Citrus Sinensis ID: 001046

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820-------830-------840-------850-------860-------870-------880-------890-------900-------910-------920-------930-------940-------950-------960-------970-------980-------990------1000------1010------1020------1030------1040------1050------1060------1070------1080------1090------1100------1110------1120------1130------1140------1150------1160------1170------
MDPPASDDGLKKLEYFSLVSKVCSELETHLGFGDKVLAEFITELGRNCETVDEFDSKLKENGAEMPDYFVRTLLTIIHAILPPKSKSADKESKKEGGGDGKKTKFKALAIEDSRDKVKDLERELEAEARERRRGNEDREREDHYRNRDRDRDRQDRDRDRGRRDRDNQRGRHYVDDDDGGDRSRGRYRDRHETARRYDNKYGDRENDDSGDRSGRYRGNEPELYQVYKGRVSRVVDTGCFVQLNDFRGKEGLVHVSQIATRRIGNAKDVVKRDQEVYVKVISVSGQKLSLSMRDVDQNTGKDLLPLKKISEDDALGNNPSGTRDGPTTRMGLSGIRIVEEDGVVPSRRPLKRMSSPEKWEAKQLIASGVLSVEDYPMYDEEGDGLAYQEEGAEEELEIELNEDEPAFLQGQTRYSVDMSPVKIFKNPEGSLSRAAALQSALIKERREVREQQQRTMLDSIPKDLNRPWEDPMPETGERHLAQELRGVGLSAYDMPEWKKDAFGKALTFGQRSKLSIQEQRQSLPIYKLKKELIQAVHDNQVLVVIGETGSGKTTQVTQYLAEAGYTTRGKIGCTQPRRVAAMSVAKRVAEEFGCRLGEEVGYAIRFEDCTGPDTVIKYMTDGMLLREILIDDNLSQYSVIMLDEAHERTIHTDVLFGLLKQLVKRRPDLRLIVTSATLDAEKFSGYFFNCNIFTIPGRTFPVEILYTKQPESDYLDASLITVLQIHLTEPEGDILLFLTGQEEIDFACQSLYERMKGLGKNVPELIILPVYSALPSEMQSRIFDPAPPGKRKVVVATNIAEASLTIDGIFYVIDPGFAKQNVYNPKQGLDSLVITPISQASAKQRAGRAGRTGPGKCYRLYTESAYRNEMSPTSIPEIQRINLGFTTLTMKAMGINDLLSFDFMDPPSPQALISAMEQLYSLGALDEEGLLTKLGRKMAEFPLDPPLSKMLLASVDLGCSDEILTIIAMIQTGNIFYRPREKQAQADQKRAKFFQPEGDHLTLLAVYEAWKAKNFSGPWCFENFVQSRSLRRAQDVRKQLLSIMDKYKLDVMSAGKNFTKIRKAITAGFFFHAARKDPQEGYRTLVENQPVYIHPSSALFQRQPDWVIYHELVMTTKEYMREVTVIDPKWLVDLAPRFFKVADPTKMSKRKRQERIEPLYDRYHEPNSWRLSKRRA
ccccccHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHcccHHHHHHHHHHccccccHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEEEccEEcccEEEEEcccccccccccccccccccccccHHHHccccEEEEEEEEEEcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHcccccccccccccccccccccccccccEEEEEEcccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccHHHHHHHHHccccccccccHHHHHHccccccccccccccHHHHHHccccHHHHHHHHHHHHHcccEEEEcccccccEEcHHHHHHHHccccccEEEEccccHHHHHHHHHHHHHHHcccccccccEEEEEccccccccEEEEccHHHHHHHHHcccccccccEEEEHHHHHHHHHHHHHHHHHHHHHHHcccccEEEEcccccHHHHHcccccccEEEEccccccccEEEcccccHHHHHHHHHHHHHHHcccccccEEEEcccHHHHHHHHHHHHHHHHHcccccccEEEEEEcccccHHHHHcccccccccccEEEEEEEHHHHccccccEEEEEccccccccccccccccccEEEEcccHHcccccccccccccccccEEcccHHHHHHHccccccccccccccHHHHHHHHHccccccccccccccccHHHHHHHHHHHHHcccccccccccHHHHHHHccccccccHHHHHHccccccHHHHHHHHHHHccccccccccHHHHHHHHHHcccccccccHHHHHHHHHHHHHccccccHHHHHcccHHHHHHHHHHHHHHHHHHHHcccccccccccHHHHHHHHHHHcccccccccccccEEEcccccEEEEccccccccccccEEEEEEEHHcccccccccccccccHHHHHcccccccccccccHHHHHHHHccHHHHHccccccHHHHHccc
ccccccHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHcccHHHHHHHHHHccccccHHHHHHHHHHHHHHcccccccccccccccccHHHHHHHccccccccccccHHHHHHHHHHHHHHHHcccHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEcEEEccEEEEEEcccEEEEEccccccccEEEEHHcHHcccccHHHHEccccEEEEEEEEEcccEEEEEcccccccccccccccHcccccccccccccccccccccccccccccccccccccccHHHHHHcccHHHHHHHHHHHcccccHHccccccHcccccccccccHHccEEEEEEcccccHHcccEEEcccccccEEEEccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHcccccccccccccccHHHHHHccccccccccHHHHHHHccccccccccccccHHHHHHcccHHHHHHHHHHHHHcccEEEEEEcccccHHHHHHHHHHHcccccccEEEcccHHHHHHHHHHHHHHHHHcccccccEEEEEEEccccccccEEEEcccHHHHHHHHccccccccEEEEEccHHHHHHHHHHHHHHHHHHHHHccccEEEEEcccccHHHHHHHHccccEEEEccccccEEEEEcccccHHHHHHHHHHHHHHHcccccccEEEEEccHHHHHHHHHHHHHHHHHHccccccEEEEEEHccccHHHHHHHcccccccccEEEEEEEEEEEEEEEccEEEEEccccEEEEcccccccccEEEEcEcHHHHHHHccccccccccccEEEEEEHHHHHHHccccccHHHHHHHHHHHHHHHHHcccccHccccccccccHHHHHHHHHHHHHHHcccccccccHHHHHHHccccccHHHHHHHHHHcccccHHHHHHHHHHccccEEEccHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccEEEccccHHHHHHHHHHHHHHHHHHccccccEEEEEcccEEEEcccHHHccccccEEEEEEEEEEcHHHHHHcEEccHHHHHHHcHHHcccccccccHHHHHHHHHHHHHHHccccccccHHcccc
mdppasddglkklEYFSLVSKVCSELETHLGFGDKVLAEFITELgrncetvdEFDSKLkengaempDYFVRTLLTIIHailppksksadkeskkegggdgkktkFKALAIEDSRDKVKDLERELEAEARERRrgnedreredhyrnrdrdrdrqdrdrdrgrrdrdnqrgrhyvddddggdrsrgryrdrHETARrydnkygdrenddsgdrsgryrgnepelyqVYKGRVsrvvdtgcfvqlndfrgkeglVHVSQIATRRignakdvvKRDQEVYVKVISVSGqklslsmrdvdqntgkdllplkkiseddalgnnpsgtrdgpttrmglsgiriveedgvvpsrrplkrmsspekWEAKQLIASgvlsvedypmydeegdglayqeegaeEELEielnedepaflqgqtrysvdmspvkifknpegsLSRAAALQSALIKERREVREQQQRTMLdsipkdlnrpwedpmpetgeRHLAQELRgvglsaydmpewkkdafgkaltfgqrskLSIQEQRQSLPIYKLKKELIQAVHDNQVLVVIgetgsgkttQVTQYLAEagyttrgkigctqpRRVAAMSVAKRVAEEFGCRlgeevgyairfedctgpdtVIKYMTDGMLLREILIDDNLSQYSVIMLDEAHERTIHTDVLFGLLKQLVKRRPDLRLIVTSATldaekfsgyffncniftipgrtfPVEILytkqpesdyldASLITVLQIhltepegdiLLFLTGQEEIDFACQSLYERMKglgknvpeliilpvysalpsemqsrifdpappgkrkvVVATNIaeasltidgifyvidpgfakqnvynpkqgldslvitpISQASAKQragragrtgpgkcyrLYTESayrnemsptsipeiqriNLGFTTLTMKAMGIndllsfdfmdppspqALISAMEQLYSlgaldeegLLTKLGRkmaefpldpplskmLLASVDLGCSDEILTIIAMIQTgnifyrprekqAQADQKRAkffqpegdhLTLLAVYEAWKaknfsgpwcfenfVQSRSLRRAQDVRKQLLSIMDKYKLDVMSAGKNFTKIRKAITAGfffhaarkdpqegyrtlvenqpvyihpssalfqrqpdwvIYHELVMTTKEYMREVtvidpkwlvdlaprffkvadptkmskrkrqerieplydryhepnswrlskrra
mdppasddglkklEYFSLVSKVCSELETHLGFGDKVLAEFITELGRNCETVDEFDSKLKENGAEMPDYFVRTLLTIIHAilppksksadkeskkegggdgkktkfkalaiedsrdkvkdlerELEAearerrrgnedreredhyrnrdrdrdrqdrdrdrgrrdrdnqrgrhyvddddggdrsrgryrdrhetarrydnkygdrenddsgdrsgryrgnepelyqvykgrvsrVVDTGCFVQlndfrgkeglvhvsqiatrrignakdvvkrdqEVYVKVIsvsgqklslsmrdvdqntgkdllplkkiseddalgnnpsgtrdgpttrmglsgiriveedgvvpsrrplkrmsspekweakqliasgVLSVEDYPMYDEEGDGLAYQEEGAEEELEIELNEDEPAFLQGQTRYSVDMSPVKIFknpegslsRAAALQSALIKERREVReqqqrtmldsipkdlnrpwEDPMPETGERHLAQELRGVGLSAYDMPEWKKDAFGKALTFGQRSKLSIQEQRQSLPIYKLKKELIQAVHDNQVLVVIgetgsgkttqVTQYLAeagyttrgkigctqPRRVAAMSVAKRVAEEFGcrlgeevgyairfedctgpDTVIKYMTDGMLLREILIDDNLSQYSVIMLDEAHERTIHTDVLFGLLKQLVKRRPDLRLIVTSAtldaekfsgYFFNCNIFTIPGRTFPVEILYTKQPESDYLDASLITVLQIHLTEPEGDILLFLTGQEEIDFACQSLYERMKGLGKNVPELIILPVYSALPSEMQSRIFDPAPPGKRKVVVATNIAEASLTIDGIFYVIDPGFAKQNVYNPKQGLDSLVITPISQAsakqragragrtgpgkcYRLYTESAYrnemsptsipeiQRINLGFTTLTMKAMGINDLLSFDFMDPPSPQALISAMEQLYSLGALDEEGLLTKLGRKMAEFPLDPPLSKMLLASVDLGCSDEILTIIAMIQTGNIFYRPREKQAQADQKRAKFFQPEGDHLTLLAVYEAWKAKNFSGPWCFENFVQSRSLRRAQDVRKQLLSIMDKYKLDVMSAGKNFTKIRKAITAGFFFHAARKDPQEGYRTLVENQPVYIhpssalfqrqpDWVIYHELVMTTKEYMREVTVIDPKWLVDLaprffkvadptkmskrkrqerieplydryhepnswrlskrra
MDPPASDDGLKKLEYFSLVSKVCSELETHLGFGDKVLAEFITELGRNCETVDEFDSKLKENGAEMPDYFVRTLLTIIHAILPPksksadkeskkegggdgkktkfkaLAIEDSRDKVKdlereleaearerrrgnedreredhyrnrdrdrdrqdrdrdrgrrdrdnqrgrhyvddddggdrsrgryrdrhETARRYDNKYGDRENDDSGDRSGRYRGNEPELYQVYKGRVSRVVDTGCFVQLNDFRGKEGLVHVSQIATRRIGNAKDVVKRDQEVYVKVISVSGQKLSLSMRDVDQNTGKDLLPLKKISEDDALGNNPSGTRDGPTTRMGLSGIRIVEEDGVVPSRRPLKRMSSPEKWEAKQLIASGVLSVEDYPMYDEEGDGlayqeegaeeeleielnedepaFLQGQTRYSVDMSPVKIFKNPEGslsraaalqsalIKerrevreqqqrTMLDSIPKDLNRPWEDPMPETGERHLAQELRGVGLSAYDMPEWKKDAFGKALTFGQRSKLSIQEQRQSLPIYKLKKELIQAVHDNQVLVVIGETGSGKTTQVTQYLAEAGYTTRGKIGCTQPRRVAAMSVAKRVAEEFGCRLGEEVGYAIRFEDCTGPDTVIKYMTDGMLLREILIDDNLSQYSVIMLDEAHERTIHTDVLFGLLKQLVKRRPDLRLIVTSATLDAEKFSGYFFNCNIFTIPGRTFPVEILYTKQPESDYLDASLITVLQIHLTEPEGDILLFLTGQEEIDFACQSLYERMKGLGKNVPELIILPVYSALPSEMQSRIFDPAPPGKRKVVVATNIAEASLTIDGIFYVIDPGFAKQNVYNPKQGLDSLVITPISQASAKQRAGRAGRTGPGKCYRLYTESAYRNEMSPTSIPEIQRINLGFTTLTMKAMGINDLLSFDFMDPPSPQALISAMEQLYSLGALDEEGLLTKLGRKMAEFPLDPPLSKMLLASVDLGCSDEILTIIAMIQTGNIFYRPREKQAQADQKRAKFFQPEGDHLTLLAVYEAWKAKNFSGPWCFENFVQSRSLRRAQDVRKQLLSIMDKYKLDVMSAGKNFTKIRKAITAGFFFHAARKDPQEGYRTLVENQPVYIHPSSALFQRQPDWVIYHELVMTTKEYMREVTVIDPKWLVDLAPRFFKVADPTKMSKRKRQERIEPLYDRYHEPNSWRLSKRRA
***********KLEYFSLVSKVCSELETHLGFGDKVLAEFITELGRNCETVDEFDSKLKENGAEMPDYFVRTLLTIIHAIL********************************************************************************************************************************************ELYQVYKGRVSRVVDTGCFVQLNDFRGKEGLVHVSQIATRRIGNAKDVVKRDQEVYVKVISVSG******************************************************************************LIASGVLSVEDYPMY**********************************************************************************************************RGVGLSAYDMPEWKKDAFGKALTFGQRSKLSI***RQSLPIYKLKKELIQAVHDNQVLVVIGETGSGKTTQVTQYLAEAGYTTRGKIGCTQPRRVAAMSVAKRVAEEFGCRLGEEVGYAIRFEDCTGPDTVIKYMTDGMLLREILIDDNLSQYSVIMLDEAHERTIHTDVLFGLLKQLVKRRPDLRLIVTSATLDAEKFSGYFFNCNIFTIPGRTFPVEILYTKQPESDYLDASLITVLQIHLTEPEGDILLFLTGQEEIDFACQSLYERMKGLGKNVPELIILPVYSALPS*****IF******KRKVVVATNIAEASLTIDGIFYVIDPGFAKQNVYNPKQGLDSLVITPI******************KCYRLYTESAYRN****TSIPEIQRINLGFTTLTMKAMGINDLLSFDFMDPP*PQALISAMEQLYSLGALDEEGLLTKLGRKMAEFPLDPPLSKMLLASVDLGCSDEILTIIAMIQTGNIFYRP*************FFQPEGDHLTLLAVYEAWKAKNFSGPWCFENFVQSRSLRRAQDVRKQLLSIMDKYKLDVMSAGKNFTKIRKAITAGFFFHAARKDPQEGYRTLVENQPVYIHPSSALFQRQPDWVIYHELVMTTKEYMREVTVIDPKWLVDLAPRFFKVA**********************************
**********KKLEYFSLVSKVCSELETHLGFGDKVLAEFITELGRNCETVDEFDSKLKENGAEMPDYFVRTLLT*********************************AIEDSR****************************************************************************************************************YKGRVSRVVDTGCFVQLNDFRGKEGLVHVSQIA********DVVKRDQEVYVKVISVSGQKLSLSMRDVDQNTGKDLLP**************************************************************GVLSVEDYPMYDEEGDGLAYQEEGAEEELEIELNEDEPAFLQGQ***********************************************************************************************************QRQSLPIYKLKKELIQAVHDNQVLVVIGETGSGKTTQVTQYLAEAGYTTRGKIGCTQPRRVAAMSVAKRVAEEFGCRLGEEVGYAIRFEDCTGPDTVIKYMTDGMLLREILIDDNLSQYSVIMLDEAHERTIHTDVLFGLLKQLVKRRPDLRLIVTSATLDAEKFSGYFFNCNIFTIPGRTFPVEILYTKQPESDYLDASLITVLQIHLTEPEGDILLFLTGQEEIDFACQSLYER*******VPELIILPVYSALPSEMQSRIFDPAPPGKRKVVVATNIAEASLTIDGIFYVIDPGFAKQNVYNPKQGLDSLVITPISQASAKQRAGRAGRTGPGKCYRLYTESAYRNEMSPTSIPEIQRINLGFTTLTMKAMGINDLLSFDFMDPPSPQALISAMEQLYSLGALDEEGLLTKLGRKMAEFPLDPPLSKMLLASVDLGCSDEILTIIAMIQTGNIF*****************FQPEGDHLTLLAVYEAWKAKNFSGPWCFENFVQSRSLRRAQDVRKQLLSIMDKYKLDVMSAGKNFTKIRKAITAGFFFHAARKDPQEGYRTLVENQPVYIHPSSALFQRQPDWVIYHELVMTTKEYMREVTVIDPKWLVDLAPRFF*************************************
********GLKKLEYFSLVSKVCSELETHLGFGDKVLAEFITELGRNCETVDEFDSKLKENGAEMPDYFVRTLLTIIHAILPPK*****************KTKFKALAIEDSRDKVKDLERELEA******************************************RGRHYVDDDDGGDRSRGRYRDRHETARRYDNKYG**********SGRYRGNEPELYQVYKGRVSRVVDTGCFVQLNDFRGKEGLVHVSQIATRRIGNAKDVVKRDQEVYVKVISVSGQKLSLSMRDVDQNTGKDLLPLKKISEDDALGNNPSGTRDGPTTRMGLSGIRIVEEDGVVPS************WEAKQLIASGVLSVEDYPMYDEEGDGLAYQEEGAEEELEIELNEDEPAFLQGQTRYSVDMSPVKIFKNPEGSLSRAAALQSALIKER********RTMLDSIPKDLNRPWEDPMPETGERHLAQELRGVGLSAYDMPEWKKDAFGKALTFGQRSKLSIQEQRQSLPIYKLKKELIQAVHDNQVLVVIGETGSGKTTQVTQYLAEAGYTTRGKIGCTQPRRVAAMSVAKRVAEEFGCRLGEEVGYAIRFEDCTGPDTVIKYMTDGMLLREILIDDNLSQYSVIMLDEAHERTIHTDVLFGLLKQLVKRRPDLRLIVTSATLDAEKFSGYFFNCNIFTIPGRTFPVEILYTKQPESDYLDASLITVLQIHLTEPEGDILLFLTGQEEIDFACQSLYERMKGLGKNVPELIILPVYSALPSEMQSRIFDPAPPGKRKVVVATNIAEASLTIDGIFYVIDPGFAKQNVYNPKQGLDSLVITPIS**************GPGKCYRLYTESAYRNEMSPTSIPEIQRINLGFTTLTMKAMGINDLLSFDFMDPPSPQALISAMEQLYSLGALDEEGLLTKLGRKMAEFPLDPPLSKMLLASVDLGCSDEILTIIAMIQTGNIFYRPR*********RAKFFQPEGDHLTLLAVYEAWKAKNFSGPWCFENFVQSRSLRRAQDVRKQLLSIMDKYKLDVMSAGKNFTKIRKAITAGFFFHAARKDPQEGYRTLVENQPVYIHPSSALFQRQPDWVIYHELVMTTKEYMREVTVIDPKWLVDLAPRFFKVADP********QERIEPLYDRYHEPN*********
*****SDDGLKKLEYFSLVSKVCSELETHLGFGDKVLAEFITELGRNCETVDEFDSKLKENGAEMPDYFVRTLLTIIHAILP*********************KFKALAIEDSRDKVKDLERELEAEARE***************************************************************************************GNEPELYQVYKGRVSRVVDTGCFVQLNDFRGKEGLVHVSQIATRRIGNAKDVVKRDQEVYVKVISVSGQKLSLSMRDVD*********************************************************SSPEKWEAKQLIASGVLSVEDYPMYDEEGD*LA*QEEGAEEELEIELNEDEPAFLQGQTRYSVDMSPVKIFKNPEGSLSRAAALQSALIKERREVREQQQ***************E************Q**R*******DM*EWK**************KLSIQEQRQSLPIYKLKKELIQAVHDNQVLVVIGETGSGKTTQVTQYLAEAGYTTRGKIGCTQPRRVAAMSVAKRVAEEFGCRLGEEVGYAIRFEDCTGPDTVIKYMTDGMLLREILIDDNLSQYSVIMLDEAHERTIHTDVLFGLLKQLVKRRPDLRLIVTSATLDAEKFSGYFFNCNIFTIPGRTFPVEILYTKQPESDYLDASLITVLQIHLTEPEGDILLFLTGQEEIDFACQSLYERMKGLGKNVPELIILPVYSALPSEMQSRIFDPAPPGKRKVVVATNIAEASLTIDGIFYVIDPGFAKQNVYNPKQGLDSLVITPISQAS***********GPGKCYRLYTESAYRNEMSPTSIPEIQRINLGFTTLTMKAMGINDLLSFDFMDPPSPQALISAMEQLYSLGALDEEGLLTKLGRKMAEFPLDPPLSKMLLASVDLGCSDEILTIIAMIQTGNIFYRPREKQAQADQKRAKFFQPEGDHLTLLAVYEAWKAKNFSGPWCFENFVQSRSLRRAQDVRKQLLSIMDKYKLDVMSAGKNFTKIRKAITAGFFFHAARKDPQEGYRTLVENQPVYIHPSSALFQRQPDWVIYHELVMTTKEYMREVTVIDPKWLVDLAPRFFKVADPTKMSKRKRQERIEPLYDRYHEP**********
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MDPPASDDGLKKLEYFSLVSKVCSELETHLGFGDKVLAEFITELGRNCETVDEFDSKLKENGAEMPDYFVRTLLTIIHAILPPKSKSADKESKKEGGGDGKKTKFKALAxxxxxxxxxxxxxxxxxxxxxxxxxxxxREREDHYRNRDRDRDRQDRDRDRGRRDRDNQRGRHYVDDDDGGDRSRGRYRDRHETARRYDNKYGDRENDDSGDRSGRYRGNEPELYQVYKGRVSRVVDTGCFVQLNDFRGKEGLVHVSQIATRRIGNAKDVVKRDQEVYVKVISVSGQKLSLSMRDVDQNTGKDLLPLKKISEDDALGNNPSGTRDGPTTRMGLSGIRIVEEDGVVPSRRPLKRMSSPEKWEAKQLIASGVLSVEDYPMYDEEGDGLAYQEEGAEEELEIELNEDEPAFLQGQTRYSVDMSPVKIFKNPEGSLSRxxxxxxxxxxxxxxxxxxxxxTMLDSIPKDLNRPWEDPMPETGERHLAQELRGVGLSAYDMPEWKKDAFGKALTFGQRSKLSIQEQRQSLPIYKLKKELIQAVHDNQVLVVIGETGSGKTTQVTQYLAEAGYTTRGKIGCTQPRRVAAMSVAKRVAEEFGCRLGEEVGYAIRFEDCTGPDTVIKYMTDGMLLREILIDDNLSQYSVIMLDEAHERTIHTDVLFGLLKQLVKRRPDLRLIVTSATLDAEKFSGYFFNCNIFTIPGRTFPVEILYTKQPESDYLDASLITVLQIHLTEPEGDILLFLTGQEEIDFACQSLYERMKGLGKNVPELIILPVYSALPSEMQSRIFDPAPPGKRKVVVATNIAEASLTIDGIFYVIDPGFAKQNVYNPKQGLDSLVITPISQASAKQRAGRAGRTGPGKCYRLYTESAYRNEMSPTSIPEIQRINLGFTTLTMKAMGINDLLSFDFMDPPSPQALISAMEQLYSLGALDEEGLLTKLGRKMAEFPLDPPLSKMLLASVDLGCSDEILTIIAMIQTGNIFYRPREKQAQADQKRAKFFQPEGDHLTLLAVYEAWKAKNFSGPWCFENFVQSRSLRRAQDVRKQLLSIMDKYKLDVMSAGKNFTKIRKAITAGFFFHAARKDPQEGYRTLVENQPVYIHPSSALFQRQPDWVIYHELVMTTKEYMREVTVIDPKWLVDLAPRFFKVADPTKMSKRKRQERIEPLYDRYHEPNSWRLSKRRA
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query1176 2.2.26 [Sep-21-2011]
Q389531168 Probable pre-mRNA-splicin yes no 0.815 0.821 0.918 0.0
Q145621220 ATP-dependent RNA helicas yes no 0.830 0.800 0.660 0.0
A2A4P01244 ATP-dependent RNA helicas yes no 0.830 0.785 0.660 0.0
Q095301200 Probable pre-mRNA-splicin yes no 0.796 0.780 0.608 0.0
O426431168 Pre-mRNA-splicing factor yes no 0.799 0.804 0.559 0.0
P243841145 Pre-mRNA-splicing factor yes no 0.785 0.806 0.493 0.0
Q54MH31106 Putative pre-mRNA-splicin yes no 0.538 0.572 0.593 0.0
Q767K61045 Putative pre-mRNA-splicin no no 0.547 0.616 0.573 0.0
Q7YR391044 Putative pre-mRNA-splicin no no 0.535 0.603 0.578 0.0
O602311041 Putative pre-mRNA-splicin no no 0.535 0.605 0.578 0.0
>sp|Q38953|DHX8_ARATH Probable pre-mRNA-splicing factor ATP-dependent RNA helicase OS=Arabidopsis thaliana GN=At3g26560 PE=1 SV=2 Back     alignment and function desciption
 Score = 1810 bits (4689), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 883/961 (91%), Positives = 927/961 (96%), Gaps = 2/961 (0%)

Query: 218  GNEPELYQVYKGRVSRVVDTGCFVQLNDFRGKEGLVHVSQIATRRIGNAKDVVKRDQEVY 277
             NEPELYQVYKGRV+RV+D GCFVQ + FRGKEGLVHVSQ+ATRR+  AK+ VKRD EVY
Sbjct: 208  ANEPELYQVYKGRVTRVMDAGCFVQFDKFRGKEGLVHVSQMATRRVDKAKEFVKRDMEVY 267

Query: 278  VKVISVSGQKLSLSMRDVDQNTGKDLLPLKKIS-EDDALGNNPS-GTRDGPTTRMGLSGI 335
            VKVIS+S  K SLSMRDVDQNTG+DL+PL+K S EDD+  +NPS  T+DG  T+ G+SGI
Sbjct: 268  VKVISISSDKYSLSMRDVDQNTGRDLIPLRKPSDEDDSSRSNPSYRTKDGQVTKTGISGI 327

Query: 336  RIVEEDGVVPSRRPLKRMSSPEKWEAKQLIASGVLSVEDYPMYDEEGDGLAYQEEGAEEE 395
            RIVEE+ V PSRRPLK+MSSPE+WEAKQLIASGVL V+++PMYDE+GDG+ YQEEGAEEE
Sbjct: 328  RIVEENDVAPSRRPLKKMSSPERWEAKQLIASGVLRVDEFPMYDEDGDGMLYQEEGAEEE 387

Query: 396  LEIELNEDEPAFLQGQTRYSVDMSPVKIFKNPEGSLSRAAALQSALIKERREVREQQQRT 455
            LEIE+NEDEPAFLQGQTRYSVDMSPVKIFKNPEGSLSRAAALQSAL KERRE+REQQQRT
Sbjct: 388  LEIEMNEDEPAFLQGQTRYSVDMSPVKIFKNPEGSLSRAAALQSALTKERREMREQQQRT 447

Query: 456  MLDSIPKDLNRPWEDPMPETGERHLAQELRGVGLSAYDMPEWKKDAFGKALTFGQRSKLS 515
            MLDSIPKDLNRPWEDPMPETGERHLAQELRGVGLSAYDMPEWKKDAFGK  TFGQRSKLS
Sbjct: 448  MLDSIPKDLNRPWEDPMPETGERHLAQELRGVGLSAYDMPEWKKDAFGKTPTFGQRSKLS 507

Query: 516  IQEQRQSLPIYKLKKELIQAVHDNQVLVVIGETGSGKTTQVTQYLAEAGYTTRGKIGCTQ 575
            IQEQR+SLPIYKLKKELIQAVHDNQVLVVIGETGSGKTTQVTQYLAEAGYTT+GKIGCTQ
Sbjct: 508  IQEQRESLPIYKLKKELIQAVHDNQVLVVIGETGSGKTTQVTQYLAEAGYTTKGKIGCTQ 567

Query: 576  PRRVAAMSVAKRVAEEFGCRLGEEVGYAIRFEDCTGPDTVIKYMTDGMLLREILIDDNLS 635
            PRRVAAMSVAKRVAEEFGCRLGEEVGYAIRFEDCTGPDTVIKYMTDGMLLREILID+NLS
Sbjct: 568  PRRVAAMSVAKRVAEEFGCRLGEEVGYAIRFEDCTGPDTVIKYMTDGMLLREILIDENLS 627

Query: 636  QYSVIMLDEAHERTIHTDVLFGLLKQLVKRRPDLRLIVTSATLDAEKFSGYFFNCNIFTI 695
            QYSVIMLDEAHERTIHTDVLFGLLK+L+KRR DLRLIVTSATLDAEKFSGYFFNCNIFTI
Sbjct: 628  QYSVIMLDEAHERTIHTDVLFGLLKKLMKRRLDLRLIVTSATLDAEKFSGYFFNCNIFTI 687

Query: 696  PGRTFPVEILYTKQPESDYLDASLITVLQIHLTEPEGDILLFLTGQEEIDFACQSLYERM 755
            PGRTFPVEILYTKQPE+DYLDA+LITVLQIHLTEPEGDIL+FLTGQEEID ACQSLYERM
Sbjct: 688  PGRTFPVEILYTKQPETDYLDAALITVLQIHLTEPEGDILVFLTGQEEIDSACQSLYERM 747

Query: 756  KGLGKNVPELIILPVYSALPSEMQSRIFDPAPPGKRKVVVATNIAEASLTIDGIFYVIDP 815
            KGLGKNVPELIILPVYSALPSEMQSRIFDP PPGKRKVVVATNIAEASLTIDGI+YV+DP
Sbjct: 748  KGLGKNVPELIILPVYSALPSEMQSRIFDPPPPGKRKVVVATNIAEASLTIDGIYYVVDP 807

Query: 816  GFAKQNVYNPKQGLDSLVITPISQASAKQRAGRAGRTGPGKCYRLYTESAYRNEMSPTSI 875
            GFAKQNVYNPKQGL+SLVITPISQASAKQRAGRAGRTGPGKCYRLYTESAYRNEM PTSI
Sbjct: 808  GFAKQNVYNPKQGLESLVITPISQASAKQRAGRAGRTGPGKCYRLYTESAYRNEMPPTSI 867

Query: 876  PEIQRINLGFTTLTMKAMGINDLLSFDFMDPPSPQALISAMEQLYSLGALDEEGLLTKLG 935
            PEIQRINLG TTLTMKAMGINDLLSFDFMDPP PQALISAMEQLYSLGALDEEGLLTKLG
Sbjct: 868  PEIQRINLGMTTLTMKAMGINDLLSFDFMDPPQPQALISAMEQLYSLGALDEEGLLTKLG 927

Query: 936  RKMAEFPLDPPLSKMLLASVDLGCSDEILTIIAMIQTGNIFYRPREKQAQADQKRAKFFQ 995
            RKMAEFPL+PPLSKMLLASVDLGCSDEILT+IAMIQTGNIFYRPREKQAQADQKRAKFFQ
Sbjct: 928  RKMAEFPLEPPLSKMLLASVDLGCSDEILTMIAMIQTGNIFYRPREKQAQADQKRAKFFQ 987

Query: 996  PEGDHLTLLAVYEAWKAKNFSGPWCFENFVQSRSLRRAQDVRKQLLSIMDKYKLDVMSAG 1055
            PEGDHLTLLAVYEAWKAKNFSGPWCFENF+QSRSLRRAQDVRKQLLSIMDKYKLDV++AG
Sbjct: 988  PEGDHLTLLAVYEAWKAKNFSGPWCFENFIQSRSLRRAQDVRKQLLSIMDKYKLDVVTAG 1047

Query: 1056 KNFTKIRKAITAGFFFHAARKDPQEGYRTLVENQPVYIHPSSALFQRQPDWVIYHELVMT 1115
            KNFTKIRKAITAGFFFH ARKDPQEGYRTLVENQPVYIHPSSALFQRQPDWVIYH+LVMT
Sbjct: 1048 KNFTKIRKAITAGFFFHGARKDPQEGYRTLVENQPVYIHPSSALFQRQPDWVIYHDLVMT 1107

Query: 1116 TKEYMREVTVIDPKWLVDLAPRFFKVADPTKMSKRKRQERIEPLYDRYHEPNSWRLSKRR 1175
            TKEYMREVTVIDPKWLV+LAPRFFKV+DPTKMSKRKRQERIEPLYDRYHEPNSWRLSKRR
Sbjct: 1108 TKEYMREVTVIDPKWLVELAPRFFKVSDPTKMSKRKRQERIEPLYDRYHEPNSWRLSKRR 1167

Query: 1176 A 1176
            A
Sbjct: 1168 A 1168
Could act late in the splicing of pre-mRNA and mediate the release of the spliced mRNA from spliceosomes.
Arabidopsis thaliana (taxid: 3702)
EC: 3EC: .EC: 6EC: .EC: 4EC: .EC: 1EC: 3
>sp|Q14562|DHX8_HUMAN ATP-dependent RNA helicase DHX8 OS=Homo sapiens GN=DHX8 PE=1 SV=1 Back     alignment and function description
>sp|A2A4P0|DHX8_MOUSE ATP-dependent RNA helicase DHX8 OS=Mus musculus GN=Dhx8 PE=2 SV=1 Back     alignment and function description
>sp|Q09530|MOG5_CAEEL Probable pre-mRNA-splicing factor ATP-dependent RNA helicase mog-5 OS=Caenorhabditis elegans GN=mog-5 PE=1 SV=1 Back     alignment and function description
>sp|O42643|PRP22_SCHPO Pre-mRNA-splicing factor ATP-dependent RNA helicase prp22 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=prp22 PE=1 SV=1 Back     alignment and function description
>sp|P24384|PRP22_YEAST Pre-mRNA-splicing factor ATP-dependent RNA helicase PRP22 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PRP22 PE=1 SV=1 Back     alignment and function description
>sp|Q54MH3|DHX16_DICDI Putative pre-mRNA-splicing factor ATP-dependent RNA helicase DHX16 OS=Dictyostelium discoideum GN=dhx16 PE=3 SV=1 Back     alignment and function description
>sp|Q767K6|DHX16_PIG Putative pre-mRNA-splicing factor ATP-dependent RNA helicase DHX16 OS=Sus scrofa GN=DHX16 PE=3 SV=1 Back     alignment and function description
>sp|Q7YR39|DHX16_PANTR Putative pre-mRNA-splicing factor ATP-dependent RNA helicase DHX16 OS=Pan troglodytes GN=DHX16 PE=3 SV=1 Back     alignment and function description
>sp|O60231|DHX16_HUMAN Putative pre-mRNA-splicing factor ATP-dependent RNA helicase DHX16 OS=Homo sapiens GN=DHX16 PE=1 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query1176
2555394161177 ATP-dependent RNA helicase, putative [Ri 0.988 0.988 0.879 0.0
2254390921175 PREDICTED: probable pre-mRNA-splicing fa 0.988 0.989 0.876 0.0
2241168621171 predicted protein [Populus trichocarpa] 0.985 0.989 0.879 0.0
2241205481207 predicted protein [Populus trichocarpa] 0.988 0.963 0.841 0.0
3594810321172 PREDICTED: probable pre-mRNA-splicing fa 0.841 0.844 0.920 0.0
3565623911197 PREDICTED: probable pre-mRNA-splicing fa 0.827 0.812 0.939 0.0
3565520731203 PREDICTED: probable pre-mRNA-splicing fa 0.832 0.813 0.930 0.0
4494829061181 PREDICTED: probable pre-mRNA-splicing fa 0.843 0.839 0.924 0.0
4494428791218 PREDICTED: uncharacterized protein LOC10 0.843 0.814 0.924 0.0
152315741168 ATP-dependent RNA helicase DHX8/PRP22 [A 0.815 0.821 0.918 0.0
>gi|255539416|ref|XP_002510773.1| ATP-dependent RNA helicase, putative [Ricinus communis] gi|223551474|gb|EEF52960.1| ATP-dependent RNA helicase, putative [Ricinus communis] Back     alignment and taxonomy information
 Score = 2045 bits (5298), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1031/1172 (87%), Positives = 1083/1172 (92%), Gaps = 9/1172 (0%)

Query: 7    DDGLKKLEYFSLVSKVCSELETHLGFGDKVLAEFITELGRNCETVDEFDSKLKENGAEMP 66
            D GL++LE+ SLVSKVC+ELE+HLGFGDKVLAE+ITE+GRN ETVDEFDSKLKENGA+ P
Sbjct: 13   DVGLERLEFLSLVSKVCTELESHLGFGDKVLAEYITEMGRNSETVDEFDSKLKENGADFP 72

Query: 67   DYFVRTLLTIIHAILPPKSKSADKESKKEGGGDGKKTKFKALAIEDSRDKVKDLERELEA 126
            DYFVRTLLTIIHAILPP SKS D  S  +     + +K++AL+I DS+D+ K+LER+L+ 
Sbjct: 73   DYFVRTLLTIIHAILPPISKS-DSNSNTKHSDAHENSKYRALSIADSKDRAKELERQLQL 131

Query: 127  EARERRRGNEDREREDHYRNRDRDRDRQDRDRDRGRRDRDNQRGRHYVDDDDGGDRSRGR 186
            EARER +  E  E +     RDR RDR            + +R R Y D      R+  R
Sbjct: 132  EARERTKLQELEEDDRTRDRRDRKRDRDRYSHRDRTHRDERRRDRDYEDHRS---RATHR 188

Query: 187  YRDRHETARRYDNKYGDRENDDSGDRSGRYRGNEPELYQVYKGRVSRVVDTGCFVQLNDF 246
              DRH      DN    RE   +   +G Y  ++PELY+VYKGRVSRV+D+GCFVQLNDF
Sbjct: 189  DGDRHRRDGSVDNGETHRETRRN---NGSYTSSDPELYRVYKGRVSRVMDSGCFVQLNDF 245

Query: 247  RGKEGLVHVSQIATRRIGNAKDVVKRDQEVYVKVISVSGQKLSLSMRDVDQNTGKDLLPL 306
            RGKEGLVHVSQ+ATRRI NAKDVVKRDQ+V+VKVISVSGQKLSLSMRDVDQN+GKDLLPL
Sbjct: 246  RGKEGLVHVSQMATRRIANAKDVVKRDQDVFVKVISVSGQKLSLSMRDVDQNSGKDLLPL 305

Query: 307  KKIS--EDDALGNNPSGTRDGPTTRMGLSGIRIVEEDGVVPSRRPLKRMSSPEKWEAKQL 364
            KK S  +DD+L  NPSG+++GP TR GLSGIRI+EED  VPSRRPLKRMSSPE+WEAKQL
Sbjct: 306  KKSSGDDDDSLRTNPSGSKEGPVTRTGLSGIRILEEDDAVPSRRPLKRMSSPERWEAKQL 365

Query: 365  IASGVLSVEDYPMYDEEGDGLAYQEEGAEEELEIELNEDEPAFLQGQTRYSVDMSPVKIF 424
            IASGVL V++YPMYD+EGDGL YQE GAEEELEIELNEDEPAFLQGQTRYSVDMSPVKIF
Sbjct: 366  IASGVLGVQEYPMYDDEGDGLLYQEGGAEEELEIELNEDEPAFLQGQTRYSVDMSPVKIF 425

Query: 425  KNPEGSLSRAAALQSALIKERREVREQQQRTMLDSIPKDLNRPWEDPMPETGERHLAQEL 484
            KNPEGSLSRAAALQSALIKERREVREQQQRTMLDSIPKDLNRPWEDPMPETGERHLAQEL
Sbjct: 426  KNPEGSLSRAAALQSALIKERREVREQQQRTMLDSIPKDLNRPWEDPMPETGERHLAQEL 485

Query: 485  RGVGLSAYDMPEWKKDAFGKALTFGQRSKLSIQEQRQSLPIYKLKKELIQAVHDNQVLVV 544
            RGVGLSAYDMPEWKKDAFGKALTFGQRSKLSIQEQRQSLPIYKLKKEL+QAVHDNQVLVV
Sbjct: 486  RGVGLSAYDMPEWKKDAFGKALTFGQRSKLSIQEQRQSLPIYKLKKELVQAVHDNQVLVV 545

Query: 545  IGETGSGKTTQVTQYLAEAGYTTRGKIGCTQPRRVAAMSVAKRVAEEFGCRLGEEVGYAI 604
            IGETGSGKTTQVTQYLAEAGYTTRGKIGCTQPRRVAAMSVAKRVAEEFGCRLGEEVGYAI
Sbjct: 546  IGETGSGKTTQVTQYLAEAGYTTRGKIGCTQPRRVAAMSVAKRVAEEFGCRLGEEVGYAI 605

Query: 605  RFEDCTGPDTVIKYMTDGMLLREILIDDNLSQYSVIMLDEAHERTIHTDVLFGLLKQLVK 664
            RFEDCTGPDTVIKYMTDGMLLREILID+NLSQYSVIMLDEAHERTIHTDVLFGLLKQLVK
Sbjct: 606  RFEDCTGPDTVIKYMTDGMLLREILIDENLSQYSVIMLDEAHERTIHTDVLFGLLKQLVK 665

Query: 665  RRPDLRLIVTSATLDAEKFSGYFFNCNIFTIPGRTFPVEILYTKQPESDYLDASLITVLQ 724
            RRPDLRLIVTSATLDAEKFSGYFFNCNIFTIPGRTFPVEILYTKQPESDYLDA+LITVLQ
Sbjct: 666  RRPDLRLIVTSATLDAEKFSGYFFNCNIFTIPGRTFPVEILYTKQPESDYLDAALITVLQ 725

Query: 725  IHLTEPEGDILLFLTGQEEIDFACQSLYERMKGLGKNVPELIILPVYSALPSEMQSRIFD 784
            IHLTEPEGD+LLFLTGQEEIDFACQSLYERMKGLGKNVPELIILPVYSALPSEMQSRIF+
Sbjct: 726  IHLTEPEGDVLLFLTGQEEIDFACQSLYERMKGLGKNVPELIILPVYSALPSEMQSRIFE 785

Query: 785  PAPPGKRKVVVATNIAEASLTIDGIFYVIDPGFAKQNVYNPKQGLDSLVITPISQASAKQ 844
            PAPPGKRKVVVATNIAEASLTIDGIFYVIDPGFAKQNVYNPKQGLDSLVITPISQASAKQ
Sbjct: 786  PAPPGKRKVVVATNIAEASLTIDGIFYVIDPGFAKQNVYNPKQGLDSLVITPISQASAKQ 845

Query: 845  RAGRAGRTGPGKCYRLYTESAYRNEMSPTSIPEIQRINLGFTTLTMKAMGINDLLSFDFM 904
            RAGRAGRTGPGKCYRLYTESAYRNEMSPTSIPEIQRINLGFTTLTMKAMGINDLLSFDFM
Sbjct: 846  RAGRAGRTGPGKCYRLYTESAYRNEMSPTSIPEIQRINLGFTTLTMKAMGINDLLSFDFM 905

Query: 905  DPPSPQALISAMEQLYSLGALDEEGLLTKLGRKMAEFPLDPPLSKMLLASVDLGCSDEIL 964
            DPPSPQALISAMEQLYSLGALDEEGLLTKLGRKMAEFPLDPPLSKMLLASVDLGCSDEIL
Sbjct: 906  DPPSPQALISAMEQLYSLGALDEEGLLTKLGRKMAEFPLDPPLSKMLLASVDLGCSDEIL 965

Query: 965  TIIAMIQTGNIFYRPREKQAQADQKRAKFFQPEGDHLTLLAVYEAWKAKNFSGPWCFENF 1024
            TIIAMIQTGNIFYRPREKQAQADQKRAKFFQPEGDHLTLLAVYEAWKAKNFSGPWCFENF
Sbjct: 966  TIIAMIQTGNIFYRPREKQAQADQKRAKFFQPEGDHLTLLAVYEAWKAKNFSGPWCFENF 1025

Query: 1025 VQSRSLRRAQDVRKQLLSIMDKYKLDVMSAGKNFTKIRKAITAGFFFHAARKDPQEGYRT 1084
            VQSRSLRRAQDVRKQLLSIMDKYKLDV+SAGKNFTKIRKAITAGFFFHAARKDPQEGYRT
Sbjct: 1026 VQSRSLRRAQDVRKQLLSIMDKYKLDVVSAGKNFTKIRKAITAGFFFHAARKDPQEGYRT 1085

Query: 1085 LVENQPVYIHPSSALFQRQPDWVIYHELVMTTKEYMREVTVIDPKWLVDLAPRFFKVADP 1144
            LVENQPVYIHPSSALFQRQPDWVIYHELVMTTKEYMREVTVIDPKWLV+LAPRFFKVADP
Sbjct: 1086 LVENQPVYIHPSSALFQRQPDWVIYHELVMTTKEYMREVTVIDPKWLVELAPRFFKVADP 1145

Query: 1145 TKMSKRKRQERIEPLYDRYHEPNSWRLSKRRA 1176
            TKMSKRKRQERIEPLYDRYHEPNSWRLSKRRA
Sbjct: 1146 TKMSKRKRQERIEPLYDRYHEPNSWRLSKRRA 1177

Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|225439092|ref|XP_002268542.1| PREDICTED: probable pre-mRNA-splicing factor ATP-dependent RNA helicase-like isoform 2 [Vitis vinifera] Back     alignment and taxonomy information
>gi|224116862|ref|XP_002331832.1| predicted protein [Populus trichocarpa] gi|222875070|gb|EEF12201.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224120548|ref|XP_002318357.1| predicted protein [Populus trichocarpa] gi|222859030|gb|EEE96577.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|359481032|ref|XP_003632558.1| PREDICTED: probable pre-mRNA-splicing factor ATP-dependent RNA helicase-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|356562391|ref|XP_003549455.1| PREDICTED: probable pre-mRNA-splicing factor ATP-dependent RNA helicase-like [Glycine max] Back     alignment and taxonomy information
>gi|356552073|ref|XP_003544395.1| PREDICTED: probable pre-mRNA-splicing factor ATP-dependent RNA helicase-like [Glycine max] Back     alignment and taxonomy information
>gi|449482906|ref|XP_004156439.1| PREDICTED: probable pre-mRNA-splicing factor ATP-dependent RNA helicase-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|449442879|ref|XP_004139208.1| PREDICTED: uncharacterized protein LOC101216792 [Cucumis sativus] Back     alignment and taxonomy information
>gi|15231574|ref|NP_189288.1| ATP-dependent RNA helicase DHX8/PRP22 [Arabidopsis thaliana] gi|27735187|sp|Q38953.2|DHX8_ARATH RecName: Full=Probable pre-mRNA-splicing factor ATP-dependent RNA helicase gi|9293935|dbj|BAB01838.1| pre-mRNA splicing factor ATP-dependent RNA helicase-like protein [Arabidopsis thaliana] gi|332643657|gb|AEE77178.1| ATP-dependent RNA helicase DHX8/PRP22 [Arabidopsis thaliana] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query1176
TAIR|locus:20888471168 AT3G26560 [Arabidopsis thalian 0.830 0.836 0.861 0.0
DICTYBASE|DDB_G02911831160 dhx8 "putative RNA splicing fa 0.823 0.834 0.650 0.0
UNIPROTKB|F1MEM41230 DHX8 "Uncharacterized protein" 0.829 0.793 0.638 0.0
UNIPROTKB|Q145621220 DHX8 "ATP-dependent RNA helica 0.829 0.8 0.637 0.0
MGI|MGI:13068231244 Dhx8 "DEAH (Asp-Glu-Ala-His) b 0.829 0.784 0.637 0.0
UNIPROTKB|D4A8051242 Dhx8 "Protein Dhx8" [Rattus no 0.829 0.785 0.637 0.0
UNIPROTKB|E2R9R91216 DHX8 "Uncharacterized protein" 0.829 0.802 0.637 0.0
UNIPROTKB|F1S1H31212 DHX8 "Uncharacterized protein" 0.829 0.805 0.637 0.0
ZFIN|ZDB-GENE-050809-391210 dhx8 "DEAH (Asp-Glu-Ala-His) b 0.826 0.803 0.640 0.0
RGD|13107231210 Dhx8 "DEAH (Asp-Glu-Ala-His) b 0.827 0.804 0.631 0.0
TAIR|locus:2088847 AT3G26560 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 4365 (1541.6 bits), Expect = 0., Sum P(3) = 0.
 Identities = 848/984 (86%), Positives = 893/984 (90%)

Query:   195 RRYDNKYGDRENDDSGDRSGRYRGNEPELYQVYKGRVSRVVDTGCFVQLNDFRGKEGLVH 254
             RR D +  D   ++  D+ G    NEPELYQVYKGRV+RV+D GCFVQ + FRGKEGLVH
Sbjct:   190 RRRDRRAKDEYVEE--DKGG---ANEPELYQVYKGRVTRVMDAGCFVQFDKFRGKEGLVH 244

Query:   255 VSQIATRRIGNAKDVVKRDQEVYVKVISVSGQKLSLSMRDVDQNTGKDLLPLKKIS-EDD 313
             VSQ+ATRR+  AK+ VKRD EVYVKVIS+S  K SLSMRDVDQNTG+DL+PL+K S EDD
Sbjct:   245 VSQMATRRVDKAKEFVKRDMEVYVKVISISSDKYSLSMRDVDQNTGRDLIPLRKPSDEDD 304

Query:   314 ALGNNPS-GTRDGPTTRMGLSGIRIVEEDGVVPSRRPLKRMSSPEKWEAKQLIASGVLSV 372
             +  +NPS  T+DG  T+ G+SGIRIVEE+ V PSRRPLK+MSSPE+WEAKQLIASGVL V
Sbjct:   305 SSRSNPSYRTKDGQVTKTGISGIRIVEENDVAPSRRPLKKMSSPERWEAKQLIASGVLRV 364

Query:   373 EDYPMYDEEGDGXXXXXXXXXXXXXXXXXXXXXXFLQGQTRYSVDMSPVKIFKNPEGXXX 432
             +++PMYDE+GDG                      FLQGQTRYSVDMSPVKIFKNPEG   
Sbjct:   365 DEFPMYDEDGDGMLYQEEGAEEELEIEMNEDEPAFLQGQTRYSVDMSPVKIFKNPEGSLS 424

Query:   433 XXXXXXXXXIKXXXXXXXXXXXTMLDSIPKDLNRPWEDPMPETGERHLAQELRGVGLSAY 492
                       K           TMLDSIPKDLNRPWEDPMPETGERHLAQELRGVGLSAY
Sbjct:   425 RAAALQSALTKERREMREQQQRTMLDSIPKDLNRPWEDPMPETGERHLAQELRGVGLSAY 484

Query:   493 DMPEWKKDAFGKALTFGQRSKLSIQEQRQSLPIYKLKKELIQAVHDNQVLVVIGETGSGK 552
             DMPEWKKDAFGK  TFGQRSKLSIQEQR+SLPIYKLKKELIQAVHDNQVLVVIGETGSGK
Sbjct:   485 DMPEWKKDAFGKTPTFGQRSKLSIQEQRESLPIYKLKKELIQAVHDNQVLVVIGETGSGK 544

Query:   553 TTQVTQYLAEAGYTTRGKIGCTQPRRVAAMSVAKRVAEEFGCRLGEEVGYAIRFEDCTGP 612
             TTQVTQYLAEAGYTT+GKIGCTQPRRVAAMSVAKRVAEEFGCRLGEEVGYAIRFEDCTGP
Sbjct:   545 TTQVTQYLAEAGYTTKGKIGCTQPRRVAAMSVAKRVAEEFGCRLGEEVGYAIRFEDCTGP 604

Query:   613 DTVIKYMTDGMLLREILIDDNLSQYSVIMLDEAHERTIHTDVLFGLLKQLVKRRPDLRLI 672
             DTVIKYMTDGMLLREILID+NLSQYSVIMLDEAHERTIHTDVLFGLLK+L+KRR DLRLI
Sbjct:   605 DTVIKYMTDGMLLREILIDENLSQYSVIMLDEAHERTIHTDVLFGLLKKLMKRRLDLRLI 664

Query:   673 VTSATLDAEKFSGYFFNCNIFTIPGRTFPVEILYTKQPESDYLDASLITVLQIHLTEPEG 732
             VTSATLDAEKFSGYFFNCNIFTIPGRTFPVEILYTKQPE+DYLDA+LITVLQIHLTEPEG
Sbjct:   665 VTSATLDAEKFSGYFFNCNIFTIPGRTFPVEILYTKQPETDYLDAALITVLQIHLTEPEG 724

Query:   733 DILLFLTGQEEIDFACQSLYERMKGLGKNVPELIILPVYSALPSEMQSRIFDPAPPGKRK 792
             DIL+FLTGQEEID ACQSLYERMKGLGKNVPELIILPVYSALPSEMQSRIFDP PPGKRK
Sbjct:   725 DILVFLTGQEEIDSACQSLYERMKGLGKNVPELIILPVYSALPSEMQSRIFDPPPPGKRK 784

Query:   793 VVVATNIAEASLTIDGIFYVIDPGFAKQNVYNPKQGLDSLVITPISQASAKQRAGRAGRT 852
             VVVATNIAEASLTIDGI+YV+DPGFAKQNVYNPKQGL+SLVITPISQASAKQRAGRAGRT
Sbjct:   785 VVVATNIAEASLTIDGIYYVVDPGFAKQNVYNPKQGLESLVITPISQASAKQRAGRAGRT 844

Query:   853 GPGKCYRLYTESAYRNEMSPTSIPEIQRINLGFTTLTMKAMGINDLLSFDFMDPPSPQAL 912
             GPGKCYRLYTESAYRNEM PTSIPEIQRINLG TTLTMKAMGINDLLSFDFMDPP PQAL
Sbjct:   845 GPGKCYRLYTESAYRNEMPPTSIPEIQRINLGMTTLTMKAMGINDLLSFDFMDPPQPQAL 904

Query:   913 ISAMEQLYSLGALDEEGLLTKLGRKMAEFPLDPPLSKMLLASVDLGCSDEILTIIAMIQT 972
             ISAMEQLYSLGALDEEGLLTKLGRKMAEFPL+PPLSKMLLASVDLGCSDEILT+IAMIQT
Sbjct:   905 ISAMEQLYSLGALDEEGLLTKLGRKMAEFPLEPPLSKMLLASVDLGCSDEILTMIAMIQT 964

Query:   973 GNIFYRPREKQAQADQKRAKFFQPEGDHLTLLAVYEAWKAKNFSGPWCFENFVQSRSLRR 1032
             GNIFYRPREKQAQADQKRAKFFQPEGDHLTLLAVYEAWKAKNFSGPWCFENF+QSRSLRR
Sbjct:   965 GNIFYRPREKQAQADQKRAKFFQPEGDHLTLLAVYEAWKAKNFSGPWCFENFIQSRSLRR 1024

Query:  1033 AQDVRKQLLSIMDKYKLDVMSAGKNFTKIRKAITAGFFFHAARKDPQEGYRTLVENQPVY 1092
             AQDVRKQLLSIMDKYKLDV++AGKNFTKIRKAITAGFFFH ARKDPQEGYRTLVENQPVY
Sbjct:  1025 AQDVRKQLLSIMDKYKLDVVTAGKNFTKIRKAITAGFFFHGARKDPQEGYRTLVENQPVY 1084

Query:  1093 IHPSSALFQRQPDWVIYHELVMTTKEYMREVTVIDPKWLVDLAPRFFKVADPTKMSKRKR 1152
             IHPSSALFQRQPDWVIYH+LVMTTKEYMREVTVIDPKWLV+LAPRFFKV+DPTKMSKRKR
Sbjct:  1085 IHPSSALFQRQPDWVIYHDLVMTTKEYMREVTVIDPKWLVELAPRFFKVSDPTKMSKRKR 1144

Query:  1153 QERIEPLYDRYHEPNSWRLSKRRA 1176
             QERIEPLYDRYHEPNSWRLSKRRA
Sbjct:  1145 QERIEPLYDRYHEPNSWRLSKRRA 1168
GO:0003676 "nucleic acid binding" evidence=IEA
GO:0003723 "RNA binding" evidence=IEA;ISS
GO:0004004 "ATP-dependent RNA helicase activity" evidence=ISS
GO:0004386 "helicase activity" evidence=IEA
GO:0005524 "ATP binding" evidence=IEA;ISS
GO:0005634 "nucleus" evidence=ISM
GO:0008026 "ATP-dependent helicase activity" evidence=IEA
GO:0005739 "mitochondrion" evidence=IDA
GO:0005829 "cytosol" evidence=IDA
GO:0009506 "plasmodesma" evidence=IDA
GO:0000226 "microtubule cytoskeleton organization" evidence=RCA
GO:0000911 "cytokinesis by cell plate formation" evidence=RCA
GO:0006486 "protein glycosylation" evidence=RCA
DICTYBASE|DDB_G0291183 dhx8 "putative RNA splicing factor" [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms
UNIPROTKB|F1MEM4 DHX8 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|Q14562 DHX8 "ATP-dependent RNA helicase DHX8" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
MGI|MGI:1306823 Dhx8 "DEAH (Asp-Glu-Ala-His) box polypeptide 8" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|D4A805 Dhx8 "Protein Dhx8" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|E2R9R9 DHX8 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|F1S1H3 DHX8 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-050809-39 dhx8 "DEAH (Asp-Glu-Ala-His) box polypeptide 8" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
RGD|1310723 Dhx8 "DEAH (Asp-Glu-Ala-His) box polypeptide 8" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q09530MOG5_CAEEL3, ., 6, ., 4, ., 1, 30.60880.79670.7808yesno
Q14562DHX8_HUMAN3, ., 6, ., 4, ., 1, 30.66020.83070.8008yesno
A2A4P0DHX8_MOUSE3, ., 6, ., 4, ., 1, 30.66020.83070.7853yesno
O42643PRP22_SCHPO3, ., 6, ., 4, ., 1, 30.55910.79930.8047yesno
Q38953DHX8_ARATH3, ., 6, ., 4, ., 1, 30.91880.81540.8210yesno

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer3.6.4.130.991
3rd Layer3.6.40.976

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query1176
COG1643845 COG1643, HrpA, HrpA-like helicases [DNA replicatio 0.0
TIGR01967 1283 TIGR01967, DEAH_box_HrpA, ATP-dependent helicase H 1e-155
PRK11131 1294 PRK11131, PRK11131, ATP-dependent RNA helicase Hrp 1e-143
TIGR01970 819 TIGR01970, DEAH_box_HrpB, ATP-dependent helicase H 4e-95
PRK11664 812 PRK11664, PRK11664, ATP-dependent RNA helicase Hrp 1e-87
pfam0440891 pfam04408, HA2, Helicase associated domain (HA2) 4e-42
pfam07717109 pfam07717, OB_NTP_bind, Oligonucleotide/oligosacch 9e-39
cd0568479 cd05684, S1_DHX8_helicase, S1_DHX8_helicase: The N 2e-35
smart0084782 smart00847, HA2, Helicase associated domain (HA2) 3e-33
cd00046144 cd00046, DEXDc, DEAD-like helicases superfamily 4e-33
smart00487201 smart00487, DEXDc, DEAD-like helicases superfamily 7e-28
PRK11824693 PRK11824, PRK11824, polynucleotide phosphorylase/p 3e-19
COG1185692 COG1185, Pnp, Polyribonucleotide nucleotidyltransf 3e-17
cd0447268 cd04472, S1_PNPase, S1_PNPase: Polynucleotide phos 6e-17
TIGR03591684 TIGR03591, polynuc_phos, polyribonucleotide nucleo 5e-15
cd0569269 cd05692, S1_RPS1_repeat_hs4, S1_RPS1_repeat_hs4: R 3e-14
smart0031672 smart00316, S1, Ribosomal protein S1-like RNA-bind 5e-14
PRK00087647 PRK00087, PRK00087, 4-hydroxy-3-methylbut-2-enyl d 1e-13
PRK06676390 PRK06676, rpsA, 30S ribosomal protein S1; Reviewed 2e-13
cd00079131 cd00079, HELICc, Helicase superfamily c-terminal d 2e-13
smart0049082 smart00490, HELICc, helicase superfamily c-termina 3e-13
cd0568673 cd05686, S1_pNO40, S1_pNO40: pNO40 , S1-like RNA-b 5e-13
COG1098129 COG1098, VacB, Predicted RNA binding protein (cont 1e-12
PRK12678672 PRK12678, PRK12678, transcription termination fact 3e-12
PRK12678672 PRK12678, PRK12678, transcription termination fact 7e-12
PRK06676390 PRK06676, rpsA, 30S ribosomal protein S1; Reviewed 1e-11
COG1093269 COG1093, SUI2, Translation initiation factor 2, al 1e-11
cd0445276 cd04452, S1_IF2_alpha, S1_IF2_alpha: The alpha sub 2e-11
PRK03987262 PRK03987, PRK03987, translation initiation factor 2e-11
COG0539541 COG0539, RpsA, Ribosomal protein S1 [Translation, 3e-11
PRK06299565 PRK06299, rpsA, 30S ribosomal protein S1; Reviewed 3e-11
cd0016465 cd00164, S1_like, S1_like: Ribosomal protein S1-li 3e-11
pfam0057574 pfam00575, S1, S1 RNA binding domain 4e-11
PRK12678672 PRK12678, PRK12678, transcription termination fact 9e-11
cd0568868 cd05688, S1_RPS1_repeat_ec3, S1_RPS1_repeat_ec3: R 1e-10
PRK00087647 PRK00087, PRK00087, 4-hydroxy-3-methylbut-2-enyl d 2e-10
PRK08059123 PRK08059, PRK08059, general stress protein 13; Val 3e-10
COG0539541 COG0539, RpsA, Ribosomal protein S1 [Translation, 1e-09
PHA02653675 PHA02653, PHA02653, RNA helicase NPH-II; Provision 3e-09
TIGR00717516 TIGR00717, rpsA, ribosomal protein S1 5e-09
pfam0027178 pfam00271, Helicase_C, Helicase conserved C-termin 5e-09
PRK07899486 PRK07899, rpsA, 30S ribosomal protein S1; Reviewed 6e-09
PRK12678672 PRK12678, PRK12678, transcription termination fact 1e-08
PRK12678672 PRK12678, PRK12678, transcription termination fact 1e-08
PRK07252120 PRK07252, PRK07252, hypothetical protein; Provisio 2e-08
PRK13806491 PRK13806, rpsA, 30S ribosomal protein S1; Provisio 2e-08
PRK06299565 PRK06299, rpsA, 30S ribosomal protein S1; Reviewed 3e-08
TIGR01642509 TIGR01642, U2AF_lg, U2 snRNP auxilliary factor, la 4e-08
PRK08582139 PRK08582, PRK08582, hypothetical protein; Provisio 4e-08
cd0568568 cd05685, S1_Tex, S1_Tex: The C-terminal S1 domain 1e-07
PRK05807136 PRK05807, PRK05807, hypothetical protein; Provisio 2e-07
TIGR01642509 TIGR01642, U2AF_lg, U2 snRNP auxilliary factor, la 3e-07
PRK07899486 PRK07899, rpsA, 30S ribosomal protein S1; Reviewed 6e-07
pfam1287197 pfam12871, PRP38_assoc, Pre-mRNA-splicing factor 3 7e-07
COG2183780 COG2183, Tex, Transcriptional accessory protein [T 8e-07
TIGR01642509 TIGR01642, U2AF_lg, U2 snRNP auxilliary factor, la 1e-06
TIGR00717516 TIGR00717, rpsA, ribosomal protein S1 2e-06
pfam1287197 pfam12871, PRP38_assoc, Pre-mRNA-splicing factor 3 2e-06
PRK06299565 PRK06299, rpsA, 30S ribosomal protein S1; Reviewed 4e-06
PRK13806491 PRK13806, rpsA, 30S ribosomal protein S1; Provisio 4e-06
cd0570877 cd05708, S1_Rrp5_repeat_sc12, S1_Rrp5_repeat_sc12: 5e-06
PRK06299565 PRK06299, rpsA, 30S ribosomal protein S1; Reviewed 2e-05
pfam08648158 pfam08648, DUF1777, Protein of unknown function (D 2e-05
cd0568972 cd05689, S1_RPS1_repeat_ec4, S1_RPS1_repeat_ec4: R 4e-05
cd0569069 cd05690, S1_RPS1_repeat_ec5, S1_RPS1_repeat_ec5: R 4e-05
TIGR01622457 TIGR01622, SF-CC1, splicing factor, CC1-like famil 6e-05
PRK06676390 PRK06676, rpsA, 30S ribosomal protein S1; Reviewed 7e-05
pfam08648158 pfam08648, DUF1777, Protein of unknown function (D 9e-05
TIGR00717516 TIGR00717, rpsA, ribosomal protein S1 1e-04
pfam08648158 pfam08648, DUF1777, Protein of unknown function (D 2e-04
pfam03064238 pfam03064, U79_P34, HSV U79 / HCMV P34 3e-04
pfam13191154 pfam13191, AAA_16, AAA ATPase domain 6e-04
PLN00207891 PLN00207, PLN00207, polyribonucleotide nucleotidyl 6e-04
cd0446183 cd04461, S1_Rrp5_repeat_hs8_sc7, S1_Rrp5_repeat_hs 6e-04
TIGR02696719 TIGR02696, pppGpp_PNP, guanosine pentaphosphate sy 7e-04
pfam00270169 pfam00270, DEAD, DEAD/DEAH box helicase 8e-04
PRK08563187 PRK08563, PRK08563, DNA-directed RNA polymerase su 8e-04
COG0539541 COG0539, RpsA, Ribosomal protein S1 [Translation, 0.001
TIGR01622457 TIGR01622, SF-CC1, splicing factor, CC1-like famil 0.001
cd0569870 cd05698, S1_Rrp5_repeat_hs6_sc5, S1_Rrp5_repeat_hs 0.001
pfam1287197 pfam12871, PRP38_assoc, Pre-mRNA-splicing factor 3 0.003
PRK12678672 PRK12678, PRK12678, transcription termination fact 0.004
>gnl|CDD|224557 COG1643, HrpA, HrpA-like helicases [DNA replication, recombination, and repair] Back     alignment and domain information 
 Score =  753 bits (1946), Expect = 0.0
 Identities = 291/677 (42%), Positives = 395/677 (58%), Gaps = 57/677 (8%)

Query: 512  SKLSIQEQRQSLPIYKLKKELIQAVHDNQVLVVIGETGSGKTTQVTQYLAEAGYTTRGKI 571
            +   I E R  LP+  ++ E+++A+  NQV++++GETGSGKTTQ+ Q+L E G    GKI
Sbjct: 38   NVPDILEYRSGLPVTAVRDEILKAIEQNQVVIIVGETGSGKTTQLPQFLLEEGLGIAGKI 97

Query: 572  GCTQPRRVAAMSVAKRVAEEFGCRLGEEVGYAIRFEDCTGPDTVIKYMTDGMLLREILID 631
            GCTQPRR+AA SVA+RVAEE G +LGE VGY+IRFE    P T IK MTDG+LLREI  D
Sbjct: 98   GCTQPRRLAARSVAERVAEELGEKLGETVGYSIRFESKVSPRTRIKVMTDGILLREIQND 157

Query: 632  DNLSQYSVIMLDEAHERTIHTDVLFGLLKQLVK-RRPDLRLIVTSATLDAEKFSGYFFNC 690
              LS YSV+++DEAHER+++TD+L GLLK L+  RR DL+LI+ SATLDAE+FS YF N 
Sbjct: 158  PLLSGYSVVIIDEAHERSLNTDILLGLLKDLLARRRDDLKLIIMSATLDAERFSAYFGNA 217

Query: 691  NIFTIPGRTFPVEILYTKQPESDY-LDASLITVLQIHLTEPEGDILLFLTGQEEIDFACQ 749
             +  I GRT+PVEI Y  + E+DY L  +++  + IHL E  G IL+FL GQ EI+   +
Sbjct: 218  PVIEIEGRTYPVEIRYLPEAEADYILLDAIVAAVDIHLREGSGSILVFLPGQREIERTAE 277

Query: 750  SLYERMKGLGKNVPELIILPVYSALPSEMQSRIFDPAPPGKRKVVVATNIAEASLTIDGI 809
             L +   G      +L ILP+Y AL +E Q R+F+PAP GKRKVV+ATNIAE SLTI GI
Sbjct: 278  WLEKAELG-----DDLEILPLYGALSAEEQVRVFEPAPGGKRKVVLATNIAETSLTIPGI 332

Query: 810  FYVIDPGFAKQNVYNPKQGLDSLVITPISQASAKQRAGRAGRTGPGKCYRLYTESAYRNE 869
             YVID G AK+  Y+P+ GL  L   PIS+ASA QRAGRAGRTGPG CYRLY+E  +   
Sbjct: 333  RYVIDSGLAKEKRYDPRTGLTRLETEPISKASADQRAGRAGRTGPGICYRLYSEEDF-LA 391

Query: 870  MSPTSIPEIQRINLGFTTLTMKAMGI-NDLLSFDFMDPPSPQALISAMEQLYSLGALDEE 928
                ++PEI R +L    L +K++GI  D+  F F+DPP   A+ +A+  L  LGALD+ 
Sbjct: 392  FPEFTLPEILRTDLSGLVLQLKSLGIGQDIAPFPFLDPPPEAAIQAALTLLQELGALDDS 451

Query: 929  GLLTKLGRKMAEFPLDPPLSKMLLASVDLGCSDEILTIIAMIQTGNI---FYRPRE-KQA 984
            G LT LG++M+  PLDP L++MLL + + GC  E  TI +M+   +    F R  + ++ 
Sbjct: 452  GKLTPLGKQMSLLPLDPRLARMLLTAPEGGCLGEAATIASMLSEQDRESDFSRDVKLRKQ 511

Query: 985  QADQKRAKFFQ------PEGDHLTLLAVYEAWKAKNFSGP------WCFENFVQSRSLRR 1032
            +  Q   K  +      P GDHL LL  +    A+  +         C      +++L R
Sbjct: 512  RTAQDLLKRLKRRNAADPRGDHLLLLEAFPDRIARKRAKGEYLRANGCRAMLFPTKALSR 571

Query: 1033 AQDVRKQLLSIMDK-YKLDVMSAGKN------------------FTKIRKAITAGFFFHA 1073
            A  +   LL          + +A  +                  +  IR A+ AG   + 
Sbjct: 572  APWIIAALLVQTSALAGRILAAAEIDEDEWAAQHLPEHCYSEPIWDDIRGALAAGRKLNI 631

Query: 1074 ARKDP-QEGYRTLVENQPVYIHPSS-ALFQRQPDWVIYHELVMTTKEYMRE--------- 1122
            A+       Y TL +N PV+ HPSS  L     +W+ Y E + T K Y+RE         
Sbjct: 632  AQLQLDGRPYVTLSDNTPVFAHPSSVRLGLVLLEWIKYAEFLRTRKGYLREGRGERWPDV 691

Query: 1123 --VTVIDPKWLVDLAPR 1137
              +  +   WL +    
Sbjct: 692  QTLIELLKLWLKEQVKG 708

Length = 845
>gnl|CDD|233659 TIGR01967, DEAH_box_HrpA, ATP-dependent helicase HrpA Back     alignment and domain information
>gnl|CDD|182986 PRK11131, PRK11131, ATP-dependent RNA helicase HrpA; Provisional Back     alignment and domain information
>gnl|CDD|233660 TIGR01970, DEAH_box_HrpB, ATP-dependent helicase HrpB Back     alignment and domain information
>gnl|CDD|236950 PRK11664, PRK11664, ATP-dependent RNA helicase HrpB; Provisional Back     alignment and domain information
>gnl|CDD|218070 pfam04408, HA2, Helicase associated domain (HA2) Back     alignment and domain information
>gnl|CDD|219532 pfam07717, OB_NTP_bind, Oligonucleotide/oligosaccharide-binding (OB)-fold Back     alignment and domain information
>gnl|CDD|240189 cd05684, S1_DHX8_helicase, S1_DHX8_helicase: The N-terminal S1 domain of human ATP-dependent RNA helicase DHX8, a DEAH (Asp-Glu-Ala-His) box polypeptide Back     alignment and domain information
>gnl|CDD|214852 smart00847, HA2, Helicase associated domain (HA2) Add an annotation Back     alignment and domain information
>gnl|CDD|238005 cd00046, DEXDc, DEAD-like helicases superfamily Back     alignment and domain information
>gnl|CDD|214692 smart00487, DEXDc, DEAD-like helicases superfamily Back     alignment and domain information
>gnl|CDD|236995 PRK11824, PRK11824, polynucleotide phosphorylase/polyadenylase; Provisional Back     alignment and domain information
>gnl|CDD|224106 COG1185, Pnp, Polyribonucleotide nucleotidyltransferase (polynucleotide phosphorylase) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|239918 cd04472, S1_PNPase, S1_PNPase: Polynucleotide phosphorylase (PNPase), ), S1-like RNA-binding domain Back     alignment and domain information
>gnl|CDD|234271 TIGR03591, polynuc_phos, polyribonucleotide nucleotidyltransferase Back     alignment and domain information
>gnl|CDD|240197 cd05692, S1_RPS1_repeat_hs4, S1_RPS1_repeat_hs4: Ribosomal protein S1 (RPS1) domain Back     alignment and domain information
>gnl|CDD|197648 smart00316, S1, Ribosomal protein S1-like RNA-binding domain Back     alignment and domain information
>gnl|CDD|234623 PRK00087, PRK00087, 4-hydroxy-3-methylbut-2-enyl diphosphate reductase/S1 RNA-binding domain protein; Reviewed Back     alignment and domain information
>gnl|CDD|235851 PRK06676, rpsA, 30S ribosomal protein S1; Reviewed Back     alignment and domain information
>gnl|CDD|238034 cd00079, HELICc, Helicase superfamily c-terminal domain; associated with DEXDc-, DEAD-, and DEAH-box proteins, yeast initiation factor 4A, Ski2p, and Hepatitis C virus NS3 helicases; this domain is found in a wide variety of helicases and helicase related proteins; may not be an autonomously folding unit, but an integral part of the helicase; 4 helicase superfamilies at present according to the organization of their signature motifs; all helicases share the ability to unwind nucleic acid duplexes with a distinct directional polarity; they utilize the free energy from nucleoside triphosphate hydrolysis to fuel their translocation along DNA, unwinding the duplex in the process Back     alignment and domain information
>gnl|CDD|197757 smart00490, HELICc, helicase superfamily c-terminal domain Back     alignment and domain information
>gnl|CDD|240191 cd05686, S1_pNO40, S1_pNO40: pNO40 , S1-like RNA-binding domain Back     alignment and domain information
>gnl|CDD|224023 COG1098, VacB, Predicted RNA binding protein (contains ribosomal protein S1 domain) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|237171 PRK12678, PRK12678, transcription termination factor Rho; Provisional Back     alignment and domain information
>gnl|CDD|237171 PRK12678, PRK12678, transcription termination factor Rho; Provisional Back     alignment and domain information
>gnl|CDD|235851 PRK06676, rpsA, 30S ribosomal protein S1; Reviewed Back     alignment and domain information
>gnl|CDD|224018 COG1093, SUI2, Translation initiation factor 2, alpha subunit (eIF-2alpha) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|239899 cd04452, S1_IF2_alpha, S1_IF2_alpha: The alpha subunit of translation Initiation Factor 2, S1-like RNA-binding domain Back     alignment and domain information
>gnl|CDD|235188 PRK03987, PRK03987, translation initiation factor IF-2 subunit alpha; Validated Back     alignment and domain information
>gnl|CDD|223613 COG0539, RpsA, Ribosomal protein S1 [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|235775 PRK06299, rpsA, 30S ribosomal protein S1; Reviewed Back     alignment and domain information
>gnl|CDD|238094 cd00164, S1_like, S1_like: Ribosomal protein S1-like RNA-binding domain Back     alignment and domain information
>gnl|CDD|216000 pfam00575, S1, S1 RNA binding domain Back     alignment and domain information
>gnl|CDD|237171 PRK12678, PRK12678, transcription termination factor Rho; Provisional Back     alignment and domain information
>gnl|CDD|240193 cd05688, S1_RPS1_repeat_ec3, S1_RPS1_repeat_ec3: Ribosomal protein S1 (RPS1) domain Back     alignment and domain information
>gnl|CDD|234623 PRK00087, PRK00087, 4-hydroxy-3-methylbut-2-enyl diphosphate reductase/S1 RNA-binding domain protein; Reviewed Back     alignment and domain information
>gnl|CDD|181215 PRK08059, PRK08059, general stress protein 13; Validated Back     alignment and domain information
>gnl|CDD|223613 COG0539, RpsA, Ribosomal protein S1 [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|177443 PHA02653, PHA02653, RNA helicase NPH-II; Provisional Back     alignment and domain information
>gnl|CDD|233102 TIGR00717, rpsA, ribosomal protein S1 Back     alignment and domain information
>gnl|CDD|201125 pfam00271, Helicase_C, Helicase conserved C-terminal domain Back     alignment and domain information
>gnl|CDD|236126 PRK07899, rpsA, 30S ribosomal protein S1; Reviewed Back     alignment and domain information
>gnl|CDD|237171 PRK12678, PRK12678, transcription termination factor Rho; Provisional Back     alignment and domain information
>gnl|CDD|237171 PRK12678, PRK12678, transcription termination factor Rho; Provisional Back     alignment and domain information
>gnl|CDD|180908 PRK07252, PRK07252, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|237516 PRK13806, rpsA, 30S ribosomal protein S1; Provisional Back     alignment and domain information
>gnl|CDD|235775 PRK06299, rpsA, 30S ribosomal protein S1; Reviewed Back     alignment and domain information
>gnl|CDD|233503 TIGR01642, U2AF_lg, U2 snRNP auxilliary factor, large subunit, splicing factor Back     alignment and domain information
>gnl|CDD|236305 PRK08582, PRK08582, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|240190 cd05685, S1_Tex, S1_Tex: The C-terminal S1 domain of a transcription accessory factor called Tex, which has been characterized in Bordetella pertussis and Pseudomonas aeruginosa Back     alignment and domain information
>gnl|CDD|235614 PRK05807, PRK05807, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|233503 TIGR01642, U2AF_lg, U2 snRNP auxilliary factor, large subunit, splicing factor Back     alignment and domain information
>gnl|CDD|236126 PRK07899, rpsA, 30S ribosomal protein S1; Reviewed Back     alignment and domain information
>gnl|CDD|221821 pfam12871, PRP38_assoc, Pre-mRNA-splicing factor 38-associated hydrophilic C-term Back     alignment and domain information
>gnl|CDD|225094 COG2183, Tex, Transcriptional accessory protein [Transcription] Back     alignment and domain information
>gnl|CDD|233503 TIGR01642, U2AF_lg, U2 snRNP auxilliary factor, large subunit, splicing factor Back     alignment and domain information
>gnl|CDD|233102 TIGR00717, rpsA, ribosomal protein S1 Back     alignment and domain information
>gnl|CDD|221821 pfam12871, PRP38_assoc, Pre-mRNA-splicing factor 38-associated hydrophilic C-term Back     alignment and domain information
>gnl|CDD|235775 PRK06299, rpsA, 30S ribosomal protein S1; Reviewed Back     alignment and domain information
>gnl|CDD|237516 PRK13806, rpsA, 30S ribosomal protein S1; Provisional Back     alignment and domain information
>gnl|CDD|240213 cd05708, S1_Rrp5_repeat_sc12, S1_Rrp5_repeat_sc12: Rrp5 is a trans-acting factor important for biogenesis of both the 40S and 60S eukaryotic ribosomal subunits Back     alignment and domain information
>gnl|CDD|235775 PRK06299, rpsA, 30S ribosomal protein S1; Reviewed Back     alignment and domain information
>gnl|CDD|219953 pfam08648, DUF1777, Protein of unknown function (DUF1777) Back     alignment and domain information
>gnl|CDD|240194 cd05689, S1_RPS1_repeat_ec4, S1_RPS1_repeat_ec4: Ribosomal protein S1 (RPS1) domain Back     alignment and domain information
>gnl|CDD|240195 cd05690, S1_RPS1_repeat_ec5, S1_RPS1_repeat_ec5: Ribosomal protein S1 (RPS1) domain Back     alignment and domain information
>gnl|CDD|233496 TIGR01622, SF-CC1, splicing factor, CC1-like family Back     alignment and domain information
>gnl|CDD|235851 PRK06676, rpsA, 30S ribosomal protein S1; Reviewed Back     alignment and domain information
>gnl|CDD|219953 pfam08648, DUF1777, Protein of unknown function (DUF1777) Back     alignment and domain information
>gnl|CDD|233102 TIGR00717, rpsA, ribosomal protein S1 Back     alignment and domain information
>gnl|CDD|219953 pfam08648, DUF1777, Protein of unknown function (DUF1777) Back     alignment and domain information
>gnl|CDD|217348 pfam03064, U79_P34, HSV U79 / HCMV P34 Back     alignment and domain information
>gnl|CDD|221970 pfam13191, AAA_16, AAA ATPase domain Back     alignment and domain information
>gnl|CDD|215104 PLN00207, PLN00207, polyribonucleotide nucleotidyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|239908 cd04461, S1_Rrp5_repeat_hs8_sc7, S1_Rrp5_repeat_hs8_sc7: Rrp5 Homo sapiens S1 repeat 8 (hs8) and Saccharomyces cerevisiae S1 repeat 7 (sc7)-like domains Back     alignment and domain information
>gnl|CDD|131743 TIGR02696, pppGpp_PNP, guanosine pentaphosphate synthetase I/polynucleotide phosphorylase Back     alignment and domain information
>gnl|CDD|215832 pfam00270, DEAD, DEAD/DEAH box helicase Back     alignment and domain information
>gnl|CDD|236289 PRK08563, PRK08563, DNA-directed RNA polymerase subunit E'; Provisional Back     alignment and domain information
>gnl|CDD|223613 COG0539, RpsA, Ribosomal protein S1 [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|233496 TIGR01622, SF-CC1, splicing factor, CC1-like family Back     alignment and domain information
>gnl|CDD|240203 cd05698, S1_Rrp5_repeat_hs6_sc5, S1_Rrp5_repeat_hs6_sc5: Rrp5 is a trans-acting factor important for biogenesis of both the 40S and 60S eukaryotic ribosomal subunits Back     alignment and domain information
>gnl|CDD|221821 pfam12871, PRP38_assoc, Pre-mRNA-splicing factor 38-associated hydrophilic C-term Back     alignment and domain information
>gnl|CDD|237171 PRK12678, PRK12678, transcription termination factor Rho; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 1176
KOG09241042 consensus mRNA splicing factor ATP-dependent RNA h 100.0
KOG0922674 consensus DEAH-box RNA helicase [RNA processing an 100.0
KOG0923902 consensus mRNA splicing factor ATP-dependent RNA h 100.0
KOG0925699 consensus mRNA splicing factor ATP-dependent RNA h 100.0
PRK11131 1294 ATP-dependent RNA helicase HrpA; Provisional 100.0
TIGR01967 1283 DEAH_box_HrpA ATP-dependent helicase HrpA. This mo 100.0
COG1643845 HrpA HrpA-like helicases [DNA replication, recombi 100.0
KOG0926 1172 consensus DEAH-box RNA helicase [RNA processing an 100.0
KOG0920924 consensus ATP-dependent RNA helicase A [RNA proces 100.0
PRK11664 812 ATP-dependent RNA helicase HrpB; Provisional 100.0
TIGR01970 819 DEAH_box_HrpB ATP-dependent helicase HrpB. This mo 100.0
KOG0921 1282 consensus Dosage compensation complex, subunit MLE 100.0
PHA02653675 RNA helicase NPH-II; Provisional 100.0
PRK01172674 ski2-like helicase; Provisional 100.0
PRK02362737 ski2-like helicase; Provisional 100.0
KOG0331519 consensus ATP-dependent RNA helicase [RNA processi 100.0
KOG0330476 consensus ATP-dependent RNA helicase [RNA processi 100.0
PRK11776460 ATP-dependent RNA helicase DbpA; Provisional 100.0
PTZ00110545 helicase; Provisional 100.0
PRK00254720 ski2-like helicase; Provisional 100.0
COG0513513 SrmB Superfamily II DNA and RNA helicases [DNA rep 100.0
PRK04837423 ATP-dependent RNA helicase RhlB; Provisional 100.0
PLN00206518 DEAD-box ATP-dependent RNA helicase; Provisional 100.0
PRK10590456 ATP-dependent RNA helicase RhlE; Provisional 100.0
PRK11634629 ATP-dependent RNA helicase DeaD; Provisional 100.0
PRK11192434 ATP-dependent RNA helicase SrmB; Provisional 100.0
KOG0333673 consensus U5 snRNP-like RNA helicase subunit [RNA 100.0
PRK04537572 ATP-dependent RNA helicase RhlB; Provisional 100.0
PRK01297475 ATP-dependent RNA helicase RhlB; Provisional 100.0
PTZ00424401 helicase 45; Provisional 100.0
PLN031371195 ATP-dependent DNA helicase; Q4-like; Provisional 100.0
TIGR03817742 DECH_helic helicase/secretion neighborhood putativ 100.0
KOG0338691 consensus ATP-dependent RNA helicase [RNA processi 100.0
KOG0345567 consensus ATP-dependent RNA helicase [RNA processi 100.0
TIGR00614470 recQ_fam ATP-dependent DNA helicase, RecQ family. 100.0
KOG0342543 consensus ATP-dependent RNA helicase pitchoune [RN 100.0
KOG0343758 consensus RNA Helicase [RNA processing and modific 100.0
PRK11057607 ATP-dependent DNA helicase RecQ; Provisional 100.0
COG1202830 Superfamily II helicase, archaea-specific [General 100.0
KOG0340442 consensus ATP-dependent RNA helicase [RNA processi 100.0
KOG0336629 consensus ATP-dependent RNA helicase [RNA processi 100.0
KOG0339731 consensus ATP-dependent RNA helicase [RNA processi 100.0
KOG0348708 consensus ATP-dependent RNA helicase [RNA processi 100.0
COG1204766 Superfamily II helicase [General function predicti 100.0
KOG0328400 consensus Predicted ATP-dependent RNA helicase FAL 100.0
KOG0334997 consensus RNA helicase [RNA processing and modific 100.0
TIGR01389591 recQ ATP-dependent DNA helicase RecQ. The ATP-depe 100.0
PRK13767 876 ATP-dependent helicase; Provisional 100.0
KOG0347731 consensus RNA helicase [RNA processing and modific 100.0
KOG0335482 consensus ATP-dependent RNA helicase [RNA processi 100.0
KOG0326459 consensus ATP-dependent RNA helicase [RNA processi 100.0
KOG0350620 consensus DEAD-box ATP-dependent RNA helicase [RNA 99.97
KOG0332477 consensus ATP-dependent RNA helicase [RNA processi 99.97
TIGR00580926 mfd transcription-repair coupling factor (mfd). Al 99.97
TIGR02621 844 cas3_GSU0051 CRISPR-associated helicase Cas3, Anae 99.97
PRK09751 1490 putative ATP-dependent helicase Lhr; Provisional 99.97
KOG0341610 consensus DEAD-box protein abstrakt [RNA processin 99.97
PRK10917681 ATP-dependent DNA helicase RecG; Provisional 99.97
COG1201 814 Lhr Lhr-like helicases [General function predictio 99.97
PRK106891147 transcription-repair coupling factor; Provisional 99.97
TIGR00643630 recG ATP-dependent DNA helicase RecG. 99.97
TIGR01587358 cas3_core CRISPR-associated helicase Cas3. This mo 99.97
KOG0952 1230 consensus DNA/RNA helicase MER3/SLH1, DEAD-box sup 99.97
COG0514590 RecQ Superfamily II DNA helicase [DNA replication, 99.96
KOG0346569 consensus RNA helicase [RNA processing and modific 99.96
KOG0344593 consensus ATP-dependent RNA helicase [RNA processi 99.96
TIGR03158357 cas3_cyano CRISPR-associated helicase, Cyano-type. 99.96
COG1111542 MPH1 ERCC4-like helicases [DNA replication, recomb 99.96
KOG4284 980 consensus DEAD box protein [Transcription] 99.95
KOG0327397 consensus Translation initiation factor 4F, helica 99.95
KOG0354746 consensus DEAD-box like helicase [General function 99.95
COG1205 851 Distinct helicase family with a unique C-terminal 99.95
PHA02558501 uvsW UvsW helicase; Provisional 99.94
KOG0951 1674 consensus RNA helicase BRR2, DEAD-box superfamily 99.94
PRK13766773 Hef nuclease; Provisional 99.94
PRK09401 1176 reverse gyrase; Reviewed 99.93
KOG0948 1041 consensus Nuclear exosomal RNA helicase MTR4, DEAD 99.93
KOG0947 1248 consensus Cytoplasmic exosomal RNA helicase SKI2, 99.93
KOG0337529 consensus ATP-dependent RNA helicase [RNA processi 99.92
KOG0353695 consensus ATP-dependent DNA helicase [General func 99.92
KOG0352641 consensus ATP-dependent DNA helicase [Replication, 99.92
COG4581 1041 Superfamily II RNA helicase [DNA replication, reco 99.92
PRK14701 1638 reverse gyrase; Provisional 99.92
TIGR00603732 rad25 DNA repair helicase rad25. All proteins in t 99.92
KOG0351941 consensus ATP-dependent DNA helicase [Replication, 99.92
TIGR03714762 secA2 accessory Sec system translocase SecA2. Memb 99.92
PRK12898656 secA preprotein translocase subunit SecA; Reviewed 99.91
PRK09200790 preprotein translocase subunit SecA; Reviewed 99.91
PRK09694878 helicase Cas3; Provisional 99.91
PRK05580679 primosome assembly protein PriA; Validated 99.9
TIGR01054 1171 rgy reverse gyrase. Generally, these gyrases are e 99.9
TIGR00963745 secA preprotein translocase, SecA subunit. The pro 99.89
TIGR00595505 priA primosomal protein N'. All proteins in this f 99.89
COG4098441 comFA Superfamily II DNA/RNA helicase required for 99.89
PRK114481123 hsdR type I restriction enzyme EcoKI subunit R; Pr 99.87
COG11971139 Mfd Transcription-repair coupling factor (superfam 99.87
COG1200677 RecG RecG-like helicase [DNA replication, recombin 99.86
KOG09501008 consensus DNA polymerase theta/eta, DEAD-box super 99.86
COG1061442 SSL2 DNA or RNA helicases of superfamily II [Trans 99.86
KOG0349725 consensus Putative DEAD-box RNA helicase DDX1 [RNA 99.82
PRK04914956 ATP-dependent helicase HepA; Validated 99.8
PF07717114 OB_NTP_bind: Oligonucleotide/oligosaccharide-bindi 99.8
KOG0329387 consensus ATP-dependent RNA helicase [RNA processi 99.79
PRK13104896 secA preprotein translocase subunit SecA; Reviewed 99.79
COG1203733 CRISPR-associated helicase Cas3 [Defense mechanism 99.78
PRK12906796 secA preprotein translocase subunit SecA; Reviewed 99.78
KOG0921 1282 consensus Dosage compensation complex, subunit MLE 99.77
PRK12904830 preprotein translocase subunit SecA; Reviewed 99.75
KOG0949 1330 consensus Predicted helicase, DEAD-box superfamily 99.72
PF04408102 HA2: Helicase associated domain (HA2); InterPro: I 99.7
PRK13107 908 preprotein translocase subunit SecA; Reviewed 99.69
PRK12899 970 secA preprotein translocase subunit SecA; Reviewed 99.69
KOG0953700 consensus Mitochondrial RNA helicase SUV3, DEAD-bo 99.69
PF00270169 DEAD: DEAD/DEAH box helicase; InterPro: IPR011545 99.67
COG1098129 VacB Predicted RNA binding protein (contains ribos 99.64
cd00268203 DEADc DEAD-box helicases. A diverse family of prot 99.62
smart0084792 HA2 Helicase associated domain (HA2) Add an annota 99.61
COG4096875 HsdR Type I site-specific restriction-modification 99.6
COG1198730 PriA Primosomal protein N' (replication factor Y) 99.59
PRK129001025 secA preprotein translocase subunit SecA; Reviewed 99.58
TIGR00348667 hsdR type I site-specific deoxyribonuclease, HsdR 99.55
KOG41501034 consensus Predicted ATP-dependent RNA helicase [RN 99.54
COG1110 1187 Reverse gyrase [DNA replication, recombination, an 99.5
TIGR00631655 uvrb excinuclease ABC, B subunit. This family is b 99.47
TIGR01407850 dinG_rel DnaQ family exonuclease/DinG family helic 99.46
PTZ00248319 eukaryotic translation initiation factor 2 subunit 99.46
PLN03142 1033 Probable chromatin-remodeling complex ATPase chain 99.46
COG0539541 RpsA Ribosomal protein S1 [Translation, ribosomal 99.45
smart00487201 DEXDc DEAD-like helicases superfamily. 99.43
TIGR025621110 cas3_yersinia CRISPR-associated helicase Cas3. The 99.42
PRK12326764 preprotein translocase subunit SecA; Reviewed 99.4
cd00046144 DEXDc DEAD-like helicases superfamily. A diverse f 99.4
cd00079131 HELICc Helicase superfamily c-terminal domain; ass 99.4
PRK05298652 excinuclease ABC subunit B; Provisional 99.4
COG0539541 RpsA Ribosomal protein S1 [Translation, ribosomal 99.36
PF07652148 Flavi_DEAD: Flavivirus DEAD domain ; InterPro: IPR 99.36
cd0568673 S1_pNO40 S1_pNO40: pNO40 , S1-like RNA-binding dom 99.33
PF0027178 Helicase_C: Helicase conserved C-terminal domain; 99.32
cd0570472 S1_Rrp5_repeat_hs13 S1_Rrp5_repeat_hs13: Rrp5 is a 99.31
PRK08582139 hypothetical protein; Provisional 99.29
PRK13103 913 secA preprotein translocase subunit SecA; Reviewed 99.29
PRK07246820 bifunctional ATP-dependent DNA helicase/DNA polyme 99.29
PRK12903925 secA preprotein translocase subunit SecA; Reviewed 99.28
cd0568479 S1_DHX8_helicase S1_DHX8_helicase: The N-terminal 99.28
COG0556663 UvrB Helicase subunit of the DNA excision repair c 99.27
PHA0294588 interferon resistance protein; Provisional 99.25
PF04851184 ResIII: Type III restriction enzyme, res subunit; 99.24
KOG09511674 consensus RNA helicase BRR2, DEAD-box superfamily 99.24
cd0445276 S1_IF2_alpha S1_IF2_alpha: The alpha subunit of tr 99.22
cd0570574 S1_Rrp5_repeat_hs14 S1_Rrp5_repeat_hs14: Rrp5 is a 99.2
PLN00207891 polyribonucleotide nucleotidyltransferase; Provisi 99.19
COG1093269 SUI2 Translation initiation factor 2, alpha subuni 99.16
PRK07252120 hypothetical protein; Provisional 99.15
cd0446183 S1_Rrp5_repeat_hs8_sc7 S1_Rrp5_repeat_hs8_sc7: Rrp 99.14
CHL00122 870 secA preprotein translocase subunit SecA; Validate 99.12
cd0569671 S1_Rrp5_repeat_hs4 S1_Rrp5_repeat_hs4: Rrp5 is a t 99.12
PRK05807136 hypothetical protein; Provisional 99.12
smart0049082 HELICc helicase superfamily c-terminal domain. 99.12
cd0569870 S1_Rrp5_repeat_hs6_sc5 S1_Rrp5_repeat_hs6_sc5: Rrp 99.11
PF0057574 S1: S1 RNA binding domain; InterPro: IPR003029 Rib 99.11
PRK07899486 rpsA 30S ribosomal protein S1; Reviewed 99.08
cd0570673 S1_Rrp5_repeat_sc10 S1_Rrp5_repeat_sc10: Rrp5 is a 99.07
PRK12269863 bifunctional cytidylate kinase/ribosomal protein S 99.06
KOG1123776 consensus RNA polymerase II transcription initiati 99.06
cd0570373 S1_Rrp5_repeat_hs12_sc9 S1_Rrp5_repeat_hs12_sc9: R 99.06
cd0569769 S1_Rrp5_repeat_hs5 S1_Rrp5_repeat_hs5: Rrp5 is a t 99.06
cd0569069 S1_RPS1_repeat_ec5 S1_RPS1_repeat_ec5: Ribosomal p 99.06
cd0570768 S1_Rrp5_repeat_sc11 S1_Rrp5_repeat_sc11: Rrp5 is a 99.03
PRK13806491 rpsA 30S ribosomal protein S1; Provisional 99.02
PRK14873665 primosome assembly protein PriA; Provisional 99.01
cd0569474 S1_Rrp5_repeat_hs2_sc2 S1_Rrp5_repeat_hs2_sc2: Rrp 99.01
PRK12902 939 secA preprotein translocase subunit SecA; Reviewed 99.01
cd0569173 S1_RPS1_repeat_ec6 S1_RPS1_repeat_ec6: Ribosomal p 98.99
PRK07400318 30S ribosomal protein S1; Reviewed 98.99
cd0568972 S1_RPS1_repeat_ec4 S1_RPS1_repeat_ec4: Ribosomal p 98.98
cd0570877 S1_Rrp5_repeat_sc12 S1_Rrp5_repeat_sc12: Rrp5 is a 98.98
PRK03987262 translation initiation factor IF-2 subunit alpha; 98.97
cd0445388 S1_RNase_E S1_RNase_E: RNase E and RNase G, S1-lik 98.96
cd0569269 S1_RPS1_repeat_hs4 S1_RPS1_repeat_hs4: Ribosomal p 98.96
TIGR03117636 cas_csf4 CRISPR-associated DEAD/DEAH-box helicase 98.96
PRK08059123 general stress protein 13; Validated 98.96
PRK08074928 bifunctional ATP-dependent DNA helicase/DNA polyme 98.94
TIGR02696719 pppGpp_PNP guanosine pentaphosphate synthetase I/p 98.92
PF02399 824 Herpes_ori_bp: Origin of replication binding prote 98.89
PRK13806491 rpsA 30S ribosomal protein S1; Provisional 98.88
PRK12269863 bifunctional cytidylate kinase/ribosomal protein S 98.87
cd0568770 S1_RPS1_repeat_ec1_hs1 S1_RPS1_repeat_ec1_hs1: Rib 98.87
cd0447268 S1_PNPase S1_PNPase: Polynucleotide phosphorylase 98.87
cd0568568 S1_Tex S1_Tex: The C-terminal S1 domain of a trans 98.86
PRK07899486 rpsA 30S ribosomal protein S1; Reviewed 98.84
COG1185692 Pnp Polyribonucleotide nucleotidyltransferase (pol 98.81
cd0578986 S1_Rrp4 S1_Rrp4: Rrp4 S1-like RNA-binding domain. 98.79
PRK129011112 secA preprotein translocase subunit SecA; Reviewed 98.79
PRK11824693 polynucleotide phosphorylase/polyadenylase; Provis 98.78
cd05693100 S1_Rrp5_repeat_hs1_sc1 S1_Rrp5_repeat_hs1_sc1: Rrp 98.78
PRK06299565 rpsA 30S ribosomal protein S1; Reviewed 98.78
COG2183780 Tex Transcriptional accessory protein [Transcripti 98.76
cd0569566 S1_Rrp5_repeat_hs3 S1_Rrp5_repeat_hs3: Rrp5 is a t 98.74
cd0568868 S1_RPS1_repeat_ec3 S1_RPS1_repeat_ec3: Ribosomal p 98.73
PRK11747697 dinG ATP-dependent DNA helicase DinG; Provisional 98.71
cd0447183 S1_RNase_R S1_RNase_R: RNase R C-terminal S1 domai 98.71
KOG0385971 consensus Chromatin remodeling complex WSTF-ISWI, 98.71
PRK06676390 rpsA 30S ribosomal protein S1; Reviewed 98.67
COG4889 1518 Predicted helicase [General function prediction on 98.67
cd0446567 S1_RPS1_repeat_ec2_hs2 S1_RPS1_repeat_ec2_hs2: Rib 98.66
PRK06676390 rpsA 30S ribosomal protein S1; Reviewed 98.66
TIGR00604705 rad3 DNA repair helicase (rad3). All proteins in t 98.62
cd0447377 S1_RecJ_like S1_RecJ_like: The S1 domain of the ar 98.62
PRK06299565 rpsA 30S ribosomal protein S1; Reviewed 98.62
cd0570270 S1_Rrp5_repeat_hs11_sc8 S1_Rrp5_repeat_hs11_sc8: R 98.6
KOG0387923 consensus Transcription-coupled repair protein CSB 98.59
cd0445482 S1_Rrp4_like S1_Rrp4_like: Rrp4-like, S1-like RNA- 98.58
smart0031672 S1 Ribosomal protein S1-like RNA-binding domain. 98.57
TIGR03591684 polynuc_phos polyribonucleotide nucleotidyltransfe 98.57
COG1419407 FlhF Flagellar GTP-binding protein [Cell motility 98.56
KOG0390776 consensus DNA repair protein, SNF2 family [Replica 98.56
PRK00087647 4-hydroxy-3-methylbut-2-enyl diphosphate reductase 98.55
TIGR00717516 rpsA ribosomal protein S1. This model provides tru 98.53
PRK07400318 30S ribosomal protein S1; Reviewed 98.51
TIGR00717516 rpsA ribosomal protein S1. This model provides tru 98.51
COG1199654 DinG Rad3-related DNA helicases [Transcription / D 98.46
cd0446099 S1_RpoE S1_RpoE: RpoE, S1-like RNA-binding domain. 98.46
PRK00087647 4-hydroxy-3-methylbut-2-enyl diphosphate reductase 98.4
PF00448196 SRP54: SRP54-type protein, GTPase domain; InterPro 98.4
PRK09521189 exosome complex RNA-binding protein Csl4; Provisio 98.39
cd0016465 S1_like S1_like: Ribosomal protein S1-like RNA-bin 98.36
KOG1000689 consensus Chromatin remodeling protein HARP/SMARCA 98.28
PRK04163235 exosome complex RNA-binding protein Rrp4; Provisio 98.27
KOG1067760 consensus Predicted RNA-binding polyribonucleotide 98.25
PRK11889436 flhF flagellar biosynthesis regulator FlhF; Provis 98.21
PRK12723388 flagellar biosynthesis regulator FlhF; Provisional 98.2
PRK12726407 flagellar biosynthesis regulator FlhF; Provisional 98.18
PRK14722374 flhF flagellar biosynthesis regulator FlhF; Provis 98.15
KOG0384 1373 consensus Chromodomain-helicase DNA-binding protei 98.15
TIGR02063709 RNase_R ribonuclease R. This family consists of an 98.15
COG1095183 RPB7 DNA-directed RNA polymerase, subunit E' [Tran 98.14
TIGR00448179 rpoE DNA-directed RNA polymerase (rpoE), archaeal 98.09
cd0579192 S1_CSL4 S1_CSL4: CSL4, S1-like RNA-binding domain. 98.04
PRK11642813 exoribonuclease R; Provisional 98.02
PF13401131 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S 98.0
PF06862442 DUF1253: Protein of unknown function (DUF1253); In 98.0
PRK05703424 flhF flagellar biosynthesis regulator FlhF; Valida 97.96
TIGR00358654 3_prime_RNase VacB and RNase II family 3'-5' exori 97.95
PRK12727559 flagellar biosynthesis regulator FlhF; Provisional 97.9
cd0445567 S1_NusA S1_NusA: N-utilizing substance A protein ( 97.9
PF13604196 AAA_30: AAA domain; PDB: 1W36_G 3K70_G 3UPU_B 3GPL 97.84
PRK12724432 flagellar biosynthesis regulator FlhF; Provisional 97.83
PF00176299 SNF2_N: SNF2 family N-terminal domain; InterPro: I 97.81
COG0653822 SecA Preprotein translocase subunit SecA (ATPase, 97.78
TIGR02768744 TraA_Ti Ti-type conjugative transfer relaxase TraA 97.77
PRK08563187 DNA-directed RNA polymerase subunit E'; Provisiona 97.76
PF1324576 AAA_19: Part of AAA domain 97.72
PRK13889988 conjugal transfer relaxase TraA; Provisional 97.69
PRK14721420 flhF flagellar biosynthesis regulator FlhF; Provis 97.67
KOG1803649 consensus DNA helicase [Replication, recombination 97.65
PRK14974336 cell division protein FtsY; Provisional 97.63
COG0610962 Type I site-specific restriction-modification syst 97.61
PRK14723767 flhF flagellar biosynthesis regulator FlhF; Provis 97.6
KOG03921549 consensus SNF2 family DNA-dependent ATPase domain- 97.6
TIGR01447586 recD exodeoxyribonuclease V, alpha subunit. This f 97.59
PHA0285886 EIF2a-like PKR inhibitor; Provisional 97.55
PRK06731270 flhF flagellar biosynthesis regulator FlhF; Valida 97.52
KOG09521230 consensus DNA/RNA helicase MER3/SLH1, DEAD-box sup 97.52
TIGR01448720 recD_rel helicase, putative, RecD/TraA family. Thi 97.51
PF02562205 PhoH: PhoH-like protein; InterPro: IPR003714 PhoH 97.5
PRK10875615 recD exonuclease V subunit alpha; Provisional 97.46
PRK06995484 flhF flagellar biosynthesis regulator FlhF; Valida 97.43
PRK138261102 Dtr system oriT relaxase; Provisional 97.43
PRK10536262 hypothetical protein; Provisional 97.39
cd00009151 AAA The AAA+ (ATPases Associated with a wide varie 97.38
PRK06526254 transposase; Provisional 97.37
PF09848352 DUF2075: Uncharacterized conserved protein (DUF207 97.36
TIGR00757414 RNaseEG ribonuclease, Rne/Rng family. The C-termin 97.28
PF13086236 AAA_11: AAA domain; PDB: 2XZL_A 2XZO_A 2WJY_A 2WJV 97.26
PRK10416318 signal recognition particle-docking protein FtsY; 97.25
KOG2916304 consensus Translation initiation factor 2, alpha s 97.21
PRK05054644 exoribonuclease II; Provisional 97.2
PRK15483 986 type III restriction-modification system StyLTI en 97.17
PRK04296190 thymidine kinase; Provisional 97.1
TIGR02760 1960 TraI_TIGR conjugative transfer relaxase protein Tr 97.08
PF05970364 PIF1: PIF1-like helicase; InterPro: IPR010285 This 97.08
PF12340229 DUF3638: Protein of unknown function (DUF3638); In 97.07
TIGR00064272 ftsY signal recognition particle-docking protein F 97.06
COG1096188 Predicted RNA-binding protein (consists of S1 doma 97.06
smart00382148 AAA ATPases associated with a variety of cellular 97.04
KOG1070 1710 consensus rRNA processing protein Rrp5 [RNA proces 97.03
PF07517266 SecA_DEAD: SecA DEAD-like domain; InterPro: IPR011 96.95
KOG1002791 consensus Nucleotide excision repair protein RAD16 96.91
smart00489289 DEXDc3 DEAD-like helicases superfamily. 96.88
smart00488289 DEXDc2 DEAD-like helicases superfamily. 96.88
PRK09202470 nusA transcription elongation factor NusA; Validat 96.88
TIGR01425429 SRP54_euk signal recognition particle protein SRP5 96.88
PF1044782 EXOSC1: Exosome component EXOSC1/CSL4; InterPro: I 96.87
COG0557706 VacB Exoribonuclease R [Transcription] 96.86
PF13173128 AAA_14: AAA domain 96.85
smart0031174 PWI PWI, domain in splicing factors. 96.85
PRK08181269 transposase; Validated 96.83
COG1097239 RRP4 RNA-binding protein Rrp4 and related proteins 96.83
PF05729166 NACHT: NACHT domain 96.77
TIGR00959428 ffh signal recognition particle protein. This mode 96.76
PF13872303 AAA_34: P-loop containing NTP hydrolase pore-1 96.76
PRK10867433 signal recognition particle protein; Provisional 96.74
TIGR03499282 FlhF flagellar biosynthetic protein FlhF. 96.73
PRK00771437 signal recognition particle protein Srp54; Provisi 96.69
cd0579086 S1_Rrp40 S1_Rrp40: Rrp40 S1-like RNA-binding domai 96.68
TIGR00596 814 rad1 DNA repair protein (rad1). This family is bas 96.67
PF00580315 UvrD-helicase: UvrD/REP helicase N-terminal domain 96.59
PRK07952244 DNA replication protein DnaC; Validated 96.58
KOG1802935 consensus RNA helicase nonsense mRNA reducing fact 96.53
TIGR00376637 DNA helicase, putative. The gene product may repre 96.52
PTZ00162176 DNA-directed RNA polymerase II subunit 7; Provisio 96.49
PRK09183259 transposase/IS protein; Provisional 96.45
TIGR03015269 pepcterm_ATPase putative secretion ATPase, PEP-CTE 96.45
KOG2340698 consensus Uncharacterized conserved protein [Funct 96.42
PF05127177 Helicase_RecD: Helicase; InterPro: IPR007807 This 96.41
cd0446288 S1_RNAPII_Rpb7 S1_RNAPII_Rpb7: Eukaryotic RNA poly 96.41
TIGR02062639 RNase_B exoribonuclease II. This family consists o 96.35
PRK07003 830 DNA polymerase III subunits gamma and tau; Validat 96.29
COG1444758 Predicted P-loop ATPase fused to an acetyltransfer 96.29
TIGR02881261 spore_V_K stage V sporulation protein K. Members o 96.11
PRK14956484 DNA polymerase III subunits gamma and tau; Provisi 96.08
cd01120165 RecA-like_NTPases RecA-like NTPases. This family i 96.08
TIGR03420226 DnaA_homol_Hda DnaA regulatory inactivator Hda. Me 96.06
KOG10701710 consensus rRNA processing protein Rrp5 [RNA proces 96.03
PRK06835329 DNA replication protein DnaC; Validated 96.03
PRK08903227 DnaA regulatory inactivator Hda; Validated 96.01
PRK08727233 hypothetical protein; Validated 96.0
PF05621302 TniB: Bacterial TniB protein; InterPro: IPR008868 95.95
KOG2146354 consensus Splicing coactivator SRm160/300, subunit 95.95
TIGR01953341 NusA transcription termination factor NusA. This m 95.94
PRK12377248 putative replication protein; Provisional 95.9
PF01695178 IstB_IS21: IstB-like ATP binding protein; InterPro 95.9
PRK07764 824 DNA polymerase III subunits gamma and tau; Validat 95.88
PRK14949 944 DNA polymerase III subunits gamma and tau; Provisi 95.86
PRK06893229 DNA replication initiation factor; Validated 95.83
PRK08939306 primosomal protein DnaI; Reviewed 95.81
cd03115173 SRP The signal recognition particle (SRP) mediates 95.79
COG1107715 Archaea-specific RecJ-like exonuclease, contains D 95.77
PHA03333752 putative ATPase subunit of terminase; Provisional 95.76
COG0552340 FtsY Signal recognition particle GTPase [Intracell 95.75
COG1875436 NYN ribonuclease and ATPase of PhoH family domains 95.74
PRK14712 1623 conjugal transfer nickase/helicase TraI; Provision 95.73
PRK08116268 hypothetical protein; Validated 95.72
PRK12402337 replication factor C small subunit 2; Reviewed 95.71
PRK07994647 DNA polymerase III subunits gamma and tau; Validat 95.7
PRK12327362 nusA transcription elongation factor NusA; Provisi 95.68
PRK12323700 DNA polymerase III subunits gamma and tau; Provisi 95.66
PRK14964491 DNA polymerase III subunits gamma and tau; Provisi 95.6
cd03221144 ABCF_EF-3 ABCF_EF-3 Elongation factor 3 (EF-3) is 95.52
PRK09112351 DNA polymerase III subunit delta'; Validated 95.52
PRK108111068 rne ribonuclease E; Reviewed 95.48
PRK14960702 DNA polymerase III subunits gamma and tau; Provisi 95.47
cd00267157 ABC_ATPase ABC (ATP-binding cassette) transporter 95.47
TIGR02880284 cbbX_cfxQ probable Rubsico expression protein CbbX 95.47
COG1484254 DnaC DNA replication protein [DNA replication, rec 95.47
PRK08084235 DNA replication initiation factor; Provisional 95.46
PRK06921266 hypothetical protein; Provisional 95.46
PF00004132 AAA: ATPase family associated with various cellula 95.44
PRK14952584 DNA polymerase III subunits gamma and tau; Provisi 95.43
PRK05642234 DNA replication initiation factor; Validated 95.42
PRK14958509 DNA polymerase III subunits gamma and tau; Provisi 95.41
cd03247178 ABCC_cytochrome_bd The CYD subfamily implicated in 95.4
KOG0391 1958 consensus SNF2 family DNA-dependent ATPase [Genera 95.36
COG2804500 PulE Type II secretory pathway, ATPase PulE/Tfp pi 95.33
TIGR02760 1960 TraI_TIGR conjugative transfer relaxase protein Tr 95.32
PRK08691709 DNA polymerase III subunits gamma and tau; Validat 95.3
PRK00411394 cdc6 cell division control protein 6; Reviewed 95.3
COG0541451 Ffh Signal recognition particle GTPase [Intracellu 95.29
PRK06645507 DNA polymerase III subunits gamma and tau; Validat 95.28
CHL00181287 cbbX CbbX; Provisional 95.25
cd01124187 KaiC KaiC is a circadian clock protein primarily f 95.24
KOG4439901 consensus RNA polymerase II transcription terminat 95.23
COG1120258 FepC ABC-type cobalamin/Fe3+-siderophores transpor 95.21
KOG03861157 consensus Chromatin remodeling complex SWI/SNF, co 95.16
PRK11712489 ribonuclease G; Provisional 95.14
PRK13709 1747 conjugal transfer nickase/helicase TraI; Provision 95.09
cd03228171 ABCC_MRP_Like The MRP (Mutidrug Resistance Protein 95.06
PRK14961363 DNA polymerase III subunits gamma and tau; Provisi 95.06
PHA02533534 17 large terminase protein; Provisional 95.05
PRK14969527 DNA polymerase III subunits gamma and tau; Provisi 95.03
PRK14951618 DNA polymerase III subunits gamma and tau; Provisi 95.02
PTZ001121164 origin recognition complex 1 protein; Provisional 94.94
PF1350961 S1_2: S1 domain; PDB: 3GO5_A. 94.94
PRK00149450 dnaA chromosomal replication initiation protein; R 94.9
PRK14955397 DNA polymerase III subunits gamma and tau; Provisi 94.89
cd03238176 ABC_UvrA The excision repair protein UvrA; Nucleot 94.88
PRK14957546 DNA polymerase III subunits gamma and tau; Provisi 94.87
cd03222177 ABC_RNaseL_inhibitor The ABC ATPase RNase L inhibi 94.79
PRK14962472 DNA polymerase III subunits gamma and tau; Provisi 94.78
PRK09111598 DNA polymerase III subunits gamma and tau; Validat 94.77
cd03216163 ABC_Carb_Monos_I This family represents the domain 94.74
KOG0989346 consensus Replication factor C, subunit RFC4 [Repl 94.72
COG2996287 Predicted RNA-bindining protein (contains S1 and H 94.72
PHA02544316 44 clamp loader, small subunit; Provisional 94.72
PRK06620214 hypothetical protein; Validated 94.7
TIGR02782299 TrbB_P P-type conjugative transfer ATPase TrbB. Th 94.65
PRK05707328 DNA polymerase III subunit delta'; Validated 94.58
TIGR03345852 VI_ClpV1 type VI secretion ATPase, ClpV1 family. M 94.57
PRK14963504 DNA polymerase III subunits gamma and tau; Provisi 94.54
PRK09087226 hypothetical protein; Validated 94.53
PF13307167 Helicase_C_2: Helicase C-terminal domain; PDB: 4A1 94.5
cd03214180 ABC_Iron-Siderophores_B12_Hemin ABC transporters, 94.44
TIGR02928365 orc1/cdc6 family replication initiation protein. M 94.34
PLN03025319 replication factor C subunit; Provisional 94.33
PF05496233 RuvB_N: Holliday junction DNA helicase ruvB N-term 94.32
COG3587 985 Restriction endonuclease [Defense mechanisms] 94.32
PRK07471365 DNA polymerase III subunit delta'; Validated 94.27
cd01122271 GP4d_helicase GP4d_helicase is a homohexameric 5'- 94.27
PRK04195482 replication factor C large subunit; Provisional 94.26
PF00308219 Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013 94.26
PRK11331459 5-methylcytosine-specific restriction enzyme subun 94.26
cd03246173 ABCC_Protease_Secretion This family represents the 94.26
cd03229178 ABC_Class3 This class is comprised of all BPD (Bin 94.24
cd03230173 ABC_DR_subfamily_A This family of ATP-binding prot 94.19
KOG18051100 consensus DNA replication helicase [Replication, r 94.19
PRK13833323 conjugal transfer protein TrbB; Provisional 94.14
COG1219408 ClpX ATP-dependent protease Clp, ATPase subunit [P 94.13
cd0569972 S1_Rrp5_repeat_hs7 S1_Rrp5_repeat_hs7: Rrp5 is a t 94.1
KOG18561299 consensus Transcription elongation factor SPT6 [RN 94.1
TIGR00362405 DnaA chromosomal replication initiator protein Dna 94.09
PRK14965576 DNA polymerase III subunits gamma and tau; Provisi 94.05
cd03223166 ABCD_peroxisomal_ALDP Peroxisomal ATP-binding cass 94.0
PRK07133725 DNA polymerase III subunits gamma and tau; Validat 93.99
KOG20361011 consensus Predicted P-loop ATPase fused to an acet 93.98
TIGR00678188 holB DNA polymerase III, delta' subunit. At positi 93.98
PRK10865857 protein disaggregation chaperone; Provisional 93.97
PF0148077 PWI: PWI domain; InterPro: IPR002483 The PWI domai 93.93
PRK14087450 dnaA chromosomal replication initiation protein; P 93.89
PRK14953486 DNA polymerase III subunits gamma and tau; Provisi 93.88
PF00437270 T2SE: Type II/IV secretion system protein; InterPr 93.87
PRK13851344 type IV secretion system protein VirB11; Provision 93.87
PRK11823446 DNA repair protein RadA; Provisional 93.86
PRK10919672 ATP-dependent DNA helicase Rep; Provisional 93.86
PRK06067234 flagellar accessory protein FlaH; Validated 93.8
PRK07940394 DNA polymerase III subunit delta'; Validated 93.77
KOG2373514 consensus Predicted mitochondrial DNA helicase twi 93.76
PF01637234 Arch_ATPase: Archaeal ATPase; InterPro: IPR011579 93.76
PRK08533230 flagellar accessory protein FlaH; Reviewed 93.57
COG2256436 MGS1 ATPase related to the helicase subunit of the 93.57
TIGR02868529 CydC thiol reductant ABC exporter, CydC subunit. T 93.57
PRK14959624 DNA polymerase III subunits gamma and tau; Provisi 93.56
PF00931287 NB-ARC: NB-ARC domain; InterPro: IPR002182 This is 93.56
PRK12422445 chromosomal replication initiation protein; Provis 93.52
PRK14950585 DNA polymerase III subunits gamma and tau; Provisi 93.52
COG3973747 Superfamily I DNA and RNA helicases [General funct 93.5
PRK13894319 conjugal transfer ATPase TrbB; Provisional 93.48
PRK05896605 DNA polymerase III subunits gamma and tau; Validat 93.4
PTZ00293211 thymidine kinase; Provisional 93.38
cd01393226 recA_like RecA is a bacterial enzyme which has rol 93.37
cd03282204 ABC_MSH4_euk MutS4 homolog in eukaryotes. The MutS 93.34
PF13177162 DNA_pol3_delta2: DNA polymerase III, delta subunit 93.28
COG4962355 CpaF Flp pilus assembly protein, ATPase CpaF [Intr 93.27
PF03354477 Terminase_1: Phage Terminase ; InterPro: IPR005021 93.2
PRK14971614 DNA polymerase III subunits gamma and tau; Provisi 93.17
PRK13900332 type IV secretion system ATPase VirB11; Provisiona 93.16
KOG3938334 consensus RGS-GAIP interacting protein GIPC, conta 93.16
PRK08451535 DNA polymerase III subunits gamma and tau; Validat 93.12
PRK13342413 recombination factor protein RarA; Reviewed 93.11
TIGR02688449 conserved hypothetical protein TIGR02688. Members 93.1
PRK14954620 DNA polymerase III subunits gamma and tau; Provisi 93.09
PRK14088440 dnaA chromosomal replication initiation protein; P 93.07
TIGR01074664 rep ATP-dependent DNA helicase Rep. Designed to id 92.98
COG1119257 ModF ABC-type molybdenum transport system, ATPase 92.94
PRK11054684 helD DNA helicase IV; Provisional 92.89
cd01130186 VirB11-like_ATPase Type IV secretory pathway compo 92.81
cd01131198 PilT Pilus retraction ATPase PilT. PilT is a nucle 92.73
PRK05563559 DNA polymerase III subunits gamma and tau; Validat 92.71
COG4555245 NatA ABC-type Na+ transport system, ATPase compone 92.69
PRK14086617 dnaA chromosomal replication initiation protein; P 92.67
COG2805353 PilT Tfp pilus assembly protein, pilus retraction 92.66
PHA00729226 NTP-binding motif containing protein 92.65
TIGR01547396 phage_term_2 phage terminase, large subunit, PBSX 92.63
COG1435201 Tdk Thymidine kinase [Nucleotide transport and met 92.62
COG1474366 CDC6 Cdc6-related protein, AAA superfamily ATPase 92.61
cd03239178 ABC_SMC_head The structural maintenance of chromos 92.61
cd01125239 repA Hexameric Replicative Helicase RepA. RepA is 92.6
KOG0151877 consensus Predicted splicing regulator, contains R 92.56
COG1702348 PhoH Phosphate starvation-inducible protein PhoH, 92.53
PF03266168 NTPase_1: NTPase; InterPro: IPR004948 This entry r 92.51
TIGR02397355 dnaX_nterm DNA polymerase III, subunit gamma and t 92.51
PRK14948620 DNA polymerase III subunits gamma and tau; Provisi 92.41
cd03215182 ABC_Carb_Monos_II This family represents domain II 92.41
PF01443234 Viral_helicase1: Viral (Superfamily 1) RNA helicas 92.4
COG0470325 HolB ATPase involved in DNA replication [DNA repli 92.39
cd03213194 ABCG_EPDR ABCG transporters are involved in eye pi 92.38
TIGR02858270 spore_III_AA stage III sporulation protein AA. Mem 92.34
TIGR02012321 tigrfam_recA protein RecA. This model describes or 92.34
PRK14970367 DNA polymerase III subunits gamma and tau; Provisi 92.32
COG3267269 ExeA Type II secretory pathway, component ExeA (pr 92.24
COG1127263 Ttg2A ABC-type transport system involved in resist 92.23
cd01121372 Sms Sms (bacterial radA) DNA repair protein. This 92.23
KOG0780483 consensus Signal recognition particle, subunit Srp 92.23
KOG0058716 consensus Peptide exporter, ABC superfamily [Intra 92.17
PRK13695174 putative NTPase; Provisional 92.16
PRK13541195 cytochrome c biogenesis protein CcmA; Provisional 92.15
cd03233202 ABC_PDR_domain1 The pleiotropic drug resistance (P 92.12
TIGR01075715 uvrD DNA helicase II. Designed to identify uvrD me 92.11
PRK00440319 rfc replication factor C small subunit; Reviewed 92.1
PRK11174588 cysteine/glutathione ABC transporter membrane/ATP- 91.99
PRK04841 903 transcriptional regulator MalT; Provisional 91.97
>KOG0924 consensus mRNA splicing factor ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information 
Probab=100.00  E-value=6.1e-169  Score=1429.47  Aligned_cols=769  Identities=50%  Similarity=0.871  Sum_probs=705.4

Q ss_pred             CCccCCCChhhHHhhhhhhcCCccccCC-CCCCcccCCccccCCCcccceeeeecCCCCccccCceeecccCCCcccccC
Q 001046          348 RPLKRMSSPEKWEAKQLIASGVLSVEDY-PMYDEEGDGLAYQEEGAEEELEIELNEDEPAFLQGQTRYSVDMSPVKIFKN  426 (1176)
Q Consensus       348 ~~~~~~~s~e~we~~ql~~sg~~~~~~~-~~~~~~~~~~~~~~~~~~~~~~~~~~~~~p~fl~g~~~~~~~~~~~~~~k~  426 (1176)
                      +.+|...++++||.+||+.|||+...+. ++|+++         ++   .++.|++..||||+|...++++++||.+++|
T Consensus       198 ~~~ki~~dn~~we~nrl~~sgvv~~~e~~~~f~~~---------e~---~~llv~~i~~~fld~r~~~~k~~~~v~pv~d  265 (1042)
T KOG0924|consen  198 KIQKINNDNALWETNRLLTSGVVQRMEVISDFLSD---------EA---RELLVHNIVPPFLDGREVFTKQAEPVIPVRD  265 (1042)
T ss_pred             HHHhhcchhhhhhhhcccchhhhhcccccCccchh---------hH---HHhhhhcccCCccccceeeecccccccccCC
Confidence            4445678999999999999999988765 333322         12   2289999999999999999999999999999


Q ss_pred             CCCchHHHHHHhHHHHHHHHHHHHHHHhhhhccCCcCCCCCCCCCCCCccchhHHHHhhcCCCCCC-----C--c-hhHH
Q 001046          427 PEGSLSRAAALQSALIKERREVREQQQRTMLDSIPKDLNRPWEDPMPETGERHLAQELRGVGLSAY-----D--M-PEWK  498 (1176)
Q Consensus       427 ~~~~l~~~a~~~~~l~k~~re~k~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~-----~--~-~~~~  498 (1176)
                      |+++|+..|++||++++++|+..+.++..         .++|+-..+..++      ..+++.+..     .  - ..+.
T Consensus       266 ~~sd~a~~a~~gs~lv~~~r~~~~~~k~~---------~~~~~~~~~~lgn------~~glek~~~ed~~~~~~~~~~~a  330 (1042)
T KOG0924|consen  266 PTSDLAISARRGSKLVRERREKEERKKAQ---------KKHWKLAGTALGN------VMGLEKKNDEDGKVAYRGSVKFA  330 (1042)
T ss_pred             CchhhhhhhhccccHHHHHHHhhhhhhhh---------hhhhhhcchhhcc------ccccccCcccccccccccchhhh
Confidence            99999999999999999999988776543         2333322211111      001110000     0  0 0011


Q ss_pred             HhhhcccccccccChHHHHHHHhcCCchHHHHHHHHHHHcCCeEEEEcCCCCcHHHHHHHHHHHhcccCCCEEEEeccHH
Q 001046          499 KDAFGKALTFGQRSKLSIQEQRQSLPIYKLKKELIQAVHDNQVLVVIGETGSGKTTQVTQYLAEAGYTTRGKIGCTQPRR  578 (1176)
Q Consensus       499 ~~~~~~~~~~~~~~~~~l~~~r~~LPi~~~q~~ii~ai~~~~~vIv~apTGSGKTt~~~~~lle~~~~~~~~Ilv~~PrR  578 (1176)
                      .+.-.....-.....+++.+||+.|||+.++.+++..|..|++|||+|+||||||||++|||++.++..+|.|.||||||
T Consensus       331 ~h~k~~~a~~~fa~~k~i~eqrq~LPvf~~R~~ll~~ir~n~vvvivgETGSGKTTQl~QyL~edGY~~~GmIGcTQPRR  410 (1042)
T KOG0924|consen  331 SHMKKSEAVSEFASKKSIREQRQYLPVFACRDQLLSVIRENQVVVIVGETGSGKTTQLAQYLYEDGYADNGMIGCTQPRR  410 (1042)
T ss_pred             hccccccccccccccchHHHHHhhcchHHHHHHHHHHHhhCcEEEEEecCCCCchhhhHHHHHhcccccCCeeeecCchH
Confidence            11100001111123346899999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHHHHHHHHhCCccCCeeEEEeecccccCCCceEEEeChHHHHHHHhhCCCCCCCceEEEcCCCcCCCchhHHHHH
Q 001046          579 VAAMSVAKRVAEEFGCRLGEEVGYAIRFEDCTGPDTVIKYMTDGMLLREILIDDNLSQYSVIMLDEAHERTIHTDVLFGL  658 (1176)
Q Consensus       579 ~lA~qva~rva~e~g~~~G~~vGy~ir~~~~~~~~t~I~~~T~g~Llr~l~~~~~L~~~s~IIiDEaHeR~~~~d~ll~l  658 (1176)
                      ++|+++|+||++|||..+|..|||.|||++++++.|.|.|||+|+||++.+.+..|.+|++||+||||||++++|+++++
T Consensus       411 vAAiSVAkrVa~EM~~~lG~~VGYsIRFEdvT~~~T~IkymTDGiLLrEsL~d~~L~kYSviImDEAHERslNtDilfGl  490 (1042)
T KOG0924|consen  411 VAAISVAKRVAEEMGVTLGDTVGYSIRFEDVTSEDTKIKYMTDGILLRESLKDRDLDKYSVIIMDEAHERSLNTDILFGL  490 (1042)
T ss_pred             HHHHHHHHHHHHHhCCccccccceEEEeeecCCCceeEEEeccchHHHHHhhhhhhhheeEEEechhhhcccchHHHHHH
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHhhCCCccEEEEcCCCCHHHHHhhhcCCCeEecCCceeeeEEEEecCCCchhHHHHHHHHHHHHhcCCCCCEEEEe
Q 001046          659 LKQLVKRRPDLRLIVTSATLDAEKFSGYFFNCNIFTIPGRTFPVEILYTKQPESDYLDASLITVLQIHLTEPEGDILLFL  738 (1176)
Q Consensus       659 lk~~~~~r~~~kvIlmSATl~~~~~~~~f~~~~v~~i~gr~~pv~~~~~~~~~~~~~~~~l~~v~~i~~~~~~g~iLVFl  738 (1176)
                      |+.++..|.|+|+|++|||||+++|++||++||.|+||||+|||++.|...+..||+++++...++||...++|+||||+
T Consensus       491 lk~~larRrdlKliVtSATm~a~kf~nfFgn~p~f~IpGRTyPV~~~~~k~p~eDYVeaavkq~v~Ihl~~~~GdilIfm  570 (1042)
T KOG0924|consen  491 LKKVLARRRDLKLIVTSATMDAQKFSNFFGNCPQFTIPGRTYPVEIMYTKTPVEDYVEAAVKQAVQIHLSGPPGDILIFM  570 (1042)
T ss_pred             HHHHHHhhccceEEEeeccccHHHHHHHhCCCceeeecCCccceEEEeccCchHHHHHHHHhhheEeeccCCCCCEEEec
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             CCHHHHHHHHHHHHHHHhccCCC-CCCeEEEEecCCCCHHHHHhhcCCCCCCCceEEEEcchhhhccCCCCeeEEEeCCc
Q 001046          739 TGQEEIDFACQSLYERMKGLGKN-VPELIILPVYSALPSEMQSRIFDPAPPGKRKVVVATNIAEASLTIDGIFYVIDPGF  817 (1176)
Q Consensus       739 ~~~~ei~~l~~~L~~~~~~l~~~-~~~~~v~~lhs~l~~~~r~~i~~~f~~g~~kVlVATniae~GIdIp~V~~VId~g~  817 (1176)
                      +|+++|+.+|..+.+.+..+... ..++.|+|+|++||.+.|.+||++.+.|.+||||||||||++||||||.||||+|+
T Consensus       571 tGqediE~t~~~i~~~l~ql~~~~~~~L~vlpiYSQLp~dlQ~kiFq~a~~~vRK~IvATNIAETSLTi~gI~yVID~Gy  650 (1042)
T KOG0924|consen  571 TGQEDIECTCDIIKEKLEQLDSAPTTDLAVLPIYSQLPADLQAKIFQKAEGGVRKCIVATNIAETSLTIPGIRYVIDTGY  650 (1042)
T ss_pred             CCCcchhHHHHHHHHHHHhhhcCCCCceEEEeehhhCchhhhhhhcccCCCCceeEEEeccchhhceeecceEEEEecCc
Confidence            99999999999999988776432 24899999999999999999999999999999999999999999999999999999


Q ss_pred             ccceeccCCCCCccccccccCHHHHHHHhcccCCCCCcEEEEecChHHHhhhCCCCCchhhhhcChHHHHHHHHHcCCCc
Q 001046          818 AKQNVYNPKQGLDSLVITPISQASAKQRAGRAGRTGPGKCYRLYTESAYRNEMSPTSIPEIQRINLGFTTLTMKAMGIND  897 (1176)
Q Consensus       818 ~k~~~yd~~~g~~~l~~~p~S~as~~QR~GRAGR~g~G~c~~L~t~~~~~~~l~~~~~pEI~r~~L~~~~L~lk~~gi~~  897 (1176)
                      +|.++|||+.||+.|.+.|||+|++.||+|||||+|||.||||||+.+|.++|.+.++|||+|+||.+++|+|+++|++|
T Consensus       651 ~K~kvyn~~~G~D~L~~~pIS~AnA~QRaGRAGRt~pG~cYRlYTe~ay~~eml~stvPEIqRTNl~nvVLlLkslgV~d  730 (1042)
T KOG0924|consen  651 CKLKVYNPRIGMDALQIVPISQANADQRAGRAGRTGPGTCYRLYTEDAYKNEMLPSTVPEIQRTNLSNVVLLLKSLGVDD  730 (1042)
T ss_pred             eeeeecccccccceeEEEechhccchhhccccCCCCCcceeeehhhhHHHhhcccCCCchhhhcchhhHHHHHHhcChhh
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             cccCCCCCCCCHHHHHHHHHHHHHcCccccCCcccHHHHHHhcCCCChHHHHHHHHhhhcCCHHHHHHHHHHhcCCCCCC
Q 001046          898 LLSFDFMDPPSPQALISAMEQLYSLGALDEEGLLTKLGRKMAEFPLDPPLSKMLLASVDLGCSDEILTIIAMIQTGNIFY  977 (1176)
Q Consensus       898 ~~~f~~~~pP~~~~l~~al~~L~~lgald~~g~lT~lG~~~a~lpl~p~l~k~ll~~~~~~c~~~~l~i~a~ls~~~~f~  977 (1176)
                      ++.|+|||||+.+.+..|+..|+.|||||+.|.||++|+.|++|||||.|+||||.|+.+||++|||+||+|||+..+|+
T Consensus       731 ll~FdFmD~Pped~~~~sly~Lw~LGAl~~~g~LT~lG~~MvefpLDP~lsKmll~a~~~Gc~dEilsIvSmLSvp~VF~  810 (1042)
T KOG0924|consen  731 LLKFDFMDPPPEDNLLNSLYQLWTLGALDNTGQLTPLGRKMVEFPLDPPLSKMLLMAARMGCSDEILSIVSMLSVPAVFY  810 (1042)
T ss_pred             hhCCCcCCCCHHHHHHHHHHHHHHhhccccCCccchhhHHhhhCCCCchHHHHHHHHhccCcHHHHHHHHHHhcccceee
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             CchhHHHHHHHHHhhcCCCCCcHHHHHHHHHHHHHhccCCCcccccccchhhhHHHHHHHHHHHHHHHHcCCCccccCcc
Q 001046          978 RPREKQAQADQKRAKFFQPEGDHLTLLAVYEAWKAKNFSGPWCFENFVQSRSLRRAQDVRKQLLSIMDKYKLDVMSAGKN 1057 (1176)
Q Consensus       978 ~p~~~~~~~~~~~~~~~~~~~D~l~~l~~~~~~~~~~~~~~~c~~~~l~~~~l~~~~~~r~ql~~~~~~~~~~~~~~~~~ 1057 (1176)
                      +|+++.++++++|.+|.+++||||||||||++|+.++++..||.+||||.++|++|+++|.||+.||+++++++.|| .+
T Consensus       811 rpker~eead~ar~Kf~~~~sDhLTlLNVf~qw~~~~~~~~WCnd~~l~~kaL~~arevR~ql~~il~~l~~~l~S~-~d  889 (1042)
T KOG0924|consen  811 RPKEREEEADAAREKFQVPESDHLTLLNVFNQWRKNKYSSMWCNDHYLQVKALKKAREVRRQLLEILKQLKLPLISS-DD  889 (1042)
T ss_pred             ccccchhhhhhHHhhhcCCCCchhhHHHHHHHHHhcCCchhhhhhhhhhHHHHHHHHHHHHHHHHHHHHcCCCcccC-ch
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999 89


Q ss_pred             hHHHHHHhhcccccccceeCCCCCeeeeecCccEEECCCCcCCCC-CCCEEEEEeeccchhhhcceecccCHHHHHhhcc
Q 001046         1058 FTKIRKAITAGFFFHAARKDPQEGYRTLVENQPVYIHPSSALFQR-QPDWVIYHELVMTTKEYMREVTVIDPKWLVDLAP 1136 (1176)
Q Consensus      1058 ~~~i~~~l~~g~~~n~a~~~~~~~y~~~~~~~~v~ihpsS~l~~~-~~~~vvy~e~~~t~~~~~~~vt~i~~~wl~~~~~ 1136 (1176)
                      |+.|++|||+|||+|+|++.+.+.|.++.+|.+++|||+|+|++. .|+||||||+++|+++||+|||.|+|+||.|++|
T Consensus       890 wdivrKCIcs~~fhn~Arlkg~g~YV~~~tg~~c~lHPsS~L~g~y~p~Yivyhel~~T~keym~cvT~v~~~wl~E~gp  969 (1042)
T KOG0924|consen  890 WDIVRKCICSAYFHNAARLKGIGEYVNLSTGIPCHLHPSSVLHGLYTPDYIVYHELLMTTKEYMQCVTSVSPEWLAELGP  969 (1042)
T ss_pred             HHHHHHHHHHHHHHHHHHhccCceEEEccCCcceeecchHhhhcCCCCCeeeehHHHHhHHHHHHHHhhCCHHHHHHhCc
Confidence            999999999999999999999999999999999999999999998 8999999999999999999999999999999999


Q ss_pred             ccccccCc
Q 001046         1137 RFFKVADP 1144 (1176)
Q Consensus      1137 ~~~~~~~~ 1144 (1176)
                      .||...+.
T Consensus       970 ~~y~ik~~  977 (1042)
T KOG0924|consen  970 MFYSIKEA  977 (1042)
T ss_pred             eeEecccc
Confidence            99987654

>KOG0922 consensus DEAH-box RNA helicase [RNA processing and modification] Back     alignment and domain information
>KOG0923 consensus mRNA splicing factor ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>KOG0925 consensus mRNA splicing factor ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>PRK11131 ATP-dependent RNA helicase HrpA; Provisional Back     alignment and domain information
>TIGR01967 DEAH_box_HrpA ATP-dependent helicase HrpA Back     alignment and domain information
>COG1643 HrpA HrpA-like helicases [DNA replication, recombination, and repair] Back     alignment and domain information
>KOG0926 consensus DEAH-box RNA helicase [RNA processing and modification; Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG0920 consensus ATP-dependent RNA helicase A [RNA processing and modification] Back     alignment and domain information
>PRK11664 ATP-dependent RNA helicase HrpB; Provisional Back     alignment and domain information
>TIGR01970 DEAH_box_HrpB ATP-dependent helicase HrpB Back     alignment and domain information
>KOG0921 consensus Dosage compensation complex, subunit MLE [Transcription] Back     alignment and domain information
>PHA02653 RNA helicase NPH-II; Provisional Back     alignment and domain information
>PRK01172 ski2-like helicase; Provisional Back     alignment and domain information
>PRK02362 ski2-like helicase; Provisional Back     alignment and domain information
>KOG0331 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>KOG0330 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>PRK11776 ATP-dependent RNA helicase DbpA; Provisional Back     alignment and domain information
>PTZ00110 helicase; Provisional Back     alignment and domain information
>PRK00254 ski2-like helicase; Provisional Back     alignment and domain information
>COG0513 SrmB Superfamily II DNA and RNA helicases [DNA replication, recombination, and repair / Transcription / Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK04837 ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>PLN00206 DEAD-box ATP-dependent RNA helicase; Provisional Back     alignment and domain information
>PRK10590 ATP-dependent RNA helicase RhlE; Provisional Back     alignment and domain information
>PRK11634 ATP-dependent RNA helicase DeaD; Provisional Back     alignment and domain information
>PRK11192 ATP-dependent RNA helicase SrmB; Provisional Back     alignment and domain information
>KOG0333 consensus U5 snRNP-like RNA helicase subunit [RNA processing and modification] Back     alignment and domain information
>PRK04537 ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>PRK01297 ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>PTZ00424 helicase 45; Provisional Back     alignment and domain information
>PLN03137 ATP-dependent DNA helicase; Q4-like; Provisional Back     alignment and domain information
>TIGR03817 DECH_helic helicase/secretion neighborhood putative DEAH-box helicase Back     alignment and domain information
>KOG0338 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>KOG0345 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>TIGR00614 recQ_fam ATP-dependent DNA helicase, RecQ family Back     alignment and domain information
>KOG0342 consensus ATP-dependent RNA helicase pitchoune [RNA processing and modification] Back     alignment and domain information
>KOG0343 consensus RNA Helicase [RNA processing and modification] Back     alignment and domain information
>PRK11057 ATP-dependent DNA helicase RecQ; Provisional Back     alignment and domain information
>COG1202 Superfamily II helicase, archaea-specific [General function prediction only] Back     alignment and domain information
>KOG0340 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>KOG0336 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>KOG0339 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>KOG0348 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>COG1204 Superfamily II helicase [General function prediction only] Back     alignment and domain information
>KOG0328 consensus Predicted ATP-dependent RNA helicase FAL1, involved in rRNA maturation, DEAD-box superfamily [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG0334 consensus RNA helicase [RNA processing and modification] Back     alignment and domain information
>TIGR01389 recQ ATP-dependent DNA helicase RecQ Back     alignment and domain information
>PRK13767 ATP-dependent helicase; Provisional Back     alignment and domain information
>KOG0347 consensus RNA helicase [RNA processing and modification] Back     alignment and domain information
>KOG0335 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>KOG0326 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>KOG0350 consensus DEAD-box ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>KOG0332 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>TIGR00580 mfd transcription-repair coupling factor (mfd) Back     alignment and domain information
>TIGR02621 cas3_GSU0051 CRISPR-associated helicase Cas3, Anaes-subtype Back     alignment and domain information
>PRK09751 putative ATP-dependent helicase Lhr; Provisional Back     alignment and domain information
>KOG0341 consensus DEAD-box protein abstrakt [RNA processing and modification] Back     alignment and domain information
>PRK10917 ATP-dependent DNA helicase RecG; Provisional Back     alignment and domain information
>COG1201 Lhr Lhr-like helicases [General function prediction only] Back     alignment and domain information
>PRK10689 transcription-repair coupling factor; Provisional Back     alignment and domain information
>TIGR00643 recG ATP-dependent DNA helicase RecG Back     alignment and domain information
>TIGR01587 cas3_core CRISPR-associated helicase Cas3 Back     alignment and domain information
>KOG0952 consensus DNA/RNA helicase MER3/SLH1, DEAD-box superfamily [RNA processing and modification] Back     alignment and domain information
>COG0514 RecQ Superfamily II DNA helicase [DNA replication, recombination, and repair] Back     alignment and domain information
>KOG0346 consensus RNA helicase [RNA processing and modification] Back     alignment and domain information
>KOG0344 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>TIGR03158 cas3_cyano CRISPR-associated helicase, Cyano-type Back     alignment and domain information
>COG1111 MPH1 ERCC4-like helicases [DNA replication, recombination, and repair] Back     alignment and domain information
>KOG4284 consensus DEAD box protein [Transcription] Back     alignment and domain information
>KOG0327 consensus Translation initiation factor 4F, helicase subunit (eIF-4A) and related helicases [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG0354 consensus DEAD-box like helicase [General function prediction only] Back     alignment and domain information
>COG1205 Distinct helicase family with a unique C-terminal domain including a metal-binding cysteine cluster [General function prediction only] Back     alignment and domain information
>PHA02558 uvsW UvsW helicase; Provisional Back     alignment and domain information
>KOG0951 consensus RNA helicase BRR2, DEAD-box superfamily [RNA processing and modification] Back     alignment and domain information
>PRK13766 Hef nuclease; Provisional Back     alignment and domain information
>PRK09401 reverse gyrase; Reviewed Back     alignment and domain information
>KOG0948 consensus Nuclear exosomal RNA helicase MTR4, DEAD-box superfamily [RNA processing and modification] Back     alignment and domain information
>KOG0947 consensus Cytoplasmic exosomal RNA helicase SKI2, DEAD-box superfamily [RNA processing and modification] Back     alignment and domain information
>KOG0337 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>KOG0353 consensus ATP-dependent DNA helicase [General function prediction only] Back     alignment and domain information
>KOG0352 consensus ATP-dependent DNA helicase [Replication, recombination and repair] Back     alignment and domain information
>COG4581 Superfamily II RNA helicase [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK14701 reverse gyrase; Provisional Back     alignment and domain information
>TIGR00603 rad25 DNA repair helicase rad25 Back     alignment and domain information
>KOG0351 consensus ATP-dependent DNA helicase [Replication, recombination and repair] Back     alignment and domain information
>TIGR03714 secA2 accessory Sec system translocase SecA2 Back     alignment and domain information
>PRK12898 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>PRK09200 preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>PRK09694 helicase Cas3; Provisional Back     alignment and domain information
>PRK05580 primosome assembly protein PriA; Validated Back     alignment and domain information
>TIGR01054 rgy reverse gyrase Back     alignment and domain information
>TIGR00963 secA preprotein translocase, SecA subunit Back     alignment and domain information
>TIGR00595 priA primosomal protein N' Back     alignment and domain information
>COG4098 comFA Superfamily II DNA/RNA helicase required for DNA uptake (late competence protein) [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK11448 hsdR type I restriction enzyme EcoKI subunit R; Provisional Back     alignment and domain information
>COG1197 Mfd Transcription-repair coupling factor (superfamily II helicase) [DNA replication, recombination, and repair / Transcription] Back     alignment and domain information
>COG1200 RecG RecG-like helicase [DNA replication, recombination, and repair / Transcription] Back     alignment and domain information
>KOG0950 consensus DNA polymerase theta/eta, DEAD-box superfamily [General function prediction only] Back     alignment and domain information
>COG1061 SSL2 DNA or RNA helicases of superfamily II [Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>KOG0349 consensus Putative DEAD-box RNA helicase DDX1 [RNA processing and modification] Back     alignment and domain information
>PRK04914 ATP-dependent helicase HepA; Validated Back     alignment and domain information
>PF07717 OB_NTP_bind: Oligonucleotide/oligosaccharide-binding (OB)-fold; InterPro: IPR011709 This domain is found towards the C terminus of the DEAD-box helicases (IPR011545 from INTERPRO) Back     alignment and domain information
>KOG0329 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>PRK13104 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>COG1203 CRISPR-associated helicase Cas3 [Defense mechanisms] Back     alignment and domain information
>PRK12906 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>KOG0921 consensus Dosage compensation complex, subunit MLE [Transcription] Back     alignment and domain information
>PRK12904 preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>KOG0949 consensus Predicted helicase, DEAD-box superfamily [General function prediction only] Back     alignment and domain information
>PF04408 HA2: Helicase associated domain (HA2); InterPro: IPR007502 This presumed domain is about 90 amino acid residues in length Back     alignment and domain information
>PRK13107 preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>PRK12899 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>KOG0953 consensus Mitochondrial RNA helicase SUV3, DEAD-box superfamily [RNA processing and modification] Back     alignment and domain information
>PF00270 DEAD: DEAD/DEAH box helicase; InterPro: IPR011545 Members of this family include the DEAD and DEAH box helicases Back     alignment and domain information
>COG1098 VacB Predicted RNA binding protein (contains ribosomal protein S1 domain) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>cd00268 DEADc DEAD-box helicases Back     alignment and domain information
>smart00847 HA2 Helicase associated domain (HA2) Add an annotation Back     alignment and domain information
>COG4096 HsdR Type I site-specific restriction-modification system, R (restriction) subunit and related helicases [Defense mechanisms] Back     alignment and domain information
>COG1198 PriA Primosomal protein N' (replication factor Y) - superfamily II helicase [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK12900 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>TIGR00348 hsdR type I site-specific deoxyribonuclease, HsdR family Back     alignment and domain information
>KOG4150 consensus Predicted ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>COG1110 Reverse gyrase [DNA replication, recombination, and repair] Back     alignment and domain information
>TIGR00631 uvrb excinuclease ABC, B subunit Back     alignment and domain information
>TIGR01407 dinG_rel DnaQ family exonuclease/DinG family helicase, putative Back     alignment and domain information
>PTZ00248 eukaryotic translation initiation factor 2 subunit 1; Provisional Back     alignment and domain information
>PLN03142 Probable chromatin-remodeling complex ATPase chain; Provisional Back     alignment and domain information
>COG0539 RpsA Ribosomal protein S1 [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>smart00487 DEXDc DEAD-like helicases superfamily Back     alignment and domain information
>TIGR02562 cas3_yersinia CRISPR-associated helicase Cas3 Back     alignment and domain information
>PRK12326 preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>cd00046 DEXDc DEAD-like helicases superfamily Back     alignment and domain information
>cd00079 HELICc Helicase superfamily c-terminal domain; associated with DEXDc-, DEAD-, and DEAH-box proteins, yeast initiation factor 4A, Ski2p, and Hepatitis C virus NS3 helicases; this domain is found in a wide variety of helicases and helicase related proteins; may not be an autonomously folding unit, but an integral part of the helicase; 4 helicase superfamilies at present according to the organization of their signature motifs; all helicases share the ability to unwind nucleic acid duplexes with a distinct directional polarity; they utilize the free energy from nucleoside triphosphate hydrolysis to fuel their translocation along DNA, unwinding the duplex in the process Back     alignment and domain information
>PRK05298 excinuclease ABC subunit B; Provisional Back     alignment and domain information
>COG0539 RpsA Ribosomal protein S1 [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PF07652 Flavi_DEAD: Flavivirus DEAD domain ; InterPro: IPR011492 This is the Flavivirus DEAD domain Back     alignment and domain information
>cd05686 S1_pNO40 S1_pNO40: pNO40 , S1-like RNA-binding domain Back     alignment and domain information
>PF00271 Helicase_C: Helicase conserved C-terminal domain; InterPro: IPR001650 The domain, which defines this group of proteins is found in a wide variety of helicases and helicase related proteins Back     alignment and domain information
>cd05704 S1_Rrp5_repeat_hs13 S1_Rrp5_repeat_hs13: Rrp5 is a trans-acting factor important for biogenesis of both the 40S and 60S eukaryotic ribosomal subunits Back     alignment and domain information
>PRK08582 hypothetical protein; Provisional Back     alignment and domain information
>PRK13103 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>PRK07246 bifunctional ATP-dependent DNA helicase/DNA polymerase III subunit epsilon; Validated Back     alignment and domain information
>PRK12903 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>cd05684 S1_DHX8_helicase S1_DHX8_helicase: The N-terminal S1 domain of human ATP-dependent RNA helicase DHX8, a DEAH (Asp-Glu-Ala-His) box polypeptide Back     alignment and domain information
>COG0556 UvrB Helicase subunit of the DNA excision repair complex [DNA replication, recombination, and repair] Back     alignment and domain information
>PHA02945 interferon resistance protein; Provisional Back     alignment and domain information
>PF04851 ResIII: Type III restriction enzyme, res subunit; InterPro: IPR006935 This entry represents a domain found in the N terminus of several proteins, including helicases, the R subunit (HsdR) of type I restriction endonucleases (3 Back     alignment and domain information
>KOG0951 consensus RNA helicase BRR2, DEAD-box superfamily [RNA processing and modification] Back     alignment and domain information
>cd04452 S1_IF2_alpha S1_IF2_alpha: The alpha subunit of translation Initiation Factor 2, S1-like RNA-binding domain Back     alignment and domain information
>cd05705 S1_Rrp5_repeat_hs14 S1_Rrp5_repeat_hs14: Rrp5 is a trans-acting factor important for biogenesis of both the 40S and 60S eukaryotic ribosomal subunits Back     alignment and domain information
>PLN00207 polyribonucleotide nucleotidyltransferase; Provisional Back     alignment and domain information
>COG1093 SUI2 Translation initiation factor 2, alpha subunit (eIF-2alpha) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK07252 hypothetical protein; Provisional Back     alignment and domain information
>cd04461 S1_Rrp5_repeat_hs8_sc7 S1_Rrp5_repeat_hs8_sc7: Rrp5 Homo sapiens S1 repeat 8 (hs8) and Saccharomyces cerevisiae S1 repeat 7 (sc7)-like domains Back     alignment and domain information
>CHL00122 secA preprotein translocase subunit SecA; Validated Back     alignment and domain information
>cd05696 S1_Rrp5_repeat_hs4 S1_Rrp5_repeat_hs4: Rrp5 is a trans-acting factor important for biogenesis of both the 40S and 60S eukaryotic ribosomal subunits Back     alignment and domain information
>PRK05807 hypothetical protein; Provisional Back     alignment and domain information
>smart00490 HELICc helicase superfamily c-terminal domain Back     alignment and domain information
>cd05698 S1_Rrp5_repeat_hs6_sc5 S1_Rrp5_repeat_hs6_sc5: Rrp5 is a trans-acting factor important for biogenesis of both the 40S and 60S eukaryotic ribosomal subunits Back     alignment and domain information
>PF00575 S1: S1 RNA binding domain; InterPro: IPR003029 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms Back     alignment and domain information
>PRK07899 rpsA 30S ribosomal protein S1; Reviewed Back     alignment and domain information
>cd05706 S1_Rrp5_repeat_sc10 S1_Rrp5_repeat_sc10: Rrp5 is a trans-acting factor important for biogenesis of both the 40S and 60S eukaryotic ribosomal subunits Back     alignment and domain information
>PRK12269 bifunctional cytidylate kinase/ribosomal protein S1; Provisional Back     alignment and domain information
>KOG1123 consensus RNA polymerase II transcription initiation/nucleotide excision repair factor TFIIH, 3'-5' helicase subunit SSL2 [Transcription; Replication, recombination and repair] Back     alignment and domain information
>cd05703 S1_Rrp5_repeat_hs12_sc9 S1_Rrp5_repeat_hs12_sc9: Rrp5 is a trans-acting factor important for biogenesis of both the 40S and 60S eukaryotic ribosomal subunits Back     alignment and domain information
>cd05697 S1_Rrp5_repeat_hs5 S1_Rrp5_repeat_hs5: Rrp5 is a trans-acting factor important for biogenesis of both the 40S and 60S eukaryotic ribosomal subunits Back     alignment and domain information
>cd05690 S1_RPS1_repeat_ec5 S1_RPS1_repeat_ec5: Ribosomal protein S1 (RPS1) domain Back     alignment and domain information
>cd05707 S1_Rrp5_repeat_sc11 S1_Rrp5_repeat_sc11: Rrp5 is a trans-acting factor important for biogenesis of both the 40S and 60S eukaryotic ribosomal subunits Back     alignment and domain information
>PRK13806 rpsA 30S ribosomal protein S1; Provisional Back     alignment and domain information
>PRK14873 primosome assembly protein PriA; Provisional Back     alignment and domain information
>cd05694 S1_Rrp5_repeat_hs2_sc2 S1_Rrp5_repeat_hs2_sc2: Rrp5 is a trans-acting factor important for biogenesis of both the 40S and 60S eukaryotic ribosomal subunits Back     alignment and domain information
>PRK12902 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>cd05691 S1_RPS1_repeat_ec6 S1_RPS1_repeat_ec6: Ribosomal protein S1 (RPS1) domain Back     alignment and domain information
>PRK07400 30S ribosomal protein S1; Reviewed Back     alignment and domain information
>cd05689 S1_RPS1_repeat_ec4 S1_RPS1_repeat_ec4: Ribosomal protein S1 (RPS1) domain Back     alignment and domain information
>cd05708 S1_Rrp5_repeat_sc12 S1_Rrp5_repeat_sc12: Rrp5 is a trans-acting factor important for biogenesis of both the 40S and 60S eukaryotic ribosomal subunits Back     alignment and domain information
>PRK03987 translation initiation factor IF-2 subunit alpha; Validated Back     alignment and domain information
>cd04453 S1_RNase_E S1_RNase_E: RNase E and RNase G, S1-like RNA-binding domain Back     alignment and domain information
>cd05692 S1_RPS1_repeat_hs4 S1_RPS1_repeat_hs4: Ribosomal protein S1 (RPS1) domain Back     alignment and domain information
>TIGR03117 cas_csf4 CRISPR-associated DEAD/DEAH-box helicase Csf4 Back     alignment and domain information
>PRK08059 general stress protein 13; Validated Back     alignment and domain information
>PRK08074 bifunctional ATP-dependent DNA helicase/DNA polymerase III subunit epsilon; Validated Back     alignment and domain information
>TIGR02696 pppGpp_PNP guanosine pentaphosphate synthetase I/polynucleotide phosphorylase Back     alignment and domain information
>PF02399 Herpes_ori_bp: Origin of replication binding protein; InterPro: IPR003450 This entry represents replication origin binding protein Back     alignment and domain information
>PRK13806 rpsA 30S ribosomal protein S1; Provisional Back     alignment and domain information
>PRK12269 bifunctional cytidylate kinase/ribosomal protein S1; Provisional Back     alignment and domain information
>cd05687 S1_RPS1_repeat_ec1_hs1 S1_RPS1_repeat_ec1_hs1: Ribosomal protein S1 (RPS1) domain Back     alignment and domain information
>cd04472 S1_PNPase S1_PNPase: Polynucleotide phosphorylase (PNPase), ), S1-like RNA-binding domain Back     alignment and domain information
>cd05685 S1_Tex S1_Tex: The C-terminal S1 domain of a transcription accessory factor called Tex, which has been characterized in Bordetella pertussis and Pseudomonas aeruginosa Back     alignment and domain information
>PRK07899 rpsA 30S ribosomal protein S1; Reviewed Back     alignment and domain information
>COG1185 Pnp Polyribonucleotide nucleotidyltransferase (polynucleotide phosphorylase) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>cd05789 S1_Rrp4 S1_Rrp4: Rrp4 S1-like RNA-binding domain Back     alignment and domain information
>PRK12901 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>PRK11824 polynucleotide phosphorylase/polyadenylase; Provisional Back     alignment and domain information
>cd05693 S1_Rrp5_repeat_hs1_sc1 S1_Rrp5_repeat_hs1_sc1: Rrp5 is a trans-acting factor important for biogenesis of both the 40S and 60S eukaryotic ribosomal subunits Back     alignment and domain information
>PRK06299 rpsA 30S ribosomal protein S1; Reviewed Back     alignment and domain information
>COG2183 Tex Transcriptional accessory protein [Transcription] Back     alignment and domain information
>cd05695 S1_Rrp5_repeat_hs3 S1_Rrp5_repeat_hs3: Rrp5 is a trans-acting factor important for biogenesis of both the 40S and 60S eukaryotic ribosomal subunits Back     alignment and domain information
>cd05688 S1_RPS1_repeat_ec3 S1_RPS1_repeat_ec3: Ribosomal protein S1 (RPS1) domain Back     alignment and domain information
>PRK11747 dinG ATP-dependent DNA helicase DinG; Provisional Back     alignment and domain information
>cd04471 S1_RNase_R S1_RNase_R: RNase R C-terminal S1 domain Back     alignment and domain information
>KOG0385 consensus Chromatin remodeling complex WSTF-ISWI, small subunit [Transcription] Back     alignment and domain information
>PRK06676 rpsA 30S ribosomal protein S1; Reviewed Back     alignment and domain information
>COG4889 Predicted helicase [General function prediction only] Back     alignment and domain information
>cd04465 S1_RPS1_repeat_ec2_hs2 S1_RPS1_repeat_ec2_hs2: Ribosomal protein S1 (RPS1) domain Back     alignment and domain information
>PRK06676 rpsA 30S ribosomal protein S1; Reviewed Back     alignment and domain information
>TIGR00604 rad3 DNA repair helicase (rad3) Back     alignment and domain information
>cd04473 S1_RecJ_like S1_RecJ_like: The S1 domain of the archaea-specific RecJ-like exonuclease Back     alignment and domain information
>PRK06299 rpsA 30S ribosomal protein S1; Reviewed Back     alignment and domain information
>cd05702 S1_Rrp5_repeat_hs11_sc8 S1_Rrp5_repeat_hs11_sc8: Rrp5 is a trans-acting factor important for biogenesis of both the 40S and 60S eukaryotic ribosomal subunits Back     alignment and domain information
>KOG0387 consensus Transcription-coupled repair protein CSB/RAD26 (contains SNF2 family DNA-dependent ATPase domain) [Transcription; Replication, recombination and repair] Back     alignment and domain information
>cd04454 S1_Rrp4_like S1_Rrp4_like: Rrp4-like, S1-like RNA-binding domain Back     alignment and domain information
>smart00316 S1 Ribosomal protein S1-like RNA-binding domain Back     alignment and domain information
>TIGR03591 polynuc_phos polyribonucleotide nucleotidyltransferase Back     alignment and domain information
>COG1419 FlhF Flagellar GTP-binding protein [Cell motility and secretion] Back     alignment and domain information
>KOG0390 consensus DNA repair protein, SNF2 family [Replication, recombination and repair] Back     alignment and domain information
>PRK00087 4-hydroxy-3-methylbut-2-enyl diphosphate reductase/S1 RNA-binding domain protein; Reviewed Back     alignment and domain information
>TIGR00717 rpsA ribosomal protein S1 Back     alignment and domain information
>PRK07400 30S ribosomal protein S1; Reviewed Back     alignment and domain information
>TIGR00717 rpsA ribosomal protein S1 Back     alignment and domain information
>COG1199 DinG Rad3-related DNA helicases [Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>cd04460 S1_RpoE S1_RpoE: RpoE, S1-like RNA-binding domain Back     alignment and domain information
>PRK00087 4-hydroxy-3-methylbut-2-enyl diphosphate reductase/S1 RNA-binding domain protein; Reviewed Back     alignment and domain information
>PF00448 SRP54: SRP54-type protein, GTPase domain; InterPro: IPR000897 The signal recognition particle (SRP) is a multimeric protein, which along with its conjugate receptor (SR), is involved in targeting secretory proteins to the rough endoplasmic reticulum (RER) membrane in eukaryotes, or to the plasma membrane in prokaryotes [, ] Back     alignment and domain information
>PRK09521 exosome complex RNA-binding protein Csl4; Provisional Back     alignment and domain information
>cd00164 S1_like S1_like: Ribosomal protein S1-like RNA-binding domain Back     alignment and domain information
>KOG1000 consensus Chromatin remodeling protein HARP/SMARCAL1, DEAD-box superfamily [Chromatin structure and dynamics] Back     alignment and domain information
>PRK04163 exosome complex RNA-binding protein Rrp4; Provisional Back     alignment and domain information
>KOG1067 consensus Predicted RNA-binding polyribonucleotide nucleotidyltransferase [General function prediction only] Back     alignment and domain information
>PRK11889 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PRK12723 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PRK12726 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PRK14722 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>KOG0384 consensus Chromodomain-helicase DNA-binding protein [Transcription] Back     alignment and domain information
>TIGR02063 RNase_R ribonuclease R Back     alignment and domain information
>COG1095 RPB7 DNA-directed RNA polymerase, subunit E' [Transcription] Back     alignment and domain information
>TIGR00448 rpoE DNA-directed RNA polymerase (rpoE), archaeal and eukaryotic form Back     alignment and domain information
>cd05791 S1_CSL4 S1_CSL4: CSL4, S1-like RNA-binding domain Back     alignment and domain information
>PRK11642 exoribonuclease R; Provisional Back     alignment and domain information
>PF13401 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S_B Back     alignment and domain information
>PF06862 DUF1253: Protein of unknown function (DUF1253); InterPro: IPR010678 This family is defined by a C-terminal region of approximately 500 residues, Digestive organ expansion factor (DEF) is thought to Regulate the p53 pathway to control the expansion growth of digestive organs and is required for the expansion growth of intestine, liver and exocrine pancreas, but not endocrine pancreas [, ] Back     alignment and domain information
>PRK05703 flhF flagellar biosynthesis regulator FlhF; Validated Back     alignment and domain information
>TIGR00358 3_prime_RNase VacB and RNase II family 3'-5' exoribonucleases Back     alignment and domain information
>PRK12727 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>cd04455 S1_NusA S1_NusA: N-utilizing substance A protein (NusA), S1-like RNA-binding domain Back     alignment and domain information
>PF13604 AAA_30: AAA domain; PDB: 1W36_G 3K70_G 3UPU_B 3GPL_A 3E1S_A 3GP8_A Back     alignment and domain information
>PRK12724 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PF00176 SNF2_N: SNF2 family N-terminal domain; InterPro: IPR000330 This domain is found in proteins involved in a variety of processes including transcription regulation (e Back     alignment and domain information
>COG0653 SecA Preprotein translocase subunit SecA (ATPase, RNA helicase) [Intracellular trafficking and secretion] Back     alignment and domain information
>TIGR02768 TraA_Ti Ti-type conjugative transfer relaxase TraA Back     alignment and domain information
>PRK08563 DNA-directed RNA polymerase subunit E'; Provisional Back     alignment and domain information
>PF13245 AAA_19: Part of AAA domain Back     alignment and domain information
>PRK13889 conjugal transfer relaxase TraA; Provisional Back     alignment and domain information
>PRK14721 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>KOG1803 consensus DNA helicase [Replication, recombination and repair] Back     alignment and domain information
>PRK14974 cell division protein FtsY; Provisional Back     alignment and domain information
>COG0610 Type I site-specific restriction-modification system, R (restriction) subunit and related helicases [Defense mechanisms] Back     alignment and domain information
>PRK14723 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>KOG0392 consensus SNF2 family DNA-dependent ATPase domain-containing protein [Transcription] Back     alignment and domain information
>TIGR01447 recD exodeoxyribonuclease V, alpha subunit Back     alignment and domain information
>PHA02858 EIF2a-like PKR inhibitor; Provisional Back     alignment and domain information
>PRK06731 flhF flagellar biosynthesis regulator FlhF; Validated Back     alignment and domain information
>KOG0952 consensus DNA/RNA helicase MER3/SLH1, DEAD-box superfamily [RNA processing and modification] Back     alignment and domain information
>TIGR01448 recD_rel helicase, putative, RecD/TraA family Back     alignment and domain information
>PF02562 PhoH: PhoH-like protein; InterPro: IPR003714 PhoH is a cytoplasmic protein and predicted ATPase that is induced by phosphate starvation and belongings to the phosphate regulon (pho) in Escherichia coli [] Back     alignment and domain information
>PRK10875 recD exonuclease V subunit alpha; Provisional Back     alignment and domain information
>PRK06995 flhF flagellar biosynthesis regulator FlhF; Validated Back     alignment and domain information
>PRK13826 Dtr system oriT relaxase; Provisional Back     alignment and domain information
>PRK10536 hypothetical protein; Provisional Back     alignment and domain information
>cd00009 AAA The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold Back     alignment and domain information
>PRK06526 transposase; Provisional Back     alignment and domain information
>PF09848 DUF2075: Uncharacterized conserved protein (DUF2075); InterPro: IPR018647 This domain, found in putative ATP/GTP binding proteins, has no known function Back     alignment and domain information
>TIGR00757 RNaseEG ribonuclease, Rne/Rng family Back     alignment and domain information
>PF13086 AAA_11: AAA domain; PDB: 2XZL_A 2XZO_A 2WJY_A 2WJV_A 2XZP_A 2GK6_A 2GK7_A 2GJK_A Back     alignment and domain information
>PRK10416 signal recognition particle-docking protein FtsY; Provisional Back     alignment and domain information
>KOG2916 consensus Translation initiation factor 2, alpha subunit (eIF-2alpha) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK05054 exoribonuclease II; Provisional Back     alignment and domain information
>PRK15483 type III restriction-modification system StyLTI enzyme res; Provisional Back     alignment and domain information
>PRK04296 thymidine kinase; Provisional Back     alignment and domain information
>TIGR02760 TraI_TIGR conjugative transfer relaxase protein TraI Back     alignment and domain information
>PF05970 PIF1: PIF1-like helicase; InterPro: IPR010285 This entry represents PIF1 helicase and related proteins Back     alignment and domain information
>PF12340 DUF3638: Protein of unknown function (DUF3638); InterPro: IPR022099 This domain family is found in eukaryotes, and is approximately 230 amino acids in length Back     alignment and domain information
>TIGR00064 ftsY signal recognition particle-docking protein FtsY Back     alignment and domain information
>COG1096 Predicted RNA-binding protein (consists of S1 domain and a Zn-ribbon domain) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>smart00382 AAA ATPases associated with a variety of cellular activities Back     alignment and domain information
>KOG1070 consensus rRNA processing protein Rrp5 [RNA processing and modification] Back     alignment and domain information
>PF07517 SecA_DEAD: SecA DEAD-like domain; InterPro: IPR011115 SecA protein binds to the plasma membrane where it interacts with proOmpA to support translocation of proOmpA through the membrane Back     alignment and domain information
>KOG1002 consensus Nucleotide excision repair protein RAD16 [Replication, recombination and repair] Back     alignment and domain information
>smart00489 DEXDc3 DEAD-like helicases superfamily Back     alignment and domain information
>smart00488 DEXDc2 DEAD-like helicases superfamily Back     alignment and domain information
>PRK09202 nusA transcription elongation factor NusA; Validated Back     alignment and domain information
>TIGR01425 SRP54_euk signal recognition particle protein SRP54 Back     alignment and domain information
>PF10447 EXOSC1: Exosome component EXOSC1/CSL4; InterPro: IPR019495 The exosome mediates degradation of unstable mRNAs that contain AU-rich elements (AREs) within their 3' untranslated regions [] Back     alignment and domain information
>COG0557 VacB Exoribonuclease R [Transcription] Back     alignment and domain information
>PF13173 AAA_14: AAA domain Back     alignment and domain information
>smart00311 PWI PWI, domain in splicing factors Back     alignment and domain information
>PRK08181 transposase; Validated Back     alignment and domain information
>COG1097 RRP4 RNA-binding protein Rrp4 and related proteins (contain S1 domain and KH domain) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PF05729 NACHT: NACHT domain Back     alignment and domain information
>TIGR00959 ffh signal recognition particle protein Back     alignment and domain information
>PF13872 AAA_34: P-loop containing NTP hydrolase pore-1 Back     alignment and domain information
>PRK10867 signal recognition particle protein; Provisional Back     alignment and domain information
>TIGR03499 FlhF flagellar biosynthetic protein FlhF Back     alignment and domain information
>PRK00771 signal recognition particle protein Srp54; Provisional Back     alignment and domain information
>cd05790 S1_Rrp40 S1_Rrp40: Rrp40 S1-like RNA-binding domain Back     alignment and domain information
>TIGR00596 rad1 DNA repair protein (rad1) Back     alignment and domain information
>PF00580 UvrD-helicase: UvrD/REP helicase N-terminal domain; InterPro: IPR000212 Members of this family are helicases that catalyse ATP dependent unwinding of double stranded DNA to single stranded DNA Back     alignment and domain information
>PRK07952 DNA replication protein DnaC; Validated Back     alignment and domain information
>KOG1802 consensus RNA helicase nonsense mRNA reducing factor (pNORF1) [RNA processing and modification] Back     alignment and domain information
>TIGR00376 DNA helicase, putative Back     alignment and domain information
>PTZ00162 DNA-directed RNA polymerase II subunit 7; Provisional Back     alignment and domain information
>PRK09183 transposase/IS protein; Provisional Back     alignment and domain information
>TIGR03015 pepcterm_ATPase putative secretion ATPase, PEP-CTERM locus subfamily Back     alignment and domain information
>KOG2340 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF05127 Helicase_RecD: Helicase; InterPro: IPR007807 This domain is about 350 amino acid residues long and appears to have a P-loop motif, suggesting this is an ATPase Back     alignment and domain information
>cd04462 S1_RNAPII_Rpb7 S1_RNAPII_Rpb7: Eukaryotic RNA polymerase II (RNAPII) Rpb7 subunit C-terminal S1 domain Back     alignment and domain information
>TIGR02062 RNase_B exoribonuclease II Back     alignment and domain information
>PRK07003 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>COG1444 Predicted P-loop ATPase fused to an acetyltransferase [General function prediction only] Back     alignment and domain information
>TIGR02881 spore_V_K stage V sporulation protein K Back     alignment and domain information
>PRK14956 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>cd01120 RecA-like_NTPases RecA-like NTPases Back     alignment and domain information
>TIGR03420 DnaA_homol_Hda DnaA regulatory inactivator Hda Back     alignment and domain information
>KOG1070 consensus rRNA processing protein Rrp5 [RNA processing and modification] Back     alignment and domain information
>PRK06835 DNA replication protein DnaC; Validated Back     alignment and domain information
>PRK08903 DnaA regulatory inactivator Hda; Validated Back     alignment and domain information
>PRK08727 hypothetical protein; Validated Back     alignment and domain information
>PF05621 TniB: Bacterial TniB protein; InterPro: IPR008868 This family consists of several bacterial TniB NTP-binding proteins Back     alignment and domain information
>KOG2146 consensus Splicing coactivator SRm160/300, subunit SRm160 (contains PWI domain) [RNA processing and modification; General function prediction only] Back     alignment and domain information
>TIGR01953 NusA transcription termination factor NusA Back     alignment and domain information
>PRK12377 putative replication protein; Provisional Back     alignment and domain information
>PF01695 IstB_IS21: IstB-like ATP binding protein; InterPro: IPR002611 Proteins in this entry contain an ATP/GTP binding P-loop motif Back     alignment and domain information
>PRK07764 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK14949 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK06893 DNA replication initiation factor; Validated Back     alignment and domain information
>PRK08939 primosomal protein DnaI; Reviewed Back     alignment and domain information
>cd03115 SRP The signal recognition particle (SRP) mediates the transport to or across the plasma membrane in bacteria and the endoplasmic reticulum in eukaryotes Back     alignment and domain information
>COG1107 Archaea-specific RecJ-like exonuclease, contains DnaJ-type Zn finger domain [DNA replication, recombination, and repair] Back     alignment and domain information
>PHA03333 putative ATPase subunit of terminase; Provisional Back     alignment and domain information
>COG0552 FtsY Signal recognition particle GTPase [Intracellular trafficking and secretion] Back     alignment and domain information
>COG1875 NYN ribonuclease and ATPase of PhoH family domains [General function prediction only] Back     alignment and domain information
>PRK14712 conjugal transfer nickase/helicase TraI; Provisional Back     alignment and domain information
>PRK08116 hypothetical protein; Validated Back     alignment and domain information
>PRK12402 replication factor C small subunit 2; Reviewed Back     alignment and domain information
>PRK07994 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK12327 nusA transcription elongation factor NusA; Provisional Back     alignment and domain information
>PRK12323 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14964 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>cd03221 ABCF_EF-3 ABCF_EF-3 Elongation factor 3 (EF-3) is a cytosolic protein required by fungal ribosomes for in vitro protein synthesis and for in vivo growth Back     alignment and domain information
>PRK09112 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK10811 rne ribonuclease E; Reviewed Back     alignment and domain information
>PRK14960 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>cd00267 ABC_ATPase ABC (ATP-binding cassette) transporter nucleotide-binding domain; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules Back     alignment and domain information
>TIGR02880 cbbX_cfxQ probable Rubsico expression protein CbbX Back     alignment and domain information
>COG1484 DnaC DNA replication protein [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK08084 DNA replication initiation factor; Provisional Back     alignment and domain information
>PRK06921 hypothetical protein; Provisional Back     alignment and domain information
>PF00004 AAA: ATPase family associated with various cellular activities (AAA); InterPro: IPR003959 AAA ATPases (ATPases Associated with diverse cellular Activities) form a large protein family and play a number of roles in the cell including cell-cycle regulation, protein proteolysis and disaggregation, organelle biogenesis and intracellular transport Back     alignment and domain information
>PRK14952 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK05642 DNA replication initiation factor; Validated Back     alignment and domain information
>PRK14958 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>cd03247 ABCC_cytochrome_bd The CYD subfamily implicated in cytochrome bd biogenesis Back     alignment and domain information
>KOG0391 consensus SNF2 family DNA-dependent ATPase [General function prediction only] Back     alignment and domain information
>COG2804 PulE Type II secretory pathway, ATPase PulE/Tfp pilus assembly pathway, ATPase PilB [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>TIGR02760 TraI_TIGR conjugative transfer relaxase protein TraI Back     alignment and domain information
>PRK08691 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK00411 cdc6 cell division control protein 6; Reviewed Back     alignment and domain information
>COG0541 Ffh Signal recognition particle GTPase [Intracellular trafficking and secretion] Back     alignment and domain information
>PRK06645 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>CHL00181 cbbX CbbX; Provisional Back     alignment and domain information
>cd01124 KaiC KaiC is a circadian clock protein primarily found in cyanobacteria KaiC is a RecA-like ATPase, having both Walker A and Walker B motifs Back     alignment and domain information
>KOG4439 consensus RNA polymerase II transcription termination factor TTF2/lodestar, DEAD-box superfamily [Transcription; Replication, recombination and repair] Back     alignment and domain information
>COG1120 FepC ABC-type cobalamin/Fe3+-siderophores transport systems, ATPase components [Inorganic ion transport and metabolism / Coenzyme metabolism] Back     alignment and domain information
>KOG0386 consensus Chromatin remodeling complex SWI/SNF, component SWI2 and related ATPases (DNA/RNA helicase superfamily) [Chromatin structure and dynamics; Transcription] Back     alignment and domain information
>PRK11712 ribonuclease G; Provisional Back     alignment and domain information
>PRK13709 conjugal transfer nickase/helicase TraI; Provisional Back     alignment and domain information
>cd03228 ABCC_MRP_Like The MRP (Mutidrug Resistance Protein)-like transporters are involved in drug, peptide, and lipid export Back     alignment and domain information
>PRK14961 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PHA02533 17 large terminase protein; Provisional Back     alignment and domain information
>PRK14969 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14951 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PTZ00112 origin recognition complex 1 protein; Provisional Back     alignment and domain information
>PF13509 S1_2: S1 domain; PDB: 3GO5_A Back     alignment and domain information
>PRK00149 dnaA chromosomal replication initiation protein; Reviewed Back     alignment and domain information
>PRK14955 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>cd03238 ABC_UvrA The excision repair protein UvrA; Nucleotide excision repair in eubacteria is a process that repairs DNA damage by the removal of a 12-13-mer oligonucleotide containing the lesion Back     alignment and domain information
>PRK14957 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>cd03222 ABC_RNaseL_inhibitor The ABC ATPase RNase L inhibitor (RLI) is a key enzyme in ribosomal biogenesis, formation of translation preinitiation complexes, and assembly of HIV capsids Back     alignment and domain information
>PRK14962 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK09111 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>cd03216 ABC_Carb_Monos_I This family represents the domain I of the carbohydrate uptake proteins that transport only monosaccharides (Monos) Back     alignment and domain information
>KOG0989 consensus Replication factor C, subunit RFC4 [Replication, recombination and repair] Back     alignment and domain information
>COG2996 Predicted RNA-bindining protein (contains S1 and HTH domains) [General function prediction only] Back     alignment and domain information
>PHA02544 44 clamp loader, small subunit; Provisional Back     alignment and domain information
>PRK06620 hypothetical protein; Validated Back     alignment and domain information
>TIGR02782 TrbB_P P-type conjugative transfer ATPase TrbB Back     alignment and domain information
>PRK05707 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>TIGR03345 VI_ClpV1 type VI secretion ATPase, ClpV1 family Back     alignment and domain information
>PRK14963 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK09087 hypothetical protein; Validated Back     alignment and domain information
>PF13307 Helicase_C_2: Helicase C-terminal domain; PDB: 4A15_A 2VSF_A 3CRV_A 3CRW_1 2VL7_A Back     alignment and domain information
>cd03214 ABC_Iron-Siderophores_B12_Hemin ABC transporters, involved in the uptake of siderophores, heme, and vitamin B12, are widely conserved in bacteria and archaea Back     alignment and domain information
>TIGR02928 orc1/cdc6 family replication initiation protein Back     alignment and domain information
>PLN03025 replication factor C subunit; Provisional Back     alignment and domain information
>PF05496 RuvB_N: Holliday junction DNA helicase ruvB N-terminus; InterPro: IPR008824 The RuvB protein makes up part of the RuvABC revolvasome which catalyses the resolution of Holliday junctions that arise during genetic recombination and DNA repair Back     alignment and domain information
>COG3587 Restriction endonuclease [Defense mechanisms] Back     alignment and domain information
>PRK07471 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>cd01122 GP4d_helicase GP4d_helicase is a homohexameric 5'-3' helicases Back     alignment and domain information
>PRK04195 replication factor C large subunit; Provisional Back     alignment and domain information
>PF00308 Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013317 This entry represents the central domain of bacterial DnaA proteins [, , ] that play an important role in initiating and regulating chromosomal replication Back     alignment and domain information
>PRK11331 5-methylcytosine-specific restriction enzyme subunit McrB; Provisional Back     alignment and domain information
>cd03246 ABCC_Protease_Secretion This family represents the ABC component of the protease secretion system PrtD, a 60-kDa integral membrane protein sharing 37% identity with HlyB, the ABC component of the alpha-hemolysin secretion pathway, in the C-terminal domain Back     alignment and domain information
>cd03229 ABC_Class3 This class is comprised of all BPD (Binding Protein Dependent) systems that are largely represented in archaea and eubacteria and are primarily involved in scavenging solutes from the environment Back     alignment and domain information
>cd03230 ABC_DR_subfamily_A This family of ATP-binding proteins belongs to a multisubunit transporter involved in drug resistance (BcrA and DrrA), nodulation, lipid transport, and lantibiotic immunity Back     alignment and domain information
>KOG1805 consensus DNA replication helicase [Replication, recombination and repair] Back     alignment and domain information
>PRK13833 conjugal transfer protein TrbB; Provisional Back     alignment and domain information
>COG1219 ClpX ATP-dependent protease Clp, ATPase subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd05699 S1_Rrp5_repeat_hs7 S1_Rrp5_repeat_hs7: Rrp5 is a trans-acting factor important for biogenesis of both the 40S and 60S eukaryotic ribosomal subunits Back     alignment and domain information
>KOG1856 consensus Transcription elongation factor SPT6 [RNA processing and modification] Back     alignment and domain information
>TIGR00362 DnaA chromosomal replication initiator protein DnaA Back     alignment and domain information
>PRK14965 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>cd03223 ABCD_peroxisomal_ALDP Peroxisomal ATP-binding cassette transporter (Pat) is involved in the import of very long-chain fatty acids (VLCFA) into the peroxisome Back     alignment and domain information
>PRK07133 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>KOG2036 consensus Predicted P-loop ATPase fused to an acetyltransferase [General function prediction only] Back     alignment and domain information
>TIGR00678 holB DNA polymerase III, delta' subunit Back     alignment and domain information
>PRK10865 protein disaggregation chaperone; Provisional Back     alignment and domain information
>PF01480 PWI: PWI domain; InterPro: IPR002483 The PWI domain, named after a highly conserved PWI tri-peptide located within its N-terminal region, is a ~80 amino acid module, which is found either at the N terminus or at the C terminus of eukaryotic proteins involved in pre-mRNA processing [] Back     alignment and domain information
>PRK14087 dnaA chromosomal replication initiation protein; Provisional Back     alignment and domain information
>PRK14953 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PF00437 T2SE: Type II/IV secretion system protein; InterPro: IPR001482 A number of bacterial proteins, some of which are involved in a general secretion pathway (GSP) for the export of proteins (also called the type II pathway) belong to this group [, ] Back     alignment and domain information
>PRK13851 type IV secretion system protein VirB11; Provisional Back     alignment and domain information
>PRK11823 DNA repair protein RadA; Provisional Back     alignment and domain information
>PRK10919 ATP-dependent DNA helicase Rep; Provisional Back     alignment and domain information
>PRK06067 flagellar accessory protein FlaH; Validated Back     alignment and domain information
>PRK07940 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>KOG2373 consensus Predicted mitochondrial DNA helicase twinkle [Replication, recombination and repair] Back     alignment and domain information
>PF01637 Arch_ATPase: Archaeal ATPase; InterPro: IPR011579 This domain has been found in a number of bacterial and archaeal proteins, all of which contain a conserved P-loop motif that is involved in binding ATP Back     alignment and domain information
>PRK08533 flagellar accessory protein FlaH; Reviewed Back     alignment and domain information
>COG2256 MGS1 ATPase related to the helicase subunit of the Holliday junction resolvase [DNA replication, recombination, and repair] Back     alignment and domain information
>TIGR02868 CydC thiol reductant ABC exporter, CydC subunit Back     alignment and domain information
>PRK14959 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PF00931 NB-ARC: NB-ARC domain; InterPro: IPR002182 This is the NB-ARC domain, a novel signalling motif found in bacteria and eukaryotes, shared by plant resistance gene products and regulators of cell death in animals [] Back     alignment and domain information
>PRK12422 chromosomal replication initiation protein; Provisional Back     alignment and domain information
>PRK14950 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>COG3973 Superfamily I DNA and RNA helicases [General function prediction only] Back     alignment and domain information
>PRK13894 conjugal transfer ATPase TrbB; Provisional Back     alignment and domain information
>PRK05896 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PTZ00293 thymidine kinase; Provisional Back     alignment and domain information
>cd01393 recA_like RecA is a bacterial enzyme which has roles in homologous recombination, DNA repair, and the induction of the SOS response Back     alignment and domain information
>cd03282 ABC_MSH4_euk MutS4 homolog in eukaryotes Back     alignment and domain information
>PF13177 DNA_pol3_delta2: DNA polymerase III, delta subunit; PDB: 1NJF_B 3GLG_G 1XXH_I 1NJG_A 3GLF_B 3GLI_G 1IQP_E 2GNO_A 1SXJ_E 1A5T_A Back     alignment and domain information
>COG4962 CpaF Flp pilus assembly protein, ATPase CpaF [Intracellular trafficking and secretion] Back     alignment and domain information
>PF03354 Terminase_1: Phage Terminase ; InterPro: IPR005021 This entry is represented by Lactococcus phage bIL285, Orf41 (terminase) Back     alignment and domain information
>PRK14971 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK13900 type IV secretion system ATPase VirB11; Provisional Back     alignment and domain information
>KOG3938 consensus RGS-GAIP interacting protein GIPC, contains PDZ domain [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PRK08451 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK13342 recombination factor protein RarA; Reviewed Back     alignment and domain information
>TIGR02688 conserved hypothetical protein TIGR02688 Back     alignment and domain information
>PRK14954 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14088 dnaA chromosomal replication initiation protein; Provisional Back     alignment and domain information
>TIGR01074 rep ATP-dependent DNA helicase Rep Back     alignment and domain information
>COG1119 ModF ABC-type molybdenum transport system, ATPase component/photorepair protein PhrA [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK11054 helD DNA helicase IV; Provisional Back     alignment and domain information
>cd01130 VirB11-like_ATPase Type IV secretory pathway component VirB11, and related ATPases Back     alignment and domain information
>cd01131 PilT Pilus retraction ATPase PilT Back     alignment and domain information
>PRK05563 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>COG4555 NatA ABC-type Na+ transport system, ATPase component [Energy production and conversion / Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK14086 dnaA chromosomal replication initiation protein; Provisional Back     alignment and domain information
>COG2805 PilT Tfp pilus assembly protein, pilus retraction ATPase PilT [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>PHA00729 NTP-binding motif containing protein Back     alignment and domain information
>TIGR01547 phage_term_2 phage terminase, large subunit, PBSX family Back     alignment and domain information
>COG1435 Tdk Thymidine kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>COG1474 CDC6 Cdc6-related protein, AAA superfamily ATPase [DNA replication, recombination, and repair / Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd03239 ABC_SMC_head The structural maintenance of chromosomes (SMC) proteins are essential for successful chromosome transmission during replication and segregation of the genome in all organisms Back     alignment and domain information
>cd01125 repA Hexameric Replicative Helicase RepA Back     alignment and domain information
>KOG0151 consensus Predicted splicing regulator, contains RRM, SWAP and RPR domains [General function prediction only] Back     alignment and domain information
>COG1702 PhoH Phosphate starvation-inducible protein PhoH, predicted ATPase [Signal transduction mechanisms] Back     alignment and domain information
>PF03266 NTPase_1: NTPase; InterPro: IPR004948 This entry represents a family of nucleoside-triphosphatases which have activity towards ATP, GTP, CTP, TTP and UTP and may hydrolyse nucleoside diphosphates with lower efficiency [] Back     alignment and domain information
>TIGR02397 dnaX_nterm DNA polymerase III, subunit gamma and tau Back     alignment and domain information
>PRK14948 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>cd03215 ABC_Carb_Monos_II This family represents domain II of the carbohydrate uptake proteins that transport only monosaccharides (Monos) Back     alignment and domain information
>PF01443 Viral_helicase1: Viral (Superfamily 1) RNA helicase; InterPro: IPR000606 This entry includes RNA and DNA helicases Back     alignment and domain information
>COG0470 HolB ATPase involved in DNA replication [DNA replication, recombination, and repair] Back     alignment and domain information
>cd03213 ABCG_EPDR ABCG transporters are involved in eye pigment (EP) precursor transport, regulation of lipid-trafficking mechanisms, and pleiotropic drug resistance (DR) Back     alignment and domain information
>TIGR02858 spore_III_AA stage III sporulation protein AA Back     alignment and domain information
>TIGR02012 tigrfam_recA protein RecA Back     alignment and domain information
>PRK14970 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>COG3267 ExeA Type II secretory pathway, component ExeA (predicted ATPase) [Intracellular trafficking and secretion] Back     alignment and domain information
>COG1127 Ttg2A ABC-type transport system involved in resistance to organic solvents, ATPase component [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>cd01121 Sms Sms (bacterial radA) DNA repair protein Back     alignment and domain information
>KOG0780 consensus Signal recognition particle, subunit Srp54 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0058 consensus Peptide exporter, ABC superfamily [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PRK13695 putative NTPase; Provisional Back     alignment and domain information
>PRK13541 cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>cd03233 ABC_PDR_domain1 The pleiotropic drug resistance (PDR) family of ATP-binding cassette (ABC) transporters Back     alignment and domain information
>TIGR01075 uvrD DNA helicase II Back     alignment and domain information
>PRK00440 rfc replication factor C small subunit; Reviewed Back     alignment and domain information
>PRK11174 cysteine/glutathione ABC transporter membrane/ATP-binding component; Reviewed Back     alignment and domain information
>PRK04841 transcriptional regulator MalT; Provisional Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query1176
3kx2_B767 Crystal Structure Of Prp43p In Complex With Adp Len 0.0
2xau_A773 Crystal Structure Of The Prp43p Deah-Box Rna Helica 0.0
3i4u_A270 Crystal Structure Analysis Of A Helicase Associated 1e-102
3llm_A235 Crystal Structure Analysis Of A Rna Helicase Length 1e-31
2eqs_A103 Solution Structure Of The S1 Rna Binding Domain Of 2e-17
4aim_A726 Crystal Structure Of C. Crescentus Pnpase Bound To 4e-13
4am3_A717 Crystal Structure Of C. Crescentus Pnpase Bound To 5e-13
4aid_A726 Crystal Structure Of C. Crescentus Pnpase Bound To 6e-13
3cdi_A723 Crystal Structure Of E. Coli Pnpase Length = 723 3e-10
2cqo_A119 Solution Structure Of The S1 Rna Binding Domain Of 7e-10
1sro_A76 S1 Rna Binding Domain, Nmr, 20 Structures Length = 2e-09
3aev_A275 Crystal Structure Of AEIF2ALPHA-Adim2p-Rrna Complex 2e-07
1yz6_A274 Crystal Structure Of Intact Alpha Subunit Of Aif2 F 2e-07
2aho_B266 Structure Of The Archaeal Initiation Factor Eif2 Al 4e-04
>pdb|3KX2|B Chain B, Crystal Structure Of Prp43p In Complex With Adp Length = 767 Back     alignment and structure 
Iteration: 1

 Score =  676 bits (1744), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 352/733 (48%), Positives = 494/733 (67%), Gaps = 33/733 (4%)
Query: 460  IPKDLNRPWEDPMPETGERHLAQELRGVGLSAYDMPEWKKDAFGKALTFGQRS----KLS 515
            I ++L++    P  E    H A E +G+        E +K   GK   F  R      + 
Sbjct: 26   IAEELSKQHPLPSEEPLVHHDAGEFKGLQRHHTSAEEAQKLEDGKINPFTGREFTPKYVD 85
Query: 516  IQEQRQSLPIYKLKKELIQAVHDNQVLVVIGETGSGKTTQVTQYLA--EAGYTTRGKIGC 573
            I + R+ LP++  + E ++   +NQ++V +GETGSGKTTQ+ Q++   E  +    ++ C
Sbjct: 86   ILKIRRELPVHAQRDEFLKLYQNNQIMVFVGETGSGKTTQIPQFVLFDEMPHLENTQVAC 145
Query: 574  TQPRRVAAMSVAKRVAEEFGCRLGEEVGYAIRFEDCTGPDTVIKYMTDGMLLREILIDDN 633
            TQPRRVAAMSVA+RVAEE   +LGEEVGY+IRFE+ T   T++KYMTDGMLLRE + D +
Sbjct: 146  TQPRRVAAMSVAQRVAEEMDVKLGEEVGYSIRFENKTSNKTILKYMTDGMLLREAMEDHD 205
Query: 634  LSQYSVIMLDEAHERTIHTDVLFGLLKQLVKRRPDLRLIVTSATLDAEKFSGYFFNCNIF 693
            LS+YS I+LDEAHERT+ TD+L GLLKQ+VKRRPDL++I+ SATLDAEKF  YF +  + 
Sbjct: 206  LSRYSCIILDEAHERTLATDILMGLLKQVVKRRPDLKIIIMSATLDAEKFQRYFNDAPLL 265
Query: 694  TIPGRTFPVEILYTKQPESDYLDASLITVLQIHLTEPEGDILLFLTGQEEIDFACQSL-- 751
             +PGRT+PVE+ YT + + DYLD+++ TVLQIH TE  GDILLFLTG++EI+ A + +  
Sbjct: 266  AVPGRTYPVELYYTPEFQRDYLDSAIRTVLQIHATEEAGDILLFLTGEDEIEDAVRKISL 325
Query: 752  ----YERMKGLGKNVPELIILPVYSALPSEMQSRIFDPAP------PGKRKVVVATNIAE 801
                  R +G G     L + P+Y +LP   Q RIF+PAP      PG RKVV++TNIAE
Sbjct: 326  EGDQLVREEGCGP----LSVYPLYGSLPPHQQQRIFEPAPESHNGRPG-RKVVISTNIAE 380
Query: 802  ASLTIDGIFYVIDPGFAKQNVYNPKQGLDSLVITPISQASAKQRAGRAGRTGPGKCYRLY 861
             SLTIDGI YV+DPGF+KQ VYNP+  ++SL+++PIS+ASA+QRAGRAGRT PGKC+RLY
Sbjct: 381  TSLTIDGIVYVVDPGFSKQKVYNPRIRVESLLVSPISKASAQQRAGRAGRTRPGKCFRLY 440
Query: 862  TESAYRNEMSPTSIPEIQRINLGFTTLTMKAMGINDLLSFDFMDPPSPQALISAMEQLYS 921
            TE A++ E+   S PEI R NL  T L +K +GI+DL+ FDFMDPP+P+ ++ A+E+L  
Sbjct: 441  TEEAFQKELIEQSYPEILRSNLSSTVLELKKLGIDDLVHFDFMDPPAPETMMRALEELNY 500
Query: 922  LGALDEEGLLTKLGRKMAEFPLDPPLSKMLLASVDLGCSDEILTIIAMIQTGNIFYRPRE 981
            L  LD+EG LT LGR  ++FPLDP L+ ML+ S +  CS EILTI+AM+   N+F RP +
Sbjct: 501  LACLDDEGNLTPLGRLASQFPLDPMLAVMLIGSFEFQCSQEILTIVAMLSVPNVFIRPTK 560
Query: 982  KQAQADQKRAKFFQPEGDHLTLLAVYEAWKAKNFS----GPWCFENFVQSRSLRRAQDVR 1037
             + +AD  +  F  P+GDH+TLL VY A+K+          WC ++++  RSL  A ++R
Sbjct: 561  DKKRADDAKNIFAHPDGDHITLLNVYHAFKSDEAYEYGIHKWCRDHYLNYRSLSAADNIR 620
Query: 1038 KQLLSIMDKYKLDVMS----AGKNFTKIRKAITAGFFFHAARK-DPQEGYRTLVENQPVY 1092
             QL  +M++Y L++ +    + K F  IRKA+ +GFF   A+K    +GY T+ +NQ V 
Sbjct: 621  SQLERLMNRYNLELNTTDYESPKYFDNIRKALASGFFMQVAKKRSGAKGYITVKDNQDVL 680
Query: 1093 IHPSSALFQRQPDWVIYHELVMTTKEYMREVTVIDPKWLVDLAPRFFKVADPTKMSKRKR 1152
            IHPS+ L     +WVIY+E V+T+K Y+R VT + P+WL+++AP ++ +++  K   +  
Sbjct: 681  IHPSTVL-GHDAEWVIYNEFVLTSKNYIRTVTSVRPEWLIEIAPAYYDLSNFQKGDVKLS 739
Query: 1153 QERIEPLYDRYHE 1165
             ERI+   DR +E
Sbjct: 740  LERIKEKVDRLNE 752
>pdb|2XAU|A Chain A, Crystal Structure Of The Prp43p Deah-Box Rna Helicase In Complex With Adp Length = 773 Back     alignment and structure
>pdb|3I4U|A Chain A, Crystal Structure Analysis Of A Helicase Associated Domain Length = 270 Back     alignment and structure
>pdb|3LLM|A Chain A, Crystal Structure Analysis Of A Rna Helicase Length = 235 Back     alignment and structure
>pdb|2EQS|A Chain A, Solution Structure Of The S1 Rna Binding Domain Of Human Atp-Dependent Rna Helicase Dhx8 Length = 103 Back     alignment and structure
>pdb|4AIM|A Chain A, Crystal Structure Of C. Crescentus Pnpase Bound To Rnase E Recognition Peptide Length = 726 Back     alignment and structure
>pdb|4AM3|A Chain A, Crystal Structure Of C. Crescentus Pnpase Bound To Rna Length = 717 Back     alignment and structure
>pdb|4AID|A Chain A, Crystal Structure Of C. Crescentus Pnpase Bound To Rnase E Recognition Peptide Length = 726 Back     alignment and structure
>pdb|3CDI|A Chain A, Crystal Structure Of E. Coli Pnpase Length = 723 Back     alignment and structure
>pdb|2CQO|A Chain A, Solution Structure Of The S1 Rna Binding Domain Of Human Hypothetical Protein Flj11067 Length = 119 Back     alignment and structure
>pdb|1SRO|A Chain A, S1 Rna Binding Domain, Nmr, 20 Structures Length = 76 Back     alignment and structure
>pdb|3AEV|A Chain A, Crystal Structure Of AEIF2ALPHA-Adim2p-Rrna Complex From Pyrococcus Horikoshii Ot3 Length = 275 Back     alignment and structure
>pdb|1YZ6|A Chain A, Crystal Structure Of Intact Alpha Subunit Of Aif2 From Pyrococcus Abyssi Length = 274 Back     alignment and structure
>pdb|2AHO|B Chain B, Structure Of The Archaeal Initiation Factor Eif2 Alpha- Gamma Heterodimer From Sulfolobus Solfataricus Complexed With Gdpnp Length = 266 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query1176
2xau_A773 PRE-mRNA-splicing factor ATP-dependent RNA helica; 0.0
3i4u_A270 ATP-dependent RNA helicase DHX8; splicing, ATP-bin 1e-167
2v6i_A431 RNA helicase; membrane, hydrolase, transmembrane, 1e-135
2z83_A459 Helicase/nucleoside triphosphatase; hydrolase, mem 1e-122
2wv9_A673 Flavivirin protease NS2B regulatory subunit, FLAV 1e-116
3llm_A235 ATP-dependent RNA helicase A; alpha-beta-alpha, st 1e-114
2jlq_A451 Serine protease subunit NS3; ribonucleoprotein, nu 1e-109
3o8b_A666 HCV NS3 protease/helicase; ntpase, RNA, translocat 1e-104
2whx_A618 Serine protease/ntpase/helicase NS3; transcription 1e-99
1yks_A440 Genome polyprotein [contains: flavivirin protease 1e-92
2eqs_A103 ATP-dependent RNA helicase DHX8; S1 domain, OB-fol 2e-37
2cqo_A119 Nucleolar protein of 40 kDa; S1 domain, OB-fold, s 7e-32
4aid_A726 Polyribonucleotide nucleotidyltransferase; transfe 2e-21
3cdi_A723 Polynucleotide phosphorylase; mRNA turnover, RNAse 4e-21
2k4k_A130 GSP13, general stress protein 13; cytoplasm, stres 9e-20
1e3p_A757 Guanosine pentaphosphate synthetase; polyribonucle 8e-19
3aev_A275 Translation initiation factor 2 subunit alpha; pro 9e-19
2a19_A175 EIF-2- alpha, eukaryotic translation initiation fa 2e-17
3cw2_C266 Translation initiation factor 2 subunit alpha; AIF 2e-17
2k52_A80 Uncharacterized protein MJ1198; metal-binding, zin 3e-17
1kl9_A182 Eukaryotic translation initiation factor 2 subuni; 3e-17
1q8k_A308 Eukaryotic translation initiation factor 2 subunit 3e-15
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 3e-15
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-08
2khj_A109 30S ribosomal protein S1; OB fold, acetylation, ph 9e-15
2khi_A115 30S ribosomal protein S1; acetylation, phosphoprot 1e-14
3bzc_A785 TEX; helix-turn-helix, helix-hairpin-helix, S1 dom 3e-10
3pgw_S437 U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM 4e-10
3pgw_S437 U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM 1e-09
3pgw_S437 U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM 1e-09
3pgw_S437 U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM 2e-09
3pgw_S437 U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM 6e-09
3pgw_S437 U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM 7e-09
3pgw_S437 U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM 8e-09
3pgw_S437 U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM 9e-09
3pgw_S437 U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM 1e-08
3pgw_S437 U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM 5e-08
3pgw_S437 U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM 7e-08
3pgw_S437 U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM 9e-08
3pgw_S437 U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM 1e-07
3pgw_S437 U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM 1e-07
3pgw_S437 U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM 9e-06
3psf_A1030 Transcription elongation factor SPT6; nucleus; 2.5 2e-06
3psi_A1219 Transcription elongation factor SPT6; nucleus; 3.3 2e-06
1go3_E187 DNA-directed RNA polymerase subunit E; transferase 1e-04
4ayb_E180 DNA-directed RNA polymerase; transferase, multi-su 1e-04
2p6r_A702 Afuhel308 helicase; protein-DNA complex, SF2 helic 8e-04
>2xau_A PRE-mRNA-splicing factor ATP-dependent RNA helica; hydrolase, ribosome biogenesis, ATPase, ATP-binding, OB-fold; HET: ADP; 1.90A {Saccharomyces cerevisiae} PDB: 3kx2_B* Length = 773 Back     alignment and structure
 Score = 1228 bits (3179), Expect = 0.0
 Identities = 351/767 (45%), Positives = 497/767 (64%), Gaps = 27/767 (3%)

Query: 431  LSRAAALQSALIKERREVREQQQRTMLDSIPKDLNRPWEDPMPETGERHLAQELRGVGLS 490
            +       S           +Q   + + + K    P E+P+      H A E +G+   
Sbjct: 1    MGSKRRFSSEHPDPVETSIPEQAAEIAEELSKQHPLPSEEPLV----HHDAGEFKGLQRH 56

Query: 491  AYDMPEWKKDAFGKALTFGQR----SKLSIQEQRQSLPIYKLKKELIQAVHDNQVLVVIG 546
                 E +K   GK   F  R      + I + R+ LP++  + E ++   +NQ++V +G
Sbjct: 57   HTSAEEAQKLEDGKINPFTGREFTPKYVDILKIRRELPVHAQRDEFLKLYQNNQIMVFVG 116

Query: 547  ETGSGKTTQVTQYLA--EAGYTTRGKIGCTQPRRVAAMSVAKRVAEEFGCRLGEEVGYAI 604
            ETGSGKTTQ+ Q++   E  +    ++ CTQPRRVAAMSVA+RVAEE   +LGEEVGY+I
Sbjct: 117  ETGSGKTTQIPQFVLFDEMPHLENTQVACTQPRRVAAMSVAQRVAEEMDVKLGEEVGYSI 176

Query: 605  RFEDCTGPDTVIKYMTDGMLLREILIDDNLSQYSVIMLDEAHERTIHTDVLFGLLKQLVK 664
            RFE+ T   T++KYMTDGMLLRE + D +LS+YS I+LDEAHERT+ TD+L GLLKQ+VK
Sbjct: 177  RFENKTSNKTILKYMTDGMLLREAMEDHDLSRYSCIILDEAHERTLATDILMGLLKQVVK 236

Query: 665  RRPDLRLIVTSATLDAEKFSGYFFNCNIFTIPGRTFPVEILYTKQPESDYLDASLITVLQ 724
            RRPDL++I+ SATLDAEKF  YF +  +  +PGRT+PVE+ YT + + DYLD+++ TVLQ
Sbjct: 237  RRPDLKIIIMSATLDAEKFQRYFNDAPLLAVPGRTYPVELYYTPEFQRDYLDSAIRTVLQ 296

Query: 725  IHLTEPEGDILLFLTGQEEIDFACQSLYERMKGLGK--NVPELIILPVYSALPSEMQSRI 782
            IH TE  GDILLFLTG++EI+ A + +      L +      L + P+Y +LP   Q RI
Sbjct: 297  IHATEEAGDILLFLTGEDEIEDAVRKISLEGDQLVREEGCGPLSVYPLYGSLPPHQQQRI 356

Query: 783  FDPAPPGK-----RKVVVATNIAEASLTIDGIFYVIDPGFAKQNVYNPKQGLDSLVITPI 837
            F+PAP        RKVV++TNIAE SLTIDGI YV+DPGF+KQ VYNP+  ++SL+++PI
Sbjct: 357  FEPAPESHNGRPGRKVVISTNIAETSLTIDGIVYVVDPGFSKQKVYNPRIRVESLLVSPI 416

Query: 838  SQASAKQRAGRAGRTGPGKCYRLYTESAYRNEMSPTSIPEIQRINLGFTTLTMKAMGIND 897
            S+ASA+QRAGRAGRT PGKC+RLYTE A++ E+   S PEI R NL  T L +K +GI+D
Sbjct: 417  SKASAQQRAGRAGRTRPGKCFRLYTEEAFQKELIEQSYPEILRSNLSSTVLELKKLGIDD 476

Query: 898  LLSFDFMDPPSPQALISAMEQLYSLGALDEEGLLTKLGRKMAEFPLDPPLSKMLLASVDL 957
            L+ FDFMDPP+P+ ++ A+E+L  L  LD+EG LT LGR  ++FPLDP L+ ML+ S + 
Sbjct: 477  LVHFDFMDPPAPETMMRALEELNYLACLDDEGNLTPLGRLASQFPLDPMLAVMLIGSFEF 536

Query: 958  GCSDEILTIIAMIQTGNIFYRPREKQAQADQKRAKFFQPEGDHLTLLAVYEAWKAKNFSG 1017
             CS EILTI+AM+   N+F RP + + +AD  +  F  P+GDH+TLL VY A+K+     
Sbjct: 537  QCSQEILTIVAMLSVPNVFIRPTKDKKRADDAKNIFAHPDGDHITLLNVYHAFKSDEAYE 596

Query: 1018 P----WCFENFVQSRSLRRAQDVRKQLLSIMDKYKLDVMSAG----KNFTKIRKAITAGF 1069
                 WC ++++  RSL  A ++R QL  +M++Y L++ +      K F  IRKA+ +GF
Sbjct: 597  YGIHKWCRDHYLNYRSLSAADNIRSQLERLMNRYNLELNTTDYESPKYFDNIRKALASGF 656

Query: 1070 FFHAARKDPQ-EGYRTLVENQPVYIHPSSALFQRQPDWVIYHELVMTTKEYMREVTVIDP 1128
            F   A+K    +GY T+ +NQ V IHPS+ L     +WVIY+E V+T+K Y+R VT + P
Sbjct: 657  FMQVAKKRSGAKGYITVKDNQDVLIHPSTVLG-HDAEWVIYNEFVLTSKNYIRTVTSVRP 715

Query: 1129 KWLVDLAPRFFKVADPTKMSKRKRQERIEPLYDRYHEPNSWRLSKRR 1175
            +WL+++AP ++ +++  K   +   ERI+   DR +E    +  K+ 
Sbjct: 716  EWLIEIAPAYYDLSNFQKGDVKLSLERIKEKVDRLNELKQGKNKKKS 762
>3i4u_A ATP-dependent RNA helicase DHX8; splicing, ATP-binding, hydrolase, mRNA processing, splicing, nucleotide-binding, nucleus, phosphoprotein, SPLI; 2.10A {Homo sapiens} Length = 270 Back     alignment and structure
>2v6i_A RNA helicase; membrane, hydrolase, transmembrane, RNA replication, viral replication, nucleotide-binding; 2.10A {Kokobera virus} PDB: 2v6j_A Length = 431 Back     alignment and structure
>2z83_A Helicase/nucleoside triphosphatase; hydrolase, membrane, nucleotide-binding, RNA replication, transmembrane, viral protein; 1.80A {Japanese encephalitis virus} PDB: 2v8o_A 2qeq_A Length = 459 Back     alignment and structure
>2wv9_A Flavivirin protease NS2B regulatory subunit, FLAV protease NS3 catalytic subunit; nucleotide-binding, capsid protein; 2.75A {Murray valley encephalitis virus} Length = 673 Back     alignment and structure
>3llm_A ATP-dependent RNA helicase A; alpha-beta-alpha, structural genomics, structural genomics consortium, SGC, activator, ATP-binding, DNA-binding; HET: ADP; 2.80A {Homo sapiens} Length = 235 Back     alignment and structure
>2jlq_A Serine protease subunit NS3; ribonucleoprotein, nucleotide-binding, viral nucleoprotein, endoplasmic reticulum, helicase, hydrolase; 1.67A {Dengue virus 4} PDB: 2jly_A* 2jls_A* 2jlu_A 2jlv_A* 2jlw_A 2jlx_A* 2jlz_A* 2jlr_A* 2bmf_A 2bhr_A Length = 451 Back     alignment and structure
>3o8b_A HCV NS3 protease/helicase; ntpase, RNA, translocation, protein-RNA compl protease/ntpase/helicase, hydrolase; 1.95A {Hepatitis c virus} PDB: 3o8c_A* 3o8d_A* 3o8r_A* 4a92_A* 1cu1_A 2zjo_A* 1a1v_A* 1hei_A 3kqn_A* 3kql_A* 3kqu_A* 3kqh_A 3kqk_A 8ohm_A 2f55_A 1jr6_A 1onb_A Length = 666 Back     alignment and structure
>2whx_A Serine protease/ntpase/helicase NS3; transcription, hydrolase, ATP-binding, reticulum, nucleotidyltransferase, multifunctional enzyme; HET: ADP; 2.20A {Dengue virus 4} PDB: 2vbc_A 2wzq_A Length = 618 Back     alignment and structure
>1yks_A Genome polyprotein [contains: flavivirin protease NS3 catalytic subunit]; helicase, flavivirus, DEAD-BOX, ATPase, rtpase, hydrolase; 1.80A {Yellow fever virus} SCOP: c.37.1.14 c.37.1.14 PDB: 1ymf_A* Length = 440 Back     alignment and structure
>2eqs_A ATP-dependent RNA helicase DHX8; S1 domain, OB-fold, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 103 Back     alignment and structure
>2cqo_A Nucleolar protein of 40 kDa; S1 domain, OB-fold, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 119 Back     alignment and structure
>4aid_A Polyribonucleotide nucleotidyltransferase; transferase-peptide complex; 2.60A {Caulobacter vibrioides} PDB: 4aim_A 4am3_A Length = 726 Back     alignment and structure
>3cdi_A Polynucleotide phosphorylase; mRNA turnover, RNAse, RNA degradation, kinase, transferase; 2.60A {Escherichia coli} PDB: 1sro_A Length = 723 Back     alignment and structure
>2k4k_A GSP13, general stress protein 13; cytoplasm, stress response, RNA binding protein; NMR {Bacillus subtilis} Length = 130 Back     alignment and structure
>1e3p_A Guanosine pentaphosphate synthetase; polyribonucleotide transferase, ATP-GTP diphosphotransferase RNA processing, RNA degradation; 2.5A {Streptomyces antibioticus} SCOP: a.4.9.1 b.40.4.5 d.14.1.4 d.14.1.4 d.52.3.1 d.101.1.1 d.101.1.1 PDB: 1e3h_A Length = 757 Back     alignment and structure
>3aev_A Translation initiation factor 2 subunit alpha; proteins-rRNA complex, 16S rRNA, RNA-binding; 2.80A {Pyrococcus horikoshii} PDB: 1yz6_A Length = 275 Back     alignment and structure
>2a19_A EIF-2- alpha, eukaryotic translation initiation factor 2 alpha; transferase, protein biosynthesis, protein synthesis transferase complex; HET: TPO ANP; 2.50A {Saccharomyces cerevisiae} PDB: 2a1a_A* 1q46_A Length = 175 Back     alignment and structure
>3cw2_C Translation initiation factor 2 subunit alpha; AIF2, intact AIF2, initiation factor 2 alpha subunit, initiation factor 2 beta subunit; 2.80A {Sulfolobus solfataricus} PDB: 2aho_B 3v11_B* Length = 266 Back     alignment and structure
>2k52_A Uncharacterized protein MJ1198; metal-binding, zinc, zinc-finger, structural genomics, PSI-2, protein structure initiative; NMR {Methanocaldococcus jannaschii} Length = 80 Back     alignment and structure
>1kl9_A Eukaryotic translation initiation factor 2 subuni; OB fold, helical domain; 1.90A {Homo sapiens} SCOP: a.60.14.1 b.40.4.5 Length = 182 Back     alignment and structure
>1q8k_A Eukaryotic translation initiation factor 2 subunit 1; NMR {Homo sapiens} SCOP: a.60.14.1 b.40.4.5 d.58.51.1 Length = 308 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>2khj_A 30S ribosomal protein S1; OB fold, acetylation, phosphoprotein, ribonucleoprotein, RNA-binding; NMR {Escherichia coli} Length = 109 Back     alignment and structure
>2khi_A 30S ribosomal protein S1; acetylation, phosphoprotein, ribonucleoprotein, RNA-binding; NMR {Escherichia coli} Length = 115 Back     alignment and structure
>3bzc_A TEX; helix-turn-helix, helix-hairpin-helix, S1 domain, YQGF domain, transcription, RNA binding protein; 2.27A {Pseudomonas aeruginosa} SCOP: a.60.2.6 a.60.2.6 a.294.1.1 b.40.4.5 c.55.3.13 PDB: 3bzk_A 2oce_A Length = 785 Back     alignment and structure
>3pgw_S U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 3cw1_K 2l5i_A 2l5j_A* Length = 437 Back     alignment and structure
>3pgw_S U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 3cw1_K 2l5i_A 2l5j_A* Length = 437 Back     alignment and structure
>3pgw_S U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 3cw1_K 2l5i_A 2l5j_A* Length = 437 Back     alignment and structure
>3pgw_S U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 3cw1_K 2l5i_A 2l5j_A* Length = 437 Back     alignment and structure
>3pgw_S U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 3cw1_K 2l5i_A 2l5j_A* Length = 437 Back     alignment and structure
>3pgw_S U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 3cw1_K 2l5i_A 2l5j_A* Length = 437 Back     alignment and structure
>3pgw_S U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 3cw1_K 2l5i_A 2l5j_A* Length = 437 Back     alignment and structure
>3pgw_S U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 3cw1_K 2l5i_A 2l5j_A* Length = 437 Back     alignment and structure
>3pgw_S U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 3cw1_K 2l5i_A 2l5j_A* Length = 437 Back     alignment and structure
>3pgw_S U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 3cw1_K 2l5i_A 2l5j_A* Length = 437 Back     alignment and structure
>3pgw_S U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 3cw1_K 2l5i_A 2l5j_A* Length = 437 Back     alignment and structure
>3pgw_S U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 3cw1_K 2l5i_A 2l5j_A* Length = 437 Back     alignment and structure
>3pgw_S U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 3cw1_K 2l5i_A 2l5j_A* Length = 437 Back     alignment and structure
>3pgw_S U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 3cw1_K 2l5i_A 2l5j_A* Length = 437 Back     alignment and structure
>3pgw_S U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 3cw1_K 2l5i_A 2l5j_A* Length = 437 Back     alignment and structure
>3psf_A Transcription elongation factor SPT6; nucleus; 2.59A {Saccharomyces cerevisiae} Length = 1030 Back     alignment and structure
>3psi_A Transcription elongation factor SPT6; nucleus; 3.30A {Saccharomyces cerevisiae} Length = 1219 Back     alignment and structure
>1go3_E DNA-directed RNA polymerase subunit E; transferase, transferase, transcription; 1.75A {Methanococcus jannaschii} SCOP: b.40.4.5 d.230.1.1 Length = 187 Back     alignment and structure
>4ayb_E DNA-directed RNA polymerase; transferase, multi-subunit, transcription; 3.20A {Sulfolobus shibatae} PDB: 2y0s_E 4b1o_E 4b1p_T 2waq_E 2wb1_E 2pmz_E 3hkz_E Length = 180 Back     alignment and structure
>2p6r_A Afuhel308 helicase; protein-DNA complex, SF2 helicase, archaeal helicase, DNA repair,, DNA binding protein/DNA complex; 3.00A {Archaeoglobus fulgidus} SCOP: a.4.5.43 a.289.1.2 c.37.1.19 c.37.1.19 PDB: 2p6u_A Length = 702 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query1176
2xau_A773 PRE-mRNA-splicing factor ATP-dependent RNA helica; 100.0
3i4u_A270 ATP-dependent RNA helicase DHX8; splicing, ATP-bin 100.0
2va8_A715 SSO2462, SKI2-type helicase; hydrolase, DNA repair 100.0
2p6r_A702 Afuhel308 helicase; protein-DNA complex, SF2 helic 100.0
2zj8_A720 DNA helicase, putative SKI2-type helicase; RECA fo 100.0
3eiq_A414 Eukaryotic initiation factor 4A-I; PDCD4, anti-onc 100.0
4f92_B1724 U5 small nuclear ribonucleoprotein 200 kDa helica; 100.0
3l9o_A 1108 ATP-dependent RNA helicase DOB1; REC-A fold, winge 100.0
4f92_B 1724 U5 small nuclear ribonucleoprotein 200 kDa helica; 100.0
2db3_A434 ATP-dependent RNA helicase VASA; DEAD-BOX, protein 100.0
3fht_A412 ATP-dependent RNA helicase DDX19B; DBP5, DEAD-box 100.0
3pey_A395 ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, A 100.0
3o8b_A666 HCV NS3 protease/helicase; ntpase, RNA, translocat 100.0
2z83_A459 Helicase/nucleoside triphosphatase; hydrolase, mem 100.0
2jlq_A451 Serine protease subunit NS3; ribonucleoprotein, nu 100.0
1s2m_A400 Putative ATP-dependent RNA helicase DHH1; ATP-bind 100.0
4a4z_A 997 Antiviral helicase SKI2; hydrolase, ATPase, mRNA d 100.0
2j0s_A410 ATP-dependent RNA helicase DDX48; mRNA processing, 100.0
2i4i_A417 ATP-dependent RNA helicase DDX3X; DEAD, structural 100.0
2v1x_A591 ATP-dependent DNA helicase Q1; DNA strand annealin 100.0
1hv8_A367 Putative ATP-dependent RNA helicase MJ0669; RNA-bi 100.0
2v6i_A431 RNA helicase; membrane, hydrolase, transmembrane, 100.0
3fmp_B479 ATP-dependent RNA helicase DDX19B; nuclear porin, 100.0
1xti_A391 Probable ATP-dependent RNA helicase P47; alpha-bet 100.0
2whx_A618 Serine protease/ntpase/helicase NS3; transcription 100.0
3i5x_A563 ATP-dependent RNA helicase MSS116; protein-RNA com 100.0
2xgj_A 1010 ATP-dependent RNA helicase DOB1; hydrolase-RNA com 100.0
3sqw_A579 ATP-dependent RNA helicase MSS116, mitochondrial; 100.0
2z0m_A337 337AA long hypothetical ATP-dependent RNA helicase 100.0
1fuu_A394 Yeast initiation factor 4A; IF4A, helicase, DEAD-b 100.0
3rc3_A677 ATP-dependent RNA helicase SUPV3L1, mitochondrial; 100.0
2ykg_A696 Probable ATP-dependent RNA helicase DDX58; hydrola 100.0
1oyw_A523 RECQ helicase, ATP-dependent DNA helicase; winged 100.0
3fho_A508 ATP-dependent RNA helicase DBP5; mRNA export, ATPa 100.0
1yks_A440 Genome polyprotein [contains: flavivirin protease 100.0
3oiy_A414 Reverse gyrase helicase domain; topoisomerase, DNA 100.0
2wv9_A673 Flavivirin protease NS2B regulatory subunit, FLAV 100.0
4a2p_A556 RIG-I, retinoic acid inducible protein I; hydrolas 100.0
3tbk_A555 RIG-I helicase domain; DECH helicase, ATP binding, 100.0
1wp9_A494 ATP-dependent RNA helicase, putative; ATPase, DNA 100.0
4gl2_A699 Interferon-induced helicase C domain-containing P; 100.0
4a2q_A797 RIG-I, retinoic acid inducible protein I; hydrolas 99.97
4a2w_A936 RIG-I, retinoic acid inducible protein I; hydrolas 99.97
1gm5_A780 RECG; helicase, replication restart; HET: DNA ADP; 99.97
2eyq_A1151 TRCF, transcription-repair coupling factor; MFD, S 99.97
4ddu_A 1104 Reverse gyrase; topoisomerase, DNA supercoiling, a 99.97
1gku_B 1054 Reverse gyrase, TOP-RG; topoisomerase, DNA superco 99.96
2oca_A510 DAR protein, ATP-dependent DNA helicase UVSW; ATP- 99.96
2fwr_A472 DNA repair protein RAD25; DNA unwinding, XPB, DNA 99.96
1tf5_A844 Preprotein translocase SECA subunit; ATPase, helic 99.95
3llm_A235 ATP-dependent RNA helicase A; alpha-beta-alpha, st 99.95
2fsf_A853 Preprotein translocase SECA subunit; ATPase, DNA-R 99.94
3h1t_A590 Type I site-specific restriction-modification syst 99.94
1nkt_A922 Preprotein translocase SECA 1 subunit; preprotein 99.94
3eaq_A212 Heat resistant RNA dependent ATPase; DEAD box RNA 99.91
3dmq_A968 RNA polymerase-associated protein RAPA; SWF2/SNF2, 99.89
3i32_A300 Heat resistant RNA dependent ATPase; RNA helicase, 99.89
2w00_A1038 HSDR, R.ECOR124I; ATP-binding, DNA-binding, restri 99.88
1z63_A500 Helicase of the SNF2/RAD54 hamily; protein-DNA com 99.86
3jux_A822 Protein translocase subunit SECA; protein transloc 99.85
1c4o_A664 DNA nucleotide excision repair enzyme UVRB; uvrabc 99.81
1z3i_X644 Similar to RAD54-like; recombination ATPase helica 99.8
3mwy_W800 Chromo domain-containing protein 1; SWI2/SNF2 ATPa 99.79
3iuy_A228 Probable ATP-dependent RNA helicase DDX53; REC-A-l 99.78
2d7d_A661 Uvrabc system protein B; helicase, protein-DNA-ADP 99.78
3fmo_B300 ATP-dependent RNA helicase DDX19B; nuclear porin, 99.77
3ber_A249 Probable ATP-dependent RNA helicase DDX47; DEAD, A 99.76
1qde_A224 EIF4A, translation initiation factor 4A; DEAD box 99.76
3ly5_A262 ATP-dependent RNA helicase DDX18; alpha-beta, stru 99.76
1vec_A206 ATP-dependent RNA helicase P54; DEAD-box protein, 99.76
3dkp_A245 Probable ATP-dependent RNA helicase DDX52; DEAD, A 99.76
3bor_A237 Human initiation factor 4A-II; translation initiat 99.76
2pl3_A236 Probable ATP-dependent RNA helicase DDX10; DEAD, s 99.75
2rb4_A175 ATP-dependent RNA helicase DDX25; rossmann fold, s 99.75
2hjv_A163 ATP-dependent RNA helicase DBPA; parallel alpha-be 99.75
3fe2_A242 Probable ATP-dependent RNA helicase DDX5; DEAD, AD 99.75
1q0u_A219 Bstdead; DEAD protein, RNA binding protein; 1.85A 99.75
2oxc_A230 Probable ATP-dependent RNA helicase DDX20; DEAD, s 99.75
2gxq_A207 Heat resistant RNA dependent ATPase; RNA helicase, 99.75
1fuk_A165 Eukaryotic initiation factor 4A; helicase, DEAD-bo 99.74
1t5i_A172 C_terminal domain of A probable ATP-dependent RNA 99.73
1t6n_A220 Probable ATP-dependent RNA helicase; RECA-like fol 99.73
2jgn_A185 DBX, DDX3, ATP-dependent RNA helicase DDX3X; phosp 99.72
1wrb_A253 DJVLGB; RNA helicase, DEAD BOX, VASA, structural g 99.71
2p6n_A191 ATP-dependent RNA helicase DDX41; DEAD, structural 99.71
2yjt_D170 ATP-dependent RNA helicase SRMB, regulator of ribo 99.5
3b6e_A216 Interferon-induced helicase C domain-containing P; 99.65
2ipc_A 997 Preprotein translocase SECA subunit; nucleotide bi 99.65
2eqs_A103 ATP-dependent RNA helicase DHX8; S1 domain, OB-fol 99.6
2cqo_A119 Nucleolar protein of 40 kDa; S1 domain, OB-fold, s 99.57
2vl7_A540 XPD; helicase, unknown function; 2.25A {Sulfolobus 99.55
1rif_A282 DAR protein, DNA helicase UVSW; bacteriophage, REC 99.53
1kl9_A182 Eukaryotic translation initiation factor 2 subuni; 99.53
1luz_A88 Protein K3, protein K2; stranded anti-parallel bet 99.51
2a19_A175 EIF-2- alpha, eukaryotic translation initiation fa 99.49
2fz4_A237 DNA repair protein RAD25; RECA-like domain, DNA da 99.43
2khi_A115 30S ribosomal protein S1; acetylation, phosphoprot 99.43
2k4k_A130 GSP13, general stress protein 13; cytoplasm, stres 99.39
3crv_A551 XPD/RAD3 related DNA helicase; XPD helicase DNA re 99.35
2k52_A80 Uncharacterized protein MJ1198; metal-binding, zin 99.33
2khj_A109 30S ribosomal protein S1; OB fold, acetylation, ph 99.33
1q8k_A308 Eukaryotic translation initiation factor 2 subunit 99.32
3aev_A275 Translation initiation factor 2 subunit alpha; pro 99.29
1z5z_A271 Helicase of the SNF2/RAD54 family; hydrolase, reco 99.21
3cw2_C266 Translation initiation factor 2 subunit alpha; AIF 99.19
4aid_A726 Polyribonucleotide nucleotidyltransferase; transfe 99.17
3cdi_A723 Polynucleotide phosphorylase; mRNA turnover, RNAse 99.14
1e3p_A757 Guanosine pentaphosphate synthetase; polyribonucle 98.99
4a15_A620 XPD helicase, ATP-dependent DNA helicase TA0057; h 98.95
3psi_A1219 Transcription elongation factor SPT6; nucleus; 3.3 98.9
1wi5_A119 RRP5 protein homolog; S1 domain, OB-fold, structur 98.9
4ayb_E180 DNA-directed RNA polymerase; transferase, multi-su 98.89
1go3_E187 DNA-directed RNA polymerase subunit E; transferase 98.89
3bzc_A785 TEX; helix-turn-helix, helix-hairpin-helix, S1 dom 98.84
2nn6_I209 3'-5' exoribonuclease CSL4 homolog; RNA, exosome, 98.81
3m7n_A179 Putative uncharacterized protein AF_0206; exosome, 98.75
3psf_A1030 Transcription elongation factor SPT6; nucleus; 2.5 98.75
3go5_A285 Multidomain protein with S1 RNA-binding domains; s 98.72
1y14_B171 B16, RPB7, DNA-directed RNA polymerase II 19 kDa p 98.69
2b8k_G215 B16, DNA-directed RNA polymerase II 19 kDa polypep 98.68
2c35_B172 Human RPB7, DNA-directed RNA polymerase II 19 kDa 98.65
2je6_I251 RRP4, exosome complex RNA-binding protein 1; nucle 98.57
3h0g_G172 DNA-directed RNA polymerase II subunit RPB7; trans 98.53
2ba0_A229 Archeal exosome RNA binding protein RRP4; RNAse PH 98.46
2z0s_A235 Probable exosome complex RNA-binding protein 1; al 98.41
3go5_A285 Multidomain protein with S1 RNA-binding domains; s 98.32
1w36_D608 RECD, exodeoxyribonuclease V alpha chain; recombin 98.14
2ckz_B218 C25, DNA-directed RNA polymerase III 25 KD polypep 98.07
2bx2_L517 Ribonuclease E, RNAse E; RNA-binding, RNA turnover 98.04
3ayh_B203 DNA-directed RNA polymerase III subunit RPC8; tran 98.04
2id0_A644 Exoribonuclease 2; RNAse, exonuclease, hydrolyase, 97.98
2bh8_A101 1B11; transcription, molecular evolution, unique a 97.77
3e1s_A574 Exodeoxyribonuclease V, subunit RECD; alpha and be 97.75
2wp8_J977 Exosome complex exonuclease DIS3; nucleus, hydrola 97.75
4b3f_X646 DNA-binding protein smubp-2; hydrolase, helicase; 97.63
3upu_A459 ATP-dependent DNA helicase DDA; RECA-like domain, 97.63
2nn6_H308 Exosome complex exonuclease RRP4; RNA, exosome, PM 97.62
2vnu_D760 Exosome complex exonuclease RRP44; hydrolase-RNA c 97.62
1hh2_P344 NUSA, N utilization substance protein A; transcrip 97.41
2b8t_A223 Thymidine kinase; deoxyribonucleoside kinase, zinc 97.35
2ja9_A175 Exosome complex exonuclease RRP40; RNA-binding pro 97.31
3lfu_A647 DNA helicase II; SF1 helicase, ATP-binding, DNA da 97.21
3ec2_A180 DNA replication protein DNAC; helicase loader, rep 96.9
2orw_A184 Thymidine kinase; TMTK, TP4A, transferase; HET: 4T 96.89
3cpe_A592 Terminase, DNA packaging protein GP17; large termi 96.89
3kl4_A433 SRP54, signal recognition 54 kDa protein; signal r 96.86
1xx6_A191 Thymidine kinase; NESG, northeast structural genom 96.8
2o0j_A385 Terminase, DNA packaging protein GP17; nucleotide- 96.73
1x4q_A92 U4/U6 small nuclear ribonucleoprotein PRP3; PWI do 96.62
2gk6_A624 Regulator of nonsense transcripts 1; UPF1, helicas 96.59
3te6_A318 Regulatory protein SIR3; heterochromatin, gene sil 96.52
3dm5_A443 SRP54, signal recognition 54 kDa protein; protein- 96.51
2px0_A296 Flagellar biosynthesis protein FLHF; SRP GTPase, f 96.48
2xzl_A802 ATP-dependent helicase NAM7; hydrolase-RNA complex 96.36
2w58_A202 DNAI, primosome component (helicase loader); ATP-b 96.3
2wjy_A800 Regulator of nonsense transcripts 1; nonsense medi 96.29
2orv_A234 Thymidine kinase; TP4A (P1-(5'-adenosyl)P4-(5'- (2 96.28
1k0r_A366 NUSA; two component arrangement, S1 domain, two K- 96.25
2j9r_A214 Thymidine kinase; TK1, DNK, lasso, transferase, AT 96.25
2kjq_A149 DNAA-related protein; solution structure, NESG, st 96.17
1vma_A306 Cell division protein FTSY; TM0570, structural gen 96.08
1njg_A250 DNA polymerase III subunit gamma; rossman-like fol 95.95
3e2i_A219 Thymidine kinase; Zn-binding, ATP-binding, DNA syn 95.9
1a5t_A334 Delta prime, HOLB; zinc finger, DNA replication; 2 95.9
2nn6_G289 Exosome complex exonuclease RRP40; RNA, exosome, P 95.71
2zpa_A671 Uncharacterized protein YPFI; RNA modification enz 95.64
1fnn_A389 CDC6P, cell division control protein 6; ORC1, AAA 95.6
2w0m_A235 SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus 95.57
3syl_A309 Protein CBBX; photosynthesis, rubisco activase, AA 95.48
2v1u_A387 Cell division control protein 6 homolog; DNA repli 95.4
2qby_B384 CDC6 homolog 3, cell division control protein 6 ho 95.39
3n70_A145 Transport activator; sigma-54, ntpase, PSI, MCSG, 95.36
2pt7_A330 CAG-ALFA; ATPase, protein-protein complex, type IV 95.33
2chg_A226 Replication factor C small subunit; DNA-binding pr 95.32
3vkw_A446 Replicase large subunit; alpha/beta domain, helica 95.28
2qgz_A308 Helicase loader, putative primosome component; str 95.24
2asb_A251 Transcription elongation protein NUSA; protein-RNA 95.22
1ls1_A295 Signal recognition particle protein; FFH, SRP54, S 95.14
3bos_A242 Putative DNA replication factor; P-loop containing 95.08
2p65_A187 Hypothetical protein PF08_0063; CLPB, malaria, str 94.96
2qen_A350 Walker-type ATPase; unknown function; HET: ADP; 2. 94.94
3e70_C328 DPA, signal recognition particle receptor; FTSY, S 94.9
1w4r_A195 Thymidine kinase; type II, human, cytosolic, phosp 94.86
1l8q_A324 Chromosomal replication initiator protein DNAA; AA 94.8
3h4m_A285 Proteasome-activating nucleotidase; ATPase, PAN, A 94.77
3b9p_A297 CG5977-PA, isoform A; AAA ATPase, ATP-binding, nuc 94.76
1cr0_A296 DNA primase/helicase; RECA-type protein fold, tran 94.6
2yhs_A503 FTSY, cell division protein FTSY; cell cycle, prot 94.6
2qby_A386 CDC6 homolog 1, cell division control protein 6 ho 94.59
1sxj_E354 Activator 1 40 kDa subunit; clamp loader, processi 94.58
1jr3_A373 DNA polymerase III subunit gamma; processivity, pr 94.55
1sxj_A516 Activator 1 95 kDa subunit; clamp loader, processi 94.45
3vfd_A389 Spastin; ATPase, microtubule severing, hydrolase; 94.34
1iqp_A327 RFCS; clamp loader, extended AAA-ATPase domain, co 94.22
1d2n_A272 N-ethylmaleimide-sensitive fusion protein; hexamer 94.15
2bjv_A265 PSP operon transcriptional activator; AAA, transcr 94.08
3u61_B324 DNA polymerase accessory protein 44; AAA+, ATP hyd 93.97
2bh8_A101 1B11; transcription, molecular evolution, unique a 93.96
1uaa_A673 REP helicase, protein (ATP-dependent DNA helicase 93.95
1j8m_F297 SRP54, signal recognition 54 kDa protein; signalin 93.91
3u4q_A 1232 ATP-dependent helicase/nuclease subunit A; helicas 93.88
2ffh_A425 Protein (FFH); SRP54, signal recognition particle, 93.79
1xwi_A322 SKD1 protein; VPS4B, AAA ATPase, protein transport 93.62
1pjr_A724 PCRA; DNA repair, DNA replication, SOS response, h 93.61
2qp9_X355 Vacuolar protein sorting-associated protein 4; ATP 93.54
2qz4_A262 Paraplegin; AAA+, SPG7, protease, ADP, structural 93.52
2fna_A357 Conserved hypothetical protein; structural genomic 93.47
3eie_A322 Vacuolar protein sorting-associated protein 4; AAA 93.47
2gno_A305 DNA polymerase III, gamma subunit-related protein; 93.43
2r6a_A454 DNAB helicase, replicative helicase; replication, 93.33
1hqc_A324 RUVB; extended AAA-ATPase domain, complex with nuc 93.31
3pfi_A338 Holliday junction ATP-dependent DNA helicase RUVB; 93.18
1sxj_D353 Activator 1 41 kDa subunit; clamp loader, processi 93.17
1sxj_C340 Activator 1 40 kDa subunit; clamp loader, processi 93.16
3cf0_A301 Transitional endoplasmic reticulum ATPase; AAA, P9 93.16
1w5s_A412 Origin recognition complex subunit 2 ORC2; replica 93.09
1zu4_A320 FTSY; GTPase, signal recognition particle, SRP, re 93.01
2z4s_A440 Chromosomal replication initiator protein DNAA; AA 92.95
1ojl_A304 Transcriptional regulatory protein ZRAR; response 92.92
2xxa_A433 Signal recognition particle protein; protein trans 92.86
2j37_W504 Signal recognition particle 54 kDa protein (SRP54) 92.57
3d8b_A357 Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, s 92.54
3t15_A293 Ribulose bisphosphate carboxylase/oxygenase activ 92.39
3k1j_A604 LON protease, ATP-dependent protease LON; ATP-bind 92.36
3b9q_A302 Chloroplast SRP receptor homolog, alpha subunit CP 92.29
4b4t_J405 26S protease regulatory subunit 8 homolog; hydrola 92.24
1rj9_A304 FTSY, signal recognition protein; SRP-GTPase domai 92.22
1g5t_A196 COB(I)alamin adenosyltransferase; P-loop protein, 92.2
2og2_A359 Putative signal recognition particle receptor; nuc 91.98
4fcw_A311 Chaperone protein CLPB; AAA domain; HET: ADP; 2.35 91.96
2q6t_A444 DNAB replication FORK helicase; hydrolase; 2.90A { 91.75
3pvs_A447 Replication-associated recombination protein A; ma 91.69
4b4t_H467 26S protease regulatory subunit 7 homolog; hydrola 91.63
2zan_A444 Vacuolar protein sorting-associating protein 4B; S 91.61
1sxj_B323 Activator 1 37 kDa subunit; clamp loader, processi 91.43
2v3c_C432 SRP54, signal recognition 54 kDa protein; nucleoti 90.95
4b4t_M434 26S protease regulatory subunit 6A; hydrolase, AAA 90.78
4aby_A415 DNA repair protein RECN; hydrolase, double strand 90.69
3pxi_A758 Negative regulator of genetic competence CLPC/MEC; 90.63
2eyu_A261 Twitching motility protein PILT; pilus retraction 90.55
3b85_A208 Phosphate starvation-inducible protein; PHOH2, ATP 90.16
4b4t_L437 26S protease subunit RPT4; hydrolase, AAA-atpases, 89.94
4b4t_K428 26S protease regulatory subunit 6B homolog; hydrol 89.62
4b4t_I437 26S protease regulatory subunit 4 homolog; hydrola 89.59
2chq_A319 Replication factor C small subunit; DNA-binding pr 89.47
3v53_A119 RNA-binding protein 25; PWI, RNA-binding domain; 2 89.42
3jvv_A356 Twitching mobility protein; hexameric P-loop ATPas 89.27
1kgd_A180 CASK, peripheral plasma membrane CASK; maguk, guan 89.27
3hr8_A356 Protein RECA; alpha and beta proteins (A/B, A+B), 89.08
1xp8_A366 RECA protein, recombinase A; recombination, radior 88.99
2ce7_A476 Cell division protein FTSH; metalloprotease; HET: 88.87
3ney_A197 55 kDa erythrocyte membrane protein; structural ge 88.79
3hu3_A489 Transitional endoplasmic reticulum ATPase; VCP, tr 88.79
3cmu_A2050 Protein RECA, recombinase A; homologous recombinat 88.76
2ewv_A372 Twitching motility protein PILT; pilus retraction 88.6
3tr0_A205 Guanylate kinase, GMP kinase; purines, pyrimidines 88.49
3co5_A143 Putative two-component system transcriptional RES 88.26
1p9r_A418 General secretion pathway protein E; bacterial typ 88.23
2zts_A251 Putative uncharacterized protein PH0186; KAIC like 88.07
1r6b_X758 CLPA protein; AAA+, N-terminal domain, CLPS, cryst 88.05
2gza_A361 Type IV secretion system protein VIRB11; ATPase, h 87.92
4a1f_A338 DNAB helicase, replicative DNA helicase; hydrolase 87.67
1jjg_A102 M156R; beta barrel, S1 motif, OB fold, MYXV156R, N 87.56
3tau_A208 Guanylate kinase, GMP kinase; structural genomics, 87.56
2j41_A207 Guanylate kinase; GMP, GMK, transferase, ATP-bindi 87.52
3cf2_A806 TER ATPase, transitional endoplasmic reticulum ATP 87.4
1lvg_A198 Guanylate kinase, GMP kinase; transferase; HET: AD 87.36
2oap_1511 GSPE-2, type II secretion system protein; hexameri 87.05
2ehv_A251 Hypothetical protein PH0186; KAIC, RECA ATPase, un 87.04
2cvh_A220 DNA repair and recombination protein RADB; filamen 86.86
1znw_A207 Guanylate kinase, GMP kinase; ATP:GMP-phosphotrans 86.84
1z6g_A218 Guanylate kinase; structural genomics, SGC, struct 86.81
1zp6_A191 Hypothetical protein ATU3015; alpha-beta protein., 86.63
1n0w_A243 DNA repair protein RAD51 homolog 1; DNA repair, ho 86.46
2l8b_A189 Protein TRAI, DNA helicase I; RECD, hydrolase; NMR 86.4
1qvr_A854 CLPB protein; coiled coil, AAA ATPase, chaperone; 86.37
3a00_A186 Guanylate kinase, GMP kinase; domain movement, dim 86.23
4gp7_A171 Metallophosphoesterase; polynucleotide kinase phos 86.18
1jbk_A195 CLPB protein; beta barrel, chaperone; 1.80A {Esche 86.05
3vaa_A199 Shikimate kinase, SK; structural genomics, center 85.64
3cf2_A806 TER ATPase, transitional endoplasmic reticulum ATP 85.63
2v9p_A305 Replication protein E1; AAA+ molecular motor, DNA 85.57
2r7d_A469 Ribonuclease II family protein; structural genomic 85.5
4f4c_A 1321 Multidrug resistance protein PGP-1; ABC transporte 85.44
3umf_A217 Adenylate kinase; rossmann fold, transferase; 2.05 85.06
2dr3_A247 UPF0273 protein PH0284; RECA superfamily ATPase, h 85.05
3b5x_A582 Lipid A export ATP-binding/permease protein MSBA; 84.31
3d0f_A106 Penicillin-binding 1 transmembrane protein MRCA; B 84.15
1kht_A192 Adenylate kinase; phosphotransferase, signaling pr 84.14
1e9r_A437 Conjugal transfer protein TRWB; coupling protein, 83.81
2qor_A204 Guanylate kinase; phosphotransferase, purine metab 83.54
1mp1_A111 Ser/Arg-related nuclear matrix protein; four helix 83.53
3trf_A185 Shikimate kinase, SK; amino acid biosynthesis, tra 83.5
1s96_A219 Guanylate kinase, GMP kinase; E.coli, dimer, SAD, 83.25
3lnc_A231 Guanylate kinase, GMP kinase; ALS collaborative cr 83.16
1ypw_A806 Transitional endoplasmic reticulum ATPase; AAA, P9 83.11
3exa_A322 TRNA delta(2)-isopentenylpyrophosphate transferase 83.06
3lw7_A179 Adenylate kinase related protein (ADKA-like); AMP, 82.85
3sr0_A206 Adenylate kinase; phosphoryl transfer analogue, AL 82.83
4ag6_A392 VIRB4 ATPase, type IV secretory pathway VIRB4 comp 82.8
3lda_A400 DNA repair protein RAD51; DNA binding protein, ATP 82.74
1qvr_A854 CLPB protein; coiled coil, AAA ATPase, chaperone; 82.52
3a8t_A339 Adenylate isopentenyltransferase; rossmann fold pr 82.35
4eun_A200 Thermoresistant glucokinase; putative sugar kinase 82.34
3ux8_A670 Excinuclease ABC, A subunit; UVRA, nucleotide exci 82.24
4a74_A231 DNA repair and recombination protein RADA; hydrola 81.96
2c95_A196 Adenylate kinase 1; transferase, AP4A, nucleotide 81.87
1zd8_A227 GTP:AMP phosphotransferase mitochondrial; ATP:AMP 81.85
3tif_A235 Uncharacterized ABC transporter ATP-binding prote; 81.6
3cm0_A186 Adenylate kinase; ATP-binding, cytoplasm, nucleoti 81.59
1kag_A173 SKI, shikimate kinase I; transferase, structural g 81.49
2dhr_A499 FTSH; AAA+ protein, hexameric Zn metalloprotease, 81.41
3kb2_A173 SPBC2 prophage-derived uncharacterized protein YOR 81.4
1qhx_A178 CPT, protein (chloramphenicol phosphotransferase); 81.24
4f4c_A1321 Multidrug resistance protein PGP-1; ABC transporte 81.15
2z43_A324 DNA repair and recombination protein RADA; archaea 81.13
1nlf_A279 Regulatory protein REPA; replicative DNA helicase 81.08
2qmh_A205 HPR kinase/phosphorylase; V267F mutation, ATP-bind 80.86
1knq_A175 Gluconate kinase; ALFA/beta structure, transferase 80.71
3c8u_A208 Fructokinase; YP_612366.1, putative fructose trans 80.64
2bwj_A199 Adenylate kinase 5; phosphoryl transfer reaction, 80.59
2bdt_A189 BH3686; alpha-beta protein, structural genomics, P 80.35
2ze6_A253 Isopentenyl transferase; crown GALL tumor, cytokin 80.31
1tev_A196 UMP-CMP kinase; ploop, NMP binding region, LID reg 80.11
1ly1_A181 Polynucleotide kinase; PNK, phosphatase, transfera 80.07
>2xau_A PRE-mRNA-splicing factor ATP-dependent RNA helica; hydrolase, ribosome biogenesis, ATPase, ATP-binding, OB-fold; HET: ADP; 1.90A {Saccharomyces cerevisiae} PDB: 3kx2_B* Back     alignment and structure
Probab=100.00  E-value=6e-110  Score=1055.68  Aligned_cols=658  Identities=50%  Similarity=0.876  Sum_probs=602.4

Q ss_pred             HHHHHHHhcCCchHHHHHHHHHHHcCCeEEEEcCCCCcHHHHHHHHHHHhcccC--CCEEEEeccHHHHHHHHHHHHHHH
Q 001046          514 LSIQEQRQSLPIYKLKKELIQAVHDNQVLVVIGETGSGKTTQVTQYLAEAGYTT--RGKIGCTQPRRVAAMSVAKRVAEE  591 (1176)
Q Consensus       514 ~~l~~~r~~LPi~~~q~~ii~ai~~~~~vIv~apTGSGKTt~~~~~lle~~~~~--~~~Ilv~~PrR~lA~qva~rva~e  591 (1176)
                      ..+..++..+|++.+|..++.++..+++++|+|||||||||+++++++......  +.+|+|++|+|+||.|++++++.+
T Consensus        84 ~~~l~~r~~lP~~~q~~~i~~~l~~~~~vii~gpTGSGKTtllp~ll~~~~~~~~~g~~ilvl~P~r~La~q~~~~l~~~  163 (773)
T 2xau_A           84 VDILKIRRELPVHAQRDEFLKLYQNNQIMVFVGETGSGKTTQIPQFVLFDEMPHLENTQVACTQPRRVAAMSVAQRVAEE  163 (773)
T ss_dssp             HHHHHHHTTSGGGGGHHHHHHHHHHCSEEEEECCTTSSHHHHHHHHHHHHHCGGGGTCEEEEEESCHHHHHHHHHHHHHH
T ss_pred             HHHHHHhhcCChHHHHHHHHHHHhCCCeEEEECCCCCCHHHHHHHHHHHhccccCCCceEEecCchHHHHHHHHHHHHHH
Confidence            344566779999999999999999999999999999999999999988765543  557999999999999999999999


Q ss_pred             hCCccCCeeEEEeecccccCCCceEEEeChHHHHHHHhhCCCCCCCceEEEcCCCcCCCchhHHHHHHHHHHhhCCCccE
Q 001046          592 FGCRLGEEVGYAIRFEDCTGPDTVIKYMTDGMLLREILIDDNLSQYSVIMLDEAHERTIHTDVLFGLLKQLVKRRPDLRL  671 (1176)
Q Consensus       592 ~g~~~G~~vGy~ir~~~~~~~~t~I~~~T~g~Llr~l~~~~~L~~~s~IIiDEaHeR~~~~d~ll~llk~~~~~r~~~kv  671 (1176)
                      ++..+|..+||.++++......+.|+++|+|++++.++.++.+.++++|||||||+|++++|.++++++.+...+++.++
T Consensus       164 ~~~~v~~~vG~~i~~~~~~~~~~~I~v~T~G~l~r~l~~~~~l~~~~~lIlDEah~R~ld~d~~~~~l~~l~~~~~~~~i  243 (773)
T 2xau_A          164 MDVKLGEEVGYSIRFENKTSNKTILKYMTDGMLLREAMEDHDLSRYSCIILDEAHERTLATDILMGLLKQVVKRRPDLKI  243 (773)
T ss_dssp             TTCCBTTTEEEEETTEEECCTTCSEEEEEHHHHHHHHHHSTTCTTEEEEEECSGGGCCHHHHHHHHHHHHHHHHCTTCEE
T ss_pred             hCCchhheecceeccccccCCCCCEEEECHHHHHHHHhhCccccCCCEEEecCccccccchHHHHHHHHHHHHhCCCceE
Confidence            99999999999999999888999999999999999999999999999999999999999999999999999998899999


Q ss_pred             EEEcCCCCHHHHHhhhcCCCeEecCCceeeeEEEEecCCCchhHHHHHHHHHHHHhcCCCCCEEEEeCCHHHHHHHHHHH
Q 001046          672 IVTSATLDAEKFSGYFFNCNIFTIPGRTFPVEILYTKQPESDYLDASLITVLQIHLTEPEGDILLFLTGQEEIDFACQSL  751 (1176)
Q Consensus       672 IlmSATl~~~~~~~~f~~~~v~~i~gr~~pv~~~~~~~~~~~~~~~~l~~v~~i~~~~~~g~iLVFl~~~~ei~~l~~~L  751 (1176)
                      |+||||++.+.++.||.+++++.++++.+|++++|...+..+++...+..++.++...++|++||||+|+++|+.++..|
T Consensus       244 Il~SAT~~~~~l~~~~~~~~vi~v~gr~~pv~~~~~~~~~~~~~~~~l~~l~~~~~~~~~g~iLVF~~~~~~i~~l~~~L  323 (773)
T 2xau_A          244 IIMSATLDAEKFQRYFNDAPLLAVPGRTYPVELYYTPEFQRDYLDSAIRTVLQIHATEEAGDILLFLTGEDEIEDAVRKI  323 (773)
T ss_dssp             EEEESCSCCHHHHHHTTSCCEEECCCCCCCEEEECCSSCCSCHHHHHHHHHHHHHHHSCSCEEEEECSCHHHHHHHHHHH
T ss_pred             EEEeccccHHHHHHHhcCCCcccccCcccceEEEEecCCchhHHHHHHHHHHHHHHhcCCCCEEEECCCHHHHHHHHHHH
Confidence            99999999999999999999999999999999999998888999988989999888888999999999999999999999


Q ss_pred             HHHHhcc--CCCCCCeEEEEecCCCCHHHHHhhcCCCC-----CCCceEEEEcchhhhccCCCCeeEEEeCCcccceecc
Q 001046          752 YERMKGL--GKNVPELIILPVYSALPSEMQSRIFDPAP-----PGKRKVVVATNIAEASLTIDGIFYVIDPGFAKQNVYN  824 (1176)
Q Consensus       752 ~~~~~~l--~~~~~~~~v~~lhs~l~~~~r~~i~~~f~-----~g~~kVlVATniae~GIdIp~V~~VId~g~~k~~~yd  824 (1176)
                      .+.+..+  .....++.+.++||+|++++|.++++.|+     +|.++||||||+||+|||||+|++|||+|++|++.||
T Consensus       324 ~~~~~~l~~~~~~~~~~v~~lhg~l~~~eR~~v~~~f~~~~~~~g~~kVlVAT~iae~GidIp~v~~VId~g~~k~~~yd  403 (773)
T 2xau_A          324 SLEGDQLVREEGCGPLSVYPLYGSLPPHQQQRIFEPAPESHNGRPGRKVVISTNIAETSLTIDGIVYVVDPGFSKQKVYN  403 (773)
T ss_dssp             HHHHHHHHHHHCCCCEEEEEECTTCCHHHHGGGGSCCCCCSSSSCCEEEEEECTHHHHTCCCTTEEEEEECSEEEEEEEE
T ss_pred             HHHHHhhcccccCCCeEEEEeCCCCCHHHHHHHHhhcccccCCCCceEEEEeCcHHHhCcCcCCeEEEEeCCCccceeec
Confidence            8754332  11235788999999999999999999999     9999999999999999999999999999999999999


Q ss_pred             CCCCCccccccccCHHHHHHHhcccCCCCCcEEEEecChHHHhhhCCCCCchhhhhcChHHHHHHHHHcCCCccccCCCC
Q 001046          825 PKQGLDSLVITPISQASAKQRAGRAGRTGPGKCYRLYTESAYRNEMSPTSIPEIQRINLGFTTLTMKAMGINDLLSFDFM  904 (1176)
Q Consensus       825 ~~~g~~~l~~~p~S~as~~QR~GRAGR~g~G~c~~L~t~~~~~~~l~~~~~pEI~r~~L~~~~L~lk~~gi~~~~~f~~~  904 (1176)
                      +.+|++.|.+.|+|.++|+||+|||||.++|.||+||++.++...|.++..|||++.+|.+++|+++++|+.++..|+|+
T Consensus       404 ~~~g~~~L~~~p~S~~s~~QR~GRaGR~~~G~~~~l~~~~~~~~~l~~~~~pEi~r~~L~~~~L~l~~~gi~~~~~f~~~  483 (773)
T 2xau_A          404 PRIRVESLLVSPISKASAQQRAGRAGRTRPGKCFRLYTEEAFQKELIEQSYPEILRSNLSSTVLELKKLGIDDLVHFDFM  483 (773)
T ss_dssp             TTTTEEEEEEEECCHHHHHHHHHGGGSSSSEEEEESSCHHHHHHTSCSSCCCGGGGSCCHHHHHHHHHTTCCCGGGCCCS
T ss_pred             cccCccccccccCCHHHHHhhccccCCCCCCEEEEEecHHHhcccccccCCCccccCcHHHHHHHHHHcCCCChhhcccc
Confidence            99999999999999999999999999999999999999999976799999999999999999999999999999999999


Q ss_pred             CCCCHHHHHHHHHHHHHcCccccCCcccHHHHHHhcCCCChHHHHHHHHhhhcCCHHHHHHHHHHhcCCCCCCCchhHHH
Q 001046          905 DPPSPQALISAMEQLYSLGALDEEGLLTKLGRKMAEFPLDPPLSKMLLASVDLGCSDEILTIIAMIQTGNIFYRPREKQA  984 (1176)
Q Consensus       905 ~pP~~~~l~~al~~L~~lgald~~g~lT~lG~~~a~lpl~p~l~k~ll~~~~~~c~~~~l~i~a~ls~~~~f~~p~~~~~  984 (1176)
                      +||+.+.+..|++.|+.+||||++|+||++|+.|+.||++|++|+||+.|+.++|++++++|||||+++++|++|.++++
T Consensus       484 ~~p~~~~i~~a~~~L~~lgald~~~~lT~lG~~~a~~pl~p~~~~~l~~~~~~~c~~~~l~i~a~ls~~~~f~~~~~~~~  563 (773)
T 2xau_A          484 DPPAPETMMRALEELNYLACLDDEGNLTPLGRLASQFPLDPMLAVMLIGSFEFQCSQEILTIVAMLSVPNVFIRPTKDKK  563 (773)
T ss_dssp             SCCCHHHHHHHHHHHHHTTSBCTTSCBCHHHHHHTTSSSCHHHHHHHHHGGGGTCHHHHHHHHHHHTSCCCBCCCTTCHH
T ss_pred             CCCcHHHHHHHHHHHHHcCCcccCCCcChhhhhhccccCCHHHHHHHHhhcccCchhHHHHHHHhcccCCcccCChHHHH
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHhhcCCCCCcHHHHHHHHHHHHHhc---cC-CCcccccccchhhhHHHHHHHHHHHHHHHHcCCCccccC----c
Q 001046          985 QADQKRAKFFQPEGDHLTLLAVYEAWKAKN---FS-GPWCFENFVQSRSLRRAQDVRKQLLSIMDKYKLDVMSAG----K 1056 (1176)
Q Consensus       985 ~~~~~~~~~~~~~~D~l~~l~~~~~~~~~~---~~-~~~c~~~~l~~~~l~~~~~~r~ql~~~~~~~~~~~~~~~----~ 1056 (1176)
                      +++.++..|.++.|||+++||+|++|....   .+ ..||.+|||++++|++|.++|.||..+|.+++++..++.    .
T Consensus       564 ~~~~~~~~f~~~~~D~~~~l~~~~~~~~~~~~~~~~~~~c~~~~l~~~~l~~~~~~~~ql~~~~~~~~~~~~~~~~~~~~  643 (773)
T 2xau_A          564 RADDAKNIFAHPDGDHITLLNVYHAFKSDEAYEYGIHKWCRDHYLNYRSLSAADNIRSQLERLMNRYNLELNTTDYESPK  643 (773)
T ss_dssp             HHHHHHHTTCCTTBHHHHHHHHHHHHTSHHHHHHCHHHHHHHTTBCHHHHHHHHHHHHHHHHHHHHTTCCCCCCCTTSTT
T ss_pred             HHHHHHHhccCCCCcHHHHHHHHHHHHHhccccchHHHHHHHhCCCHHHHHHHHHHHHHHHHHHHhcCCCcCCCCCCchh
Confidence            999999999999999999999999997654   44 679999999999999999999999999999988776543    3


Q ss_pred             chHHHHHHhhcccccccceeCCCCC-eeeeecCccEEECCCCcCCCCCCCEEEEEeeccchhhhcceecccCHHHHHhhc
Q 001046         1057 NFTKIRKAITAGFFFHAARKDPQEG-YRTLVENQPVYIHPSSALFQRQPDWVIYHELVMTTKEYMREVTVIDPKWLVDLA 1135 (1176)
Q Consensus      1057 ~~~~i~~~l~~g~~~n~a~~~~~~~-y~~~~~~~~v~ihpsS~l~~~~~~~vvy~e~~~t~~~~~~~vt~i~~~wl~~~~ 1135 (1176)
                      ++..|++|||+|||+|+|++.+.++ |.++.+++.|+|||+|+|. ..|+||||+|++.|++.||++||+|+|+||.++|
T Consensus       644 ~~~~i~~~l~~g~~~~~a~~~~~~~~y~~~~~~~~~~ihp~s~l~-~~~~~~v~~e~~~t~~~~~~~~~~i~~~~l~~~~  722 (773)
T 2xau_A          644 YFDNIRKALASGFFMQVAKKRSGAKGYITVKDNQDVLIHPSTVLG-HDAEWVIYNEFVLTSKNYIRTVTSVRPEWLIEIA  722 (773)
T ss_dssp             HHHHHHHHHHHHHTTSEEEECCC--CEEETTTCCEEEECTTCCCC-TTCSEEEEEEEEESSSEEEEEEEECCHHHHHHHC
T ss_pred             hHHHHHHHHHHhChHhheeeccCCCcceEeeCCCEEEECCCcccC-CCCCEEEEEEeeccchhheeecccCCHHHHHHHH
Confidence            4688999999999999999987765 9999999999999999994 4699999999999999999999999999999999


Q ss_pred             cccccccCccccchHhhhcccccccccccCCCcccccccc
Q 001046         1136 PRFFKVADPTKMSKRKRQERIEPLYDRYHEPNSWRLSKRR 1175 (1176)
Q Consensus      1136 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ 1175 (1176)
                      |+||...+.   .+.+.++++++|+++++..++|+.++.+
T Consensus       723 ~~~~~~~~~---~~~~~~~~~~~~~~~~~~~~~~~~~~~~  759 (773)
T 2xau_A          723 PAYYDLSNF---QKGDVKLSLERIKEKVDRLNELKQGKNK  759 (773)
T ss_dssp             TTTSCGGGC---CSSHHHHHHHHHHHHHHC----------
T ss_pred             HHheeeccC---CchhHHHHHHHHHHHhhhhhhccccccc
Confidence            999987663   3334456899999999999999987643
>3i4u_A ATP-dependent RNA helicase DHX8; splicing, ATP-binding, hydrolase, mRNA processing, splicing, nucleotide-binding, nucleus, phosphoprotein, SPLI; 2.10A {Homo sapiens} Back     alignment and structure
>2va8_A SSO2462, SKI2-type helicase; hydrolase, DNA repair, ATP-bindin nucleotide-binding; 2.30A {Sulfolobus solfataricus} Back     alignment and structure
>2p6r_A Afuhel308 helicase; protein-DNA complex, SF2 helicase, archaeal helicase, DNA repair,, DNA binding protein/DNA complex; 3.00A {Archaeoglobus fulgidus} SCOP: a.4.5.43 a.289.1.2 c.37.1.19 c.37.1.19 PDB: 2p6u_A Back     alignment and structure
>2zj8_A DNA helicase, putative SKI2-type helicase; RECA fold, ATP-binding, hydrolase, nucleotide- binding; 2.00A {Pyrococcus furiosus} PDB: 2zj5_A* 2zj2_A 2zja_A* Back     alignment and structure
>3eiq_A Eukaryotic initiation factor 4A-I; PDCD4, anti-oncogene, apoptosis, cell cycle, nucleus, phosph RNA-binding, ATP-binding, helicase, hydrolase; 3.50A {Homo sapiens} Back     alignment and structure
>4f92_B U5 small nuclear ribonucleoprotein 200 kDa helica; RNP remodeling, PRE-mRNA splicing, spliceosome catalytic ACT DEXD/H-box RNA helicase; HET: SAN; 2.66A {Homo sapiens} PDB: 4f93_B* 4f91_B Back     alignment and structure
>3l9o_A ATP-dependent RNA helicase DOB1; REC-A fold, winged-helix-turn-helix, antiparallel-coiled-COI domain, ATP-binding, helicase, hydrolase; 3.39A {Saccharomyces cerevisiae} Back     alignment and structure
>4f92_B U5 small nuclear ribonucleoprotein 200 kDa helica; RNP remodeling, PRE-mRNA splicing, spliceosome catalytic ACT DEXD/H-box RNA helicase; HET: SAN; 2.66A {Homo sapiens} PDB: 4f93_B* 4f91_B Back     alignment and structure
>2db3_A ATP-dependent RNA helicase VASA; DEAD-BOX, protein-RNA complex, ATPase, riken structural genomics/proteomics initiative, RSGI; HET: ANP; 2.20A {Drosophila melanogaster} Back     alignment and structure
>3fht_A ATP-dependent RNA helicase DDX19B; DBP5, DEAD-box helicase, RNA dependent ATPase, mRNA export, nucleocytoplasmic transport, NUP214, CAN; HET: ANP; 2.20A {Homo sapiens} PDB: 3ews_A* 3g0h_A* 3fhc_B Back     alignment and structure
>3pey_A ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, ATPase, helicase, mRNA-export, nuclear pore, hydrolase-RNA complex; HET: ADP; 1.40A {Saccharomyces cerevisiae} PDB: 3pew_A* 3pex_A* 3pez_A* 3rrm_A* 3rrn_A* 2kbe_A 3gfp_A 2kbf_A 3pev_A* 3peu_A* Back     alignment and structure
>3o8b_A HCV NS3 protease/helicase; ntpase, RNA, translocation, protein-RNA compl protease/ntpase/helicase, hydrolase; 1.95A {Hepatitis c virus} PDB: 3o8c_A* 3o8d_A* 3o8r_A* 4b71_A* 4b73_A* 4b74_A* 4b76_A* 4b75_A* 4a92_A* 1cu1_A 4b6e_A* 4b6f_A* 2zjo_A* 1a1v_A* 1hei_A 3kqn_A* 3kql_A* 3kqu_A* 3kqh_A 3kqk_A ... Back     alignment and structure
>2z83_A Helicase/nucleoside triphosphatase; hydrolase, membrane, nucleotide-binding, RNA replication, transmembrane, viral protein; 1.80A {Japanese encephalitis virus} PDB: 2v8o_A 2qeq_A Back     alignment and structure
>2jlq_A Serine protease subunit NS3; ribonucleoprotein, nucleotide-binding, viral nucleoprotein, endoplasmic reticulum, helicase, hydrolase; 1.67A {Dengue virus 4} PDB: 2jly_A* 2jls_A* 2jlu_A 2jlv_A* 2jlw_A 2jlx_A* 2jlz_A* 2jlr_A* 2bmf_A 2bhr_A Back     alignment and structure
>1s2m_A Putative ATP-dependent RNA helicase DHH1; ATP-binding, RNA-binding, RNA binding protein; 2.10A {Saccharomyces cerevisiae} SCOP: c.37.1.19 c.37.1.19 PDB: 2wax_A* 2way_A Back     alignment and structure
>4a4z_A Antiviral helicase SKI2; hydrolase, ATPase, mRNA degradation, exosome; HET: ANP; 2.40A {Saccharomyces cerevisiae} PDB: 4a4k_A Back     alignment and structure
>2j0s_A ATP-dependent RNA helicase DDX48; mRNA processing, phosphorylation, rRNA processing, mRNA splicing, mRNA transport; HET: ANP; 2.21A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 2j0q_A* 2hyi_C* 3ex7_C* 2xb2_A* 2hxy_A 2j0u_A 2j0u_B 2zu6_A Back     alignment and structure
>2i4i_A ATP-dependent RNA helicase DDX3X; DEAD, structural genomics, SGC, structural GE consortium, hydrolase; HET: AMP; 2.20A {Homo sapiens} Back     alignment and structure
>2v1x_A ATP-dependent DNA helicase Q1; DNA strand annealing, mismatch repair, nucleotide-binding, DNA-binding, polymorphism, nuclear protein, ATPase; HET: ADP; 2.00A {Homo sapiens} PDB: 2wwy_A* Back     alignment and structure
>1hv8_A Putative ATP-dependent RNA helicase MJ0669; RNA-binding protein, ATPase, RNA binding protein; 3.00A {Methanocaldococcus jannaschii} SCOP: c.37.1.19 c.37.1.19 Back     alignment and structure
>2v6i_A RNA helicase; membrane, hydrolase, transmembrane, RNA replication, viral replication, nucleotide-binding; 2.10A {Kokobera virus} PDB: 2v6j_A Back     alignment and structure
>3fmp_B ATP-dependent RNA helicase DDX19B; nuclear porin, nuclear pore complex, nucleocytoplasmic trans mRNA export, protein interaction, beta-propeller; HET: ADP; 3.19A {Homo sapiens} Back     alignment and structure
>1xti_A Probable ATP-dependent RNA helicase P47; alpha-beta fold, gene regulation; 1.95A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 1xtj_A* 1xtk_A Back     alignment and structure
>2whx_A Serine protease/ntpase/helicase NS3; transcription, hydrolase, ATP-binding, reticulum, nucleotidyltransferase, multifunctional enzyme; HET: ADP; 2.20A {Dengue virus 4} PDB: 2vbc_A 2wzq_A Back     alignment and structure
>3i5x_A ATP-dependent RNA helicase MSS116; protein-RNA complex, RNA helicase, DEAD-BOX, ATP-binding, HE hydrolase, mitochondrion; HET: ANP; 1.90A {Saccharomyces cerevisiae} PDB: 3i5y_A* 3i61_A* 3i62_A* 3sqx_A* 4db2_A 4db4_A Back     alignment and structure
>2xgj_A ATP-dependent RNA helicase DOB1; hydrolase-RNA complex, hydrolase, tramp, exosome, DEAD, nucleotide-binding; HET: ADP; 2.90A {Saccharomyces cerevisiae} Back     alignment and structure
>3sqw_A ATP-dependent RNA helicase MSS116, mitochondrial; RECA fold, RNA dependent ATPase, RNA helicase; HET: ANP; 1.91A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>2z0m_A 337AA long hypothetical ATP-dependent RNA helicase DEAD; ATP-binding, hydrolase, nucleotide-binding, RNA binding protein, structural genomics; 1.90A {Sulfolobus tokodaii} Back     alignment and structure
>1fuu_A Yeast initiation factor 4A; IF4A, helicase, DEAD-box protein, translation; 2.50A {Saccharomyces cerevisiae} SCOP: c.37.1.19 PDB: 2vso_A* 2vsx_A* Back     alignment and structure
>3rc3_A ATP-dependent RNA helicase SUPV3L1, mitochondrial; SUV3, nucleus, hydrolase; HET: ANP; 2.08A {Homo sapiens} PDB: 3rc8_A Back     alignment and structure
>2ykg_A Probable ATP-dependent RNA helicase DDX58; hydrolase, innate immunity; 2.50A {Homo sapiens} PDB: 3tmi_A* Back     alignment and structure
>1oyw_A RECQ helicase, ATP-dependent DNA helicase; winged helix, helix-turn-helix, ATP binding, Zn(2+) binding, hydrolase; 1.80A {Escherichia coli} SCOP: a.4.5.43 c.37.1.19 c.37.1.19 PDB: 1oyy_A* Back     alignment and structure
>1yks_A Genome polyprotein [contains: flavivirin protease NS3 catalytic subunit]; helicase, flavivirus, DEAD-BOX, ATPase, rtpase, hydrolase; 1.80A {Yellow fever virus} SCOP: c.37.1.14 c.37.1.14 PDB: 1ymf_A* Back     alignment and structure
>3oiy_A Reverse gyrase helicase domain; topoisomerase, DNA supercoiling, archaea, isomeras; 2.35A {Thermotoga maritima} PDB: 3p4y_A 3p4x_A* Back     alignment and structure
>2wv9_A Flavivirin protease NS2B regulatory subunit, FLAV protease NS3 catalytic subunit; nucleotide-binding, capsid protein; 2.75A {Murray valley encephalitis virus} Back     alignment and structure
>4a2p_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.00A {Anas platyrhynchos} PDB: 4a36_A* Back     alignment and structure
>3tbk_A RIG-I helicase domain; DECH helicase, ATP binding, hydrolase; HET: ANP; 2.14A {Mus musculus} Back     alignment and structure
>1wp9_A ATP-dependent RNA helicase, putative; ATPase, DNA replication, DNA repair, DNA recombina hydrolase; 2.90A {Pyrococcus furiosus} SCOP: c.37.1.19 c.37.1.19 Back     alignment and structure
>4gl2_A Interferon-induced helicase C domain-containing P; MDA5, dsRNA, anti-viral signaling, RIG-I, MAVS, oligomerizat helicase, ATPase; HET: ANP; 3.56A {Homo sapiens} Back     alignment and structure
>4a2q_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.40A {Anas platyrhynchos} Back     alignment and structure
>4a2w_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.70A {Anas platyrhynchos} Back     alignment and structure
>1gm5_A RECG; helicase, replication restart; HET: DNA ADP; 3.24A {Thermotoga maritima} SCOP: a.24.21.1 b.40.4.9 c.37.1.19 c.37.1.19 Back     alignment and structure
>2eyq_A TRCF, transcription-repair coupling factor; MFD, SF2 ATPase, hydrolase; HET: EPE; 3.20A {Escherichia coli} SCOP: b.34.18.1 c.37.1.19 c.37.1.19 c.37.1.19 c.37.1.19 d.315.1.1 Back     alignment and structure
>4ddu_A Reverse gyrase; topoisomerase, DNA supercoiling, archaea, helicase, hydrolas; 3.00A {Thermotoga maritima} PDB: 4ddt_A 4ddv_A 4ddw_A 4ddx_A Back     alignment and structure
>1gku_B Reverse gyrase, TOP-RG; topoisomerase, DNA supercoiling, archaea, helicase; 2.7A {Archaeoglobus fulgidus} SCOP: c.37.1.16 c.37.1.16 e.10.1.1 PDB: 1gl9_B* Back     alignment and structure
>2oca_A DAR protein, ATP-dependent DNA helicase UVSW; ATP-dependant helicase, T4-bacteriophage, recombination, hydrolase; 2.70A {Enterobacteria phage T4} Back     alignment and structure
>2fwr_A DNA repair protein RAD25; DNA unwinding, XPB, DNA binding protein; HET: DNA; 2.60A {Archaeoglobus fulgidus} SCOP: c.37.1.19 c.37.1.19 PDB: 2fzl_A* Back     alignment and structure
>1tf5_A Preprotein translocase SECA subunit; ATPase, helicase, translocation, secretion, protein transport; 2.18A {Bacillus subtilis} SCOP: a.162.1.1 a.172.1.1 c.37.1.19 c.37.1.19 PDB: 1tf2_A 3iqy_A 1m6n_A 1m74_A* 3iqm_A 3jv2_A* 2ibm_A* 3dl8_A 1sx0_A 1sx1_A 1tm6_A Back     alignment and structure
>3llm_A ATP-dependent RNA helicase A; alpha-beta-alpha, structural genomics, structural genomics consortium, SGC, activator, ATP-binding, DNA-binding; HET: ADP; 2.80A {Homo sapiens} Back     alignment and structure
>2fsf_A Preprotein translocase SECA subunit; ATPase, DNA-RNA helicase, protein translocation, protein transport; 2.00A {Escherichia coli} PDB: 2fsg_A* 2fsh_A* 2fsi_A* 2vda_A 3bxz_A* Back     alignment and structure
>3h1t_A Type I site-specific restriction-modification system, R (restriction) subunit; hydrolase, restriction enzyme HSDR, ATP-binding; 2.30A {Vibrio vulnificus} Back     alignment and structure
>1nkt_A Preprotein translocase SECA 1 subunit; preprotein translocation, ATPase, transmembrane transport, helicase-like motor domain; HET: ADP; 2.60A {Mycobacterium tuberculosis} SCOP: a.162.1.1 a.172.1.1 c.37.1.19 c.37.1.19 PDB: 1nl3_A Back     alignment and structure
>3eaq_A Heat resistant RNA dependent ATPase; DEAD box RNA helicase, dimer, ATP-binding, helicase, hydrolase, nucleotide-binding; 2.30A {Thermus thermophilus} PDB: 3ear_A 3eas_A Back     alignment and structure
>3dmq_A RNA polymerase-associated protein RAPA; SWF2/SNF2, transcription factor, RNA polymerase recycling, activator, ATP-binding, DNA-binding; 3.20A {Escherichia coli K12} Back     alignment and structure
>3i32_A Heat resistant RNA dependent ATPase; RNA helicase, dimer, RNA recognition motif, ATP-BIND helicase, nucleotide-binding; 2.80A {Thermus thermophilus} Back     alignment and structure
>2w00_A HSDR, R.ECOR124I; ATP-binding, DNA-binding, restriction system, helicase, HYDR R.ECOR124I, nucleotide-binding; HET: ATP; 2.6A {Escherichia coli} PDB: 2y3t_A* 2w74_B* Back     alignment and structure
>1z63_A Helicase of the SNF2/RAD54 hamily; protein-DNA complex, hydrolase/DNA complex complex; 3.00A {Sulfolobus solfataricus} SCOP: c.37.1.19 c.37.1.19 PDB: 1z6a_A Back     alignment and structure
>3jux_A Protein translocase subunit SECA; protein translocation, ATPase, conformational change, peptide binding, ATP-binding, cell inner membrane; HET: ADP; 3.10A {Thermotoga maritima} PDB: 3din_A* Back     alignment and structure
>1c4o_A DNA nucleotide excision repair enzyme UVRB; uvrabc, helicase, hypertherm protein, replication; HET: DNA BOG; 1.50A {Thermus thermophilus} SCOP: c.37.1.19 c.37.1.19 PDB: 1d2m_A* Back     alignment and structure
>1z3i_X Similar to RAD54-like; recombination ATPase helicase, recombination-DNA binding COM; 3.00A {Danio rerio} SCOP: c.37.1.19 c.37.1.19 Back     alignment and structure
>3mwy_W Chromo domain-containing protein 1; SWI2/SNF2 ATPase, double chromodomains, hydrolase; HET: ATG; 3.70A {Saccharomyces cerevisiae} Back     alignment and structure
>3iuy_A Probable ATP-dependent RNA helicase DDX53; REC-A-like, DEAD-BOX, structural genomics, structural genomi consortium, SGC, ATP-binding, hydrolase; HET: AMP; 2.40A {Homo sapiens} Back     alignment and structure
>2d7d_A Uvrabc system protein B; helicase, protein-DNA-ADP ternary complex, hydrolase/DNA complex; HET: ADP; 2.10A {Bacillus subtilis} PDB: 2nmv_A* 2fdc_A* 1t5l_A 3uwx_B 1d9z_A* 1d9x_A 2d7d_B* 2nmv_B* Back     alignment and structure
>3fmo_B ATP-dependent RNA helicase DDX19B; nuclear porin, nuclear pore complex, nucleocytoplasmic trans mRNA export, protein interaction, beta-propeller; HET: ADP; 2.51A {Homo sapiens} Back     alignment and structure
>3ber_A Probable ATP-dependent RNA helicase DDX47; DEAD, AMP, structural genomics, structural GEN consortium, SGC, ATP-binding, hydrolase; HET: AMP PGE; 1.40A {Homo sapiens} Back     alignment and structure
>1qde_A EIF4A, translation initiation factor 4A; DEAD box protein family, gene regulation; 2.00A {Saccharomyces cerevisiae} SCOP: c.37.1.19 PDB: 1qva_A Back     alignment and structure
>3ly5_A ATP-dependent RNA helicase DDX18; alpha-beta, structural genomics, structural genomics consort ATP-binding, hydrolase, nucleotide-binding, RNA-B; 2.80A {Homo sapiens} Back     alignment and structure
>1vec_A ATP-dependent RNA helicase P54; DEAD-box protein, RNA binding protein; HET: TLA; 2.01A {Homo sapiens} SCOP: c.37.1.19 Back     alignment and structure
>3dkp_A Probable ATP-dependent RNA helicase DDX52; DEAD, ADP, structural genomics, structural GEN consortium, SGC, rRNA, ATP-binding, hydrolase; HET: ADP; 2.10A {Homo sapiens} Back     alignment and structure
>3bor_A Human initiation factor 4A-II; translation initiation, DEAD BOX, structural genomics, helic binding, HOST-virus interaction, hydrolase; 1.85A {Homo sapiens} PDB: 2g9n_A* Back     alignment and structure
>2pl3_A Probable ATP-dependent RNA helicase DDX10; DEAD, structural genomics, structural genomic consortium, SGC, hydrolase; HET: ADP; 2.15A {Homo sapiens} Back     alignment and structure
>2rb4_A ATP-dependent RNA helicase DDX25; rossmann fold, structural genomics, structural consortium, SGC, alternative initiation, ATP-binding, devel protein; 2.80A {Homo sapiens} Back     alignment and structure
>2hjv_A ATP-dependent RNA helicase DBPA; parallel alpha-beta, hydrolase; 1.95A {Bacillus subtilis} Back     alignment and structure
>3fe2_A Probable ATP-dependent RNA helicase DDX5; DEAD, ADP, ATP-binding, hydrolase, nucleotide- RNA-binding, methylation, mRNA processing, mRNA S nucleus; HET: ADP; 2.60A {Homo sapiens} PDB: 4a4d_A Back     alignment and structure
>1q0u_A Bstdead; DEAD protein, RNA binding protein; 1.85A {Geobacillus stearothermophilus} SCOP: c.37.1.19 Back     alignment and structure
>2oxc_A Probable ATP-dependent RNA helicase DDX20; DEAD, structural genomics, structural genomics consortium, SGC, hydrolase; HET: ADP; 1.30A {Homo sapiens} PDB: 3b7g_A* Back     alignment and structure
>2gxq_A Heat resistant RNA dependent ATPase; RNA helicase, atomic resolution, AMP complex, ribosome biogenesis, thermophilic, hydrolase; HET: AMP; 1.20A {Thermus thermophilus HB27} PDB: 2gxs_A* 2gxu_A 3mwj_A 3mwk_A* 3mwl_A* 3nbf_A* 3nej_A Back     alignment and structure
>1fuk_A Eukaryotic initiation factor 4A; helicase, DEAD-box protein, translation; 1.75A {Saccharomyces cerevisiae} SCOP: c.37.1.19 Back     alignment and structure
>1t5i_A C_terminal domain of A probable ATP-dependent RNA helicase; RECA-like fold, PRE-mRNA processing protein; 1.90A {Homo sapiens} SCOP: c.37.1.19 Back     alignment and structure
>1t6n_A Probable ATP-dependent RNA helicase; RECA-like fold, PRE-mRNA processing protein; HET: FLC; 1.94A {Homo sapiens} SCOP: c.37.1.19 Back     alignment and structure
>2jgn_A DBX, DDX3, ATP-dependent RNA helicase DDX3X; phosphorylation, nucleotide-binding, hydrolase, RNA-binding, ATP-binding, DNA-binding, nuclear protein; 1.91A {Homo sapiens} Back     alignment and structure
>1wrb_A DJVLGB; RNA helicase, DEAD BOX, VASA, structural genomics, NPPSFA, N project on protein structural and functional analyses; 2.40A {Dugesia japonica} SCOP: c.37.1.19 Back     alignment and structure
>2p6n_A ATP-dependent RNA helicase DDX41; DEAD, structural genomics, structural genomic consortium, SGC, hydrolase; 2.60A {Homo sapiens} Back     alignment and structure
>2yjt_D ATP-dependent RNA helicase SRMB, regulator of ribonuclease activity A; hydrolase inhibitor-hydrolase complex, DEAD box RNA helicase; 2.90A {Escherichia coli} Back     alignment and structure
>3b6e_A Interferon-induced helicase C domain-containing P; DECH, DEXD/H RNA-binding helicase, innate immunity, IFIH1, S genomics; 1.60A {Homo sapiens} Back     alignment and structure
>2ipc_A Preprotein translocase SECA subunit; nucleotide binding fold, ATPase, parallel dimer; 2.80A {Thermus thermophilus} Back     alignment and structure
>2eqs_A ATP-dependent RNA helicase DHX8; S1 domain, OB-fold, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2cqo_A Nucleolar protein of 40 kDa; S1 domain, OB-fold, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2vl7_A XPD; helicase, unknown function; 2.25A {Sulfolobus tokodaii} Back     alignment and structure
>1rif_A DAR protein, DNA helicase UVSW; bacteriophage, RECG, SF2, DNA binding protein; HET: DNA; 2.00A {Enterobacteria phage T4} SCOP: c.37.1.23 Back     alignment and structure
>1kl9_A Eukaryotic translation initiation factor 2 subuni; OB fold, helical domain; 1.90A {Homo sapiens} SCOP: a.60.14.1 b.40.4.5 Back     alignment and structure
>1luz_A Protein K3, protein K2; stranded anti-parallel beta barrel, viral protein; 1.80A {Vaccinia virus} SCOP: b.40.4.5 Back     alignment and structure
>2a19_A EIF-2- alpha, eukaryotic translation initiation factor 2 alpha; transferase, protein biosynthesis, protein synthesis transferase complex; HET: TPO ANP; 2.50A {Saccharomyces cerevisiae} PDB: 2a1a_A* 1q46_A Back     alignment and structure
>2fz4_A DNA repair protein RAD25; RECA-like domain, DNA damage recognition domain, DNA binding; HET: DNA; 2.40A {Archaeoglobus fulgidus} SCOP: c.37.1.19 Back     alignment and structure
>2khi_A 30S ribosomal protein S1; acetylation, phosphoprotein, ribonucleoprotein, RNA-binding; NMR {Escherichia coli} Back     alignment and structure
>2k4k_A GSP13, general stress protein 13; cytoplasm, stress response, RNA binding protein; NMR {Bacillus subtilis} Back     alignment and structure
>3crv_A XPD/RAD3 related DNA helicase; XPD helicase DNA repair cancer aging, hydrolase; HET: FLC; 2.00A {Sulfolobus acidocaldarius} PDB: 3crw_1* Back     alignment and structure
>2k52_A Uncharacterized protein MJ1198; metal-binding, zinc, zinc-finger, structural genomics, PSI-2, protein structure initiative; NMR {Methanocaldococcus jannaschii} Back     alignment and structure
>2khj_A 30S ribosomal protein S1; OB fold, acetylation, phosphoprotein, ribonucleoprotein, RNA-binding; NMR {Escherichia coli} Back     alignment and structure
>1q8k_A Eukaryotic translation initiation factor 2 subunit 1; NMR {Homo sapiens} SCOP: a.60.14.1 b.40.4.5 d.58.51.1 Back     alignment and structure
>3aev_A Translation initiation factor 2 subunit alpha; proteins-rRNA complex, 16S rRNA, RNA-binding; 2.80A {Pyrococcus horikoshii} PDB: 1yz6_A Back     alignment and structure
>1z5z_A Helicase of the SNF2/RAD54 family; hydrolase, recombination, hydrolase-recombination complex; 2.00A {Sulfolobus solfataricus} SCOP: c.37.1.19 Back     alignment and structure
>3cw2_C Translation initiation factor 2 subunit alpha; AIF2, intact AIF2, initiation factor 2 alpha subunit, initiation factor 2 beta subunit; 2.80A {Sulfolobus solfataricus} PDB: 2aho_B 3v11_B* Back     alignment and structure
>4aid_A Polyribonucleotide nucleotidyltransferase; transferase-peptide complex; 2.60A {Caulobacter vibrioides} PDB: 4aim_A 4am3_A Back     alignment and structure
>3cdi_A Polynucleotide phosphorylase; mRNA turnover, RNAse, RNA degradation, kinase, transferase; 2.60A {Escherichia coli} PDB: 1sro_A Back     alignment and structure
>1e3p_A Guanosine pentaphosphate synthetase; polyribonucleotide transferase, ATP-GTP diphosphotransferase RNA processing, RNA degradation; 2.5A {Streptomyces antibioticus} SCOP: a.4.9.1 b.40.4.5 d.14.1.4 d.14.1.4 d.52.3.1 d.101.1.1 d.101.1.1 PDB: 1e3h_A Back     alignment and structure
>4a15_A XPD helicase, ATP-dependent DNA helicase TA0057; hydrolase, nucleotide excision repair,; 2.20A {Thermoplasma acidophilum} PDB: 2vsf_A* Back     alignment and structure
>3psi_A Transcription elongation factor SPT6; nucleus; 3.30A {Saccharomyces cerevisiae} Back     alignment and structure
>1wi5_A RRP5 protein homolog; S1 domain, OB-fold, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.40.4.5 Back     alignment and structure
>4ayb_E DNA-directed RNA polymerase; transferase, multi-subunit, transcription; 3.20A {Sulfolobus shibatae} PDB: 2y0s_E 4b1o_E 4b1p_T 2waq_E 2wb1_E 2pmz_E 3hkz_E Back     alignment and structure
>1go3_E DNA-directed RNA polymerase subunit E; transferase, transferase, transcription; 1.75A {Methanococcus jannaschii} SCOP: b.40.4.5 d.230.1.1 Back     alignment and structure
>3bzc_A TEX; helix-turn-helix, helix-hairpin-helix, S1 domain, YQGF domain, transcription, RNA binding protein; 2.27A {Pseudomonas aeruginosa} SCOP: a.60.2.6 a.60.2.6 a.294.1.1 b.40.4.5 c.55.3.13 PDB: 3bzk_A 2oce_A Back     alignment and structure
>2nn6_I 3'-5' exoribonuclease CSL4 homolog; RNA, exosome, PM/SCL, phosphorolytic, hydrolase/transferase complex; 3.35A {Homo sapiens} SCOP: b.40.4.5 b.84.4.2 Back     alignment and structure
>3m7n_A Putative uncharacterized protein AF_0206; exosome, RNA, exonuclease, hydrolase, nuclease, hydrolase-RN; 2.40A {Archaeoglobus fulgidus} PDB: 2ba1_A 3m85_A Back     alignment and structure
>3psf_A Transcription elongation factor SPT6; nucleus; 2.59A {Saccharomyces cerevisiae} Back     alignment and structure
>3go5_A Multidomain protein with S1 RNA-binding domains; structural genomics, joint center for structural genomics, JCSG; HET: MSE; 1.40A {Streptococcus pneumoniae} Back     alignment and structure
>1y14_B B16, RPB7, DNA-directed RNA polymerase II 19 kDa polypeptide; transferase; 2.30A {Saccharomyces cerevisiae} SCOP: b.40.4.5 d.230.1.1 PDB: 1nt9_G 1wcm_G 1pqv_G 1y1v_G 1y1w_G 1y1y_G 1y77_G* 2b63_G* 2ja5_G* 2ja6_G* 2ja7_G* 2ja8_G* 2r7z_G 2r92_G 2r93_G 2vum_G* 3fki_G 3h3v_H 3hou_G* 3hov_G* ... Back     alignment and structure
>2b8k_G B16, DNA-directed RNA polymerase II 19 kDa polypeptide; DNA-dependent RNA polymerase, cellular RNA polymerase; 4.15A {Saccharomyces cerevisiae} SCOP: b.40.4.5 d.230.1.1 Back     alignment and structure
>2c35_B Human RPB7, DNA-directed RNA polymerase II 19 kDa polypeptide; transcription, nucleotidyltransferase; 2.70A {Homo sapiens} SCOP: b.40.4.5 d.230.1.1 Back     alignment and structure
>2je6_I RRP4, exosome complex RNA-binding protein 1; nuclease, hydrolase, exonuclease, phosphorolytic, exoribonuclease, RNA degradation; HET: 1PE; 1.6A {Sulfolobus solfataricus} SCOP: b.40.4.5 b.84.4.2 d.51.1.1 PDB: 2jea_I* 2jeb_I* 3l7z_C Back     alignment and structure
>3h0g_G DNA-directed RNA polymerase II subunit RPB7; transcription, multi-protein complex, DNA- binding, magnesium; 3.65A {Schizosaccharomyces pombe} Back     alignment and structure
>2ba0_A Archeal exosome RNA binding protein RRP4; RNAse PH, RNA degradation, exoribonuclease, S1domain, KH domain, archaeal; 2.70A {Archaeoglobus fulgidus} SCOP: b.40.4.5 b.84.4.2 d.51.1.1 Back     alignment and structure
>2z0s_A Probable exosome complex RNA-binding protein 1; alpha/beta protein, cytoplasm, structural genomics, NPPSFA; 3.20A {Aeropyrum pernix} SCOP: b.40.4.5 d.51.1.1 Back     alignment and structure
>3go5_A Multidomain protein with S1 RNA-binding domains; structural genomics, joint center for structural genomics, JCSG; HET: MSE; 1.40A {Streptococcus pneumoniae} Back     alignment and structure
>1w36_D RECD, exodeoxyribonuclease V alpha chain; recombination, helicase, hydrolase, DNA repair; HET: DNA; 3.1A {Escherichia coli} SCOP: c.37.1.19 c.37.1.19 PDB: 3k70_D* Back     alignment and structure
>2ckz_B C25, DNA-directed RNA polymerase III 25 KD polypeptide; multiprotein complex, nucleotidyltransferase, nuclear protein, hypothetical protein; 3.2A {Saccharomyces cerevisiae} Back     alignment and structure
>2bx2_L Ribonuclease E, RNAse E; RNA-binding, RNA turnover, RNA processing, hydrolase, endonu nuclease; 2.85A {Escherichia coli} PDB: 2c0b_L 2c4r_L 2vmk_A 2vrt_A 1slj_A 1smx_A 1sn8_A Back     alignment and structure
>3ayh_B DNA-directed RNA polymerase III subunit RPC8; transcription; 2.19A {Schizosaccharomyces pombe} Back     alignment and structure
>2id0_A Exoribonuclease 2; RNAse, exonuclease, hydrolyase, mRNA decay, RNR family, hydrolase; 2.35A {Escherichia coli} SCOP: b.40.4.5 b.40.4.5 b.40.4.5 b.40.4.16 PDB: 2ix0_A* 2ix1_A Back     alignment and structure
>2bh8_A 1B11; transcription, molecular evolution, unique architecture, transcription regulation, phosphorylation; 1.9A {Escherichia coli} Back     alignment and structure
>3e1s_A Exodeoxyribonuclease V, subunit RECD; alpha and beta protein, ATP-binding, nucleotide-binding, HYD; 2.20A {Deinococcus radiodurans} PDB: 3gp8_A 3gpl_A* Back     alignment and structure
>2wp8_J Exosome complex exonuclease DIS3; nucleus, hydrolase, RNA-binding, exonucle binding, mitochondrion, rRNA processing; 3.00A {Saccharomyces cerevisiae} Back     alignment and structure
>4b3f_X DNA-binding protein smubp-2; hydrolase, helicase; 2.50A {Homo sapiens} PDB: 4b3g_A Back     alignment and structure
>3upu_A ATP-dependent DNA helicase DDA; RECA-like domain, SH3 domain, PIN-tower interface, coupling hydrolysis to DNA unwinding, ssDNA; 3.30A {Enterobacteria phage T4} Back     alignment and structure
>2nn6_H Exosome complex exonuclease RRP4; RNA, exosome, PM/SCL, phosphorolytic, hydrolase/transferase complex; 3.35A {Homo sapiens} SCOP: b.40.4.5 b.84.4.2 d.51.1.1 Back     alignment and structure
>2vnu_D Exosome complex exonuclease RRP44; hydrolase-RNA complex, RNA degradation, RNA-binding, RNA Pro; HET: 1PE; 2.30A {Saccharomyces cerevisiae} SCOP: b.40.4.5 b.40.4.5 b.40.4.5 b.40.4.16 Back     alignment and structure
>1hh2_P NUSA, N utilization substance protein A; transcription regulation, termination; 2.1A {Thermotoga maritima} SCOP: b.40.4.5 d.52.3.1 d.52.3.1 d.202.1.1 PDB: 1l2f_A Back     alignment and structure
>2b8t_A Thymidine kinase; deoxyribonucleoside kinase, zinc-binding domain, TK1, UU-TK, transferase; HET: THM; 2.00A {Ureaplasma parvum} SCOP: c.37.1.24 g.39.1.14 PDB: 2uz3_A* Back     alignment and structure
>2ja9_A Exosome complex exonuclease RRP40; RNA-binding protein, RNA, S1 domain, KH domain, hydrolase, RNA-binding, nuclear protein; 2.20A {Saccharomyces cerevisiae} SCOP: b.40.4.5 d.51.1.1 Back     alignment and structure
>3lfu_A DNA helicase II; SF1 helicase, ATP-binding, DNA damage, DNA REP replication, DNA-binding, hydrolase, nucleotide-B SOS response; HET: DNA; 1.80A {Escherichia coli} PDB: 2is6_A* 2is2_A* 2is1_A* 2is4_A* Back     alignment and structure
>3ec2_A DNA replication protein DNAC; helicase loader, replication initiation factor, ATP-binding, nucleotide-binding; HET: DNA ADP; 2.70A {Aquifex aeolicus} PDB: 3ecc_A* Back     alignment and structure
>2orw_A Thymidine kinase; TMTK, TP4A, transferase; HET: 4TA; 1.50A {Thermotoga maritima} PDB: 2qpo_A 2qq0_A* 2qqe_A* Back     alignment and structure
>3cpe_A Terminase, DNA packaging protein GP17; large terminase, alternative initiation, ATP-binding, DNA- binding, hydrolase, nuclease; HET: DNA; 2.80A {Bacteriophage T4} PDB: 3ezk_A* Back     alignment and structure
>3kl4_A SRP54, signal recognition 54 kDa protein; signal recognition particle, SRP, SRP54, FFH, signal sequenc peptide; 3.50A {Sulfolobus solfataricus} PDB: 1qzx_A 1qzw_A Back     alignment and structure
>1xx6_A Thymidine kinase; NESG, northeast structural genomics consortium, protein STRU initiative, PSI, structural genomics, DNA synthesis; HET: ADP; 2.00A {Clostridium acetobutylicum} SCOP: c.37.1.24 g.39.1.14 Back     alignment and structure
>2o0j_A Terminase, DNA packaging protein GP17; nucleotide-binding fold, hydrolase; HET: DNA ADP; 1.80A {Enterobacteria phage T4} PDB: 2o0h_A* 2o0k_A* Back     alignment and structure
>1x4q_A U4/U6 small nuclear ribonucleoprotein PRP3; PWI domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2gk6_A Regulator of nonsense transcripts 1; UPF1, helicase, NMD, hydrolase; HET: ADP; 2.40A {Homo sapiens} PDB: 2gjk_A* 2gk7_A 2xzo_A* 2xzp_A Back     alignment and structure
>3te6_A Regulatory protein SIR3; heterochromatin, gene silencing, SIR complex, HMR, HML, TELO AAA+ domain, structural, nucleus, gene RE; 2.80A {Saccharomyces cerevisiae} Back     alignment and structure
>3dm5_A SRP54, signal recognition 54 kDa protein; protein-RNA, signal recognition particle, SRP-GTPase, protein targeting, cytoplasm, GTP-binding; HET: GDP; 2.51A {Pyrococcus furiosus} Back     alignment and structure
>2px0_A Flagellar biosynthesis protein FLHF; SRP GTPase, flagellum, protein transport, biosynthetic protein; HET: GNP; 3.00A {Bacillus subtilis} PDB: 2px3_A* 3syn_A* Back     alignment and structure
>2xzl_A ATP-dependent helicase NAM7; hydrolase-RNA complex, NMD, RNA degradation, allosteric REGU; HET: ADP 1PE; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2w58_A DNAI, primosome component (helicase loader); ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.50A {Geobacillus kaustophilus HTA426} Back     alignment and structure
>2wjy_A Regulator of nonsense transcripts 1; nonsense mediated decay, zinc-finger, ATP-binding, metal-BIN UPF2, UPF1, helicase, hydrolase; 2.50A {Homo sapiens} PDB: 2wjv_A 2iyk_A Back     alignment and structure
>2orv_A Thymidine kinase; TP4A (P1-(5'-adenosyl)P4-(5'- (2'deoxythymidil))tetraphosphate, transferase; HET: 4TA; 2.30A {Homo sapiens} SCOP: c.37.1.24 g.39.1.14 Back     alignment and structure
>1k0r_A NUSA; two component arrangement, S1 domain, two K-homology domains., structural genomics, PSI, protein structure initiative; 1.70A {Mycobacterium tuberculosis} SCOP: b.40.4.5 d.52.3.1 d.52.3.1 d.202.1.1 Back     alignment and structure
>2j9r_A Thymidine kinase; TK1, DNK, lasso, transferase, ATP-binding, deoxyribonucleoside kinase, DNA synthesis, phosphate accept nucleotide-binding; HET: THM; 2.7A {Bacillus anthracis} PDB: 2ja1_A* Back     alignment and structure
>2kjq_A DNAA-related protein; solution structure, NESG, structural genomics, PSI-2, protei structure initiative; NMR {Neisseria meningitidis serogroup B} Back     alignment and structure
>1vma_A Cell division protein FTSY; TM0570, structural genomics, JCS protein structure initiative, PSI, joint center for structu genomics; HET: CIT; 1.60A {Thermotoga maritima} SCOP: a.24.13.1 c.37.1.10 Back     alignment and structure
>1njg_A DNA polymerase III subunit gamma; rossman-like fold, AAA+ ATPase domains, sensor 1, sensor 2, transferase; HET: DNA; 2.20A {Escherichia coli} SCOP: c.37.1.20 PDB: 1njf_A* Back     alignment and structure
>3e2i_A Thymidine kinase; Zn-binding, ATP-binding, DNA synthesis, nucleotide-B transferase; HET: MSE; 2.01A {Staphylococcus aureus} Back     alignment and structure
>1a5t_A Delta prime, HOLB; zinc finger, DNA replication; 2.20A {Escherichia coli K12} SCOP: a.80.1.1 c.37.1.20 PDB: 1jr3_E* 1xxh_E* 1xxi_E* 3glf_E* 3glg_E* 3glh_E* 3gli_E* Back     alignment and structure
>2nn6_G Exosome complex exonuclease RRP40; RNA, exosome, PM/SCL, phosphorolytic, hydrolase/transferase complex; 3.35A {Homo sapiens} SCOP: b.40.4.5 b.84.4.2 d.51.1.1 Back     alignment and structure
>2zpa_A Uncharacterized protein YPFI; RNA modification enzyme, RNA helicase, acetyltransferase, GCN5 acetyltransferase; HET: ACO ADP; 2.35A {Escherichia coli K12} Back     alignment and structure
>1fnn_A CDC6P, cell division control protein 6; ORC1, AAA protein, DNA replication initation factor, cell cycle control factor; HET: ADP; 2.00A {Pyrobaculum aerophilum} SCOP: a.4.5.11 c.37.1.20 Back     alignment and structure
>2w0m_A SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus solfataricus P2} Back     alignment and structure
>3syl_A Protein CBBX; photosynthesis, rubisco activase, AAA+ protein, calvin cycle chaperone; 3.00A {Rhodobacter sphaeroides} PDB: 3syk_A 3zuh_A* Back     alignment and structure
>2v1u_A Cell division control protein 6 homolog; DNA replication, nucleotide-binding, replication, archaea; HET: ADP; 3.10A {Aeropyrum pernix} Back     alignment and structure
>2qby_B CDC6 homolog 3, cell division control protein 6 homolog 3; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} Back     alignment and structure
>3n70_A Transport activator; sigma-54, ntpase, PSI, MCSG, structural genomics, center for structural genomics; 2.80A {Escherichia coli} Back     alignment and structure
>2pt7_A CAG-ALFA; ATPase, protein-protein complex, type IV secretion, hydrolas binding complex; 2.40A {Helicobacter pylori} SCOP: c.37.1.11 PDB: 1nly_A* 1nlz_A 1opx_A* 1g6o_A Back     alignment and structure
>2chg_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATPase, ATP-binding, nucleotide-binding; HET: ANP; 2.1A {Archaeoglobus fulgidus} Back     alignment and structure
>3vkw_A Replicase large subunit; alpha/beta domain, helicase, transferase; 1.90A {Tomato mosaic virus} Back     alignment and structure
>2qgz_A Helicase loader, putative primosome component; structural genomics, PSI-2, protein structure initiative; 2.40A {Streptococcus pyogenes serotype M3} Back     alignment and structure
>2asb_A Transcription elongation protein NUSA; protein-RNA complex, transcription/RNA complex; 1.50A {Mycobacterium tuberculosis} SCOP: b.40.4.5 d.52.3.1 d.52.3.1 PDB: 2atw_A Back     alignment and structure
>1ls1_A Signal recognition particle protein; FFH, SRP54, SRP, GTPase, ultrahigh resolution, protein transport; 1.10A {Thermus aquaticus} SCOP: a.24.13.1 c.37.1.10 PDB: 1jpn_B* 1jpj_A* 1ry1_U* 2j45_A* 1o87_A* 2c04_A* 2j46_A* 1rj9_B* 2c03_A* 2j7p_A* 1okk_A* 2cnw_A* 1ng1_A* 2xkv_A 3ng1_A 1ffh_A 2ng1_A* Back     alignment and structure
>3bos_A Putative DNA replication factor; P-loop containing nucleoside triphosphate hydrolases, struct genomics; HET: MSE CDP; 1.75A {Shewanella amazonensis} PDB: 3sc3_A Back     alignment and structure
>2p65_A Hypothetical protein PF08_0063; CLPB, malaria, structural genomics, structural genomics consortium, SGC, unknown function; 1.70A {Plasmodium falciparum} Back     alignment and structure
>2qen_A Walker-type ATPase; unknown function; HET: ADP; 2.25A {Pyrococcus abyssi} Back     alignment and structure
>3e70_C DPA, signal recognition particle receptor; FTSY, SRP-GTPase, protein-targeting, transport protein; HET: GDP; 1.97A {Pyrococcus furiosus} PDB: 3dmd_B 3dm9_B* Back     alignment and structure
>1w4r_A Thymidine kinase; type II, human, cytosolic, phosphorylation, transferase; HET: TTP; 1.83A {Homo sapiens} PDB: 1xbt_A* 2wvj_A* 2j87_A* Back     alignment and structure
>1l8q_A Chromosomal replication initiator protein DNAA; AAA+, helix-turn-helix, nucleotide-binding, DNA binding, REP initiation, DNA binding protein; HET: ADP; 2.70A {Aquifex aeolicus} SCOP: a.4.12.2 c.37.1.20 PDB: 3r8f_A* 2hcb_A* Back     alignment and structure
>3h4m_A Proteasome-activating nucleotidase; ATPase, PAN, ATP-binding, nucleotide-binding, HY; HET: ADP; 3.11A {Methanocaldococcus jannaschii} Back     alignment and structure
>3b9p_A CG5977-PA, isoform A; AAA ATPase, ATP-binding, nucleotide-binding, hydrolase; 2.70A {Drosophila melanogaster} Back     alignment and structure
>1cr0_A DNA primase/helicase; RECA-type protein fold, transferase; HET: DNA; 2.30A {Enterobacteria phage T7} SCOP: c.37.1.11 PDB: 1cr1_A* 1cr2_A* 1cr4_A* 1e0j_A* 1e0k_A* Back     alignment and structure
>2yhs_A FTSY, cell division protein FTSY; cell cycle, protein targeting, simibi class GTPase, GTP-BIND membrane, nucleotide-binding; 1.60A {Escherichia coli} PDB: 2qy9_A 2xxa_B* 1fts_A Back     alignment and structure
>2qby_A CDC6 homolog 1, cell division control protein 6 homolog 1; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} Back     alignment and structure
>1sxj_E Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>1jr3_A DNA polymerase III subunit gamma; processivity, processivity clamp, clamp loader, AAA+ ATPase, transferase; HET: DNA; 2.70A {Escherichia coli} SCOP: a.80.1.1 c.37.1.20 PDB: 1xxh_B* 3glh_B* 3glf_B* 3gli_B* 3glg_B* 1xxi_B* Back     alignment and structure
>1sxj_A Activator 1 95 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>3vfd_A Spastin; ATPase, microtubule severing, hydrolase; 3.30A {Homo sapiens} Back     alignment and structure
>1iqp_A RFCS; clamp loader, extended AAA-ATPase domain, complex with ADP, replication; HET: ADP; 2.80A {Pyrococcus furiosus} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>1d2n_A N-ethylmaleimide-sensitive fusion protein; hexamerization domain, ATPase, transport; HET: ANP; 1.75A {Cricetulus griseus} SCOP: c.37.1.20 PDB: 1nsf_A* Back     alignment and structure
>2bjv_A PSP operon transcriptional activator; AAA, transcription activation, gene regulation, sigma54 activator, enhancer binding protein, PSPF; 1.7A {Escherichia coli} PDB: 2bjw_A 2c96_A* 2c98_A* 2c99_A* 2c9c_A* 2vii_A* Back     alignment and structure
>3u61_B DNA polymerase accessory protein 44; AAA+, ATP hydrolase, clamp loader, sliding clamp, primer-TEM DNA, DNA binding protein-DNA complex; HET: DNA ADP 08T; 3.20A {Enterobacteria phage T4} PDB: 3u5z_B* 3u60_B* Back     alignment and structure
>2bh8_A 1B11; transcription, molecular evolution, unique architecture, transcription regulation, phosphorylation; 1.9A {Escherichia coli} Back     alignment and structure
>1uaa_A REP helicase, protein (ATP-dependent DNA helicase REP.); complex (helicase/DNA), DNA unwinding, hydrolase/DNA complex; HET: DNA; 3.00A {Escherichia coli} SCOP: c.37.1.19 c.37.1.19 Back     alignment and structure
>1j8m_F SRP54, signal recognition 54 kDa protein; signaling protein; 2.00A {Acidianus ambivalens} SCOP: a.24.13.1 c.37.1.10 PDB: 1j8y_F Back     alignment and structure
>3u4q_A ATP-dependent helicase/nuclease subunit A; helicase, nuclease, double strand DNA repair, protein-DNA CO hydrolase-DNA complex; HET: DNA; 2.80A {Bacillus subtilis} PDB: 3u44_A* Back     alignment and structure
>2ffh_A Protein (FFH); SRP54, signal recognition particle, GTPase, M domain, RNA-binding, signal sequence-binding, helix-turn-helix, protein targeting; 3.20A {Thermus aquaticus} SCOP: a.24.13.1 a.36.1.1 c.37.1.10 PDB: 2iy3_A Back     alignment and structure
>1xwi_A SKD1 protein; VPS4B, AAA ATPase, protein transport; 2.80A {Homo sapiens} Back     alignment and structure
>1pjr_A PCRA; DNA repair, DNA replication, SOS response, helicase, ATP- binding, DNA-binding; 2.50A {Geobacillus stearothermophilus} SCOP: c.37.1.19 c.37.1.19 PDB: 1qhg_A* 3pjr_A* 2pjr_A* 1qhh_B* 1qhh_D* 1qhh_A* 1qhh_C* 2pjr_B* Back     alignment and structure
>2qp9_X Vacuolar protein sorting-associated protein 4; ATPase domain, beta domain, C-terminal helix, ATP-binding, E nucleotide-binding; 2.90A {Saccharomyces cerevisiae} PDB: 2qpa_A* Back     alignment and structure
>2qz4_A Paraplegin; AAA+, SPG7, protease, ADP, structural genomics, structural G consortium, SGC, ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.22A {Homo sapiens} Back     alignment and structure
>2fna_A Conserved hypothetical protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE ADP; 2.00A {Sulfolobus solfataricus} SCOP: a.4.5.11 c.37.1.20 Back     alignment and structure
>3eie_A Vacuolar protein sorting-associated protein 4; AAA ATPase, ATP-binding cassette, ATP-binding, endosome, MEM nucleotide-binding; 2.70A {Saccharomyces cerevisiae} PDB: 3eih_A* 2rko_A 3mhv_C Back     alignment and structure
>2gno_A DNA polymerase III, gamma subunit-related protein; structural genomics, joint center for structural genomics, J protein structure initiative; HET: DNA; 2.00A {Thermotoga maritima} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>2r6a_A DNAB helicase, replicative helicase; replication, DNAB; 2.90A {Geobacillus stearothermophilus} PDB: 2r6c_A 2r6d_A 2r6e_A 2vyf_A 2vye_A Back     alignment and structure
>1hqc_A RUVB; extended AAA-ATPase domain, complex with nucleotide, hydrolase; HET: ADE; 3.20A {Thermus thermophilus} SCOP: a.4.5.11 c.37.1.20 PDB: 1ixs_B* 1ixr_C* Back     alignment and structure
>3pfi_A Holliday junction ATP-dependent DNA helicase RUVB; probable holliday junction DNA helicase; HET: ADP; 2.69A {Campylobacter jejuni subsp} Back     alignment and structure
>1sxj_D Activator 1 41 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>1sxj_C Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>3cf0_A Transitional endoplasmic reticulum ATPase; AAA, P97/VCP, ERAD, CDC48, ATP-binding, lipid-binding, nucle binding, nucleus, phosphoprotein, transport; HET: ADP; 3.00A {Mus musculus} Back     alignment and structure
>1w5s_A Origin recognition complex subunit 2 ORC2; replication, CDC6, DNA replication initiation, DNA BIND protein, AAA+ ATPase; HET: ADP; 2.4A {Aeropyrum pernix} SCOP: a.4.5.11 c.37.1.20 PDB: 1w5t_A* Back     alignment and structure
>1zu4_A FTSY; GTPase, signal recognition particle, SRP, receptor, protein transport; 1.95A {Mycoplasma mycoides} PDB: 1zu5_A Back     alignment and structure
>2z4s_A Chromosomal replication initiator protein DNAA; AAA+ ATPase, domain III (ATPase domain), ATP-binding, cytoplasm, DNA replication; HET: ADP; 3.00A {Thermotoga maritima} PDB: 2z4r_A* Back     alignment and structure
>1ojl_A Transcriptional regulatory protein ZRAR; response regulator, two component system, AAA domain, NTRC family, DNA-binding; HET: ATP; 3.0A {Salmonella typhimurium} Back     alignment and structure
>2xxa_A Signal recognition particle protein; protein transport, RNA/RNA binding protein, hydrolase, gtpas; HET: GCP; 3.94A {Escherichia coli} PDB: 2j28_9 Back     alignment and structure
>2j37_W Signal recognition particle 54 kDa protein (SRP54); ribosome, SRP, translation/RNA; 8.00A {Canis SP} PDB: 1wgw_A Back     alignment and structure
>3d8b_A Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, structural genomics consortium, ATP- hydrolase, magnesium, metal-binding, nucleotide-binding; HET: ADP; 2.00A {Homo sapiens} Back     alignment and structure
>3t15_A Ribulose bisphosphate carboxylase/oxygenase activ chloroplastic; photosynthesis, rubisco activase, AAA+ protein; 2.95A {Nicotiana tabacum} PDB: 3zw6_A Back     alignment and structure
>3k1j_A LON protease, ATP-dependent protease LON; ATP-binding, nucleotide-binding, Pro hydrolase; HET: ADP PE8; 2.00A {Thermococcus onnurineus} Back     alignment and structure
>3b9q_A Chloroplast SRP receptor homolog, alpha subunit CPFTSY; protein translocation, GTP-binding, nucleotide-binding, protein transport; 1.75A {Arabidopsis thaliana} Back     alignment and structure
>4b4t_J 26S protease regulatory subunit 8 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1rj9_A FTSY, signal recognition protein; SRP-GTPase domain, heterodimer, nucleotide twinning, protein complex, protein transport; HET: GCP; 1.90A {Thermus aquaticus} SCOP: a.24.13.1 c.37.1.10 PDB: 2q9c_A* 2q9b_A* 2q9a_A* 1okk_D* 2xkv_D 2iyl_D* 2cnw_D* 2j7p_D* Back     alignment and structure
>1g5t_A COB(I)alamin adenosyltransferase; P-loop protein, cobalamin biosynthesis, RECA fold; HET: ATP; 1.80A {Salmonella typhimurium} SCOP: c.37.1.11 PDB: 1g5r_A* 1g64_A* Back     alignment and structure
>2og2_A Putative signal recognition particle receptor; nucleotide-binding, protein transport; 2.00A {Arabidopsis thaliana} Back     alignment and structure
>4fcw_A Chaperone protein CLPB; AAA domain; HET: ADP; 2.35A {Thermus thermophilus} PDB: 4fcv_A* 4fd2_A* 4fct_A* Back     alignment and structure
>2q6t_A DNAB replication FORK helicase; hydrolase; 2.90A {Thermus aquaticus} Back     alignment and structure
>3pvs_A Replication-associated recombination protein A; maintenance of genome stability Pro recombination; 2.50A {Escherichia coli} Back     alignment and structure
>4b4t_H 26S protease regulatory subunit 7 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2zan_A Vacuolar protein sorting-associating protein 4B; SKD1, VPS4B, AAA ATPase, ATP-binding, coiled coil, membrane, nucleotide-binding, phosphorylation; HET: ATP; 3.00A {Mus musculus} PDB: 2zam_A* 2zao_A* 2jqh_A 2jqk_A 1wr0_A 2jq9_A 2k3w_A 1yxr_A Back     alignment and structure
>1sxj_B Activator 1 37 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>2v3c_C SRP54, signal recognition 54 kDa protein; nucleotide-binding, signal recognition particle, GTP-binding, RNA-binding; 2.50A {Methanocaldococcus jannaschii} PDB: 3ndb_B Back     alignment and structure
>4b4t_M 26S protease regulatory subunit 6A; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4aby_A DNA repair protein RECN; hydrolase, double strand break repair, ATPase, nucleotide binding domain; HET: DNA; 3.00A {Deinococcus radiodurans} Back     alignment and structure
>3pxi_A Negative regulator of genetic competence CLPC/MEC; CLPB, proteolysis, CLPX, HSP100/CLP, AAA+ proteins, PR binding; 6.93A {Bacillus subtilis} Back     alignment and structure
>2eyu_A Twitching motility protein PILT; pilus retraction motor, C-terminal domain PILT, protein transport; 1.87A {Aquifex aeolicus} Back     alignment and structure
>3b85_A Phosphate starvation-inducible protein; PHOH2, ATPase, PFAM: PF02562, ST genomics, PSI-2, protein structure initiative; 2.35A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>4b4t_L 26S protease subunit RPT4; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4b4t_K 26S protease regulatory subunit 6B homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4b4t_I 26S protease regulatory subunit 4 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2chq_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATP ATP-binding, nucleotide-binding; HET: ANP; 3.5A {Archaeoglobus fulgidus} PDB: 2chv_A Back     alignment and structure
>3v53_A RNA-binding protein 25; PWI, RNA-binding domain; 2.90A {Homo sapiens} Back     alignment and structure
>3jvv_A Twitching mobility protein; hexameric P-loop ATPase, secretion ATPase, ATP-binding, FIMB nucleotide-binding, transport; HET: ACP CIT; 2.60A {Pseudomonas aeruginosa} PDB: 3jvu_A* Back     alignment and structure
>1kgd_A CASK, peripheral plasma membrane CASK; maguk, guanylate kinase like domain, protein binding; 1.31A {Homo sapiens} SCOP: c.37.1.1 Back     alignment and structure
>3hr8_A Protein RECA; alpha and beta proteins (A/B, A+B), ATP-binding, cytoplasm, damage, DNA recombination, DNA repair, DNA-binding; 1.95A {Thermotoga maritima} Back     alignment and structure
>1xp8_A RECA protein, recombinase A; recombination, radioresistance, DNA-repair, ATPase, DNA-BIND protein, DNA binding protein; HET: AGS; 2.50A {Deinococcus radiodurans} SCOP: c.37.1.11 d.48.1.1 Back     alignment and structure
>2ce7_A Cell division protein FTSH; metalloprotease; HET: ADP; 2.44A {Thermotoga maritima} SCOP: a.269.1.1 c.37.1.20 PDB: 2cea_A* 3kds_E* Back     alignment and structure
>3ney_A 55 kDa erythrocyte membrane protein; structural genomics consortium, SGC, 55 kDa erythrocyte MEMB protein; 2.26A {Homo sapiens} SCOP: c.37.1.0 Back     alignment and structure
>3hu3_A Transitional endoplasmic reticulum ATPase; VCP, transport protein; HET: AGS; 2.20A {Homo sapiens} PDB: 3hu2_A* 3hu1_A* 1e32_A* 1s3s_A* Back     alignment and structure
>3cmu_A Protein RECA, recombinase A; homologous recombination, recombination/DNA complex; HET: DNA ADP; 4.20A {Escherichia coli} Back     alignment and structure
>2ewv_A Twitching motility protein PILT; pilus retraction motor, ATPase, hexameric PILT, protein TRAN; HET: ADP; 2.80A {Aquifex aeolicus} PDB: 2eww_A* 2gsz_A* Back     alignment and structure
>3tr0_A Guanylate kinase, GMP kinase; purines, pyrimidines, nucleosides, nucleotides, transferase; HET: 5GP; 1.85A {Coxiella burnetii} Back     alignment and structure
>3co5_A Putative two-component system transcriptional RES regulator; structural genomics, APC89341.1; 2.40A {Neisseria gonorrhoeae} Back     alignment and structure
>1p9r_A General secretion pathway protein E; bacterial type II secretion system cytoplasmic protein - GSPE, putative ATPase/ ATP binding protein; 2.50A {Vibrio cholerae} SCOP: c.37.1.11 PDB: 1p9w_A* Back     alignment and structure
>2zts_A Putative uncharacterized protein PH0186; KAIC like protein, ATP-binding, nucleotide-binding, ATP- binding protein; HET: ADP; 2.07A {Pyrococcus horikoshii} Back     alignment and structure
>1r6b_X CLPA protein; AAA+, N-terminal domain, CLPS, crystal, binding mechanism, hydrolase; HET: ADP; 2.25A {Escherichia coli} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 PDB: 1ksf_X* Back     alignment and structure
>2gza_A Type IV secretion system protein VIRB11; ATPase, hydrolase; 2.60A {Brucella suis} Back     alignment and structure
>4a1f_A DNAB helicase, replicative DNA helicase; hydrolase, DNA replication, ATPase; HET: FLC; 2.50A {Helicobacter pylori} Back     alignment and structure
>1jjg_A M156R; beta barrel, S1 motif, OB fold, MYXV156R, NESG project, structural genomics, EIF-2A homolog, PSI, protein structure initiative; NMR {Myxoma virus} SCOP: b.40.4.5 Back     alignment and structure
>3tau_A Guanylate kinase, GMP kinase; structural genomics, center for structural genomics of infec diseases, csgid, putative guanylate kinase; HET: MSE; 2.05A {Listeria monocytogenes} Back     alignment and structure
>2j41_A Guanylate kinase; GMP, GMK, transferase, ATP-binding, nucleotide- binding; HET: 5GP; 1.9A {Staphylococcus aureus} Back     alignment and structure
>3cf2_A TER ATPase, transitional endoplasmic reticulum ATPase, valosi; AAA, CDC48, ERAD, transport protein; HET: ADP ANP; 3.50A {Mus musculus} PDB: 3cf1_A* 3cf3_A* 1r7r_A* Back     alignment and structure
>1lvg_A Guanylate kinase, GMP kinase; transferase; HET: ADP 5GP; 2.10A {Mus musculus} SCOP: c.37.1.1 Back     alignment and structure
>2oap_1 GSPE-2, type II secretion system protein; hexameric ATPase, hydrolase; HET: ANP; 2.95A {Archaeoglobus fulgidus} PDB: 2oaq_1 Back     alignment and structure
>2cvh_A DNA repair and recombination protein RADB; filament formation, homologous recombination, ATPase domain, hyperthermophIle; HET: DNA; 2.20A {Thermococcus kodakarensis} PDB: 2cvf_A* Back     alignment and structure
>1znw_A Guanylate kinase, GMP kinase; ATP:GMP-phosphotransferase, TR; 2.10A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1znx_A* 1zny_A* 1znz_A* 1s4q_A 1z8f_A Back     alignment and structure
>1z6g_A Guanylate kinase; structural genomics, SGC, structural genom consortium, transferase; HET: EPE; 2.18A {Plasmodium falciparum} Back     alignment and structure
>1zp6_A Hypothetical protein ATU3015; alpha-beta protein., structural genomics, PSI, protein struc initiative; 3.20A {Agrobacterium tumefaciens str} SCOP: c.37.1.25 Back     alignment and structure
>1n0w_A DNA repair protein RAD51 homolog 1; DNA repair, homologous recombination, breast cancer susceptibility, RECA-like ATPase, protein complex; HET: DNA MSE; 1.70A {Homo sapiens} SCOP: c.37.1.11 Back     alignment and structure
>2l8b_A Protein TRAI, DNA helicase I; RECD, hydrolase; NMR {Escherichia coli} Back     alignment and structure
>1qvr_A CLPB protein; coiled coil, AAA ATPase, chaperone; HET: ANP; 3.00A {Thermus thermophilus} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 Back     alignment and structure
>4gp7_A Metallophosphoesterase; polynucleotide kinase phosphatase, RNA repair, transferase; HET: ATP CIT; 2.00A {Clostridium thermocellum} PDB: 4gp6_A* Back     alignment and structure
>1jbk_A CLPB protein; beta barrel, chaperone; 1.80A {Escherichia coli} SCOP: c.37.1.20 Back     alignment and structure
>3vaa_A Shikimate kinase, SK; structural genomics, center for structural genomics of infec diseases, csgid, metal binding, transferase; 1.70A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3cf2_A TER ATPase, transitional endoplasmic reticulum ATPase, valosi; AAA, CDC48, ERAD, transport protein; HET: ADP ANP; 3.50A {Mus musculus} PDB: 3cf1_A* 3cf3_A* 1r7r_A* Back     alignment and structure
>2v9p_A Replication protein E1; AAA+ molecular motor, DNA replication, DNA translocation, nucleotide-binding, DNA-binding; 3.00A {Bovine papillomavirus type 1} PDB: 2gxa_A* Back     alignment and structure
>2r7d_A Ribonuclease II family protein; structural genomics, PSI-2, structure initiative, northeast structural genomics consort NESG; 1.80A {Deinococcus radiodurans R1} SCOP: b.40.4.5 b.40.4.16 PDB: 2r7f_A Back     alignment and structure
>4f4c_A Multidrug resistance protein PGP-1; ABC transporter, ATPase, multi-drug transporter, exporter, A binding, hydrolase,protein transport; HET: NDG NAG BMA MAN 0SA; 3.40A {Caenorhabditis elegans} Back     alignment and structure
>3umf_A Adenylate kinase; rossmann fold, transferase; 2.05A {Schistosoma mansoni} Back     alignment and structure
>2dr3_A UPF0273 protein PH0284; RECA superfamily ATPase, hexamer, structural genomics; HET: ADP; 2.00A {Pyrococcus horikoshii} Back     alignment and structure
>3b5x_A Lipid A export ATP-binding/permease protein MSBA; ABC transporter, lipid flippase, hydrolase, inner membrane, lipid transport, membrane; 5.50A {Vibrio cholerae} Back     alignment and structure
>3d0f_A Penicillin-binding 1 transmembrane protein MRCA; BIG_1156.2, STR genomics, PSI-2, protein structure initiative; 1.64A {Nitrosomonas europaea atcc 19718} Back     alignment and structure
>1kht_A Adenylate kinase; phosphotransferase, signaling protein, transferase; HET: AMP; 2.50A {Methanococcus voltae} SCOP: c.37.1.1 PDB: 3h86_B* 1ki9_A Back     alignment and structure
>1e9r_A Conjugal transfer protein TRWB; coupling protein, bacterial conjugation, F1-ATPase-like quaternary structure, ring helicases; 2.4A {Escherichia coli} SCOP: c.37.1.11 PDB: 1e9s_A 1gki_A* 1gl7_A* 1gl6_A* Back     alignment and structure
>2qor_A Guanylate kinase; phosphotransferase, purine metabolism, structural genomics, structural genomics of pathogenic protozoa consortium; HET: 5GP POP; 1.80A {Plasmodium vivax} Back     alignment and structure
>1mp1_A Ser/Arg-related nuclear matrix protein; four helix bundle, RNA binding protein; NMR {Homo sapiens} SCOP: a.188.1.1 Back     alignment and structure
>3trf_A Shikimate kinase, SK; amino acid biosynthesis, transferase; 2.60A {Coxiella burnetii} Back     alignment and structure
>1s96_A Guanylate kinase, GMP kinase; E.coli, dimer, SAD, transferase; 2.00A {Escherichia coli} SCOP: c.37.1.1 PDB: 2an9_A* 2anb_A* 2anc_A 2f3r_A* 2f3t_A* Back     alignment and structure
>3lnc_A Guanylate kinase, GMP kinase; ALS collaborative crystallography, emerald biostructures, ATP-binding, cytoplasm, nucleotide-binding; HET: 5GP; 1.95A {Anaplasma phagocytophilum} Back     alignment and structure
>3exa_A TRNA delta(2)-isopentenylpyrophosphate transferase; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; 2.30A {Bacillus halodurans} PDB: 2qgn_A Back     alignment and structure
>3lw7_A Adenylate kinase related protein (ADKA-like); AMP, PSI, MCSG, structural genomics, midwest center for structural genomics; HET: AMP; 2.30A {Sulfolobus solfataricus} PDB: 3h0k_A Back     alignment and structure
>3sr0_A Adenylate kinase; phosphoryl transfer analogue, ALF4, transferase (phosphotran phosphoryl transfer, nucleotide-binding; HET: ADP AMP; 1.56A {Aquifex aeolicus} PDB: 2rh5_A 2rgx_A* Back     alignment and structure
>4ag6_A VIRB4 ATPase, type IV secretory pathway VIRB4 components-like P; hydrolase, type IV secretion, conjugation; 2.35A {Thermoanaerobacter pseudethanolicus} PDB: 4ag5_A Back     alignment and structure
>3lda_A DNA repair protein RAD51; DNA binding protein, ATP-binding, DNA damage, DNA recombinat repair, nucleotide-binding; HET: DNA; 2.50A {Saccharomyces cerevisiae} PDB: 1szp_A* Back     alignment and structure
>1qvr_A CLPB protein; coiled coil, AAA ATPase, chaperone; HET: ANP; 3.00A {Thermus thermophilus} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 Back     alignment and structure
>3a8t_A Adenylate isopentenyltransferase; rossmann fold protein; HET: ATP; 2.37A {Humulus lupulus} Back     alignment and structure
>4eun_A Thermoresistant glucokinase; putative sugar kinase, enzyme function initiative, EFI, STRU genomics, transferase; 1.60A {Janibacter SP} Back     alignment and structure
>3ux8_A Excinuclease ABC, A subunit; UVRA, nucleotide excision repair, DNA repair, ABC ATPase, DN binding protein; HET: ADP; 2.10A {Geobacillus} Back     alignment and structure
>4a74_A DNA repair and recombination protein RADA; hydrolase, recombinase; HET: DNA ANP; 1.48A {Pyrococcus furiosus} PDB: 4a6x_A* 4a6p_A* 4a7o_A* Back     alignment and structure
>2c95_A Adenylate kinase 1; transferase, AP4A, nucleotide kinase, transferase ATP-bindi; HET: B4P; 1.71A {Homo sapiens} PDB: 1z83_A* 3adk_A Back     alignment and structure
>1zd8_A GTP:AMP phosphotransferase mitochondrial; ATP:AMP phosphotransferase, myokinase, structural genomics, structural genomics consortium, SGC; 1.48A {Homo sapiens} PDB: 2ak3_A* Back     alignment and structure
>3tif_A Uncharacterized ABC transporter ATP-binding prote; nucleotide-binding domain, ABC transporter ATPase; HET: ADP; 1.80A {Methanocaldococcus jannaschii dsm 2661ORGANISM_TAXID} PDB: 1l2t_A* 1f3o_A* Back     alignment and structure
>3cm0_A Adenylate kinase; ATP-binding, cytoplasm, nucleotide biosynthesis, nucleotide-binding, transferase, structural genomics; 1.80A {Thermus thermophilus} Back     alignment and structure
>1kag_A SKI, shikimate kinase I; transferase, structural genomics, PSI, protein structure initiative; 2.05A {Escherichia coli} SCOP: c.37.1.2 Back     alignment and structure
>2dhr_A FTSH; AAA+ protein, hexameric Zn metalloprotease, hydrolase; HET: ADP; 3.90A {Thermus thermophilus} Back     alignment and structure
>3kb2_A SPBC2 prophage-derived uncharacterized protein YORR; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; HET: G3D; 2.20A {Bacillus subtilis} SCOP: c.37.1.1 PDB: 2axp_A* Back     alignment and structure
>1qhx_A CPT, protein (chloramphenicol phosphotransferase); kinase, antibiotic resistance, phosphorylation, mononucleoti binding fold; HET: ATP; 2.50A {Streptomyces venezuelae} SCOP: c.37.1.3 PDB: 1grr_A* 1grq_A 1qhs_A* 1qhn_A* 1qhy_A* Back     alignment and structure
>4f4c_A Multidrug resistance protein PGP-1; ABC transporter, ATPase, multi-drug transporter, exporter, A binding, hydrolase,protein transport; HET: NDG NAG BMA MAN 0SA; 3.40A {Caenorhabditis elegans} Back     alignment and structure
>2z43_A DNA repair and recombination protein RADA; archaea, filament, DNA binding, molecular SWI RECA, DMC1; HET: DNA; 1.93A {Sulfolobus solfataricus} PDB: 2bke_A* 2dfl_A* 2zub_A* 2zuc_A* 2zud_A* Back     alignment and structure
>1nlf_A Regulatory protein REPA; replicative DNA helicase structural changes, replication; 1.95A {Escherichia coli} SCOP: c.37.1.11 PDB: 1g8y_A 1olo_A Back     alignment and structure
>2qmh_A HPR kinase/phosphorylase; V267F mutation, ATP-binding, carbohydrate metabolism, magnesium, metal-binding, multifunctional enzyme; 2.60A {Lactobacillus casei} PDB: 1jb1_A 1kkl_A 1kkm_A* Back     alignment and structure
>1knq_A Gluconate kinase; ALFA/beta structure, transferase; 2.00A {Escherichia coli} SCOP: c.37.1.17 PDB: 1ko1_A 1ko4_A 1ko5_A* 1ko8_A* 1kof_A* Back     alignment and structure
>3c8u_A Fructokinase; YP_612366.1, putative fructose transport system kinase, STRU genomics, joint center for structural genomics, JCSG; 1.95A {Silicibacter SP} Back     alignment and structure
>2bwj_A Adenylate kinase 5; phosphoryl transfer reaction, transferase; HET: AMP; 2.3A {Homo sapiens} Back     alignment and structure
>2bdt_A BH3686; alpha-beta protein, structural genomics, PSI, protein struct initiative, northeast structural genomics consortium, NESG, function; 2.40A {Bacillus halodurans} SCOP: c.37.1.25 Back     alignment and structure
>2ze6_A Isopentenyl transferase; crown GALL tumor, cytokinin biosynthesis; HET: DST AMP; 2.10A {Agrobacterium tumefaciens} PDB: 2ze5_A* 2ze7_A* 2ze8_A Back     alignment and structure
>1tev_A UMP-CMP kinase; ploop, NMP binding region, LID region, conformational changes, transferase; 2.10A {Homo sapiens} SCOP: c.37.1.1 Back     alignment and structure
>1ly1_A Polynucleotide kinase; PNK, phosphatase, transferase; 2.00A {Enterobacteria phage T4} SCOP: c.37.1.1 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 1176
d1yksa2299 c.37.1.14 (A:325-623) YFV helicase domain {Yellow 3e-68
d2bmfa2305 c.37.1.14 (A:178-482) Dengue virus helicase {Dengu 1e-52
d1a1va1136 c.37.1.14 (A:190-325) HCV helicase domain {Human h 4e-29
d1yksa1140 c.37.1.14 (A:185-324) YFV helicase domain {Yellow 2e-16
d1sroa_76 b.40.4.5 (A:) S1 RNA-binding domain of polyribonuc 4e-14
d2ahob284 b.40.4.5 (B:1-84) Eukaryotic initiation factor 2al 7e-13
d2nn6h195 b.40.4.5 (H:73-167) S1-domain of Ribosomal RNA-pro 1e-12
d1kl9a286 b.40.4.5 (A:3-88) Eukaryotic initiation factor 2al 3e-12
d2z0sa188 b.40.4.5 (A:60-147) S1-domain of exosome complex R 9e-12
d3bzka494 b.40.4.5 (A:637-730) Tex S1-domain {Pseudomonas ae 1e-11
d1e3pa262 b.40.4.5 (A:656-717) S1 RNA-binding domain of poly 1e-11
d1go3e1106 b.40.4.5 (E:79-184) C-terminal domain of RNA polym 4e-10
d2je6i187 b.40.4.5 (I:66-152) S1-domain of exosome complex R 3e-09
d2ba0a183 b.40.4.5 (A:53-135) S1-domain of exosome complex R 1e-08
d1y14b191 b.40.4.5 (B:81-171) C-terminal domain of RNA polym 2e-07
d2p6ra3202 c.37.1.19 (A:1-202) Hel308 helicase {Archaeoglobus 6e-06
d2c35b194 b.40.4.5 (B:78-171) C-terminal domain of RNA polym 4e-05
d2ix0a387 b.40.4.5 (A:558-644) Exoribonuclease 2, RNB {Esche 7e-05
d1wp9a2286 c.37.1.19 (A:201-486) putative ATP-dependent RNA h 2e-04
d1gkub1237 c.37.1.16 (B:1-250) Helicase-like "domain" of reve 2e-04
d2nn6g188 b.40.4.5 (G:107-194) S1-domain of exosome componen 0.002
d1sgwa_200 c.37.1.12 (A:) Putative ABC transporter PF0895 {Py 0.002
d1lkxa_684 c.37.1.9 (A:) Myosin S1, motor domain {Dictyosteli 0.004
d1oywa2206 c.37.1.19 (A:1-206) RecQ helicase domain {Escheric 0.004
>d1yksa2 c.37.1.14 (A:325-623) YFV helicase domain {Yellow fever virus [TaxId: 11089]} Length = 299 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: RNA helicase
domain: YFV helicase domain
species: Yellow fever virus [TaxId: 11089]

 Score =  229 bits (585), Expect = 3e-68
 Identities = 52/344 (15%), Positives = 96/344 (27%), Gaps = 56/344 (16%)

Query: 695  IPGRTFPVEILYTKQPESDYLDASLITVLQIHLTEPEGDILLFLTGQEEIDFACQSLYER 754
             P     +E + T  P   +            +   +     FL      +     +   
Sbjct: 6    FPHSNGEIEDVQTDIPSEPWNTGH------DWILADKRPTAWFLPSIRAAN----VMAAS 55

Query: 755  MKGLGKNVPELIILPVYSALPSEMQSRIFDPAPPGKRKVVVATNIAEASLTIDGIFYVID 814
            ++  GK+V     + +           I       K   ++AT+IAE    +  +  V+D
Sbjct: 56   LRKAGKSV-----VVLNRKTFEREYPTIKQK----KPDFILATDIAEMGANLC-VERVLD 105

Query: 815  PGFA-KQNVYNPKQGLDSLVITPISQASAKQRAGRAGRTGPGKCYRLYTESAYRNEMSPT 873
               A K  + +  + +       IS +SA QR GR GR  P +    Y    Y    S  
Sbjct: 106  CRTAFKPVLVDEGRKVAIKGPLRISASSAAQRRGRIGRN-PNRDGDSYY---YSEPTSEN 161

Query: 874  SIPEIQR----INLGFTTLTMKAMGINDLLSFDFMDPPSPQALISAMEQLYSLGALDEEG 929
            +   +      + L    +    +     +          +  +   ++      +    
Sbjct: 162  NAHHVCWLEASMLLDNMEVRGGMVAPLYGVEGTKTPVSPGEMRLRDDQRKVFRELVRNCD 221

Query: 930  LLTKLGRKMAEFPLDPPLSKMLLASVDLGCSDEILTIIAMIQTGNIFYRPREKQAQAD-Q 988
            L   L  ++A+  L     K                          F  P E +   D  
Sbjct: 222  LPVWLSWQVAKAGLKTNDRKWC------------------------FEGPEEHEILNDSG 257

Query: 989  KRAKFFQPEGDHLTLLAVYEAWKAKNFSGPWCFENFVQSRSLRR 1032
            +  K   P G    L   +     +  S       F++    RR
Sbjct: 258  ETVKCRAPGGAKKPLRPRW--CDERVSSDQSALSEFIKFAEGRR 299
>d2bmfa2 c.37.1.14 (A:178-482) Dengue virus helicase {Dengue virus type 2 [TaxId: 11060]} Length = 305 Back     information, alignment and structure
>d1a1va1 c.37.1.14 (A:190-325) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} Length = 136 Back     information, alignment and structure
>d1yksa1 c.37.1.14 (A:185-324) YFV helicase domain {Yellow fever virus [TaxId: 11089]} Length = 140 Back     information, alignment and structure
>d1sroa_ b.40.4.5 (A:) S1 RNA-binding domain of polyribonucleotide phosphorylase, PNPase {Escherichia coli [TaxId: 562]} Length = 76 Back     information, alignment and structure
>d2ahob2 b.40.4.5 (B:1-84) Eukaryotic initiation factor 2alpha, eIF2alpha, N-terminal domain {Sulfolobus solfataricus [TaxId: 2287]} Length = 84 Back     information, alignment and structure
>d2nn6h1 b.40.4.5 (H:73-167) S1-domain of Ribosomal RNA-processing protein 4, RRP4 {Human (Homo sapiens) [TaxId: 9606]} Length = 95 Back     information, alignment and structure
>d1kl9a2 b.40.4.5 (A:3-88) Eukaryotic initiation factor 2alpha, eIF2alpha, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 86 Back     information, alignment and structure
>d2z0sa1 b.40.4.5 (A:60-147) S1-domain of exosome complex RNA-binding protein 1, ECR1 {Aeropyrum pernix [TaxId: 56636]} Length = 88 Back     information, alignment and structure
>d3bzka4 b.40.4.5 (A:637-730) Tex S1-domain {Pseudomonas aeruginosa [TaxId: 287]} Length = 94 Back     information, alignment and structure
>d1e3pa2 b.40.4.5 (A:656-717) S1 RNA-binding domain of polyribonucleotide phosphorylase, PNPase {Streptomyces antibioticus [TaxId: 1890]} Length = 62 Back     information, alignment and structure
>d1go3e1 b.40.4.5 (E:79-184) C-terminal domain of RNA polymerase II subunit RBP7 (RpoE) {Archaeon Methanococcus jannaschii [TaxId: 2190]} Length = 106 Back     information, alignment and structure
>d2je6i1 b.40.4.5 (I:66-152) S1-domain of exosome complex RNA-binding protein 1, ECR1 {Sulfolobus solfataricus [TaxId: 2287]} Length = 87 Back     information, alignment and structure
>d2ba0a1 b.40.4.5 (A:53-135) S1-domain of exosome complex RNA-binding protein 1, ECR1 {Archaeoglobus fulgidus [TaxId: 2234]} Length = 83 Back     information, alignment and structure
>d1y14b1 b.40.4.5 (B:81-171) C-terminal domain of RNA polymerase II subunit RBP7 (RpoE) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 91 Back     information, alignment and structure
>d2p6ra3 c.37.1.19 (A:1-202) Hel308 helicase {Archaeoglobus fulgidus [TaxId: 2234]} Length = 202 Back     information, alignment and structure
>d2c35b1 b.40.4.5 (B:78-171) C-terminal domain of RNA polymerase II subunit RBP7 (RpoE) {Human (Homo sapiens) [TaxId: 9606]} Length = 94 Back     information, alignment and structure
>d2ix0a3 b.40.4.5 (A:558-644) Exoribonuclease 2, RNB {Escherichia coli [TaxId: 562]} Length = 87 Back     information, alignment and structure
>d1wp9a2 c.37.1.19 (A:201-486) putative ATP-dependent RNA helicase PF2015 {Pyrococcus furiosus [TaxId: 2261]} Length = 286 Back     information, alignment and structure
>d1gkub1 c.37.1.16 (B:1-250) Helicase-like "domain" of reverse gyrase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Length = 237 Back     information, alignment and structure
>d2nn6g1 b.40.4.5 (G:107-194) S1-domain of exosome component 3 (RRP40) {Human (Homo sapiens) [TaxId: 9606]} Length = 88 Back     information, alignment and structure
>d1sgwa_ c.37.1.12 (A:) Putative ABC transporter PF0895 {Pyrococcus furiosus [TaxId: 2261]} Length = 200 Back     information, alignment and structure
>d1lkxa_ c.37.1.9 (A:) Myosin S1, motor domain {Dictyostelium discoideum, class-I myosin MyoE [TaxId: 44689]} Length = 684 Back     information, alignment and structure
>d1oywa2 c.37.1.19 (A:1-206) RecQ helicase domain {Escherichia coli [TaxId: 562]} Length = 206 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query1176
d2bmfa2305 Dengue virus helicase {Dengue virus type 2 [TaxId: 100.0
d1yksa2299 YFV helicase domain {Yellow fever virus [TaxId: 11 99.96
d1oywa3200 RecQ helicase domain {Escherichia coli [TaxId: 562 99.79
d1s2ma2171 Putative ATP-dependent RNA helicase DHH1 {Baker's 99.78
d1fuka_162 Initiation factor 4a {Baker's yeast (Saccharomyces 99.78
d2j0sa2168 Probable ATP-dependent RNA helicase DDX48 {Human ( 99.78
d2j0sa1222 Probable ATP-dependent RNA helicase DDX48 {Human ( 99.78
d1veca_206 DEAD box RNA helicase rck/p54 {Human (Homo sapiens 99.77
d1hv8a2155 Putative DEAD box RNA helicase {Archaeon Methanoco 99.77
d2rb4a1168 ATP-dependent RNA helicase DDX25 {Human (Homo sapi 99.77
d1t5ia_168 Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo 99.76
d1c4oa2174 Nucleotide excision repair enzyme UvrB {Thermus th 99.75
d1t6na_207 Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo 99.75
d2g9na1218 Initiation factor 4a {Human (Homo sapiens) [TaxId: 99.75
d2p6ra3202 Hel308 helicase {Archaeoglobus fulgidus [TaxId: 22 99.74
d1hv8a1208 Putative DEAD box RNA helicase {Archaeon Methanoco 99.74
d1t5la2181 Nucleotide excision repair enzyme UvrB {Bacillus c 99.73
d1qdea_212 Initiation factor 4a {Baker's yeast (Saccharomyces 99.72
d1jr6a_138 HCV helicase domain {Human hepatitis C virus (HCV) 99.7
d1a1va1136 HCV helicase domain {Human hepatitis C virus (HCV) 99.69
d1wrba1238 putative ATP-dependent RNA helicase VlgB {Flatworm 99.68
d1s2ma1206 Putative ATP-dependent RNA helicase DHH1 {Baker's 99.68
d1q0ua_209 Probable DEAD box RNA helicase YqfR {Bacillus stea 99.66
d1yksa1140 YFV helicase domain {Yellow fever virus [TaxId: 11 99.65
d1wp9a1200 putative ATP-dependent RNA helicase PF2015 {Pyroco 99.65
d2p6ra4201 Hel308 helicase {Archaeoglobus fulgidus [TaxId: 22 99.63
d1oywa2206 RecQ helicase domain {Escherichia coli [TaxId: 562 99.62
d1gkub1237 Helicase-like "domain" of reverse gyrase {Archaeon 99.59
d1wp9a2286 putative ATP-dependent RNA helicase PF2015 {Pyroco 99.57
d1sroa_76 S1 RNA-binding domain of polyribonucleotide phosph 99.54
d1kl9a286 Eukaryotic initiation factor 2alpha, eIF2alpha, N- 99.48
d1a1va2299 HCV helicase domain {Human hepatitis C virus (HCV) 99.46
d2ahob284 Eukaryotic initiation factor 2alpha, eIF2alpha, N- 99.45
d2eyqa5211 Transcription-repair coupling factor, TRCF {Escher 99.44
d2fz4a1206 DNA repair protein RAD25 {Archaeoglobus fulgidus [ 99.41
d1gm5a4206 RecG helicase domain {Thermotoga maritima [TaxId: 99.41
d1go3e1106 C-terminal domain of RNA polymerase II subunit RBP 99.36
d2ba0a183 S1-domain of exosome complex RNA-binding protein 1 99.34
d3bzka494 Tex S1-domain {Pseudomonas aeruginosa [TaxId: 287] 99.31
d1rifa_282 DNA helicase UvsW {Bacteriophage T4 [TaxId: 10665] 99.31
d2je6i187 S1-domain of exosome complex RNA-binding protein 1 99.28
d2fwra1200 DNA repair protein RAD25 {Archaeoglobus fulgidus [ 99.26
d2z0sa188 S1-domain of exosome complex RNA-binding protein 1 99.23
d1gm5a3264 RecG helicase domain {Thermotoga maritima [TaxId: 99.21
d1gkub2248 Helicase-like "domain" of reverse gyrase {Archaeon 99.21
d2eyqa3233 Transcription-repair coupling factor, TRCF {Escher 99.17
d1e3pa262 S1 RNA-binding domain of polyribonucleotide phosph 99.07
d1wi5a_119 S1-domain of RRP5 protein homolog (PDCD11, KIAA018 99.06
d2nn6h195 S1-domain of Ribosomal RNA-processing protein 4, R 99.02
d2ix0a387 Exoribonuclease 2, RNB {Escherichia coli [TaxId: 5 98.86
d1y14b191 C-terminal domain of RNA polymerase II subunit RBP 98.62
d1z3ix1346 Rad54-like, Rad54L {Zebra fish (Danio rerio) [TaxI 98.54
d1tf5a4175 Translocation ATPase SecA, nucleotide-binding doma 98.51
d2c35b194 C-terminal domain of RNA polymerase II subunit RBP 98.51
d2nn6g188 S1-domain of exosome component 3 (RRP40) {Human (H 98.5
d1z5za1244 Helicase of the SNF2/Rad54 hamily {Sulfolobus solf 98.32
d2ja9a190 S1-domain of exosome component 3 (RRP40) {Saccharo 98.22
d1okkd2207 GTPase domain of the signal recognition particle r 97.98
d1z3ix2298 Rad54-like, Rad54L {Zebra fish (Danio rerio) [TaxI 97.97
d2qy9a2211 GTPase domain of the signal recognition particle r 97.88
d1ls1a2207 GTPase domain of the signal sequence recognition p 97.87
d1w36d1359 Exodeoxyribonuclease V alpha chain (RecD) {Escheri 97.85
d1vmaa2213 GTPase domain of the signal recognition particle r 97.81
d1z63a1230 Helicase of the SNF2/Rad54 hamily {Sulfolobus solf 97.71
d2nn6i1125 Exosome component 1, EXOSC1 {Human (Homo sapiens) 97.68
d1nkta4219 Translocation ATPase SecA, nucleotide-binding doma 97.58
d1j8yf2211 GTPase domain of the signal sequence recognition p 97.43
d1nkta3288 Translocation ATPase SecA, nucleotide-binding doma 97.31
d1tf5a3273 Translocation ATPase SecA, nucleotide-binding doma 97.3
d1smxa_87 S1-domain of Ribonuclease E {Escherichia coli [Tax 97.14
d1hh2p172 S1 domain of NusA {Thermotoga maritima [TaxId: 233 97.02
d1uaaa1306 DEXX box DNA helicase {Escherichia coli, RepD [Tax 96.91
d1ye8a1178 Hypothetical kinase-like protein Aq_1292 {Aquifex 96.37
d1pjra1318 DEXX box DNA helicase {Bacillus stearothermophilus 96.36
d1a5ta2207 delta prime subunit of DNA polymerase III, N-domai 96.01
g1qhh.1623 DEXX box DNA helicase {Bacillus stearothermophilus 95.34
d1sxjc2227 Replication factor C3 {Baker's yeast (Saccharomyce 95.31
d2asba176 S1 domain of NusA {Mycobacterium tuberculosis [Tax 95.3
d2b8ta1139 Thymidine kinase, TK1, N-terminal domain {Ureaplas 94.95
d2gnoa2198 gamma subunit of DNA polymerase III, N-domain {The 94.8
d1njfa_239 delta prime subunit of DNA polymerase III, N-domai 94.71
d1l8qa2213 Chromosomal replication initiation factor DnaA {Aq 94.7
d2i3ba1189 Cancer-related NTPase, C1orf57 {Human (Homo sapien 94.65
d1sgwa_200 Putative ABC transporter PF0895 {Pyrococcus furios 94.56
d1sxjb2224 Replication factor C4 {Baker's yeast (Saccharomyce 94.48
d1iqpa2231 Replication factor C {Archaeon Pyrococcus furiosus 94.28
d1d2na_246 Hexamerization domain of N-ethylmalemide-sensitive 94.09
d1luza_85 Viral structural mimic of eIF2alpha {Vaccinia viru 94.0
d1fnna2276 CDC6, N-domain {Archaeon Pyrobaculum aerophilum [T 93.86
d2pmka1241 Haemolysin B ATP-binding protein {Escherichia coli 93.56
d1sxje2252 Replication factor C5 {Baker's yeast (Saccharomyce 93.32
d1g6oa_323 Hexameric traffic ATPase, HP0525 {Helicobacter pyl 93.22
d1sxja2253 Replication factor C1 {Baker's yeast (Saccharomyce 92.68
d1ixza_247 AAA domain of cell division protein FtsH {Thermus 92.54
d2fnaa2283 Archaeal ATPase SSO1545 {Sulfolobus solfataricus [ 92.18
d2hyda1255 Putative multidrug export ATP-binding/permease pro 91.87
d1p9ra_401 Extracellular secretion NTPase EpsE {Vibrio choler 91.84
d1um8a_364 ClpX {Helicobacter pylori [TaxId: 210]} 91.64
d1e32a2258 Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu 91.4
d1xx6a1141 Thymidine kinase, TK1, N-terminal domain {Clostrid 91.34
d1ly1a_152 Polynucleotide kinase, kinase domain {Bacteriophag 91.25
d1r6bx2268 ClpA, an Hsp100 chaperone, AAA+ modules {Escherich 91.22
d1qvra2387 ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 90.95
d1lv7a_256 AAA domain of cell division protein FtsH {Escheric 90.85
d1xbta1133 Thymidine kinase, TK1, N-terminal domain {Human (H 90.77
d3adka_194 Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} 90.74
d1gm5a3264 RecG helicase domain {Thermotoga maritima [TaxId: 90.59
d1zp6a1176 Hypothetical protein Atu3015 {Agrobacterium tumefa 90.38
d1khta_190 Adenylate kinase {Archaeon Methanococcus voltae [T 90.2
d1jjga_102 Viral structural mimic of eIF2alpha {Myxoma virus, 90.09
d1qhxa_178 Chloramphenicol phosphotransferase {Streptomyces v 90.01
d1t5la1413 Nucleotide excision repair enzyme UvrB {Bacillus c 89.89
d1wb9a2234 DNA repair protein MutS, the C-terminal domain {Es 89.87
d1cr2a_277 Gene 4 protein (g4p, DNA primase), helicase domain 89.25
d2bdta1176 Hypothetical protein BH3686 {Bacillus halodurans [ 89.22
d1w36b1485 Exodeoxyribonuclease V beta chain (RecB), N-termin 89.2
d1kaga_169 Shikimate kinase (AroK) {Escherichia coli [TaxId: 88.97
d1knqa_171 Gluconate kinase {Escherichia coli [TaxId: 562]} 88.92
d1lw7a2192 Transcriptional regulator NadR, ribosylnicotinamid 88.68
d1rkba_173 Adenylate kinase {Human (Homo sapiens), isoenzyme 88.53
d1pzna2254 DNA repair protein Rad51, catalytic domain {Archae 87.84
d1r7ra3265 Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu 87.69
d1y63a_174 Probable kinase LmjF30.1890 {Leishmania major [Tax 87.64
d1teva_194 UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606] 87.53
d1znwa1182 Guanylate kinase {Mycobacterium tuberculosis [TaxI 87.46
d1qf9a_194 UMP/CMP kinase {Dictyostelium discoideum [TaxId: 4 87.44
d1n0wa_242 DNA repair protein Rad51, catalytic domain {Human 87.3
d1zina1182 Adenylate kinase {Bacillus stearothermophilus [Tax 87.2
d1s3ga1182 Adenylate kinase {Bacillus globisporus [TaxId: 145 87.11
d1np6a_170 Molybdopterin-guanine dinucleotide biosynthesis pr 87.01
d1ak2a1190 Adenylate kinase {Cow (Bos taurus), mitochondrial 86.9
d1ukza_196 Uridylate kinase {Baker's yeast (Saccharomyces cer 86.84
d1tf7a1242 Circadian clock protein KaiC {Synechococcus sp. st 86.74
d2eyqa3233 Transcription-repair coupling factor, TRCF {Escher 86.69
d1szpa2251 DNA repair protein Rad51, catalytic domain {Baker' 86.45
d1e4va1179 Adenylate kinase {Escherichia coli [TaxId: 562]} 86.4
d1jbka_195 ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} 85.78
d1zaka1189 Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} 85.78
d1e9ra_433 Bacterial conjugative coupling protein TrwB {Esche 85.74
d1w44a_321 NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} 85.72
d1tf7a2242 Circadian clock protein KaiC {Synechococcus sp. st 85.67
d1rz3a_198 Hypothetical protein rbstp0775 {Bacillus stearothe 85.17
d2cdna1181 Adenylate kinase {Mycobacterium tuberculosis [TaxI 85.12
d1m8pa3183 ATP sulfurylase C-terminal domain {Fungus (Penicil 85.02
d1ofha_309 HslU {Haemophilus influenzae [TaxId: 727]} 84.88
d2ak3a1189 Adenylate kinase {Cow (Bos taurus), mitochondrial 84.13
d1e6ca_170 Shikimate kinase (AroK) {Erwinia chrysanthemi [Tax 84.13
d1in4a2238 Holliday junction helicase RuvB {Thermotoga mariti 84.1
d1s96a_205 Guanylate kinase {Escherichia coli [TaxId: 562]} 83.86
d1nksa_194 Adenylate kinase {Archaeon Sulfolobus acidocaldari 83.8
d1akya1180 Adenylate kinase {Baker's yeast (Saccharomyces cer 83.29
d1viaa_161 Shikimate kinase (AroK) {Campylobacter jejuni [Tax 83.27
d1yj5a2172 5' polynucleotide kinase-3' phosphatase, C-termina 83.14
d1ewqa2224 DNA repair protein MutS, the C-terminal domain {Th 83.09
d1sxjd2237 Replication factor C2 {Baker's yeast (Saccharomyce 83.06
d1xjca_165 Molybdopterin-guanine dinucleotide biosynthesis pr 83.04
d1ixsb2239 Holliday junction helicase RuvB {Thermus thermophi 82.96
d1ckea_225 CMP kinase {Escherichia coli [TaxId: 562]} 82.51
d1g41a_443 HslU {Haemophilus influenzae [TaxId: 727]} 82.45
d1jj7a_251 Peptide transporter Tap1, C-terminal ABC domain {H 82.13
d1l2ta_230 MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 81.65
d1gkya_186 Guanylate kinase {Baker's yeast (Saccharomyces cer 81.63
d1gvnb_273 Plasmid maintenance system epsilon/zeta, toxin zet 81.24
d3b60a1253 Multidrug resistance ABC transporter MsbA, C-termi 81.12
d1v5wa_258 Meiotic recombination protein DMC1/LIM15 homolog { 80.9
d2i1qa2258 DNA repair protein Rad51, catalytic domain {Archae 80.72
d1r0wa_281 Cystic fibrosis transmembrane conductance regulato 80.59
d2awna2232 Maltose transport protein MalK, N-terminal domain 80.36
d1x6va3195 Adenosine-5'phosphosulfate kinase (APS kinase) {Hu 80.1
>d2bmfa2 c.37.1.14 (A:178-482) Dengue virus helicase {Dengue virus type 2 [TaxId: 11060]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: RNA helicase
domain: Dengue virus helicase
species: Dengue virus type 2 [TaxId: 11060]

Probab=100.00  E-value=4.1e-34  Score=321.68  Aligned_cols=294  Identities=16%  Similarity=0.169  Sum_probs=214.5

Q ss_pred             HHcCCeEEEEcCCCCcHHHHHHHHHHHhcccCCCEEEEeccHHHHHHHHHHHHHHHhCCccCCeeEEEeecccccCCCce
Q 001046          536 VHDNQVLVVIGETGSGKTTQVTQYLAEAGYTTRGKIGCTQPRRVAAMSVAKRVAEEFGCRLGEEVGYAIRFEDCTGPDTV  615 (1176)
Q Consensus       536 i~~~~~vIv~apTGSGKTt~~~~~lle~~~~~~~~Ilv~~PrR~lA~qva~rva~e~g~~~G~~vGy~ir~~~~~~~~t~  615 (1176)
                      +.+++++||.||||||||+++++++++.....+.+++|++|+|+||.|+++++... +.  + ..++  ......+..+.
T Consensus         6 ~~~~~~~lv~~~TGsGKT~~~l~~~~~~~~~~~~~~lvi~Ptr~La~q~~~~l~~~-~~--~-~~~~--~~~~~~~~~~~   79 (305)
T d2bmfa2           6 FRKKRLTIMDLHPGAGKTKRYLPAIVREAIKRGLRTLILAPTRVVAAEMEEALRGL-PI--R-YQTP--AIRAEHTGREI   79 (305)
T ss_dssp             SSTTCEEEECCCTTSSTTTTHHHHHHHHHHHHTCCEEEEESSHHHHHHHHHHTTTS-CC--B-CCC----------CCCS
T ss_pred             hhcCCcEEEEECCCCCHHHHHHHHHHHHHHhcCCEEEEEccHHHHHHHHHHHHhcC-Cc--c-eeee--EEeecccCccc
Confidence            56899999999999999998877777665666778999999999999999876432 11  1 1111  22334557789


Q ss_pred             EEEeChHHHHHHHhhCCCCCCCceEEEcCCCcCCCchhHHHHHHHHHHhhCCCccEEEEcCCCCHHHHHhhhcCCCeEec
Q 001046          616 IKYMTDGMLLREILIDDNLSQYSVIMLDEAHERTIHTDVLFGLLKQLVKRRPDLRLIVTSATLDAEKFSGYFFNCNIFTI  695 (1176)
Q Consensus       616 I~~~T~g~Llr~l~~~~~L~~~s~IIiDEaHeR~~~~d~ll~llk~~~~~r~~~kvIlmSATl~~~~~~~~f~~~~v~~i  695 (1176)
                      ++++|+++|...+..+..+.++++|||||||........+.++++.+.. ++++++++||||++.....          .
T Consensus        80 i~~~t~~~l~~~~~~~~~~~~~~~vViDE~H~~~~~~~~~~~~l~~~~~-~~~~~~v~~SAT~~~~~~~----------~  148 (305)
T d2bmfa2          80 VDLMCHATFTMRLLSPIRVPNYNLIIMDEAHFTDPASIAARGYISTRVE-MGEAAGIFMTATPPGSRDP----------F  148 (305)
T ss_dssp             EEEEEHHHHHHHHTSSSCCCCCSEEEEESTTCCSHHHHHHHHHHHHHHH-HTSCEEEEECSSCTTCCCS----------S
T ss_pred             cccCCcHHHHHHHhcCccccceeEEEeeeeeecchhhHHHHHHHHHhhc-cccceEEEeecCCCcceee----------e
Confidence            9999999999998888889999999999999766666666666666544 4688999999998532111          1


Q ss_pred             CCceeeeEEEEecCCCchhHHHHHHHHHHHHhcCCCCCEEEEeCCHHHHHHHHHHHHHHHhccCCCCCCeEEEEecCCCC
Q 001046          696 PGRTFPVEILYTKQPESDYLDASLITVLQIHLTEPEGDILLFLTGQEEIDFACQSLYERMKGLGKNVPELIILPVYSALP  775 (1176)
Q Consensus       696 ~gr~~pv~~~~~~~~~~~~~~~~l~~v~~i~~~~~~g~iLVFl~~~~ei~~l~~~L~~~~~~l~~~~~~~~v~~lhs~l~  775 (1176)
                      .....|+.......+...... .     ........+++||||+++++++.++..|.+.         ++.+.++||+++
T Consensus       149 ~~~~~~~~~~~~~~~~~~~~~-~-----~~~~~~~~~~~lvf~~~~~~~~~l~~~L~~~---------~~~~~~l~~~~~  213 (305)
T d2bmfa2         149 PQSNAPIMDEEREIPERSWNS-G-----HEWVTDFKGKTVWFVPSIKAGNDIAACLRKN---------GKKVIQLSRKTF  213 (305)
T ss_dssp             CCCSSCEEEEECCCCCSCCSS-C-----CHHHHSSCSCEEEECSCHHHHHHHHHHHHHH---------TCCCEECCTTCH
T ss_pred             cccCCcceEEEEeccHHHHHH-H-----HHHHHhhCCCEEEEeccHHHHHHHHHHHHhC---------CCCEEEeCCcCh
Confidence            122223322222211111000 0     0112345789999999999999999999874         456788999997


Q ss_pred             HHHHHhhcCCCCCCCceEEEEcchhhhccCCCCeeEEEeCCcccc--eeccCCCCCccccccccCHHHHHHHhcccCCCC
Q 001046          776 SEMQSRIFDPAPPGKRKVVVATNIAEASLTIDGIFYVIDPGFAKQ--NVYNPKQGLDSLVITPISQASAKQRAGRAGRTG  853 (1176)
Q Consensus       776 ~~~r~~i~~~f~~g~~kVlVATniae~GIdIp~V~~VId~g~~k~--~~yd~~~g~~~l~~~p~S~as~~QR~GRAGR~g  853 (1176)
                      ...+.    .+.+|.++++|||+++++|+|+ ++++|||+|....  ..||+.+++..+...|+|.++|+||+|||||.|
T Consensus       214 ~~~~~----~~~~~~~~~lvaT~~~~~G~~~-~~~~Vi~~~~~~~~~~~~~~~~~~~~~~~~~~s~~~~~Qr~GR~GR~~  288 (305)
T d2bmfa2         214 DSEYI----KTRTNDWDFVVTTDISEMGANF-KAERVIDPRRCMKPVILTDGEERVILAGPMPVTHSSAAQRRGRVGRNP  288 (305)
T ss_dssp             HHHGG----GGGTSCCSEEEECGGGGTTCCC-CCSEEEECCEEEEEEEECSSSCEEEEEEEEECCHHHHHHHHTTSSCSS
T ss_pred             HHHHh----hhhccchhhhhhhHHHHhcCCC-CccEEEEcCCceeeeEecCCCCceEEeccccCCHHHHhhhhcCcCcCC
Confidence            65544    4577899999999999999999 5899999998654  358888888888889999999999999999999


Q ss_pred             CcE-EEEecChHHH
Q 001046          854 PGK-CYRLYTESAY  866 (1176)
Q Consensus       854 ~G~-c~~L~t~~~~  866 (1176)
                      .|. ...||..+..
T Consensus       289 ~~~~~~~~~~~~~~  302 (305)
T d2bmfa2         289 KNENDQYIYMGEPL  302 (305)
T ss_dssp             SCCCEEEEECSCCC
T ss_pred             CCceEEEEECCCCC
Confidence            655 5567765443
>d1yksa2 c.37.1.14 (A:325-623) YFV helicase domain {Yellow fever virus [TaxId: 11089]} Back     information, alignment and structure
>d1oywa3 c.37.1.19 (A:207-406) RecQ helicase domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1s2ma2 c.37.1.19 (A:252-422) Putative ATP-dependent RNA helicase DHH1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1fuka_ c.37.1.19 (A:) Initiation factor 4a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2j0sa2 c.37.1.19 (A:244-411) Probable ATP-dependent RNA helicase DDX48 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2j0sa1 c.37.1.19 (A:22-243) Probable ATP-dependent RNA helicase DDX48 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1veca_ c.37.1.19 (A:) DEAD box RNA helicase rck/p54 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hv8a2 c.37.1.19 (A:211-365) Putative DEAD box RNA helicase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1t5ia_ c.37.1.19 (A:) Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1c4oa2 c.37.1.19 (A:410-583) Nucleotide excision repair enzyme UvrB {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1t6na_ c.37.1.19 (A:) Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2g9na1 c.37.1.19 (A:21-238) Initiation factor 4a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2p6ra3 c.37.1.19 (A:1-202) Hel308 helicase {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1hv8a1 c.37.1.19 (A:3-210) Putative DEAD box RNA helicase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1t5la2 c.37.1.19 (A:415-595) Nucleotide excision repair enzyme UvrB {Bacillus caldotenax [TaxId: 1395]} Back     information, alignment and structure
>d1qdea_ c.37.1.19 (A:) Initiation factor 4a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1jr6a_ c.37.1.14 (A:) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} Back     information, alignment and structure
>d1a1va1 c.37.1.14 (A:190-325) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} Back     information, alignment and structure
>d1wrba1 c.37.1.19 (A:164-401) putative ATP-dependent RNA helicase VlgB {Flatworm (Dugesia japonica) [TaxId: 6161]} Back     information, alignment and structure
>d1s2ma1 c.37.1.19 (A:46-251) Putative ATP-dependent RNA helicase DHH1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1q0ua_ c.37.1.19 (A:) Probable DEAD box RNA helicase YqfR {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1yksa1 c.37.1.14 (A:185-324) YFV helicase domain {Yellow fever virus [TaxId: 11089]} Back     information, alignment and structure
>d1wp9a1 c.37.1.19 (A:1-200) putative ATP-dependent RNA helicase PF2015 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d2p6ra4 c.37.1.19 (A:203-403) Hel308 helicase {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1oywa2 c.37.1.19 (A:1-206) RecQ helicase domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1gkub1 c.37.1.16 (B:1-250) Helicase-like "domain" of reverse gyrase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1wp9a2 c.37.1.19 (A:201-486) putative ATP-dependent RNA helicase PF2015 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1sroa_ b.40.4.5 (A:) S1 RNA-binding domain of polyribonucleotide phosphorylase, PNPase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1kl9a2 b.40.4.5 (A:3-88) Eukaryotic initiation factor 2alpha, eIF2alpha, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a1va2 c.37.1.14 (A:326-624) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} Back     information, alignment and structure
>d2ahob2 b.40.4.5 (B:1-84) Eukaryotic initiation factor 2alpha, eIF2alpha, N-terminal domain {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d2eyqa5 c.37.1.19 (A:779-989) Transcription-repair coupling factor, TRCF {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2fz4a1 c.37.1.19 (A:24-229) DNA repair protein RAD25 {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1gm5a4 c.37.1.19 (A:550-755) RecG helicase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1go3e1 b.40.4.5 (E:79-184) C-terminal domain of RNA polymerase II subunit RBP7 (RpoE) {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d2ba0a1 b.40.4.5 (A:53-135) S1-domain of exosome complex RNA-binding protein 1, ECR1 {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d3bzka4 b.40.4.5 (A:637-730) Tex S1-domain {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1rifa_ c.37.1.23 (A:) DNA helicase UvsW {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d2je6i1 b.40.4.5 (I:66-152) S1-domain of exosome complex RNA-binding protein 1, ECR1 {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d2fwra1 c.37.1.19 (A:257-456) DNA repair protein RAD25 {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2z0sa1 b.40.4.5 (A:60-147) S1-domain of exosome complex RNA-binding protein 1, ECR1 {Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1gm5a3 c.37.1.19 (A:286-549) RecG helicase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1gkub2 c.37.1.16 (B:251-498) Helicase-like "domain" of reverse gyrase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2eyqa3 c.37.1.19 (A:546-778) Transcription-repair coupling factor, TRCF {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1e3pa2 b.40.4.5 (A:656-717) S1 RNA-binding domain of polyribonucleotide phosphorylase, PNPase {Streptomyces antibioticus [TaxId: 1890]} Back     information, alignment and structure
>d1wi5a_ b.40.4.5 (A:) S1-domain of RRP5 protein homolog (PDCD11, KIAA0185) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2nn6h1 b.40.4.5 (H:73-167) S1-domain of Ribosomal RNA-processing protein 4, RRP4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ix0a3 b.40.4.5 (A:558-644) Exoribonuclease 2, RNB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1y14b1 b.40.4.5 (B:81-171) C-terminal domain of RNA polymerase II subunit RBP7 (RpoE) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1z3ix1 c.37.1.19 (X:390-735) Rad54-like, Rad54L {Zebra fish (Danio rerio) [TaxId: 7955]} Back     information, alignment and structure
>d1tf5a4 c.37.1.19 (A:396-570) Translocation ATPase SecA, nucleotide-binding domains {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2c35b1 b.40.4.5 (B:78-171) C-terminal domain of RNA polymerase II subunit RBP7 (RpoE) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2nn6g1 b.40.4.5 (G:107-194) S1-domain of exosome component 3 (RRP40) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z5za1 c.37.1.19 (A:663-906) Helicase of the SNF2/Rad54 hamily {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d2ja9a1 b.40.4.5 (A:62-151) S1-domain of exosome component 3 (RRP40) {Saccharomyces cerevisiae [TaxId: 4932]} Back     information, alignment and structure
>d1okkd2 c.37.1.10 (D:97-303) GTPase domain of the signal recognition particle receptor FtsY {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1z3ix2 c.37.1.19 (X:92-389) Rad54-like, Rad54L {Zebra fish (Danio rerio) [TaxId: 7955]} Back     information, alignment and structure
>d2qy9a2 c.37.1.10 (A:285-495) GTPase domain of the signal recognition particle receptor FtsY {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ls1a2 c.37.1.10 (A:89-295) GTPase domain of the signal sequence recognition protein Ffh {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1w36d1 c.37.1.19 (D:2-360) Exodeoxyribonuclease V alpha chain (RecD) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1vmaa2 c.37.1.10 (A:82-294) GTPase domain of the signal recognition particle receptor FtsY {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1z63a1 c.37.1.19 (A:432-661) Helicase of the SNF2/Rad54 hamily {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d2nn6i1 b.40.4.5 (I:61-185) Exosome component 1, EXOSC1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nkta4 c.37.1.19 (A:397-615) Translocation ATPase SecA, nucleotide-binding domains {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1j8yf2 c.37.1.10 (F:87-297) GTPase domain of the signal sequence recognition protein Ffh {Archaeon Acidianus ambivalens [TaxId: 2283]} Back     information, alignment and structure
>d1tf5a3 c.37.1.19 (A:1-226,A:349-395) Translocation ATPase SecA, nucleotide-binding domains {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1smxa_ b.40.4.5 (A:) S1-domain of Ribonuclease E {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1hh2p1 b.40.4.5 (P:127-198) S1 domain of NusA {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1uaaa1 c.37.1.19 (A:2-307) DEXX box DNA helicase {Escherichia coli, RepD [TaxId: 562]} Back     information, alignment and structure
>d1ye8a1 c.37.1.11 (A:1-178) Hypothetical kinase-like protein Aq_1292 {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1pjra1 c.37.1.19 (A:1-318) DEXX box DNA helicase {Bacillus stearothermophilus, PcrA [TaxId: 1422]} Back     information, alignment and structure
>d1a5ta2 c.37.1.20 (A:1-207) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1sxjc2 c.37.1.20 (C:12-238) Replication factor C3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2asba1 b.40.4.5 (A:108-183) S1 domain of NusA {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2b8ta1 c.37.1.24 (A:11-149) Thymidine kinase, TK1, N-terminal domain {Ureaplasma urealyticum [TaxId: 2130]} Back     information, alignment and structure
>d2gnoa2 c.37.1.20 (A:11-208) gamma subunit of DNA polymerase III, N-domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1njfa_ c.37.1.20 (A:) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1l8qa2 c.37.1.20 (A:77-289) Chromosomal replication initiation factor DnaA {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d2i3ba1 c.37.1.11 (A:1-189) Cancer-related NTPase, C1orf57 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sgwa_ c.37.1.12 (A:) Putative ABC transporter PF0895 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1sxjb2 c.37.1.20 (B:7-230) Replication factor C4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1iqpa2 c.37.1.20 (A:2-232) Replication factor C {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1d2na_ c.37.1.20 (A:) Hexamerization domain of N-ethylmalemide-sensitive fusion (NSF) protein {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d1luza_ b.40.4.5 (A:) Viral structural mimic of eIF2alpha {Vaccinia virus [TaxId: 10245]} Back     information, alignment and structure
>d1fnna2 c.37.1.20 (A:1-276) CDC6, N-domain {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d2pmka1 c.37.1.12 (A:467-707) Haemolysin B ATP-binding protein {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1sxje2 c.37.1.20 (E:4-255) Replication factor C5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1g6oa_ c.37.1.11 (A:) Hexameric traffic ATPase, HP0525 {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1sxja2 c.37.1.20 (A:295-547) Replication factor C1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ixza_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2fnaa2 c.37.1.20 (A:1-283) Archaeal ATPase SSO1545 {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d2hyda1 c.37.1.12 (A:324-578) Putative multidrug export ATP-binding/permease protein SAV1866 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1p9ra_ c.37.1.11 (A:) Extracellular secretion NTPase EpsE {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1um8a_ c.37.1.20 (A:) ClpX {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1e32a2 c.37.1.20 (A:201-458) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1xx6a1 c.37.1.24 (A:2-142) Thymidine kinase, TK1, N-terminal domain {Clostridium acetobutylicum [TaxId: 1488]} Back     information, alignment and structure
>d1ly1a_ c.37.1.1 (A:) Polynucleotide kinase, kinase domain {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d1r6bx2 c.37.1.20 (X:169-436) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1qvra2 c.37.1.20 (A:149-535) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1lv7a_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xbta1 c.37.1.24 (A:18-150) Thymidine kinase, TK1, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3adka_ c.37.1.1 (A:) Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1gm5a3 c.37.1.19 (A:286-549) RecG helicase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1zp6a1 c.37.1.25 (A:6-181) Hypothetical protein Atu3015 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1khta_ c.37.1.1 (A:) Adenylate kinase {Archaeon Methanococcus voltae [TaxId: 2188]} Back     information, alignment and structure
>d1jjga_ b.40.4.5 (A:) Viral structural mimic of eIF2alpha {Myxoma virus, m156r [TaxId: 10273]} Back     information, alignment and structure
>d1qhxa_ c.37.1.3 (A:) Chloramphenicol phosphotransferase {Streptomyces venezuelae [TaxId: 54571]} Back     information, alignment and structure
>d1t5la1 c.37.1.19 (A:2-414) Nucleotide excision repair enzyme UvrB {Bacillus caldotenax [TaxId: 1395]} Back     information, alignment and structure
>d1wb9a2 c.37.1.12 (A:567-800) DNA repair protein MutS, the C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1cr2a_ c.37.1.11 (A:) Gene 4 protein (g4p, DNA primase), helicase domain {Bacteriophage T7 [TaxId: 10760]} Back     information, alignment and structure
>d2bdta1 c.37.1.25 (A:1-176) Hypothetical protein BH3686 {Bacillus halodurans [TaxId: 86665]} Back     information, alignment and structure
>d1w36b1 c.37.1.19 (B:1-485) Exodeoxyribonuclease V beta chain (RecB), N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1kaga_ c.37.1.2 (A:) Shikimate kinase (AroK) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1knqa_ c.37.1.17 (A:) Gluconate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1lw7a2 c.37.1.1 (A:220-411) Transcriptional regulator NadR, ribosylnicotinamide kinase domain {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1rkba_ c.37.1.1 (A:) Adenylate kinase {Human (Homo sapiens), isoenzyme 6 [TaxId: 9606]} Back     information, alignment and structure
>d1pzna2 c.37.1.11 (A:96-349) DNA repair protein Rad51, catalytic domain {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1r7ra3 c.37.1.20 (A:471-735) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1y63a_ c.37.1.1 (A:) Probable kinase LmjF30.1890 {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d1teva_ c.37.1.1 (A:) UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1znwa1 c.37.1.1 (A:20-201) Guanylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1qf9a_ c.37.1.1 (A:) UMP/CMP kinase {Dictyostelium discoideum [TaxId: 44689]} Back     information, alignment and structure
>d1n0wa_ c.37.1.11 (A:) DNA repair protein Rad51, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zina1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1s3ga1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus globisporus [TaxId: 1459]} Back     information, alignment and structure
>d1np6a_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ak2a1 c.37.1.1 (A:14-146,A:177-233) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-2 [TaxId: 9913]} Back     information, alignment and structure
>d1ukza_ c.37.1.1 (A:) Uridylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1tf7a1 c.37.1.11 (A:14-255) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} Back     information, alignment and structure
>d2eyqa3 c.37.1.19 (A:546-778) Transcription-repair coupling factor, TRCF {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1szpa2 c.37.1.11 (A:145-395) DNA repair protein Rad51, catalytic domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1e4va1 c.37.1.1 (A:1-121,A:157-214) Adenylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1jbka_ c.37.1.20 (A:) ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1zaka1 c.37.1.1 (A:3-127,A:159-222) Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} Back     information, alignment and structure
>d1e9ra_ c.37.1.11 (A:) Bacterial conjugative coupling protein TrwB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1w44a_ c.37.1.11 (A:) NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} Back     information, alignment and structure
>d1tf7a2 c.37.1.11 (A:256-497) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} Back     information, alignment and structure
>d1rz3a_ c.37.1.6 (A:) Hypothetical protein rbstp0775 {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d2cdna1 c.37.1.1 (A:1-181) Adenylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1m8pa3 c.37.1.15 (A:391-573) ATP sulfurylase C-terminal domain {Fungus (Penicillium chrysogenum) [TaxId: 5076]} Back     information, alignment and structure
>d1ofha_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d2ak3a1 c.37.1.1 (A:0-124,A:162-225) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-3 [TaxId: 9913]} Back     information, alignment and structure
>d1e6ca_ c.37.1.2 (A:) Shikimate kinase (AroK) {Erwinia chrysanthemi [TaxId: 556]} Back     information, alignment and structure
>d1in4a2 c.37.1.20 (A:17-254) Holliday junction helicase RuvB {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1s96a_ c.37.1.1 (A:) Guanylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1nksa_ c.37.1.1 (A:) Adenylate kinase {Archaeon Sulfolobus acidocaldarius [TaxId: 2285]} Back     information, alignment and structure
>d1akya1 c.37.1.1 (A:3-130,A:169-220) Adenylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1viaa_ c.37.1.2 (A:) Shikimate kinase (AroK) {Campylobacter jejuni [TaxId: 197]} Back     information, alignment and structure
>d1yj5a2 c.37.1.1 (A:351-522) 5' polynucleotide kinase-3' phosphatase, C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ewqa2 c.37.1.12 (A:542-765) DNA repair protein MutS, the C-terminal domain {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1sxjd2 c.37.1.20 (D:26-262) Replication factor C2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1xjca_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1ixsb2 c.37.1.20 (B:4-242) Holliday junction helicase RuvB {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1ckea_ c.37.1.1 (A:) CMP kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1g41a_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1jj7a_ c.37.1.12 (A:) Peptide transporter Tap1, C-terminal ABC domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1l2ta_ c.37.1.12 (A:) MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1gkya_ c.37.1.1 (A:) Guanylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1gvnb_ c.37.1.21 (B:) Plasmid maintenance system epsilon/zeta, toxin zeta subunit {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d3b60a1 c.37.1.12 (A:329-581) Multidrug resistance ABC transporter MsbA, C-terminal domain {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1v5wa_ c.37.1.11 (A:) Meiotic recombination protein DMC1/LIM15 homolog {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2i1qa2 c.37.1.11 (A:65-322) DNA repair protein Rad51, catalytic domain {Archaeon Methanococcus voltae [TaxId: 2188]} Back     information, alignment and structure
>d1r0wa_ c.37.1.12 (A:) Cystic fibrosis transmembrane conductance regulator, CFTR, nucleotide-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2awna2 c.37.1.12 (A:4-235) Maltose transport protein MalK, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1x6va3 c.37.1.4 (A:34-228) Adenosine-5'phosphosulfate kinase (APS kinase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure