Protein tyrosine phosphatase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >cd00179 SynN Syntaxin N-terminus domain; syntaxins are nervous system-specific proteins implicated in the docking of synaptic vesicles with the presynaptic plasma membrane; they are a family of receptors for intracellular transport vesicles; each target membrane may be identified by a specific member of the syntaxin family; syntaxins contain a moderately well conserved amino-terminal domain, called Habc, whose structure is an antiparallel three-helix bundle; a linker of about 30 amino acids connects this to the carboxy-terminal region, designated H3 (t_SNARE), of the syntaxin cytoplasmic domain; the highly conserved H3 region forms a single, long alpha-helix when it is part of the core SNARE complex and anchors the protein on the cytoplasmic surface of cellular membranes; H3 is not included in defining this domain | Back alignment and domain information |
|---|
| >PF12325 TMF_TATA_bd: TATA element modulatory factor 1 TATA binding; InterPro: IPR022091 This is the C-terminal conserved coiled coil region of a family of TATA element modulatory factor 1 proteins conserved in eukaryotes [] | Back alignment and domain information |
|---|
| >KOG0793 consensus Protein tyrosine phosphatase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG1853 consensus LIS1-interacting protein NUDE [Cytoskeleton] | Back alignment and domain information |
|---|
| >PF10234 Cluap1: Clusterin-associated protein-1; InterPro: IPR019366 This protein of 413 amino acids contains a central coiled-coil domain, possibly the region that binds to clusterin | Back alignment and domain information |
|---|
| >cd07667 BAR_SNX30 The Bin/Amphiphysin/Rvs (BAR) domain of Sorting Nexin 30 | Back alignment and domain information |
|---|
| >KOG2007 consensus Cysteinyl-tRNA synthetase [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >smart00498 FH2 Formin Homology 2 Domain | Back alignment and domain information |
|---|
| >COG5350 Predicted protein tyrosine phosphatase [General function prediction only] | Back alignment and domain information |
|---|
| >KOG4228 consensus Protein tyrosine phosphatase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0243 consensus Kinesin-like protein [Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG1830 consensus Wiskott Aldrich syndrome proteins [Cytoskeleton] | Back alignment and domain information |
|---|
| >cd07598 BAR_FAM92 The Bin/Amphiphysin/Rvs (BAR) domain of Family with sequence similarity 92 (FAM92) | Back alignment and domain information |
|---|
| >PF04108 APG17: Autophagy protein Apg17 ; InterPro: IPR007240 Macroautophagy is a bulk degradation process induced by starvation in eukaryotic cells | Back alignment and domain information |
|---|
| >COG4942 Membrane-bound metallopeptidase [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >KOG1830 consensus Wiskott Aldrich syndrome proteins [Cytoskeleton] | Back alignment and domain information |
|---|
| >smart00806 AIP3 Actin interacting protein 3 | Back alignment and domain information |
|---|
| >PF06160 EzrA: Septation ring formation regulator, EzrA ; InterPro: IPR010379 During the bacterial cell cycle, the tubulin-like cell-division protein FtsZ polymerises into a ring structure that establishes the location of the nascent division site | Back alignment and domain information |
|---|
| >PF10168 Nup88: Nuclear pore component; InterPro: IPR019321 Nup88 can be divided into two structural domains; the N-terminal two-thirds of the protein have no obvious structural motifs | Back alignment and domain information |
|---|
| >KOG0976 consensus Rho/Rac1-interacting serine/threonine kinase Citron [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF09726 Macoilin: Transmembrane protein; InterPro: IPR019130 This entry represents the multi-pass transmembrane protein Macoilin, which is highly conserved in eukaryotes | Back alignment and domain information |
|---|
| >KOG0994 consensus Extracellular matrix glycoprotein Laminin subunit beta [Extracellular structures] | Back alignment and domain information |
|---|
| >KOG0163 consensus Myosin class VI heavy chain [Cytoskeleton] | Back alignment and domain information |
|---|
| >PF09602 PhaP_Bmeg: Polyhydroxyalkanoic acid inclusion protein (PhaP_Bmeg); InterPro: IPR011728 This entry describes a protein found in polyhydroxyalkanoic acid (PHA) gene regions and incorporated into PHA inclusions in Bacillus cereus and Bacillus megaterium | Back alignment and domain information |
|---|
| >smart00503 SynN Syntaxin N-terminal domain | Back alignment and domain information |
|---|
| >KOG4673 consensus Transcription factor TMF, TATA element modulatory factor [Transcription] | Back alignment and domain information |
|---|
| >PF10147 CR6_interact: Growth arrest and DNA-damage-inducible proteins-interacting protein 1; InterPro: IPR018472 Members of this family of proteins act as negative regulators of G1 to S cell cycle phase progression by inhibiting cyclin-dependent kinases | Back alignment and domain information |
|---|
| >cd07637 BAR_ACAP3 The Bin/Amphiphysin/Rvs (BAR) domain of ArfGAP with Coiled-coil, ANK repeat and PH domain containing protein 3 | Back alignment and domain information |
|---|
| >PLN00047 photosystem II biogenesis protein Psb29; Provisional | Back alignment and domain information |
|---|
| >COG4372 Uncharacterized protein conserved in bacteria with the myosin-like domain [Function unknown] | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST
Original result of BLAST against Protein Data Bank
| ID | Alignment Graph | Length |
Definition |
E-value | |
| Query | 1184 | ||||
| 3o4x_E | 467 | Crystal Structure Of Complex Between Amino And Carb | 1e-15 | ||
| 1v9d_A | 340 | Crystal Structure Of The Core Fh2 Domain Of Mouse M | 2e-15 | ||
| 3obv_E | 457 | Autoinhibited Formin Mdia1 Structure Length = 457 | 2e-15 | ||
| 4eah_A | 402 | Crystal Structure Of The Formin Homology 2 Domain O | 4e-13 | ||
| 2z6e_A | 419 | Crystal Structure Of Human Daam1 Fh2 Length = 419 | 1e-08 | ||
| 2j1d_G | 483 | Crystallization Of Hdaam1 C-Terminal Fragment Lengt | 1e-08 |
| >pdb|3O4X|E Chain E, Crystal Structure Of Complex Between Amino And Carboxy Terminal Fragments Of Mdia1 Length = 467 | Back alignment and structure |
|
| >pdb|1V9D|A Chain A, Crystal Structure Of The Core Fh2 Domain Of Mouse Mdia1 Length = 340 | Back alignment and structure |
| >pdb|3OBV|E Chain E, Autoinhibited Formin Mdia1 Structure Length = 457 | Back alignment and structure |
| >pdb|4EAH|A Chain A, Crystal Structure Of The Formin Homology 2 Domain Of Fmnl3 Bound To Actin Length = 402 | Back alignment and structure |
| >pdb|2Z6E|A Chain A, Crystal Structure Of Human Daam1 Fh2 Length = 419 | Back alignment and structure |
| >pdb|2J1D|G Chain G, Crystallization Of Hdaam1 C-Terminal Fragment Length = 483 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST
Original result of RPS-BLAST against PDB70 database
| >1v9d_A Diaphanous protein homolog 1; helix bundle, protein binding; 2.60A {Mus musculus} SCOP: a.207.1.1 Length = 340 | Back alignment and structure |
|---|
Score = 227 bits (580), Expect = 2e-66
Identities = 62/327 (18%), Positives = 120/327 (36%), Gaps = 88/327 (26%)
Query: 931 IELRRANNCEIMLTKVKIPLPDLM------------------------------------ 954
++ + A N I L ++P ++
Sbjct: 12 LDSKTAQNLSIFLGSFRMPYQEIKNVILEVNEAVLTESMIQNLIKQMPEPEQLKMLSELK 71
Query: 955 -----------FFLELMKVPRVESKLRVFSFKIQFQT-----------------QVRNSI 986
F + + VPR+ +L FK+QF ++R S
Sbjct: 72 EEYDDLAESEQFGVVMGTVPRLRPRLNAILFKLQFSEQVENIKPEIVSVTAACEELRKSE 131
Query: 987 KLKRIMQTILSLGNALNHGTARGSAVGFRLDSLLKLTDTRARNNKMTLMHYLC------- 1039
+++ L +GN +N G+ A GF + L KL DT++ + KMTL+H+L
Sbjct: 132 NFSSLLELTLLVGNYMNAGSRNAGAFGFNISFLCKLRDTKSADQKMTLLHFLAELCENDH 191
Query: 1040 -----------------KIQLKFLAEEMQAISKGLEKVVQELTASENDGEVSGNFCKLLK 1082
++ + L + + + K + V +++ + F + +
Sbjct: 192 PEVLKFPDELAHVEKASRVSAENLQKSLDQMKKQIADVERDVQNFPAATDEKDKFVEKMT 251
Query: 1083 EFLSYAEGEVRSLALLYSSVGRNADALAQYFGEDPARCPFEQVVSTLLNFVKMFVLAHEE 1142
F+ A+ + L +++S++ L YF DP + E+ L NF MF+ A +E
Sbjct: 252 SFVKDAQEQYNKLRMMHSNMETLYKELGDYFVFDPKKLSVEEFFMDLHNFRNMFLQAVKE 311
Query: 1143 NCRQLEFERKKAEKAVENEKLKTQKGQ 1169
N ++ E E K + EK + ++ +
Sbjct: 312 NQKRRETEEKMRRAKLAKEKAEKERLE 338
|
| >3obv_E Protein diaphanous homolog 1; autoinhibition, actin, nucleation, cytoskeleton, structural; HET: SUC; 2.75A {Mus musculus} PDB: 3o4x_E 2bap_D Length = 457 | Back alignment and structure |
|---|
| >2j1d_G DAAM1, disheveled-associated activator of morphogenesis; actin assembly, protein binding; 2.55A {Homo sapiens} PDB: 2z6e_A Length = 483 | Back alignment and structure |
|---|
| >1ux5_A BNI1 protein; structural protein, FH2 actin cytoskeleton; 2.5A {Saccharomyces cerevisiae} SCOP: a.207.1.1 PDB: 1y64_B* 1ux4_A Length = 411 | Back alignment and structure |
|---|
| >1d5r_A Phosphoinositide phosphotase PTEN; C2 domain, phosphotidylinositol, hydrolase; HET: TLA; 2.10A {Homo sapiens} SCOP: b.7.1.1 c.45.1.1 Length = 324 | Back alignment and structure |
|---|
| >3v0d_A Voltage-sensor containing phosphatase; PTP, hydrolase; HET: PO4; 1.10A {Ciona intestinalis} PDB: 3v0f_A* 3v0g_A 3v0h_A* 3awf_A 3v0j_A 3awe_A 3awg_A 3v0e_A 3v0i_A Length = 339 | Back alignment and structure |
|---|
| >3n0a_A Tyrosine-protein phosphatase auxilin; phosphatase-like domain, C2 domain, hydrolase; 2.20A {Bos taurus} Length = 361 | Back alignment and structure |
|---|
| >1twf_A B220, DNA-directed RNA polymerase II largest subunit; transcription, mRNA, multiprotein complex; HET: UTP; 2.30A {Saccharomyces cerevisiae} SCOP: e.29.1.2 PDB: 1i3q_A 1i6h_A 1k83_A* 1nik_A 1nt9_A 1pqv_A 1r5u_A 1r9s_A* 1r9t_A* 1sfo_A* 1twa_A* 1twc_A* 1i50_A* 1twg_A* 1twh_A* 1wcm_A 1y1v_A 1y1w_A 1y1y_A 1y77_A* ... Length = 1733 | Back alignment and structure |
|---|
| >1twf_A B220, DNA-directed RNA polymerase II largest subunit; transcription, mRNA, multiprotein complex; HET: UTP; 2.30A {Saccharomyces cerevisiae} SCOP: e.29.1.2 PDB: 1i3q_A 1i6h_A 1k83_A* 1nik_A 1nt9_A 1pqv_A 1r5u_A 1r9s_A* 1r9t_A* 1sfo_A* 1twa_A* 1twc_A* 1i50_A* 1twg_A* 1twh_A* 1wcm_A 1y1v_A 1y1w_A 1y1y_A 1y77_A* ... Length = 1733 | Back alignment and structure |
|---|
| >1twf_A B220, DNA-directed RNA polymerase II largest subunit; transcription, mRNA, multiprotein complex; HET: UTP; 2.30A {Saccharomyces cerevisiae} SCOP: e.29.1.2 PDB: 1i3q_A 1i6h_A 1k83_A* 1nik_A 1nt9_A 1pqv_A 1r5u_A 1r9s_A* 1r9t_A* 1sfo_A* 1twa_A* 1twc_A* 1i50_A* 1twg_A* 1twh_A* 1wcm_A 1y1v_A 1y1w_A 1y1y_A 1y77_A* ... Length = 1733 | Back alignment and structure |
|---|
| >1twf_A B220, DNA-directed RNA polymerase II largest subunit; transcription, mRNA, multiprotein complex; HET: UTP; 2.30A {Saccharomyces cerevisiae} SCOP: e.29.1.2 PDB: 1i3q_A 1i6h_A 1k83_A* 1nik_A 1nt9_A 1pqv_A 1r5u_A 1r9s_A* 1r9t_A* 1sfo_A* 1twa_A* 1twc_A* 1i50_A* 1twg_A* 1twh_A* 1wcm_A 1y1v_A 1y1w_A 1y1y_A 1y77_A* ... Length = 1733 | Back alignment and structure |
|---|
| >1twf_A B220, DNA-directed RNA polymerase II largest subunit; transcription, mRNA, multiprotein complex; HET: UTP; 2.30A {Saccharomyces cerevisiae} SCOP: e.29.1.2 PDB: 1i3q_A 1i6h_A 1k83_A* 1nik_A 1nt9_A 1pqv_A 1r5u_A 1r9s_A* 1r9t_A* 1sfo_A* 1twa_A* 1twc_A* 1i50_A* 1twg_A* 1twh_A* 1wcm_A 1y1v_A 1y1w_A 1y1y_A 1y77_A* ... Length = 1733 | Back alignment and structure |
|---|
| >1twf_A B220, DNA-directed RNA polymerase II largest subunit; transcription, mRNA, multiprotein complex; HET: UTP; 2.30A {Saccharomyces cerevisiae} SCOP: e.29.1.2 PDB: 1i3q_A 1i6h_A 1k83_A* 1nik_A 1nt9_A 1pqv_A 1r5u_A 1r9s_A* 1r9t_A* 1sfo_A* 1twa_A* 1twc_A* 1i50_A* 1twg_A* 1twh_A* 1wcm_A 1y1v_A 1y1w_A 1y1y_A 1y77_A* ... Length = 1733 | Back alignment and structure |
|---|
| >1twf_A B220, DNA-directed RNA polymerase II largest subunit; transcription, mRNA, multiprotein complex; HET: UTP; 2.30A {Saccharomyces cerevisiae} SCOP: e.29.1.2 PDB: 1i3q_A 1i6h_A 1k83_A* 1nik_A 1nt9_A 1pqv_A 1r5u_A 1r9s_A* 1r9t_A* 1sfo_A* 1twa_A* 1twc_A* 1i50_A* 1twg_A* 1twh_A* 1wcm_A 1y1v_A 1y1w_A 1y1y_A 1y77_A* ... Length = 1733 | Back alignment and structure |
|---|
| >3h0g_A DNA-directed RNA polymerase II subunit RPB1; transcription, multi-protein complex, DNA- binding, magnesium; 3.65A {Schizosaccharomyces pombe} Length = 1752 | Back alignment and structure |
|---|
| >3h0g_A DNA-directed RNA polymerase II subunit RPB1; transcription, multi-protein complex, DNA- binding, magnesium; 3.65A {Schizosaccharomyces pombe} Length = 1752 | Back alignment and structure |
|---|
| >3h0g_A DNA-directed RNA polymerase II subunit RPB1; transcription, multi-protein complex, DNA- binding, magnesium; 3.65A {Schizosaccharomyces pombe} Length = 1752 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1m2v_B SEC24, protein transport protein SEC24, SEC24P, SEC24 protein, abnormal nuclear; zinc-finger, beta barrel, VWA domain, gelsolin domain,; 2.75A {Saccharomyces cerevisiae} SCOP: a.71.2.1 b.2.8.1 c.62.1.2 d.109.2.1 g.41.10.1 Length = 926 | Back alignment and structure |
|---|
| >1m2v_B SEC24, protein transport protein SEC24, SEC24P, SEC24 protein, abnormal nuclear; zinc-finger, beta barrel, VWA domain, gelsolin domain,; 2.75A {Saccharomyces cerevisiae} SCOP: a.71.2.1 b.2.8.1 c.62.1.2 d.109.2.1 g.41.10.1 Length = 926 | Back alignment and structure |
|---|
| >1m2v_B SEC24, protein transport protein SEC24, SEC24P, SEC24 protein, abnormal nuclear; zinc-finger, beta barrel, VWA domain, gelsolin domain,; 2.75A {Saccharomyces cerevisiae} SCOP: a.71.2.1 b.2.8.1 c.62.1.2 d.109.2.1 g.41.10.1 Length = 926 | Back alignment and structure |
|---|
| >1m2v_B SEC24, protein transport protein SEC24, SEC24P, SEC24 protein, abnormal nuclear; zinc-finger, beta barrel, VWA domain, gelsolin domain,; 2.75A {Saccharomyces cerevisiae} SCOP: a.71.2.1 b.2.8.1 c.62.1.2 d.109.2.1 g.41.10.1 Length = 926 | Back alignment and structure |
|---|
| >1m2v_B SEC24, protein transport protein SEC24, SEC24P, SEC24 protein, abnormal nuclear; zinc-finger, beta barrel, VWA domain, gelsolin domain,; 2.75A {Saccharomyces cerevisiae} SCOP: a.71.2.1 b.2.8.1 c.62.1.2 d.109.2.1 g.41.10.1 Length = 926 | Back alignment and structure |
|---|
| >1m2v_B SEC24, protein transport protein SEC24, SEC24P, SEC24 protein, abnormal nuclear; zinc-finger, beta barrel, VWA domain, gelsolin domain,; 2.75A {Saccharomyces cerevisiae} SCOP: a.71.2.1 b.2.8.1 c.62.1.2 d.109.2.1 g.41.10.1 Length = 926 | Back alignment and structure |
|---|
| >1pk8_A RAT synapsin I; ATP binding, ATP grAsp, calcium (II) ION, membrane protein; HET: ATP; 2.10A {Rattus norvegicus} SCOP: c.30.1.5 d.142.1.3 PDB: 1px2_A* Length = 422 | Back alignment and structure |
|---|
| >1pk8_A RAT synapsin I; ATP binding, ATP grAsp, calcium (II) ION, membrane protein; HET: ATP; 2.10A {Rattus norvegicus} SCOP: c.30.1.5 d.142.1.3 PDB: 1px2_A* Length = 422 | Back alignment and structure |
|---|
| >3dzy_A Retinoic acid receptor RXR-alpha; DNA-binding, HOST-virus interaction, metal-binding, nucleus, receptor, transcription, transcription regulation, zinc-FIN activator; HET: DNA REA BRL; 3.10A {Homo sapiens} PDB: 3dzu_A* 3e00_A* Length = 467 | Back alignment and structure |
|---|
| >3dzy_A Retinoic acid receptor RXR-alpha; DNA-binding, HOST-virus interaction, metal-binding, nucleus, receptor, transcription, transcription regulation, zinc-FIN activator; HET: DNA REA BRL; 3.10A {Homo sapiens} PDB: 3dzu_A* 3e00_A* Length = 467 | Back alignment and structure |
|---|
| >3dzy_A Retinoic acid receptor RXR-alpha; DNA-binding, HOST-virus interaction, metal-binding, nucleus, receptor, transcription, transcription regulation, zinc-FIN activator; HET: DNA REA BRL; 3.10A {Homo sapiens} PDB: 3dzu_A* 3e00_A* Length = 467 | Back alignment and structure |
|---|
| >3dzy_A Retinoic acid receptor RXR-alpha; DNA-binding, HOST-virus interaction, metal-binding, nucleus, receptor, transcription, transcription regulation, zinc-FIN activator; HET: DNA REA BRL; 3.10A {Homo sapiens} PDB: 3dzu_A* 3e00_A* Length = 467 | Back alignment and structure |
|---|
| >3dzy_A Retinoic acid receptor RXR-alpha; DNA-binding, HOST-virus interaction, metal-binding, nucleus, receptor, transcription, transcription regulation, zinc-FIN activator; HET: DNA REA BRL; 3.10A {Homo sapiens} PDB: 3dzu_A* 3e00_A* Length = 467 | Back alignment and structure |
|---|
| >3dzy_A Retinoic acid receptor RXR-alpha; DNA-binding, HOST-virus interaction, metal-binding, nucleus, receptor, transcription, transcription regulation, zinc-FIN activator; HET: DNA REA BRL; 3.10A {Homo sapiens} PDB: 3dzu_A* 3e00_A* Length = 467 | Back alignment and structure |
|---|
| >3dzy_A Retinoic acid receptor RXR-alpha; DNA-binding, HOST-virus interaction, metal-binding, nucleus, receptor, transcription, transcription regulation, zinc-FIN activator; HET: DNA REA BRL; 3.10A {Homo sapiens} PDB: 3dzu_A* 3e00_A* Length = 467 | Back alignment and structure |
|---|
| >3dzy_A Retinoic acid receptor RXR-alpha; DNA-binding, HOST-virus interaction, metal-binding, nucleus, receptor, transcription, transcription regulation, zinc-FIN activator; HET: DNA REA BRL; 3.10A {Homo sapiens} PDB: 3dzu_A* 3e00_A* Length = 467 | Back alignment and structure |
|---|
| >3v1v_A 2-MIB synthase, 2-methylisoborneol synthase; class I terpenoid cyclase fold, DDXXXXD motif, NDXXSXXXE MOT methylisoborneol biosynthesis; HET: GST; 1.80A {Streptomyces coelicolor} PDB: 3v1x_A* Length = 433 | Back alignment and structure |
|---|
| >3v1v_A 2-MIB synthase, 2-methylisoborneol synthase; class I terpenoid cyclase fold, DDXXXXD motif, NDXXSXXXE MOT methylisoborneol biosynthesis; HET: GST; 1.80A {Streptomyces coelicolor} PDB: 3v1x_A* Length = 433 | Back alignment and structure |
|---|
| >3v1v_A 2-MIB synthase, 2-methylisoborneol synthase; class I terpenoid cyclase fold, DDXXXXD motif, NDXXSXXXE MOT methylisoborneol biosynthesis; HET: GST; 1.80A {Streptomyces coelicolor} PDB: 3v1x_A* Length = 433 | Back alignment and structure |
|---|
| >3v1v_A 2-MIB synthase, 2-methylisoborneol synthase; class I terpenoid cyclase fold, DDXXXXD motif, NDXXSXXXE MOT methylisoborneol biosynthesis; HET: GST; 1.80A {Streptomyces coelicolor} PDB: 3v1x_A* Length = 433 | Back alignment and structure |
|---|
| >3v1v_A 2-MIB synthase, 2-methylisoborneol synthase; class I terpenoid cyclase fold, DDXXXXD motif, NDXXSXXXE MOT methylisoborneol biosynthesis; HET: GST; 1.80A {Streptomyces coelicolor} PDB: 3v1x_A* Length = 433 | Back alignment and structure |
|---|
| >3v1v_A 2-MIB synthase, 2-methylisoborneol synthase; class I terpenoid cyclase fold, DDXXXXD motif, NDXXSXXXE MOT methylisoborneol biosynthesis; HET: GST; 1.80A {Streptomyces coelicolor} PDB: 3v1x_A* Length = 433 | Back alignment and structure |
|---|
| >2wvr_C DNA replication factor CDT1; DNA replication license, DNA replication inhibitor, phosphoprotein, UBL conjugation, DNA-binding, polymorphism; HET: DNA; 3.30A {Homo sapiens} PDB: 2klo_A* Length = 546 | Back alignment and structure |
|---|
| >2wvr_C DNA replication factor CDT1; DNA replication license, DNA replication inhibitor, phosphoprotein, UBL conjugation, DNA-binding, polymorphism; HET: DNA; 3.30A {Homo sapiens} PDB: 2klo_A* Length = 546 | Back alignment and structure |
|---|
| >2xag_A Lysine-specific histone demethylase 1; amine oxidase, chromatin regulator, histone inhibitor binding, methylation, nucleosome core, oxidoreductase; HET: FAD TCF; 3.10A {Homo sapiens} PDB: 2xaf_A* 2xah_A* 2xaj_A* 2xaq_A* 2xas_A* 2com_A Length = 852 | Back alignment and structure |
|---|
| >2xag_A Lysine-specific histone demethylase 1; amine oxidase, chromatin regulator, histone inhibitor binding, methylation, nucleosome core, oxidoreductase; HET: FAD TCF; 3.10A {Homo sapiens} PDB: 2xaf_A* 2xah_A* 2xaj_A* 2xaq_A* 2xas_A* 2com_A Length = 852 | Back alignment and structure |
|---|
| >2xag_A Lysine-specific histone demethylase 1; amine oxidase, chromatin regulator, histone inhibitor binding, methylation, nucleosome core, oxidoreductase; HET: FAD TCF; 3.10A {Homo sapiens} PDB: 2xaf_A* 2xah_A* 2xaj_A* 2xaq_A* 2xas_A* 2com_A Length = 852 | Back alignment and structure |
|---|
| >2v5y_A Receptor-type tyrosine-protein phosphatase MU; membrane, hydrolase, glycoprotein, receptor protei tyrosine phosphatase, cell adhesion; HET: NAG; 3.10A {Homo sapiens} Length = 731 | Back alignment and structure |
|---|
| >3tx7_B Nuclear receptor subfamily 5 group A member 2; LRH-1, beta-catenin, armadillo repeat, nuclear receptor LIGA binding domain, protein binding; HET: P6L; 2.76A {Homo sapiens} Length = 352 | Back alignment and structure |
|---|
| >3tx7_B Nuclear receptor subfamily 5 group A member 2; LRH-1, beta-catenin, armadillo repeat, nuclear receptor LIGA binding domain, protein binding; HET: P6L; 2.76A {Homo sapiens} Length = 352 | Back alignment and structure |
|---|
| >3nwa_A GB, GB-1, GB1, envelope glycoprotein B; coiled-coil, membrane fusion, viral P glycoprotein B, HSV-1, membrane; HET: NAG; 2.26A {Human herpesvirus 1} PDB: 3nwf_A* 3nw8_A* 3nwd_A* Length = 703 | Back alignment and structure |
|---|
| >3nwa_A GB, GB-1, GB1, envelope glycoprotein B; coiled-coil, membrane fusion, viral P glycoprotein B, HSV-1, membrane; HET: NAG; 2.26A {Human herpesvirus 1} PDB: 3nwf_A* 3nw8_A* 3nwd_A* Length = 703 | Back alignment and structure |
|---|
| >3pgw_B SM B; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 3cw1_A Length = 231 | Back alignment and structure |
|---|
| >3pgw_B SM B; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 3cw1_A Length = 231 | Back alignment and structure |
|---|
| >2grx_C Protein TONB; beta barrel, outer membrane, heterocomplex, inter-protein beta sheet, protein-protein, metal transport; HET: GCN KDO GMH FTT DAO MYR FCI; 3.30A {Escherichia coli} SCOP: d.212.1.2 PDB: 1xx3_A Length = 229 | Back alignment and structure |
|---|
| >1w7p_D VPS36P, YLR417W; ESCRT-II complex, endosomal protein sorting, protein transpo; 3.60A {Saccharomyces cerevisiae} SCOP: a.4.5.54 a.4.5.54 Length = 566 | Back alignment and structure |
|---|
| >1zlg_A Anosmin 1; insulin-like growth factor receptor Cys-rich fold, WHEY acidic protein fold, fibronectin type III fold, hormone- growth factor complex; NMR {Homo sapiens} Length = 680 | Back alignment and structure |
|---|
| >3iox_A AGI/II, PA; alpha helix, PPII helix, supersandwich fold, surface adhesin WALL, peptidoglycan-anchor, cell adhesion; HET: PMS; 1.80A {Streptococcus mutans} PDB: 3ipk_A* 1jmm_A Length = 497 | Back alignment and structure |
|---|
| >3iox_A AGI/II, PA; alpha helix, PPII helix, supersandwich fold, surface adhesin WALL, peptidoglycan-anchor, cell adhesion; HET: PMS; 1.80A {Streptococcus mutans} PDB: 3ipk_A* 1jmm_A Length = 497 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch
Original result of HHsearch against PDB70 database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 1184 | |||
| 3n0a_A | 361 | Tyrosine-protein phosphatase auxilin; phosphatase- | 100.0 | |
| 3v0d_A | 339 | Voltage-sensor containing phosphatase; PTP, hydrol | 100.0 | |
| 1d5r_A | 324 | Phosphoinositide phosphotase PTEN; C2 domain, phos | 100.0 | |
| 1v9d_A | 340 | Diaphanous protein homolog 1; helix bundle, protei | 100.0 | |
| 3obv_E | 457 | Protein diaphanous homolog 1; autoinhibition, acti | 100.0 | |
| 2j1d_G | 483 | DAAM1, disheveled-associated activator of morphoge | 100.0 | |
| 4eah_A | 402 | Formin-like protein 3, actin, alpha skeletal muscl | 100.0 | |
| 1ux5_A | 411 | BNI1 protein; structural protein, FH2 actin cytosk | 100.0 | |
| 2c46_A | 241 | MRNA capping enzyme; phosphatase, transferase, hyd | 99.65 | |
| 1yn9_A | 169 | BVP, polynucleotide 5'-phosphatase; RNA triphospha | 99.56 | |
| 3rz2_A | 189 | Protein tyrosine phosphatase type IVA 1; tyrosine | 99.51 | |
| 2img_A | 151 | Dual specificity protein phosphatase 23; DUSP23, V | 99.25 | |
| 4erc_A | 150 | Dual specificity protein phosphatase 23; alpha bet | 99.22 | |
| 1ohe_A | 348 | CDC14B, CDC14B2 phosphatase; protein phosphatase, | 99.21 | |
| 1rxd_A | 159 | Protein tyrosine phosphatase type IVA, member 1; p | 99.16 | |
| 3s4o_A | 167 | Protein tyrosine phosphatase-like protein; structu | 99.11 | |
| 1fpz_A | 212 | Cyclin-dependent kinase inhibitor 3; alpha-beta sa | 99.1 | |
| 1xri_A | 151 | AT1G05000; structural genomics, protein structure | 98.92 | |
| 3rgo_A | 157 | Protein-tyrosine phosphatase mitochondrial 1; phos | 98.9 | |
| 2i6j_A | 161 | Ssoptp, sulfolobus solfataricus protein tyrosine p | 98.81 | |
| 3ezz_A | 144 | Dual specificity protein phosphatase 4; alpha/beta | 98.8 | |
| 3f81_A | 183 | Dual specificity protein phosphatase 3; hydrolase, | 98.78 | |
| 2y96_A | 219 | Dual specificity phosphatase DUPD1; hydrolase; 2.3 | 98.75 | |
| 2hcm_A | 164 | Dual specificity protein phosphatase; structural g | 98.62 | |
| 1zzw_A | 149 | Dual specificity protein phosphatase 10; MKP, PTP, | 98.6 | |
| 2wgp_A | 190 | Dual specificity protein phosphatase 14; MKP6, DUS | 98.58 | |
| 3nme_A | 294 | Ptpkis1 protein, SEX4 glucan phosphatase; dual spe | 98.56 | |
| 2e0t_A | 151 | Dual specificity phosphatase 26; conserved hypothe | 98.54 | |
| 2oud_A | 177 | Dual specificity protein phosphatase 10; A central | 98.54 | |
| 3s4e_A | 144 | Dual specificity protein phosphatase 19; PTP, prot | 98.54 | |
| 1yz4_A | 160 | DUSP15, dual specificity phosphatase-like 15 isofo | 98.52 | |
| 2esb_A | 188 | Dual specificity protein phosphatase 18; alpha/bet | 98.49 | |
| 3emu_A | 161 | Leucine rich repeat and phosphatase domain contain | 98.45 | |
| 1wrm_A | 165 | Dual specificity phosphatase 22; DSP, JNK, hydrola | 98.43 | |
| 2g6z_A | 211 | Dual specificity protein phosphatase 5; alpha/beta | 98.43 | |
| 2hxp_A | 155 | Dual specificity protein phosphatase 9; human phos | 98.42 | |
| 2nt2_A | 145 | Protein phosphatase slingshot homolog 2; alpha/bet | 98.42 | |
| 3cm3_A | 176 | Late protein H1, dual specificity protein phosphat | 98.4 | |
| 2q05_A | 195 | Late protein H1, dual specificity protein phosphat | 98.33 | |
| 2pq5_A | 205 | Dual specificity protein phosphatase 13; hydrolase | 98.32 | |
| 2r0b_A | 154 | Serine/threonine/tyrosine-interacting protein; str | 98.23 | |
| 2j16_A | 182 | SDP-1, tyrosine-protein phosphatase YIL113W; hydro | 98.2 | |
| 2hc1_A | 291 | Receptor-type tyrosine-protein phosphatase beta; p | 97.68 | |
| 2f46_A | 156 | Hypothetical protein; structural genomics, joint c | 97.65 | |
| 1p15_A | 253 | Protein-tyrosine phosphatase alpha; transmembrane, | 97.64 | |
| 1g4w_R | 383 | Protein tyrosine phosphatase SPTP; virulence facto | 97.64 | |
| 1fpr_A | 284 | Protein-tyrosine phosphatase 1C; protein tyrosine | 97.57 | |
| 3mmj_A | 314 | MYO-inositol hexaphosphate phosphohydrolase; phyta | 97.55 | |
| 4az1_A | 302 | Tyrosine specific protein phosphatase; hydrolase, | 97.42 | |
| 2i75_A | 320 | Tyrosine-protein phosphatase non-receptor type 4; | 97.42 | |
| 4grz_A | 288 | Tyrosine-protein phosphatase non-receptor type 6; | 97.36 | |
| 1jln_A | 297 | STEP-like ptpase, protein tyrosine phosphatase, re | 97.35 | |
| 3f41_A | 629 | Phytase; tandem repeat, protein tyrosine phosphata | 97.33 | |
| 2oc3_A | 303 | Tyrosine-protein phosphatase non-receptor type 18; | 97.33 | |
| 1wch_A | 315 | Protein tyrosine phosphatase, non-receptor type 13 | 97.31 | |
| 3b7o_A | 316 | Tyrosine-protein phosphatase non-receptor type 11; | 97.28 | |
| 3f41_A | 629 | Phytase; tandem repeat, protein tyrosine phosphata | 97.27 | |
| 1yfo_A | 302 | D1, receptor protein tyrosine phosphatase alpha; h | 97.24 | |
| 2b49_A | 287 | Protein tyrosine phosphatase, non-receptor type 3; | 97.23 | |
| 3m4u_A | 306 | Tyrosine specific protein phosphatase, putative; p | 97.22 | |
| 1zc0_A | 309 | Tyrosine-protein phosphatase, non-receptor type 7; | 97.22 | |
| 2bzl_A | 325 | Tyrosine-protein phosphatase, non-receptor type 14 | 97.19 | |
| 2i1y_A | 301 | Receptor-type tyrosine-protein phosphatase; recept | 97.18 | |
| 2gjt_A | 295 | Receptor-type tyrosine-protein phosphatase PTPro; | 97.18 | |
| 2cm2_A | 304 | Tyrosine-protein phosphatase non-receptor type 1; | 97.14 | |
| 2ooq_A | 286 | Receptor-type tyrosine-protein phosphatase T; prot | 97.12 | |
| 1l8k_A | 314 | T-cell protein-tyrosine phosphatase; hydrolase; 2. | 97.11 | |
| 2p6x_A | 309 | Tyrosine-protein phosphatase non-receptor type 22; | 97.11 | |
| 2b3o_A | 532 | Tyrosine-protein phosphatase, non-receptor type 6; | 97.08 | |
| 2cjz_A | 305 | Human protein tyrosine phosphatase PTPN5; protein | 97.07 | |
| 3i36_A | 342 | Vascular protein tyrosine phosphatase 1; PTP, hydr | 97.03 | |
| 3s3e_A | 307 | Tyrosine-protein phosphatase 10D; differentiation, | 96.99 | |
| 2jjd_A | 599 | Receptor-type tyrosine-protein phosphatase epsilo; | 96.91 | |
| 2shp_A | 525 | SHP-2, SYP, SHPTP-2; tyrosine phosphatase, insulin | 96.87 | |
| 2h4v_A | 320 | Receptor-type tyrosine-protein phosphatase gamma; | 96.87 | |
| 4i8n_A | 354 | Tyrosine-protein phosphatase non-receptor type 1; | 96.73 | |
| 1lar_A | 575 | Protein (LAR); tyrosine phosphatease, LAR protein, | 96.69 | |
| 4ge6_A | 314 | Tyrosine-protein phosphatase non-receptor type 9; | 96.64 | |
| 1ygr_A | 610 | CD45 protein tyrosine phosphatase; protein tyrosin | 96.61 | |
| 1lyv_A | 306 | Protein-tyrosine phosphatase YOPH; toxin, hydrolas | 96.59 | |
| 3ps5_A | 595 | Tyrosine-protein phosphatase non-receptor type 6; | 96.28 | |
| 1lar_A | 575 | Protein (LAR); tyrosine phosphatease, LAR protein, | 96.28 | |
| 1ygr_A | 610 | CD45 protein tyrosine phosphatase; protein tyrosin | 96.09 | |
| 1ywf_A | 296 | Phosphotyrosine protein phosphatase PTPB; four str | 96.02 | |
| 2jjd_A | 599 | Receptor-type tyrosine-protein phosphatase epsilo; | 95.89 | |
| 1v9d_A | 340 | Diaphanous protein homolog 1; helix bundle, protei | 95.79 | |
| 3gxh_A | 157 | Putative phosphatase (DUF442); YP_001181608.1, str | 95.7 | |
| 2nlk_A | 627 | Protein tyrosine phosphatase, receptor type, G VA | 95.49 | |
| 2nlk_A | 627 | Protein tyrosine phosphatase, receptor type, G VA | 95.3 | |
| 3obv_E | 457 | Protein diaphanous homolog 1; autoinhibition, acti | 95.06 | |
| 1ohe_A | 348 | CDC14B, CDC14B2 phosphatase; protein phosphatase, | 93.78 | |
| 2j1d_G | 483 | DAAM1, disheveled-associated activator of morphoge | 84.58 | |
| 4hpq_C | 413 | ATG17, KLTH0D15642P; autophagy, protein transport; | 83.53 | |
| 3na7_A | 256 | HP0958; flagellar biogenesis, flagellum export, C4 | 83.35 | |
| 1ux5_A | 411 | BNI1 protein; structural protein, FH2 actin cytosk | 80.93 |
| >3n0a_A Tyrosine-protein phosphatase auxilin; phosphatase-like domain, C2 domain, hydrolase; 2.20A {Bos taurus} | Back alignment and structure |
|---|
Probab=100.00 E-value=5.8e-65 Score=583.80 Aligned_cols=309 Identities=19% Similarity=0.323 Sum_probs=253.4
Q ss_pred hccCCCCCceeeeCcEEEecCCCCCCcchhHHhhccHHHHHHHHhhhCCCCcEEEEEeccCCcCcccccccccCCceEEe
Q 001026 8 FYRKPPDGLLEISERVFVFDCCFTTDILEEEEYKEYLGGIVGQLREYFPEASFMVFNFREGEHQSQIGQVLSEYDMTVMD 87 (1184)
Q Consensus 8 ~~~~~~lDLtyIT~RIiams~gfPa~~~~e~~YRN~i~dV~~fL~~~H~~~~y~V~Nl~ee~~~~~~~~~~~~f~~~V~~ 87 (1184)
.|.+.+|||+|||+|||||+ ||++++ |+.|||+|++|++||+++|+|| |+|||||++.|+ .++|+++|.+
T Consensus 16 ~~~~~~LDltyIT~riIam~--~P~~~~-e~~yrn~i~~v~~~L~~~H~~~-y~V~NLse~~Yd------~~~f~~~V~~ 85 (361)
T 3n0a_A 16 SYTKGDLDFTYVTSRIIVMS--FPLDSV-DIGFRNQVDDIRSFLDSRHLDH-YTVYNLSPKSYR------TAKFHSRVSE 85 (361)
T ss_dssp EEESSSCEEEESSSSEEEEE--C-------------CHHHHHHHHHHHTTC-EEEEECSSSCCG------GGSCGGGEEE
T ss_pred HhcCCCccEEEEcCCEEEEE--CCCCCc-hhhhcCCHHHHHHHHHHhCCCe-EEEEECCCCCCC------hhhcCCcEEE
Confidence 37788999999999999995 999987 9999999999999999999995 999999987655 3689999999
Q ss_pred cCCCCCCCCCCcHHHHHHHHHHHHHHHhcCCCcEEEEEecCCCCCchHHHHHHHHHHhhCCCcHHHHHHHHh--------
Q 001026 88 YPRHYEGCPLLTMETVHHFLRSSESWLSLGHQNVLLMHCERGGWPVLAFMLAALLIYRKQFTGEQKTLDMIY-------- 159 (1184)
Q Consensus 88 ~P~~~~~~p~p~L~~l~~~c~~i~~WL~~d~~NVvvvHCk~Gkgr~tg~mia~yLly~~~~~~~~~aL~~~~-------- 159 (1184)
|+ |.|+.+|+++.|++||+.|++||+++++|+|+|||++|+|| ||+||||||+|++.+.++++||++|.
T Consensus 86 ~~--~pD~~~P~l~~l~~~~~~i~~~l~~~~~~~v~VHC~aG~GR-tg~~ia~~Li~~~~~~~~~eAl~~~~~~R~~~~~ 162 (361)
T 3n0a_A 86 CS--WPIRQAPSLHNLFAVCRNMYNWLLQNPKNVCVVHCLDGRAA-SSILVGAMFIFCNLYSTPGPAVRLLYAKRPGIGL 162 (361)
T ss_dssp CC--CCSSSCCCHHHHHHHHHHHHHHHHHCTTCEEEEEECSCTHH-HHHHHHHHHHHTTSCSSHHHHHHHHHHHSTTCCC
T ss_pred ee--cCCCCCCCHHHHHHHHHHHHHHHhcCCCCeEEEEeCCCCcc-HHHHHHHHHHHhcCCCCHHHHHHHHHHhCCCCCC
Confidence 96 55677889999999999999999999999999999999999 99999999999999999999999996
Q ss_pred hhchhhhhcccCCCC----CCC----CC-----ccccCCcCC-CCCceeEEEEEecCCCcccCCCCcEEEeCccCcccee
Q 001026 160 KQAPRELLQLMSPLN----PLP----SQ-----LRVIPNFDG-EGGCCPIFRIYGQDPLMVADRTPKVLFSTPKRSKLVR 225 (1184)
Q Consensus 160 ~pSq~ryl~yfs~Ln----~~P----sq-----lr~VP~f~~-~~gcrP~l~Iy~~~~~~~~~~~~~~lfss~~~~~~~~ 225 (1184)
.+||+|||+||..+. ..| .. |++||.|++ .+||||||+||++ .+.||++.+.++.++
T Consensus 163 ~psQ~ryv~yf~~ll~~~~~~P~~~~L~L~~i~l~~iP~f~~~~~GCrP~~~Iy~~---------~~~v~ss~~~~~~~r 233 (361)
T 3n0a_A 163 SPSHRRYLGYMCDLLADKPYRPHFKPLTIKSITVSPVPFFNKQRNGCRPYCDVLIG---------ETKIYTTCADFERMK 233 (361)
T ss_dssp CHHHHHHHHHHHHHHSSSCCCCCCCCEEEEEEEEESCCCCSTTSSEECEEEEEEET---------TEEEEECCCCGGGSC
T ss_pred CHHHHHHHHHHHHHHhcCCcCCCCceeEEEEEEEecCCcccCCCCCcceEEEEEeC---------CeEEEecCchhhccc
Confidence 389999999998761 122 22 389999997 5899999999987 478999876777788
Q ss_pred eecccCccEEEEeccccccCCeEEEEEecCCc-------CccceeEEEEEeecccccCC--EEEeccccccccccCCCcC
Q 001026 226 HYKQADCELVKIDIHCHIQGDVVLECISLDSD-------QEREEMMFRVMFNTAFIRSN--ILMLNRDEIDILWNSKDLF 296 (1184)
Q Consensus 226 ~~~~~d~~~i~i~~~~~v~GDV~i~~~h~~~~-------~~~~~~~Fr~~FnT~FI~~~--~L~l~k~eLD~~~~~~~~f 296 (1184)
.|.++++ .|+|++++.|+|||+|+|||++.. ...+++||||||||+||++| +|+|+|+|||.++ .+++|
T Consensus 234 ~~~~~~~-~i~i~~~~~l~GDV~v~~~h~~~~~g~~l~~k~~~~~mFr~~FhT~FI~~~~~~l~~~k~eLD~~~-~~~rf 311 (361)
T 3n0a_A 234 EYRVQDG-KIFIPLSITVQGDVVVSMYHLRSTIGSRLQAKVTNTQIFQLQFHTGFIPLDTTVLKFTKPELDACD-VPEKY 311 (361)
T ss_dssp CEEGGGC-CEEEEEEEEECSEEEEEEEEEEEEECTTSCEEEEEEEEEEEEEEGGGSCTTCCEEEEEGGGCBSCC-CGGGS
T ss_pred cccccCc-eEEeCCCCeEECCEEEEEEeCCCccccccccccccceEEEEEeeeeEeeCCceEEEeEhhhccccc-ccccC
Confidence 8988775 578999999999999999998642 23468999999999999987 8999999999854 57999
Q ss_pred CcccceEEEEeccccCCcCCcC-CCCCCccCCCCcHHHHHHHHHh
Q 001026 297 SKEFRAEVLFSEMDAATSLVSV-DLPGIEEKDGLPIEAFAKVQEI 340 (1184)
Q Consensus 297 p~dF~vel~F~~~~~~~~~~~~-~~~~~~~~~~~~~e~f~~~~~~ 340 (1184)
|+||+|||.|+........... --.+.+.|+..+...|+..+|.
T Consensus 312 p~~f~v~l~f~~~~~~r~~~~~~~w~~~~~~~~~~~~~fs~~~e~ 356 (361)
T 3n0a_A 312 PQLFQVTLDVELQPHDKVMELTPPWEHYCTKDVNPSILFSSHQEH 356 (361)
T ss_dssp CTTCEEEEEEEECSSCCCCSSCCGGGGCCCTTCCGGGGCSSHHHH
T ss_pred CCCeEEEEEEEecCCCCCCCCCCCcccCCccCCCchhhcCCHHHh
Confidence 9999999999886655433222 2345667777788888877774
|
| >3v0d_A Voltage-sensor containing phosphatase; PTP, hydrolase; HET: PO4; 1.10A {Ciona intestinalis} PDB: 3v0f_A* 3v0g_A 3v0h_A* 3awf_A 3v0j_A 3awe_A 3awg_A 3v0e_A 3v0i_A | Back alignment and structure |
|---|
| >1d5r_A Phosphoinositide phosphotase PTEN; C2 domain, phosphotidylinositol, hydrolase; HET: TLA; 2.10A {Homo sapiens} SCOP: b.7.1.1 c.45.1.1 | Back alignment and structure |
|---|
| >1v9d_A Diaphanous protein homolog 1; helix bundle, protein binding; 2.60A {Mus musculus} SCOP: a.207.1.1 | Back alignment and structure |
|---|
| >3obv_E Protein diaphanous homolog 1; autoinhibition, actin, nucleation, cytoskeleton, structural; HET: SUC; 2.75A {Mus musculus} PDB: 3o4x_E 2bap_D | Back alignment and structure |
|---|
| >2j1d_G DAAM1, disheveled-associated activator of morphogenesis; actin assembly, protein binding; 2.55A {Homo sapiens} PDB: 2z6e_A | Back alignment and structure |
|---|
| >4eah_A Formin-like protein 3, actin, alpha skeletal muscle; ATP binding, cytoskeleton, FMNL3, protein BIN; HET: ATP; 3.40A {Mus musculus} | Back alignment and structure |
|---|
| >1ux5_A BNI1 protein; structural protein, FH2 actin cytoskeleton; 2.5A {Saccharomyces cerevisiae} SCOP: a.207.1.1 PDB: 1y64_B* 1ux4_A | Back alignment and structure |
|---|
| >2c46_A MRNA capping enzyme; phosphatase, transferase, hydrolase, mRNA processing, multifunctional enzyme, nucleotidyltransferase; 1.6A {Homo sapiens} PDB: 1i9s_A 1i9t_A | Back alignment and structure |
|---|
| >1yn9_A BVP, polynucleotide 5'-phosphatase; RNA triphosphatase, cysteine phosphatase, P-loop, hydrolase; HET: PO4; 1.50A {Autographa californicanucleopolyhedrovirus} | Back alignment and structure |
|---|
| >3rz2_A Protein tyrosine phosphatase type IVA 1; tyrosine phosphatase, dual specific phosphatase, COMP with peptide, hydrolase; 2.80A {Rattus norvegicus} PDB: 1x24_A 1zcl_A | Back alignment and structure |
|---|
| >2img_A Dual specificity protein phosphatase 23; DUSP23, VHZ, LDP-3, dual specicity protein phosphatase 23, DUS23_human, malate, structural genomics, PSI; 1.93A {Homo sapiens} | Back alignment and structure |
|---|
| >4erc_A Dual specificity protein phosphatase 23; alpha beta, phosphatase(hydrolase), hydrolase; 1.15A {Homo sapiens} PDB: 2img_A | Back alignment and structure |
|---|
| >1ohe_A CDC14B, CDC14B2 phosphatase; protein phosphatase, cell cycle, hydrolase; HET: SEP; 2.20A {Homo sapiens} SCOP: c.45.1.1 c.45.1.1 PDB: 1ohc_A 1ohd_A | Back alignment and structure |
|---|
| >1rxd_A Protein tyrosine phosphatase type IVA, member 1; protein tyrosine phosphatase IVA1...; structural genomics, NYSGXRC, unknown function, PSI; 1.90A {Homo sapiens} SCOP: c.45.1.1 PDB: 1xm2_A 1zck_A 1r6h_A 1v3a_A | Back alignment and structure |
|---|
| >3s4o_A Protein tyrosine phosphatase-like protein; structural genomics, medical structural genomics of pathogen protozoa, MSGPP, unknown function; HET: MSE EPE; 2.30A {Leishmania major} | Back alignment and structure |
|---|
| >1fpz_A Cyclin-dependent kinase inhibitor 3; alpha-beta sandwich, hydrolase; 2.00A {Homo sapiens} SCOP: c.45.1.1 PDB: 1fq1_A* | Back alignment and structure |
|---|
| >1xri_A AT1G05000; structural genomics, protein structure initiative, CESG for eukaryotic structural genomics, phosphoprote phosphatase; 3.30A {Arabidopsis thaliana} SCOP: c.45.1.1 PDB: 2q47_A | Back alignment and structure |
|---|
| >3rgo_A Protein-tyrosine phosphatase mitochondrial 1; phosphatidylglycerol phosphate (PGP) phosphatase, hydrolase; 1.93A {Mus musculus} PDB: 3rgq_A* | Back alignment and structure |
|---|
| >2i6j_A Ssoptp, sulfolobus solfataricus protein tyrosine phosphatase; PTP domain, hydrolase; 1.66A {Sulfolobus solfataricus} PDB: 2i6i_A 2i6m_A 3ro1_A* 2i6o_A* 2dxp_A* 2i6p_A* | Back alignment and structure |
|---|
| >3ezz_A Dual specificity protein phosphatase 4; alpha/beta, hydrolase, nucleus; 2.90A {Homo sapiens} SCOP: c.45.1.1 PDB: 1m3g_A | Back alignment and structure |
|---|
| >3f81_A Dual specificity protein phosphatase 3; hydrolase, protein dual-specificity phosphatase, inhibitor; HET: STT; 1.90A {Homo sapiens} SCOP: c.45.1.1 PDB: 1vhr_A* 1j4x_A* | Back alignment and structure |
|---|
| >2y96_A Dual specificity phosphatase DUPD1; hydrolase; 2.38A {Homo sapiens} | Back alignment and structure |
|---|
| >2hcm_A Dual specificity protein phosphatase; structural genomics, PSI, protein structure INI NEW YORK SGX research center for structural genomics; 2.00A {Mus musculus} | Back alignment and structure |
|---|
| >1zzw_A Dual specificity protein phosphatase 10; MKP, PTP, hydrolase; 1.60A {Homo sapiens} | Back alignment and structure |
|---|
| >2wgp_A Dual specificity protein phosphatase 14; MKP6, DUSP14, hydrolase, dual specifici phosphatase; 1.88A {Homo sapiens} | Back alignment and structure |
|---|
| >3nme_A Ptpkis1 protein, SEX4 glucan phosphatase; dual specificity phosphatase, carbohydrate BIND hydrolase; 2.40A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >2e0t_A Dual specificity phosphatase 26; conserved hypothetical protein, structural genomics, NPPSFA, project on protein structural and functional analyses; 1.67A {Homo sapiens} | Back alignment and structure |
|---|
| >2oud_A Dual specificity protein phosphatase 10; A central five-stranded B-sheet, hydrolase; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >3s4e_A Dual specificity protein phosphatase 19; PTP, protein tyrosine phosphatase, hydrolase; 1.26A {Homo sapiens} | Back alignment and structure |
|---|
| >1yz4_A DUSP15, dual specificity phosphatase-like 15 isoform A; hydrolase; HET: BOG; 2.40A {Homo sapiens} | Back alignment and structure |
|---|
| >2esb_A Dual specificity protein phosphatase 18; alpha/beta structure, hydrolase; HET: EPE; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >3emu_A Leucine rich repeat and phosphatase domain containing protein; structural genomics, hydrolase, PSI-2, protein structure initiative; 2.30A {Entamoeba histolytica} | Back alignment and structure |
|---|
| >1wrm_A Dual specificity phosphatase 22; DSP, JNK, hydrolase; HET: MES; 1.50A {Homo sapiens} | Back alignment and structure |
|---|
| >2g6z_A Dual specificity protein phosphatase 5; alpha/beta, hydrolase; 2.70A {Homo sapiens} | Back alignment and structure |
|---|
| >2hxp_A Dual specificity protein phosphatase 9; human phosphatase, structural genomics, PSI-2, protein structure initiative; 1.83A {Homo sapiens} PDB: 3lj8_A 1mkp_A | Back alignment and structure |
|---|
| >2nt2_A Protein phosphatase slingshot homolog 2; alpha/beta hydrolase; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >3cm3_A Late protein H1, dual specificity protein phosphatase; dual-specificity phosphatase, VH1, hydrolase; 1.32A {Vaccinia virus} PDB: 2rf6_A 2p4d_A | Back alignment and structure |
|---|
| >2q05_A Late protein H1, dual specificity protein phosphatase; structural genomics, APC7320, P protein structure initiative; HET: MSE; 2.57A {Vaccinia virus WR} | Back alignment and structure |
|---|
| >2pq5_A Dual specificity protein phosphatase 13; hydrolase, dual specificity phosphatase, DUSP13, testis and skeletal muscle specific DSP; 2.30A {Homo sapiens} PDB: 2gwo_A | Back alignment and structure |
|---|
| >2r0b_A Serine/threonine/tyrosine-interacting protein; structural genomics, phosphatase, PSI-2, protein structure initiative; 1.60A {Homo sapiens} | Back alignment and structure |
|---|
| >2hc1_A Receptor-type tyrosine-protein phosphatase beta; protein tyrosine phosphatase, WPD-loop, sulfamic acid, inhibitor, drug design, hydrolase; 1.30A {Homo sapiens} PDB: 2h03_A 2hc2_A 2i4g_A* 2h04_A* 2h02_A 2i3u_A 2i3r_A 2i4e_A* 2i4h_A* 2i5x_A* 2ahs_A | Back alignment and structure |
|---|
| >2f46_A Hypothetical protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2, hydrolase; HET: MSE; 1.41A {Neisseria meningitidis Z2491} | Back alignment and structure |
|---|
| >1p15_A Protein-tyrosine phosphatase alpha; transmembrane, hydrolase, phosphorylation; 2.00A {Mus musculus} SCOP: c.45.1.2 | Back alignment and structure |
|---|
| >1g4w_R Protein tyrosine phosphatase SPTP; virulence factor, GTPase activating protein, 4-helix bundle, disorder, signaling protein; 2.20A {Salmonella typhimurium} SCOP: a.24.11.1 c.45.1.2 PDB: 1g4u_S | Back alignment and structure |
|---|
| >1fpr_A Protein-tyrosine phosphatase 1C; protein tyrosine phosphatase, substrate specificity, residue shift, signaling protein; HET: PTR; 2.50A {Homo sapiens} SCOP: c.45.1.2 PDB: 1gwz_A | Back alignment and structure |
|---|
| >3mmj_A MYO-inositol hexaphosphate phosphohydrolase; phytase, protein tyrosine phosphatase, inositol phosphate, I phosphatase; HET: IHP; 1.60A {Selenomonas ruminantium} SCOP: c.45.1.4 PDB: 1u24_A 1u25_A* 1u26_A* 3o3l_A* 3moz_A* 2pt0_A 2psz_A 3d1h_A 3d1o_A 3d1q_A 2b4u_A 2b4p_A 2b4o_A | Back alignment and structure |
|---|
| >4az1_A Tyrosine specific protein phosphatase; hydrolase, drug design; 2.18A {Trypanosoma cruzi} | Back alignment and structure |
|---|
| >2i75_A Tyrosine-protein phosphatase non-receptor type 4; PTPN4, PTP, tyrosine phosphatase, MEG-1, structural genomics structural genomics consortium, SGC; 2.45A {Homo sapiens} | Back alignment and structure |
|---|
| >4grz_A Tyrosine-protein phosphatase non-receptor type 6; phosphatase domain, hydrolase; 1.37A {Homo sapiens} PDB: 4gry_A 4gs0_A* 1gwz_A 1fpr_A* | Back alignment and structure |
|---|
| >1jln_A STEP-like ptpase, protein tyrosine phosphatase, receptor type, R; PTP-SL, PTPBR7, ERK2-MAP kinase regulation, hydrolase; 1.81A {Mus musculus} SCOP: c.45.1.2 PDB: 2a8b_A | Back alignment and structure |
|---|
| >3f41_A Phytase; tandem repeat, protein tyrosine phosphatase, inositol phosphatase, hydrolase; 2.30A {Mitsuokella multacida} | Back alignment and structure |
|---|
| >2oc3_A Tyrosine-protein phosphatase non-receptor type 18; protein tyrosine phosphatase, human, structural genomics, structural genomics consortium, SGC; 1.50A {Homo sapiens} | Back alignment and structure |
|---|
| >1wch_A Protein tyrosine phosphatase, non-receptor type 13; hydrolase, phosphate ION, colorectal cancer alternative splicing, coiled coil, cytoskeleton; 1.85A {Homo sapiens} SCOP: c.45.1.2 | Back alignment and structure |
|---|
| >3b7o_A Tyrosine-protein phosphatase non-receptor type 11; SHP2, PTPN11, tyrosine phosphatase, structural genomics, STR genomics consortium, SGC, deafness; 1.60A {Homo sapiens} PDB: 3jrl_A* 3mow_A* 3o5x_A* | Back alignment and structure |
|---|
| >3f41_A Phytase; tandem repeat, protein tyrosine phosphatase, inositol phosphatase, hydrolase; 2.30A {Mitsuokella multacida} | Back alignment and structure |
|---|
| >1yfo_A D1, receptor protein tyrosine phosphatase alpha; hydrolase, signal transduction, glycoprotein, phosphorylation, signal; 2.25A {Mus musculus} SCOP: c.45.1.2 | Back alignment and structure |
|---|
| >2b49_A Protein tyrosine phosphatase, non-receptor type 3; human, STRU genomics, structural genomics consortium, SGC, hydrolase; 1.54A {Homo sapiens} | Back alignment and structure |
|---|
| >3m4u_A Tyrosine specific protein phosphatase, putative; protein tyrosine phosphatase, hydrolase; 2.39A {Trypanosoma brucei} | Back alignment and structure |
|---|
| >1zc0_A Tyrosine-protein phosphatase, non-receptor type 7; heptp, human tyrosine phosphatase catalytic domain, LC-PTP, hydrolase; 1.85A {Homo sapiens} PDB: 2gp0_A 2qdc_A 2hvl_A 2qdp_A 2qdm_A 3o4s_A 3o4t_A* 3o4u_A* 3d44_A* 3d42_A* 2a3k_A | Back alignment and structure |
|---|
| >2bzl_A Tyrosine-protein phosphatase, non-receptor type 14; PTPN14, hydrolase; 1.65A {Homo sapiens} | Back alignment and structure |
|---|
| >2i1y_A Receptor-type tyrosine-protein phosphatase; receptor-type protein tyrosine phosphatase precursor, phosph structural genomics, PSI; 2.23A {Homo sapiens} PDB: 2qep_A | Back alignment and structure |
|---|
| >2gjt_A Receptor-type tyrosine-protein phosphatase PTPro; tyrosine phosphatase, glepp1, PTPU2, structural genom structural genomics consortium, SGC; 2.15A {Homo sapiens} PDB: 2g59_A 2pi7_A | Back alignment and structure |
|---|
| >2cm2_A Tyrosine-protein phosphatase non-receptor type 1; polymorphism, phosphorylation, endoplasmic reticulum, oxidation, hydrolase, acetylation; 1.5A {Homo sapiens} SCOP: c.45.1.2 PDB: 2cm3_A 2cmb_A* 2cmc_A* 2cne_A* 3a5j_A 2cma_A 3a5k_A 3eu0_A 3sme_A 2azr_A* 2b07_A* 2h4g_A* 2h4k_A* 2hb1_A* 2qbp_A* 2qbq_A* 2qbr_A* 2qbs_A* 2zmm_A* 2zn7_A* ... | Back alignment and structure |
|---|
| >2ooq_A Receptor-type tyrosine-protein phosphatase T; protein tyrosine phosphatase, human, structural GE structural genomics consortium, SGC, hydrolase; HET: B3P; 1.80A {Homo sapiens} PDB: 1rpm_A 2c7s_A | Back alignment and structure |
|---|
| >1l8k_A T-cell protein-tyrosine phosphatase; hydrolase; 2.56A {Homo sapiens} SCOP: c.45.1.2 | Back alignment and structure |
|---|
| >2p6x_A Tyrosine-protein phosphatase non-receptor type 22; tyrosine phosphatase, lymphoid phosphatase, PEP, LYP, struct genomics; 1.90A {Homo sapiens} PDB: 3h2x_A 3brh_A 2qct_A* 2qcj_A* 3olr_A* 3omh_A* | Back alignment and structure |
|---|
| >2b3o_A Tyrosine-protein phosphatase, non-receptor type 6; protein tyrosine phosphatase, SHP-1, signaling, hydrolase; 2.80A {Homo sapiens} PDB: 1x6c_A 2rmx_A* 2yu7_A* | Back alignment and structure |
|---|
| >2cjz_A Human protein tyrosine phosphatase PTPN5; protein phosphatase, STEP, hydrolase; HET: PTR; 1.70A {Homo sapiens} PDB: 2bij_A 2bv5_A* | Back alignment and structure |
|---|
| >3i36_A Vascular protein tyrosine phosphatase 1; PTP, hydrolase; 1.84A {Rattus norvegicus} PDB: 2nz6_A 2cfv_A | Back alignment and structure |
|---|
| >3s3e_A Tyrosine-protein phosphatase 10D; differentiation, neurogenesis, signal transduction, developm protein, hydrolase; 2.40A {Drosophila melanogaster} PDB: 3s3f_A 3s3h_A* 3s3k_A* | Back alignment and structure |
|---|
| >2jjd_A Receptor-type tyrosine-protein phosphatase epsilo; transmembrane, phosphoprotein, consorti structural, glycoprotein, SGC, PTPRE, membrane genomics; 3.20A {Homo sapiens} | Back alignment and structure |
|---|
| >2shp_A SHP-2, SYP, SHPTP-2; tyrosine phosphatase, insulin signaling, SH2 protein; HET: CAT; 2.00A {Homo sapiens} SCOP: c.45.1.2 d.93.1.1 d.93.1.1 | Back alignment and structure |
|---|
| >2h4v_A Receptor-type tyrosine-protein phosphatase gamma; tyrosine receptor phosphatase, human, structural GENO structural genomics consortium, SGC; HET: FLC; 1.55A {Homo sapiens} PDB: 3qcd_A 3qcc_A 3qcb_A 3qce_A* 3qcf_A* 3qcg_A* 3qch_A* 3qci_A* 3qcj_A* 3qck_A* 2pbn_A 2hy3_A 3qcm_A* 3qcl_A* 3qcn_A | Back alignment and structure |
|---|
| >4i8n_A Tyrosine-protein phosphatase non-receptor type 1; PTP1B, hydrolase-hydrolase inhibitor CO; HET: 1CG; 2.50A {Homo sapiens} | Back alignment and structure |
|---|
| >1lar_A Protein (LAR); tyrosine phosphatease, LAR protein, hydrolase; 2.00A {Homo sapiens} SCOP: c.45.1.2 c.45.1.2 PDB: 2fh7_A 2nv5_A | Back alignment and structure |
|---|
| >4ge6_A Tyrosine-protein phosphatase non-receptor type 9; hydrolase-hydrolase inhibitor complex; HET: B26; 1.40A {Homo sapiens} PDB: 4ge2_A* 4ge5_A* 2pa5_A* | Back alignment and structure |
|---|
| >1ygr_A CD45 protein tyrosine phosphatase; protein tyrosine phosphatase, RPTP, LCA, lymphocyte activation, hydrolase; HET: PTR; 2.90A {Homo sapiens} PDB: 1ygu_A* | Back alignment and structure |
|---|
| >1lyv_A Protein-tyrosine phosphatase YOPH; toxin, hydrolase; 1.36A {Yersinia enterocolitica} SCOP: c.45.1.2 PDB: 1qz0_A* 1ytn_A 1ytw_A 2i42_A 2y2f_A* 2ydu_A* 1xxp_A* 3blu_A* 1ypt_A* 3blt_A* 1xxv_A* 3f9b_A 3f9a_A 3f99_A 3bm8_A* 1pa9_A* 1yts_A | Back alignment and structure |
|---|
| >3ps5_A Tyrosine-protein phosphatase non-receptor type 6; SH2, PTP, hydrolase, signaling protein; 3.10A {Homo sapiens} | Back alignment and structure |
|---|
| >1lar_A Protein (LAR); tyrosine phosphatease, LAR protein, hydrolase; 2.00A {Homo sapiens} SCOP: c.45.1.2 c.45.1.2 PDB: 2fh7_A 2nv5_A | Back alignment and structure |
|---|
| >1ygr_A CD45 protein tyrosine phosphatase; protein tyrosine phosphatase, RPTP, LCA, lymphocyte activation, hydrolase; HET: PTR; 2.90A {Homo sapiens} PDB: 1ygu_A* | Back alignment and structure |
|---|
| >1ywf_A Phosphotyrosine protein phosphatase PTPB; four stranded parallel beta sheet with flanking helices, structural genomics, PSI; 1.71A {Mycobacterium tuberculosis} SCOP: c.45.1.5 PDB: 2oz5_A* | Back alignment and structure |
|---|
| >2jjd_A Receptor-type tyrosine-protein phosphatase epsilo; transmembrane, phosphoprotein, consorti structural, glycoprotein, SGC, PTPRE, membrane genomics; 3.20A {Homo sapiens} | Back alignment and structure |
|---|
| >1v9d_A Diaphanous protein homolog 1; helix bundle, protein binding; 2.60A {Mus musculus} SCOP: a.207.1.1 | Back alignment and structure |
|---|
| >3gxh_A Putative phosphatase (DUF442); YP_001181608.1, structural GE joint center for structural genomics, JCSG; HET: MSE; 1.40A {Shewanella putrefaciens cn-32} PDB: 3gxg_A* | Back alignment and structure |
|---|
| >2nlk_A Protein tyrosine phosphatase, receptor type, G VA (fragment); PTPRG, R-PTP gamma, protein tyrosine phosphatase gamma, D3S1 HPTPG, RPTPG, PTPG; 2.40A {Homo sapiens} | Back alignment and structure |
|---|
| >2nlk_A Protein tyrosine phosphatase, receptor type, G VA (fragment); PTPRG, R-PTP gamma, protein tyrosine phosphatase gamma, D3S1 HPTPG, RPTPG, PTPG; 2.40A {Homo sapiens} | Back alignment and structure |
|---|
| >3obv_E Protein diaphanous homolog 1; autoinhibition, actin, nucleation, cytoskeleton, structural; HET: SUC; 2.75A {Mus musculus} PDB: 3o4x_E 2bap_D | Back alignment and structure |
|---|
| >1ohe_A CDC14B, CDC14B2 phosphatase; protein phosphatase, cell cycle, hydrolase; HET: SEP; 2.20A {Homo sapiens} SCOP: c.45.1.1 c.45.1.1 PDB: 1ohc_A 1ohd_A | Back alignment and structure |
|---|
| >2j1d_G DAAM1, disheveled-associated activator of morphogenesis; actin assembly, protein binding; 2.55A {Homo sapiens} PDB: 2z6e_A | Back alignment and structure |
|---|
| >4hpq_C ATG17, KLTH0D15642P; autophagy, protein transport; 3.06A {Lachancea thermotolerans cbs 6340} | Back alignment and structure |
|---|
| >3na7_A HP0958; flagellar biogenesis, flagellum export, C4 Zn-ribbon, coiled post-transcriptional, gene regulation, chaperone; HET: EPE; 2.20A {Helicobacter pylori} | Back alignment and structure |
|---|
| >1ux5_A BNI1 protein; structural protein, FH2 actin cytoskeleton; 2.5A {Saccharomyces cerevisiae} SCOP: a.207.1.1 PDB: 1y64_B* 1ux4_A | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST
Original result of RPS-BLAST against SCOP70(version1.75) database
| ID | Alignment Graph | Length |
Definition |
E-value |
| 1184 | ||||
| d1v9da_ | 332 | a.207.1.1 (A:) Diaphanous protein homolog 1, dia1 | 5e-55 | |
| d1ux5a_ | 411 | a.207.1.1 (A:) Bni1 {Baker's yeast (Saccharomyces | 2e-41 | |
| d1d5ra1 | 141 | b.7.1.1 (A:188-351) Pten tumor suppressor (Phoshph | 4e-31 | |
| d1d5ra2 | 174 | c.45.1.1 (A:14-187) Phoshphoinositide phosphatase | 5e-17 |
| >d1v9da_ a.207.1.1 (A:) Diaphanous protein homolog 1, dia1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 332 | Back information, alignment and structure |
|---|
class: All alpha proteins fold: Formin homology 2 domain (FH2 domain) superfamily: Formin homology 2 domain (FH2 domain) family: Formin homology 2 domain (FH2 domain) domain: Diaphanous protein homolog 1, dia1 species: Mouse (Mus musculus) [TaxId: 10090]
Score = 192 bits (490), Expect = 5e-55
Identities = 62/325 (19%), Positives = 119/325 (36%), Gaps = 88/325 (27%)
Query: 931 IELRRANNCEIMLTKVKIPLPDLM------------------------------------ 954
++ + A N I L ++P ++
Sbjct: 7 LDSKTAQNLSIFLGSFRMPYQEIKNVILEVNEAVLTESMIQNLIKQMPEPEQLKMLSELK 66
Query: 955 -----------FFLELMKVPRVESKLRVFSFKIQFQT-----------------QVRNSI 986
F + + VPR+ +L FK+QF ++R S
Sbjct: 67 EEYDDLAESEQFGVVMGTVPRLRPRLNAILFKLQFSEQVENIKPEIVSVTAACEELRKSE 126
Query: 987 KLKRIMQTILSLGNALNHGTARGSAVGFRLDSLLKLTDTRARNNKMTLMHYLC------- 1039
+++ L +GN +N G+ A GF + L KL DT++ + KMTL+H+L
Sbjct: 127 NFSSLLELTLLVGNYMNAGSRNAGAFGFNISFLCKLRDTKSADQKMTLLHFLAELCENDH 186
Query: 1040 -----------------KIQLKFLAEEMQAISKGLEKVVQELTASENDGEVSGNFCKLLK 1082
++ + L + + + K + V +++ + F + +
Sbjct: 187 PEVLKFPDELAHVEKASRVSAENLQKSLDQMKKQIADVERDVQNFPAATDEKDKFVEKMT 246
Query: 1083 EFLSYAEGEVRSLALLYSSVGRNADALAQYFGEDPARCPFEQVVSTLLNFVKMFVLAHEE 1142
F+ A+ + L +++S++ L YF DP + E+ L NF MF+ A +E
Sbjct: 247 SFVKDAQEQYNKLRMMHSNMETLYKELGDYFVFDPKKLSVEEFFMDLHNFRNMFLQAVKE 306
Query: 1143 NCRQLEFERKKAEKAVENEKLKTQK 1167
N ++ E E K + EK + ++
Sbjct: 307 NQKRRETEEKMRRAKLAKEKAEKER 331
|
| >d1ux5a_ a.207.1.1 (A:) Bni1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 411 | Back information, alignment and structure |
|---|
| >d1d5ra1 b.7.1.1 (A:188-351) Pten tumor suppressor (Phoshphoinositide phosphatase), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 141 | Back information, alignment and structure |
|---|
| >d1d5ra2 c.45.1.1 (A:14-187) Phoshphoinositide phosphatase Pten (Pten tumor suppressor), N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 174 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch
Original result of HHsearch against SCOP70(version1.75) database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 1184 | |||
| d1v9da_ | 332 | Diaphanous protein homolog 1, dia1 {Mouse (Mus mus | 100.0 | |
| d1ux5a_ | 411 | Bni1 {Baker's yeast (Saccharomyces cerevisiae) [Ta | 100.0 | |
| d1d5ra2 | 174 | Phoshphoinositide phosphatase Pten (Pten tumor sup | 100.0 | |
| d1d5ra1 | 141 | Pten tumor suppressor (Phoshphoinositide phosphata | 99.93 | |
| d1i9sa_ | 194 | mRNA capping enzyme, triphosphatase domain {Mouse | 99.72 | |
| d1fpza_ | 176 | Kinase associated phosphatase (kap) {Human (Homo s | 99.72 | |
| d1ohea2 | 182 | Proline directed phosphatase CDC14b2 {Human (Homo | 99.63 | |
| d1rxda_ | 152 | Protein tyrosine phosphatase type IVa {Human (Homo | 99.6 | |
| d1mkpa_ | 144 | Mapk phosphatase {Human (Homo sapiens), pyst1 (mkp | 98.56 | |
| d1vhra_ | 178 | VH1-related dual-specificity phosphatase, VHR {Hum | 98.43 | |
| d1xria_ | 151 | Putative phosphatase At1g05000 {Thale cress (Arabi | 98.42 | |
| d1m3ga_ | 145 | Mapk phosphatase {Human (Homo sapiens), pac-1 [Tax | 98.19 | |
| d1g4us2 | 243 | SptP tyrosine phosphatase, catalytic domain {Salmo | 97.45 | |
| d2pt0a1 | 313 | Myo-inositol hexaphosphate phosphohydrolase (phyta | 97.4 | |
| d1wcha_ | 308 | Tyrosine-protein phosphatase, non-receptor type 13 | 96.66 | |
| d2shpa1 | 307 | Tyrosine phosphatase {Human (Homo sapiens), shp-2 | 96.58 | |
| d1l8ka_ | 273 | Tyrosine phosphatase {Human (Homo sapiens), T-cell | 96.45 | |
| d1fpra_ | 284 | Tyrosine phosphatase {Human (Homo sapiens), shp-1 | 96.43 | |
| d1yfoa_ | 288 | Tyrosine phosphatase {Mouse (Mus musculus) [TaxId: | 96.35 | |
| d1jlna_ | 297 | Tyrosine phosphatase {Mouse (Mus musculus), ptp-sl | 96.26 | |
| d1p15a_ | 245 | Protein-tyrosine phosphatase alpha {Mouse (Mus mus | 96.24 | |
| d1lyva_ | 283 | Protein-tyrosine phosphatase YopH, catalytic domai | 96.14 | |
| d1lara1 | 317 | RPTP Lar {Human (Homo sapiens) [TaxId: 9606]} | 96.04 | |
| d2f71a1 | 297 | Tyrosine phosphatase {Human (Homo sapiens), 1B [Ta | 96.01 | |
| d1lara2 | 249 | RPTP Lar {Human (Homo sapiens) [TaxId: 9606]} | 95.71 | |
| d1rpma_ | 278 | Tyrosine phosphatase {Human (Homo sapiens), mu [Ta | 95.69 | |
| d1ywfa1 | 272 | Phosphotyrosine protein phosphatase PtpB {Mycobact | 93.18 | |
| d1v9da_ | 332 | Diaphanous protein homolog 1, dia1 {Mouse (Mus mus | 92.77 | |
| d1ohea1 | 157 | Proline directed phosphatase CDC14b2 {Human (Homo | 91.61 | |
| d1ux5a_ | 411 | Bni1 {Baker's yeast (Saccharomyces cerevisiae) [Ta | 86.0 | |
| d1ez3a_ | 124 | Syntaxin 1A N-terminal domain {Rat (Rattus norvegi | 80.6 |
| >d1v9da_ a.207.1.1 (A:) Diaphanous protein homolog 1, dia1 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
class: All alpha proteins fold: Formin homology 2 domain (FH2 domain) superfamily: Formin homology 2 domain (FH2 domain) family: Formin homology 2 domain (FH2 domain) domain: Diaphanous protein homolog 1, dia1 species: Mouse (Mus musculus) [TaxId: 10090]
Probab=100.00 E-value=3.4e-41 Score=384.19 Aligned_cols=236 Identities=27% Similarity=0.464 Sum_probs=194.8
Q ss_pred cccccccccccccceeeccccCCcchhH-----------------------------------------------HHHHh
Q 001026 927 GLAHIELRRANNCEIMLTKVKIPLPDLM-----------------------------------------------FFLEL 959 (1184)
Q Consensus 927 ~V~lLd~kRa~nl~I~L~klK~s~~ei~-----------------------------------------------Fll~L 959 (1184)
.|.|||.+|++|++|+|++++++.++|. ||++|
T Consensus 3 ~i~vLd~kr~~ni~I~L~~~k~~~~~i~~ai~~~D~~~l~~e~l~~L~~~~Pt~eE~~~l~~~~~~~~~L~~~E~f~~~l 82 (332)
T d1v9da_ 3 ELKVLDSKTAQNLSIFLGSFRMPYQEIKNVILEVNEAVLTESMIQNLIKQMPEPEQLKMLSELKEEYDDLAESEQFGVVM 82 (332)
T ss_dssp CCSSSCHHHHHHHHHHHHHHCCCHHHHHHHHHHTCTTTCCHHHHHHHHHHSCCHHHHHHHHTCGGGGGGSCHHHHHHHHH
T ss_pred eeEeccHHHHHHHHHHHhhCCcCHHHHHHHHHhCCcccCCHHHHHHHHHhCcCHHHHHHHHHhcCChhhcChHHHHHHHH
Confidence 4789999999999999999999998886 99999
Q ss_pred cCCCchhhhhhhhhhccchHHH-----------------HHcchhHHHHHHHHHHHhhhhcCCCCCcceeeeeccchhch
Q 001026 960 MKVPRVESKLRVFSFKIQFQTQ-----------------VRNSIKLKRIMQTILSLGNALNHGTARGSAVGFRLDSLLKL 1022 (1184)
Q Consensus 960 ~~IPrl~~RL~~l~fk~~F~~~-----------------L~~S~~L~~lL~~IL~iGN~LN~gt~rG~A~GFkL~SL~KL 1022 (1184)
++||+++.||++|+|+.+|.+. |++|..|+.||++||++|||||+|+.||+|+||+|++|.||
T Consensus 83 ~~ip~~~~Rl~~~~~~~~f~~~~~~l~~~l~~l~~a~~~l~~S~~l~~~L~~iL~~GN~mN~g~~~g~A~GFkL~sL~kL 162 (332)
T d1v9da_ 83 GTVPRLRPRLNAILFKLQFSEQVENIKPEIVSVTAACEELRKSENFSSLLELTLLVGNYMNAGSRNAGAFGFNISFLCKL 162 (332)
T ss_dssp HTSTTHHHHHHHHHHHHHHHHHHHTTHHHHHHHHHHHHHHHTCHHHHHCC------------------------CCHHHH
T ss_pred hccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhChhHHHHHHHHHHhcchhccccccccccccCHHHHHhH
Confidence 9999999999999999999987 99999999999999999999999999999999999999999
Q ss_pred hcccccCCcchHHHHHHH------------------------HHHHHHHHHHHHHHHHHHHHHHHHhhhccCCccchhhH
Q 001026 1023 TDTRARNNKMTLMHYLCK------------------------IQLKFLAEEMQAISKGLEKVVQELTASENDGEVSGNFC 1078 (1184)
Q Consensus 1023 ~dtKs~d~k~TLLhflvk------------------------i~L~~L~~El~~l~k~L~kv~~el~~s~~d~~~~d~f~ 1078 (1184)
.|+|++|+++||||||++ +++.++..+++++.+++..+++++.....+....+.|.
T Consensus 163 ~d~Ks~d~~~tLL~~iv~~~~~~~p~l~~~~~eL~~v~~ask~~~~~l~~~~~~l~~~l~~~~~~l~~~~~~~~~~d~f~ 242 (332)
T d1v9da_ 163 RDTKSADQKMTLLHFLAELCENDHPEVLKFPDELAHVEKASRVSAENLQKSLDQMKKQIADVERDVQNFPAATDEKDKFV 242 (332)
T ss_dssp HHSBCSSTTSBHHHHHHHHHHHSCCTTSSGGGGCTTHHHHHHCCHHHHHHHHHHHHHHHHHHHHHHHTCCCCSSSSCCHH
T ss_pred hhccCCCCCccHHHHHHHHHHHhCchhccchhhhhhHHHHhcCCHHHHHHHHHHHHHHHHHHHHHHHhccccccchhhHH
Confidence 999999999999999998 35678899999999999999999998777666778999
Q ss_pred HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhhCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q 001026 1079 KLLKEFLSYAEGEVRSLALLYSSVGRNADALAQYFGEDPARCPFEQVVSTLLNFVKMFVLAHEENCRQLEFERKKAEKAV 1158 (1184)
Q Consensus 1079 ~~m~~Fl~~a~~~l~~L~~~~~~~~~~~~~l~~yFGEd~~~~~~e~ff~~l~~F~~~fk~a~ee~~k~~e~ekkk~ekea 1158 (1184)
+.|..|++.++.++..|+..+.++++.|.+++.|||||+++.++++||++|.+|+..|+++++++.++++++++.+++++
T Consensus 243 ~~~~~Fl~~a~~~l~~l~~~~~~~~~~~~~~~~yfgEd~~~~~~~efF~~~~~F~~~~~~a~~e~~~~~~~~~~~~r~~~ 322 (332)
T d1v9da_ 243 EKMTSFVKDAQEQYNKLRMMHSNMETLYKELGDYFVFDPKKLSVEEFFMDLHNFRNMFLQAVKENQKRRETEEKMRRAKL 322 (332)
T ss_dssp HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHTTCCTTTSCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_pred HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence 99999999999999999999999999999999999999999999999999999999999999999887776655444443
Q ss_pred HHHH
Q 001026 1159 ENEK 1162 (1184)
Q Consensus 1159 ekek 1162 (1184)
++++
T Consensus 323 ~~~~ 326 (332)
T d1v9da_ 323 AKEK 326 (332)
T ss_dssp HHHH
T ss_pred HHHH
Confidence 3333
|
| >d1ux5a_ a.207.1.1 (A:) Bni1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1d5ra2 c.45.1.1 (A:14-187) Phoshphoinositide phosphatase Pten (Pten tumor suppressor), N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1d5ra1 b.7.1.1 (A:188-351) Pten tumor suppressor (Phoshphoinositide phosphatase), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1i9sa_ c.45.1.1 (A:) mRNA capping enzyme, triphosphatase domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1fpza_ c.45.1.1 (A:) Kinase associated phosphatase (kap) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ohea2 c.45.1.1 (A:199-380) Proline directed phosphatase CDC14b2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1rxda_ c.45.1.1 (A:) Protein tyrosine phosphatase type IVa {Human (Homo sapiens), pr-1 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1mkpa_ c.45.1.1 (A:) Mapk phosphatase {Human (Homo sapiens), pyst1 (mkp3) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1vhra_ c.45.1.1 (A:) VH1-related dual-specificity phosphatase, VHR {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xria_ c.45.1.1 (A:) Putative phosphatase At1g05000 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1m3ga_ c.45.1.1 (A:) Mapk phosphatase {Human (Homo sapiens), pac-1 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1g4us2 c.45.1.2 (S:297-539) SptP tyrosine phosphatase, catalytic domain {Salmonella typhimurium [TaxId: 90371]} | Back information, alignment and structure |
|---|
| >d2pt0a1 c.45.1.4 (A:34-346) Myo-inositol hexaphosphate phosphohydrolase (phytase) PhyA {Selenomonas ruminantium [TaxId: 971]} | Back information, alignment and structure |
|---|
| >d1wcha_ c.45.1.2 (A:) Tyrosine-protein phosphatase, non-receptor type 13 (PTPL1) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2shpa1 c.45.1.2 (A:219-525) Tyrosine phosphatase {Human (Homo sapiens), shp-2 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1l8ka_ c.45.1.2 (A:) Tyrosine phosphatase {Human (Homo sapiens), T-cell [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fpra_ c.45.1.2 (A:) Tyrosine phosphatase {Human (Homo sapiens), shp-1 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1yfoa_ c.45.1.2 (A:) Tyrosine phosphatase {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1jlna_ c.45.1.2 (A:) Tyrosine phosphatase {Mouse (Mus musculus), ptp-sl/br7 [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1p15a_ c.45.1.2 (A:) Protein-tyrosine phosphatase alpha {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1lyva_ c.45.1.2 (A:) Protein-tyrosine phosphatase YopH, catalytic domain {Yersinia enterocolitica [TaxId: 630]} | Back information, alignment and structure |
|---|
| >d1lara1 c.45.1.2 (A:1307-1623) RPTP Lar {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2f71a1 c.45.1.2 (A:2-298) Tyrosine phosphatase {Human (Homo sapiens), 1B [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1lara2 c.45.1.2 (A:1628-1876) RPTP Lar {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1rpma_ c.45.1.2 (A:) Tyrosine phosphatase {Human (Homo sapiens), mu [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ywfa1 c.45.1.5 (A:4-275) Phosphotyrosine protein phosphatase PtpB {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1v9da_ a.207.1.1 (A:) Diaphanous protein homolog 1, dia1 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1ohea1 c.45.1.1 (A:42-198) Proline directed phosphatase CDC14b2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ux5a_ a.207.1.1 (A:) Bni1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1ez3a_ a.47.2.1 (A:) Syntaxin 1A N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|