Citrus Sinensis ID: 001096

Local Sequence Feature Prediction

Prediction and (Method)	Result

Residue Number Marker

Protein Sequence

Secondary Structure (PSIPRED)

Secondary Structure Prediction (SSPRO)

Coil and Loop (DISEMBL)

Flexible Loop (DISEMBL)

Low Complexity Region (SEG)

Disordered region (IsUnstruct)

Disordered Region (DISOPRED)

Disordered Region (DISEMBL)

Disordered Region (DISPRO)

Transmembrane Helix (TMHMM)

Transmembrane Helix (HMMTOP)

Transmembrane Helix (MEMSAT)

TM Helix, Signal Peptide (MEMSAT_SVM)

TM Helix, Signal Peptide (Phobius)

Signal Peptide (SignalP HMM Mode)

Signal Peptide (SignalP NN Mode)

Coiled Coils (COILS)

Positional Conservation

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820-------830-------840-------850-------860-------870-------880-------890-------900-------910-------920-------930-------940-------950-------960-------970-------980-------990------1000------1010------1020------1030------1040------1050------1060------1070------1080------1090------1100------1110------1120------1130------1140------1150------116

MGFACGLQQPNVFEGTRYRISDRLINSRFRYGGFGYNVSNRRIVSKTRSTRNLSKSISYAGCSKSSLVFRGNSDANLWGLYTCKSLFCSFDDFSKLSRGVCPTCQGNDSLAFIDGNGRNVEFSENGDGPEANSLGEEERETKEDAEPPTTDELRELLMNAMKELEVAQLNSTMFEEKAQRISEAAIALKDEAANAWNNVNVTLDMVHEIVNEECIAKEAVHKATMALSLAEARLQVAIESLQDVKQEDDYPEGSTEDDAKSDGKEEDGLLLAAENDIKECQANLANCETELRRLQSKKEELQKEVDRLNEVAEKAQMNALKAEEDVANIMLLAEQAVAFEIEATQRVNDAEIALQRAEKSLSNSSVDISERIKGYVSGDETAVKEEKAGSTDDVNVERDIDVPVNGDYLVSESSHDILPDKVSQSSEELYQSDELIDQENGKLNLDSPKEAEVEAEKSKNVIQTKKQEMQKDLTRESSPVNAPKTLQKKSSRFFPASFFSSAVDGTESTQASIFQGLMEYARKQLPKLVLGFLLFGAGVAFYANQAERSSLQLQQPDVITTSIEEASSNAKPLIREVKKLPKRIKKLLDMLPEQEINEEEASLFDVLWLLLASVIFVPIFQKIPGGSPVLGYLAAGILIGPYGLSIIRHVHGTKAIAEFGVVFLLFNIGLELSVERLSSMKKYVFGLGSAQVLVTAVVVGLVAHFVSGLPGPASIVIGNGLALSSTAVVLQVLQERGESTSRHGRATFSVLLFQDLAVVVLLILIPLISPNSSKGGVGFQAIAEALGVAAVKAAVAITAIIAGGRLLLRPIYKQIAENQNAEIFSANTLLVILGTSLLTARAGLSMALGAFLAGLLLAETEFSLQVESDIAPYRGLLLGLFFMTVGMSIDPKLLLSNFPVITGALGLLIGGKTILVALVGRLFGVSVISAIRTGLLLAPGGEFAFVAFGEAVNQGIMSSQLSSLLFLLVGISMALTPWLAAGGQLIASRFEQHDVRSLLPVESETDDLQDHIILCGFGRVGQIIAQLLSERLIPFVALDVRSDRVAIGRALDLPVYFGDAGSREVLHKVGAERACAAAITLDTPGANYRTVWALSKYFPNVKTFVRAHDIDHGLNLEKAGATAVVPETLEPSLQLAAAVLAQVIHDYQREKVFRSGVK

cccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHcccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHccccccHHHHHHcccccccHHHHHHHcccccccccccccccccccccccccccccccccccccHHHHHcccHHHHHHHccccccccccHHHHHHHHHHHHHHHHHHHHHHHHccccccccccHHHHHHccccccccccccccccccccHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHcccHHHHHHHHcccHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHccccccHHHHccccccHHHHHHHHHHHHHccccHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHccccccHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccEEEEcccccHHHHHHHHHHccccEEEEEccHHHHHHHHHccccEEEcccccHHHHHHcccccccEEEEEcccHHHHHHHHHHHHHHccccEEEEEcccccHHHHHHHccccEEcccccHHHHHHHHHHHHHccccHHHHHHHHHccc

ccccccccccccccccEEEccccEEEccccccccccccccccEEEEccccHHccccEEEccccccHHHHcccccccEEEcccccccccccccccccccccEEEcccccccEEEcccccccEEEccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccHHHcEccccccccccHHcccccccccccccccHHHcccHHccccccccccccccccccccccccccccccccccccccccccccHHHHHccccccccccccHHHHccccccccccEEccccccccccHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHEEccHHHHHHHcccccEEEEcHHHcccccHHHHHHHHHccHHHHHHHHHcccHHcccccHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHEcccccHHcccHHHHHHHHHHHHHHHHHHEcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccEEEEEccHHHHHHHHHHHHccccEEEEEccHHHHHHHHHccccEEEccccHHHHHHHccccccEEEEEEcccHHHHHHHHHHHHHHccccEEEEEEccHHHHHHHHHccccEcccHHHHHHHHHHHHHHHHccccHHHHHHHHHHcc

mgfacglqqpnvfegtryrISDRLINsrfryggfgynvsnrrivsktrstrnlsksisyagcsksslvfrgnsdanlwglytckslfcsfddfsklsrgvcptcqgndslafidgngrnvefsengdgpeanslgeeeretkedaeppttDELRELLMNAMKELEVAQLNSTMFEEKAQRISEAAIALKDEAANAWNNVNVTLDMVHEIVNEECIAKEAVHKATMALSLAEARLQVAIESLQdvkqeddypegsteddaksdgkeedGLLLAAENDIKECQANLANCETELRRLQSKKEELQKEVDRLNEVAEKAQMNALKAEEDVANIMLLAEQAVAFEIEATQRVNDAEIALQRAEKslsnssvdiserikgyvsgdetavkeekagstddvnverdidvpvngdylvsesshdilpdkvsqsseelyqsdelidqengklnldspkeAEVEAEKSKNVIQTKKQEMQKdltresspvnapktlqkkssrffpasffssavdgtestQASIFQGLMEYARKQLPKLVLGFLLFGAGVafyanqaersslqlqqpdvITTSIEEASSNAKPLIREVKKLPKRIKKLLDmlpeqeineEEASLFDVLWLLLASVIFvpifqkipggspvlgYLAAGILIGPYGLSIIRHVHGTKAIAEFGVVFLLFNIGLELSVERLSSMKKYVFGLGSAQVLVTAVVVGLVAHFvsglpgpasivignglaLSSTAVVLQVLQERgestsrhgrATFSVLLFQDLAVVVLLILIplispnsskggvGFQAIAEALGVAAVKAAVAITAIIAGGRLLLRPIYKQIAENQNAEIFSANTLLVILGTSLLTARAGLSMALGAFLAGLLLAETEFslqvesdiapyRGLLLGLFFMTvgmsidpklllsnfpviTGALGLLIGGKTILVALVGRLFGVSVISAIRTGlllapggefafVAFGEAVNQGIMSSQLSSLLFLLVGISMALTPWLAAGGQLIASRfeqhdvrsllpvesetddlqdhiilcGFGRVGQIIAQLLSERLIPFVALDVRSDRVAIGraldlpvyfgdagsreVLHKVGAERACAAAItldtpganyRTVWALSKYFPNVKTFVRAHdidhglnlekagatavvpetlePSLQLAAAVLAQVIHDYQREKVFRSGVK

mgfacglqqpnvfegtryrisdrlinsrfryggfgynvsnrrivsktrstrnlsksisyagcsksslvFRGNSDANLWGLYTCKSLFCSFDDFSKLSRGVCPTCQGNDSLAFIDGNGRNVEfsengdgpeanslgeeeretkedaepptTDELRELLMNAMKELEVAQLNSTMFEEKAQRISEAAIALKDEAANAWNNVNVTLDMVHEIVNEECIAKEAVHKATMALSLAEARLQVAIESLqdvkqeddypegsteddaksdgkEEDGLLLAAENDIKECQANLANCETELRRLQSKKEELQKEVDRLNEVAEKAQMNALKAEEDVANIMLLAEQAVAFEIEATQRVNDAEIALQRaekslsnssvdiserikgyvsgdetavkeekagstddvnverdidVPVNGDYLVSESSHDILPDKVSQSSEELYQSdelidqengklNLDSPKEAEveaeksknviqtkkqemqkdltresspvnapktlqkkssrffPASFFSSAVDGTESTQASIFQGLMEYARKQLPKLVLGFLLFGAGVAFYANQAERSSLQLQQPDVITTsieeassnakplirevkkLPKRIKKLLDMLPEQEINEEEASLFDVLWLLLASVIFVPIFQKIPGGSPVLGYLAAGILIGPYGLSIIRHVHGTKAIAEFGVVFLLFNIGLELSVERLSSMKKYVFGLGSAQVLVTAVVVGLVAHFVSGLPGPASIVIGNGLALSSTAVVLQVLQERGESTSRHGRATFSVLLFQDLAVVVLLILIPLISPNSSKGGVGFQAIAEALGVAAVKAAVAITAIIAGGRLLLRPIYKQIAENQNAEIFSANTLLVILGTSLLTARAGLSMALGAFLAGLLLAETEFSLQVESDIAPYRGLLLGLFFMTVGMSIDPKLLLSNFPVITGALGLLIGGKTILVALVGRLFGVSVISAIRTGLLLAPGGEFAFVAFGEAVNQGIMSSQLSSLLFLLVGISMALTPWLAAGGQLIASRFEQHDVRSLLPVESETDDLQDHIILCGFGRVGQIIAQLLSERLIPFVALDVRSDRVAIGRALDLPVYFGDAGSREVLHKVGAERACAAAitldtpganYRTVWALSKYFPNVKTFVRAHDIDHGLNLEKAGATAVVPETLEPSLQLAAAVLAQVIHDYQREkvfrsgvk

MGFACGLQQPNVFEGTRYRISDRLINSRFRYGGFGYNVSNRRIVSKTRSTRNLSKSISYAGCSKSSLVFRGNSDANLWGLYTCKSLFCSFDDFSKLSRGVCPTCQGNDSLAFIDGNGRNVEFSENGDGPEANSLGEEERETKEDAEPPTTDELRELLMNAMKELEVAQLNSTMFEEKAQRISEAAIALKDEAANAWNNVNVTLDMVHEIVNEECIAKEAVHKATMALSLAEARLQVAIESLQDVKQEDDYPEGSTEDDAKSDGKEEDGLLLAAENDIKECQANLANCETELRRLQSKKEELQKEVDRLNEVAEKAQMNALKAEEDVANIMLLAEQAVAFEIEATQRVNDAEIALQRAEKSLSNSSVDISERIKGYVSGDETAVKEEKAGSTDDVNVERDIDVPVNGDYLVSESSHDILPDKVSQSSEELYQSDELIDQENGKLNLDSPKEAEVEAEKSKNVIQTKKQEMQKDLTRESSPVNAPKTLQKKssrffpasffssaVDGTESTQASIFQGLMEYARKQLPKlvlgfllfgagvafYANQAERSSLQLQQPDVITTSIEEASSNAKPLIREVKKLPKRIKKLLDMLPEQEINEEEASLFDVLWLLLASVIFVPIFQKIPGGSPVLGYLAAGILIGPYGLSIIRHVHGTKAIAEFGVVFLLFNIGLELSVERLSSMKKYVFGLGSAQvlvtavvvglvahfvSGLPGPASIVIGNGLALSSTAVVLQVLQERGESTSRHGRATFSVLLFQDlavvvllilipliSPNSSKGGVGFQaiaealgvaavkaavaitaiiaggRLLLRPIYKQIAENQNAEIFSANTLLVILGTSLLTARaglsmalgaflaglllaETEFSLQVESDIAPYRGLLLGLFFMTVGMSIDPKLLLSNFPVITGALGLLIGGKTILVALVGRLFGVSVISAIRTGLLLAPGGEFAFVAFGEAVNQGIMssqlssllfllVGISMALTPWLAAGGQLIASRFEQHDVRSLLPVESETDDLQDHIILCGFGRVGQIIAQLLSERLIPFVALDVRSDRVAIGRALDLPVYFGDAGSREVLHKVGAERACAAAITLDTPGANYRTVWALSKYFPNVKTFVRAHDIDHGLNLEKAGATAVVPETLEPSlqlaaavlaqvIHDYQREKVFRSGVK

***ACGLQQPNVFEGTRYRISDRLINSRFRYGGFGYNVSNRRIVSKT*****LSKSISYAGCSKSSLVFRGNSDANLWGLYTCKSLFCSFDDFSKLSRGVCPTCQGNDSLAFIDG*****************************************************************ISEAAIALKDEAANAWNNVNVTLDMVHEIVNEECIAKEAVHKATMALSLAEARLQVAI*****************************************C********************************************DVANIMLLAEQAVAFEIEATQRVND******************************************************V**DY*****************************************************************************************************QASIFQGLMEYARKQLPKLVLGFLLFGAGVAFYANQ****************************************KLLDM********EEASLFDVLWLLLASVIFVPIFQKIPGGSPVLGYLAAGILIGPYGLSIIRHVHGTKAIAEFGVVFLLFNIGLELSVERLSSMKKYVFGLGSAQVLVTAVVVGLVAHFVSGLPGPASIVIGNGLALSSTAVVLQVLQER******HGRATFSVLLFQDLAVVVLLILIPLISPNSSKGGVGFQAIAEALGVAAVKAAVAITAIIAGGRLLLRPIYKQIAENQNAEIFSANTLLVILGTSLLTARAGLSMALGAFLAGLLLAETEFSLQVESDIAPYRGLLLGLFFMTVGMSIDPKLLLSNFPVITGALGLLIGGKTILVALVGRLFGVSVISAIRTGLLLAPGGEFAFVAFGEAVNQGIMSSQLSSLLFLLVGISMALTPWLAAGGQLIASRFEQHDVRSLLPVESETDDLQDHIILCGFGRVGQIIAQLLSERLIPFVALDVRSDRVAIGRALDLPVYFGDAGSREVLHKVGAERACAAAITLDTPGANYRTVWALSKYFPNVKTFVRAHDIDHGLNLEKAGATAVVPETLEPSLQLAAAVLAQVIHDYQREK*******

*******QQPNVFEGTRYRISDRLINSRFRYGGFGYNVSN*********************CSKS*LVF*****************************GVCPTCQGNDSLAFI***************************************LRELLMNAMKELEVAQ***********RISEAAIALKDEAANAWNNVNVTLDMVHEIVNEECIAKEAVHKATMALSLAEARLQVAIE*****************************************QANLANCET*******************************KAEEDVANIMLLAEQAVAFEIEATQRVNDAEIALQRAE*******************************************************************************************************************************************F*******TESTQASIFQGLMEYARKQLPKLVLGFLLFGAGVAFYANQAERSSLQLQQPDVITTSIEEASSNAKPLIREVKKLPKRIKKLLDMLP****NEEEASLFDVLWLLLASVIFVPIFQKIPGGSPVLGYLAAGILIGPYGLSIIRHVHGTKAIAEFGVVFLLFNIGLELSVERLSSMKKYVFGLGSAQVLVTAVVVGLVAHFVSGLPGPASIVIGNGLALSSTAVVLQVLQ**********RATFSVLLFQDLAVVVLLILIPLISPNSSKGGVGFQAIAEALGVAAVKAAVAITAIIAGGRLLLRPIYKQIAENQNAEIFSANTLLVILGTSLLTARAGLSMALGAFLAGLLLAETEFSLQVESDIAPYRGLLLGLFFMTVGMSIDPKLLLSNFPVITGALGLLIGGKTILVALVGRLFGVSVISAIRTGLLLAPGGEFAFVAFGEAVNQGIMSSQLSSLLFLLVGISMALTPWLAAGGQLIASRF********************HIILCGFGRVGQIIAQLLSERLIPFVALDVRSDRVAIGRALDLPVYFGDAGSREVLHKVGAERACAAAITLDTPGANYRTVWALSKYFPNVKTFVRAHDIDHGLNLEKAGATAVVPETLEPSLQLAAAVLAQVIHDYQREKVFRSGVK

MGFACGLQQPNVFEGTRYRISDRLINSRFRYGGFGYNVSNRRIVSKTRSTRNLSKSISYAGCSKSSLVFRGNSDANLWGLYTCKSLFCSFDDFSKLSRGVCPTCQGNDSLAFIDGNGRNVEFSEN************************TDELRELLMNAMKELEVAQLNSTMFEEKAQRISEAAIALKDEAANAWNNVNVTLDMVHEIVNEECIAKEAVHKATMALSLAEARLQVAIESLQDV*********************EDGLLLAAENDIKECQANLANCETELRRLQSKKEELQKEVDRLNEVAEKAQMNALKAEEDVANIMLLAEQAVAFEIEATQRVNDAEIALQRA********VDISERIKGYVSGD*************DVNVERDIDVPVNGDYLVSESSHDILP**********YQSDELIDQENGKLNLDS************NVIQTK****************APKTLQKKSSRFFPASFFSSAVDGTESTQASIFQGLMEYARKQLPKLVLGFLLFGAGVAFYANQAERSSLQLQQPDVITTSIEEASSNAKPLIREVKKLPKRIKKLLDMLPEQEINEEEASLFDVLWLLLASVIFVPIFQKIPGGSPVLGYLAAGILIGPYGLSIIRHVHGTKAIAEFGVVFLLFNIGLELSVERLSSMKKYVFGLGSAQVLVTAVVVGLVAHFVSGLPGPASIVIGNGLALSSTAVVLQVLQ********HGRATFSVLLFQDLAVVVLLILIPLISPNSSKGGVGFQAIAEALGVAAVKAAVAITAIIAGGRLLLRPIYKQIAENQNAEIFSANTLLVILGTSLLTARAGLSMALGAFLAGLLLAETEFSLQVESDIAPYRGLLLGLFFMTVGMSIDPKLLLSNFPVITGALGLLIGGKTILVALVGRLFGVSVISAIRTGLLLAPGGEFAFVAFGEAVNQGIMSSQLSSLLFLLVGISMALTPWLAAGGQLIASRFEQHDVRSLLPVESETDDLQDHIILCGFGRVGQIIAQLLSERLIPFVALDVRSDRVAIGRALDLPVYFGDAGSREVLHKVGAERACAAAITLDTPGANYRTVWALSKYFPNVKTFVRAHDIDHGLNLEKAGATAVVPETLEPSLQLAAAVLAQVIHDYQREKVFRSGVK

**FACGLQQPNVFEGTRYRISDRLINSRFRYGGFGYNVSNRRIVSKTRSTRNLSKSISYAGCSKSSLVFRGNSDANLWGLYTCKSLFCSFDDFSKLSRGVCPTCQGNDSLAFIDGNGRNVEFSE***********************PTTDELRELLMNAMKELEVAQLNSTMFEEKAQRISEAAIALKDEAANAWNNVNVTLDMVHEIVNEECIAKEAVHKATMALSLAEARLQVAIESLQDVKQ******************EEDGLLLAAENDIKECQANLANCETELRRLQSKKEELQKEVDRLNEVAEKAQMNALKAEEDVANIMLLAEQAVAFEIEATQRVNDAEIALQRAEKSLSN***********************************************SESS*D*LPDK*S**********************************************************************F*********DGTESTQASIFQGLMEYARKQLPKLVLGFLLFGAGVAFYANQAERSSLQLQQPDVITTSIEEASSNAKPLIREVKKLPKRIKKLLDMLPEQEINEEEASLFDVLWLLLASVIFVPIFQKIPGGSPVLGYLAAGILIGPYGLSIIRHVHGTKAIAEFGVVFLLFNIGLELSVERLSSMKKYVFGLGSAQVLVTAVVVGLVAHFVSGLPGPASIVIGNGLALSSTAVVLQVLQERGESTSRHGRATFSVLLFQDLAVVVLLILIPLISPNSSKGGVGFQAIAEALGVAAVKAAVAITAIIAGGRLLLRPIYKQIAENQNAEIFSANTLLVILGTSLLTARAGLSMALGAFLAGLLLAETEFSLQVESDIAPYRGLLLGLFFMTVGMSIDPKLLLSNFPVITGALGLLIGGKTILVALVGRLFGVSVISAIRTGLLLAPGGEFAFVAFGEAVNQGIMSSQLSSLLFLLVGISMALTPWLAAGGQLIASRFEQH*********SETDDLQDHIILCGFGRVGQIIAQLLSERLIPFVALDVRSDRVAIGRALDLPVYFGDAGSREVLHKVGAERACAAAITLDTPGANYRTVWALSKYFPNVKTFVRAHDIDHGLNLEKAGATAVVPETLEPSLQLAAAVLAQVIHDYQREKVFRSGVK

ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii

iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiHHHHHHHHHHHHHHHHHHHooooooooHHHHHHHHHHHHHHHHHHHiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii

iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiHHHHHHHHHHHHHHHHHHHHoooooHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHoooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii

SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHiiiiiiiiHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiHHHHHHHHHHHHHHHHooooooooooooooooooHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHoooooooooHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiHHHHHHHHHHHHHHHHooooooooooooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii

iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiHHHHHHHHHHHHHHHHHHHHHoooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooooHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHoooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooooHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

MGFACGLQQPNVFEGTRYRISDRLINSRFRYGGFGYNVSNRRIVSKTRSTRNLSKSISYAGCSKSSLVFRGNSDANLWGLYTCKSLFCSFDDFSKLSRGVCPTCQGNDSLAFIDGNGRNVEFSENGDGPEANSLGEEERETKEDAEPPTxxxxxxxxxxxxxxxxxxxxxSTMFEEKAQRISEAAIALKDEAANAWNNVNVTLDMVHEIVNEECIAKEAVHKATMAxxxxxxxxxxxxxxxxxxxxxDDYPEGSTEDDAKSDGKEEDGLxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxVANIMLLAEQAVAFxxxxxxxxxxxxxxxxxxxxxLSNSSVDISERIKGYVSGDETAVKEEKAGSTDDVNVERDIDVPVNGDYLVSESSHDILPDKVSQSSEELYQSDELIDQENGKLNLDSPKEAEVEAEKSKNVIQTKKQEMQKDLTRESSPVNAPKTLQKKSSRFFPASFFSSAVDGTESTQASIFQGLMEYARKQLPKLVLGFLLFGAGVAFYANQAERSSLQLQQPDVITTSIEEASSNAKPLIREVKKLPKRIKKLLDMLPEQEINEEEASLFDVLWLLLASVIFVPIFQKIPGGSPVLGYLAAGILIGPYGLSIIRHVHGTKAIAEFGVVFLLFNIGLELSVERLSSMKKYVFGLGSAQVLVTAVVVGLVAHFVSGLPGPASIVIGNGLALSSTAVVLQVLQERGESTSRHGRATFSVLLFQDLAVVVLLILIPLISPNSSKGGVGFQAIAEALGVAAVKAAVAITAIIAGGRLLLRPIYKQIAENQNAEIFSANTLLVILGTSLLTARAGLSMALGAFLAGLLLAETEFSLQVESDIAPYRGLLLGLFFMTVGMSIDPKLLLSNFPVITGALGLLIGGKTILVALVGRLFGVSVISAIRTGLLLAPGGEFAFVAFGEAVNQGIMSSQLSSLLFLLVGISMALTPWLAAGGQLIASRFEQHDVRSLLPVESETDDLQDHIILCGFGRVGQIIAQLLSERLIPFVALDVRSDRVAIGRALDLPVYFGDAGSREVLHKVGAERACAAAITLDTPGANYRTVWALSKYFPNVKTFVRAHDIDHGLNLEKAGATAVVPETLEPSLQLAAAVLAQVIHDYQREKVFRSGVK

no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST

Original result of BLAST against SWISS-PROT Database

ID	Alignment graph	Length	Definition	RBH(Q2H)	RBH(H2Q)	Q cover	H cover	Identity	E-value
Query		1158	2.2.26 [Sep-21-2011]
O65272		1174	K(+) efflux antiporter 2,	yes	no	0.939	0.926	0.702	0.0
Q9ZTZ7		1193	K(+) efflux antiporter 1,	no	no	0.958	0.930	0.685	0.0
Q9M0Z3		776	K(+) efflux antiporter 3,	no	no	0.454	0.677	0.377	2e-91
A8AQP0		601	Glutathione-regulated pot	yes	no	0.452	0.871	0.370	4e-84
B4TJ42		620	Glutathione-regulated pot	yes	no	0.449	0.838	0.375	7e-83
B7LVT8		620	Glutathione-regulated pot	yes	no	0.448	0.837	0.378	1e-82
A8ALQ4		620	Glutathione-regulated pot	no	no	0.448	0.837	0.376	1e-82
B1JIU4		602	Glutathione-regulated pot	yes	no	0.455	0.877	0.379	1e-82
Q664Q5		602	Glutathione-regulated pot	yes	no	0.455	0.877	0.379	1e-82
A4TGX5		602	Glutathione-regulated pot	yes	no	0.455	0.877	0.379	1e-82

>sp\|O65272\|KEA2_ARATH K(+) efflux antiporter 2, chloroplastic OS=Arabidopsis thaliana GN=KEA2 PE=1 SV=2	Back alignment and function desciption

 Score = 1446 bits (3743), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 802/1142 (70%), Positives = 919/1142 (80%), Gaps = 54/1142 (4%)

Query: 1    MGFACGLQQPNVFEG----TRYRISDRLINSRFRYGGFG-YNVSNRRIVSKTRSTRNLSK 55
            M FA  +Q+ ++F G      Y + +R+I+++    G G     +  I SK RS     +
Sbjct: 1    MDFASSVQRQSMFHGGADFASYCLPNRMISAKLCPKGLGGTRFWDPMIDSKVRSAIRSKR 60

Query: 56   SISYAGCSKSSLVFRGNSDANLWG-LYTCKSLFCSFDDFSKLSRGVCPTCQGNDSLAFID 114
            ++SY    +SSL    + +   +G L   K           +  G    CQ +DS+  + 
Sbjct: 61   NVSY----RSSLTLNADFNGRFYGHLLPAKP--------QNVPLGFRLLCQSSDSVGDLV 108

Query: 115  GNGRNVEFSENGDGPEANSLGEEERETKEDAEPPTTDELRELLMNAMKELEVAQLNSTMF 174
            GN RN+EF+E  D  E  +  +EE++T+E    P+ +ELR+LL  A KELEVA LNSTMF
Sbjct: 109  GNDRNLEFAEGSDDREV-TFSKEEKDTREQDSAPSLEELRDLLNKATKELEVASLNSTMF 167

Query: 175  EEKAQRISEAAIALKDEAANAWNNVNVTLDMVHEIVNEECIAKEAVHKATMALSLAEARL 234
            EEKAQRISE AIALKDEAA+AWN+VN TL++V E V+EE +AKEAV KATMALSLAEARL
Sbjct: 168  EEKAQRISEVAIALKDEAASAWNDVNQTLNVVQEAVDEESVAKEAVQKATMALSLAEARL 227

Query: 235  QVAIESLQDVKQEDDYPEGSTEDDAKSDGKEEDGLLLAAENDIKECQANLANCETELRRL 294
            QVA+ESL     E +    S E + +   K+++  LL+A+ DIKECQ NLA+CE +LRRL
Sbjct: 228  QVALESL-----EAEGYNTSEESEVRDGVKDKEEALLSAKADIKECQENLASCEEQLRRL 282

Query: 295  QSKKEELQKEVDRLNEVAEKAQMNALKAEEDVANIMLLAEQAVAFEIEATQRVNDAEIAL 354
            Q KK+ELQKEVDRLNE AE+AQ++ALKAEEDVANIM+LAEQAVAFE+EATQRVNDAEIAL
Sbjct: 283  QVKKDELQKEVDRLNEAAERAQISALKAEEDVANIMVLAEQAVAFELEATQRVNDAEIAL 342

Query: 355  QRAEKSLSNSSVDISERIKGYV-SGDETAVKEEKAGS-TDDVN--VERDIDVPVNGDYLV 410
            QRAEK+L  S     E  +G V  G  T V E++  S   DV+   ERD+ V      + 
Sbjct: 343  QRAEKTLFGSQTQ--ETTQGKVLDGKNTIVGEDEVLSEIVDVSHQAERDLVVVGVSSDVG 400

Query: 411  SESSHDILPDKVSQSSEELYQSDELIDQENGKLNLDSPKEAEVEAEKSKNVIQTKKQEMQ 470
            ++S                Y+SD     ENGK   D  KEAE EAEKSKNV+ TKKQE+Q
Sbjct: 401  TQS----------------YESD----NENGKPTADFAKEAEGEAEKSKNVVLTKKQEVQ 440

Query: 471  KDLTRESSPVNAPKTLQKKSSRFFPASFFSSAVDGTESTQASIFQGLMEYARKQLPKLVL 530
            KDL RESS  N  KT  KKSSRFFPASFFSS  DGT    A++F+ L+E A++Q PKL+L
Sbjct: 441  KDLPRESSSHNGTKTSLKKSSRFFPASFFSSNGDGT----ATVFESLVESAKQQWPKLIL 496

Query: 531  GFLLFGAGVAFYANQAERSSLQLQQPDVITTSIEEASSNAKPLIREVKKLPKRIKKLLDM 590
            GF L GAGVA Y+N   R++   QQP++++TS E+ SS+ KPLIR+++KLPKRIKKLL+M
Sbjct: 497  GFTLLGAGVAIYSNGVGRNNQLPQQPNIVSTSAEDVSSSTKPLIRQMQKLPKRIKKLLEM 556

Query: 591  LPEQEINEEEASLFDVLWLLLASVIFVPIFQKIPGGSPVLGYLAAGILIGPYGLSIIRHV 650
             P+QE+NEEEASL DVLWLLLASVIFVP+FQKIPGGSPVLGYLAAGILIGPYGLSIIR+V
Sbjct: 557  FPQQEVNEEEASLLDVLWLLLASVIFVPLFQKIPGGSPVLGYLAAGILIGPYGLSIIRNV 616

Query: 651  HGTKAIAEFGVVFLLFNIGLELSVERLSSMKKYVFGLGSAQVLVTAVVVGLVAHFVSGLP 710
            HGTKAIAEFGVVFLLFNIGLELSVERLSSMKKYVFGLGSAQVLVTA V+GL+ H+V+G  
Sbjct: 617  HGTKAIAEFGVVFLLFNIGLELSVERLSSMKKYVFGLGSAQVLVTAAVIGLITHYVAGQA 676

Query: 711  GPASIVIGNGLALSSTAVVLQVLQERGESTSRHGRATFSVLLFQDLAVVVLLILIPLISP 770
            GPA+IVIGNGLALSSTAVVLQVLQERGESTSRHGRATFSVLLFQDLAVVVLLILIPLISP
Sbjct: 677  GPAAIVIGNGLALSSTAVVLQVLQERGESTSRHGRATFSVLLFQDLAVVVLLILIPLISP 736

Query: 771  NSSKGGVGFQAIAEALGVAAVKAAVAITAIIAGGRLLLRPIYKQIAENQNAEIFSANTLL 830
            NSSKGG+GFQAIAEALG+AA+KAAVAIT IIAGGRLLLRPIYKQIAEN+NAEIFSANTLL
Sbjct: 737  NSSKGGIGFQAIAEALGLAAIKAAVAITGIIAGGRLLLRPIYKQIAENRNAEIFSANTLL 796

Query: 831  VILGTSLLTARAGLSMALGAFLAGLLLAETEFSLQVESDIAPYRGLLLGLFFMTVGMSID 890
            VILGTSLLTARAGLSMALGAFLAGLLLAETEFSLQVESDIAPYRGLLLGLFFMTVGMSID
Sbjct: 797  VILGTSLLTARAGLSMALGAFLAGLLLAETEFSLQVESDIAPYRGLLLGLFFMTVGMSID 856

Query: 891  PKLLLSNFPVITGALGLLIGGKTILVALVGRLFGVSVISAIRTGLLLAPGGEFAFVAFGE 950
            PKLLL+NFP+I G LGLL+ GKTILV ++G+LFG+S+ISA+R GLLLAPGGEFAFVAFGE
Sbjct: 857  PKLLLANFPLIMGTLGLLLVGKTILVVIIGKLFGISIISAVRVGLLLAPGGEFAFVAFGE 916

Query: 951  AVNQGIMSSQLSSLLFLLVGISMALTPWLAAGGQLIASRFEQHDVRSLLPVESETDDLQD 1010
            AVNQGIM+ QLSSLLFL+VGISMALTPWLAAGGQLIASRFE  DVRSLLPVESETDDLQ 
Sbjct: 917  AVNQGIMTPQLSSLLFLVVGISMALTPWLAAGGQLIASRFELQDVRSLLPVESETDDLQG 976

Query: 1011 HIILCGFGRVGQIIAQLLSERLIPFVALDVRSDRVAIGRALDLPVYFGDAGSREVLHKVG 1070
            HII+CGFGR+GQIIAQLLSERLIPFVALDV SDRVAIGR+LDLPVYFGDAGSREVLHK+G
Sbjct: 977  HIIICGFGRIGQIIAQLLSERLIPFVALDVSSDRVAIGRSLDLPVYFGDAGSREVLHKIG 1036

Query: 1071 AERACAAAITLDTPGANYRTVWALSKYFPNVKTFVRAHDIDHGLNLEKAGATAVVPETLE 1130
            A+RACAAAI LDTPGANYR VWALSKYFPNVKTFVRAHD+DHGLNLEKAGATAVVPETLE
Sbjct: 1037 ADRACAAAIALDTPGANYRCVWALSKYFPNVKTFVRAHDVDHGLNLEKAGATAVVPETLE 1096

Query: 1131 PS 1132
            PS
Sbjct: 1097 PS 1098

May operate as a K(+)/H(+) antiporter.
Arabidopsis thaliana (taxid: 3702)

>sp\|Q9ZTZ7\|KEA1_ARATH K(+) efflux antiporter 1, chloroplastic OS=Arabidopsis thaliana GN=KEA1 PE=1 SV=2	Back alignment and function description

>sp\|Q9M0Z3\|KEA3_ARATH K(+) efflux antiporter 3, chloroplastic OS=Arabidopsis thaliana GN=KEA3 PE=1 SV=2	Back alignment and function description

>sp\|A8AQP0\|KEFB_CITK8 Glutathione-regulated potassium-efflux system protein KefB OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=kefB PE=3 SV=1	Back alignment and function description

>sp\|B4TJ42\|KEFC_SALHS Glutathione-regulated potassium-efflux system protein KefC OS=Salmonella heidelberg (strain SL476) GN=kefC PE=3 SV=1	Back alignment and function description

>sp\|B7LVT8\|KEFC_ESCF3 Glutathione-regulated potassium-efflux system protein KefC OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=kefC PE=3 SV=1	Back alignment and function description

>sp\|A8ALQ4\|KEFC_CITK8 Glutathione-regulated potassium-efflux system protein KefC OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=kefC PE=3 SV=1	Back alignment and function description

>sp\|B1JIU4\|KEFB_YERPY Glutathione-regulated potassium-efflux system protein KefB OS=Yersinia pseudotuberculosis serotype O:3 (strain YPIII) GN=kefB PE=3 SV=1	Back alignment and function description

>sp\|Q664Q5\|KEFB_YERPS Glutathione-regulated potassium-efflux system protein KefB OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=kefB PE=3 SV=1	Back alignment and function description

>sp\|A4TGX5\|KEFB_YERPP Glutathione-regulated potassium-efflux system protein KefB OS=Yersinia pestis (strain Pestoides F) GN=kefB PE=3 SV=1	Back alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST

Original result of BLAST against Nonredundant Database

GI	Alignment Graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		1158
255541526		1228	Glutathione-regulated potassium-efflux s	0.975	0.920	0.773	0.0
225454115		1207	PREDICTED: K(+) efflux antiporter 2, chl	0.955	0.916	0.752	0.0
356522640		1206	PREDICTED: K(+) efflux antiporter 2, chl	0.891	0.855	0.743	0.0
356506274		1203	PREDICTED: K(+) efflux antiporter 2, chl	0.885	0.852	0.744	0.0
449433089		1212	PREDICTED: K(+) efflux antiporter 2, chl	0.962	0.919	0.725	0.0
356568360		1109	PREDICTED: K(+) efflux antiporter 2, chl	0.884	0.923	0.757	0.0
356532026		1107	PREDICTED: K(+) efflux antiporter 2, chl	0.881	0.922	0.756	0.0
240255705		1174	K(+) efflux antiporter 2 [Arabidopsis th	0.939	0.926	0.702	0.0
334186250		1185	K(+) efflux antiporter 2 [Arabidopsis th	0.939	0.918	0.695	0.0
297848322		1171	hypothetical protein ARALYDRAFT_311263 [	0.944	0.934	0.687	0.0

>gi\|255541526\|ref\|XP_002511827.1\| Glutathione-regulated potassium-efflux system protein kefB, putative [Ricinus communis] gi\|223549007\|gb\|EEF50496.1\| Glutathione-regulated potassium-efflux system protein kefB, putative [Ricinus communis]	Back alignment and taxonomy information

 Score = 1667 bits (4318), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 896/1158 (77%), Positives = 980/1158 (84%), Gaps = 28/1158 (2%)

Query: 1    MGFACGLQQPNVFEG---TRYRISDRLINSRFRYGGFGYNVSNRRIVSKTRSTRNLSKSI 57
            M  AC +QQPN F G   T YR+  RL +S  RY  F YNV +  IV K RS++  SK +
Sbjct: 1    MDLACSIQQPNAFHGSEVTCYRVPGRLYSSS-RYRSFRYNVVDPSIVLKDRSSKKRSKIL 59

Query: 58   SYAG-CSKSSLVFRGNSDANLWGLYT-CKSLFCSFDDFSKLSRGVCPTCQGNDSLAFIDG 115
            +Y G C  SSLVF     ++L   ++   S +CS      + +G    CQGNDSLA+++G
Sbjct: 60   AYNGSCLNSSLVFGRGFQSHLSCAHSNISSFYCSLGGGFNVLKGAKLHCQGNDSLAYVNG 119

Query: 116  NGRNVEFSENG---------DGPEANSLGEEERETKED-AEPPTTDELRELLMNAMKELE 165
            N RNVEF E           DG E   LGE E E KE  AE  + DEL+ELL  A++ELE
Sbjct: 120  NDRNVEFVEGSAESSRVGSEDGVELIRLGENEGEQKEVVAEASSLDELKELLQKALRELE 179

Query: 166  VAQLNSTMFEEKAQRISEAAIALKDEAANAWNNVNVTLDMVHEIVNEECIAKEAVHKATM 225
            +A+LNSTMFEEKAQRISE AIALKDEAANAW+NVN TLD +  +VNEE +AKEA+  ATM
Sbjct: 180  IARLNSTMFEEKAQRISETAIALKDEAANAWDNVNSTLDTIQGVVNEEAVAKEAIQNATM 239

Query: 226  ALSLAEARLQVAIESLQDVKQEDDYPEGSTEDDAKSDGKEEDGLLLAAENDIKECQANLA 285
            ALSLAEARL+VA+ES+   K E D P GS   D   D ++ED  L  A+++I ECQ NL 
Sbjct: 240  ALSLAEARLRVAVESIDSAKGETDSPHGSGVSDVVKDIRKEDEALSDAQDEIIECQMNLG 299

Query: 286  NCETELRRLQSKKEELQKEVDRLNEVAEKAQMNALKAEEDVANIMLLAEQAVAFEIEATQ 345
            NCE ELRRLQSKKEELQKEVDRLNEVAEKAQM+ALKAEEDVAN+MLLAEQAVAFE+EATQ
Sbjct: 300  NCEAELRRLQSKKEELQKEVDRLNEVAEKAQMDALKAEEDVANVMLLAEQAVAFELEATQ 359

Query: 346  RVNDAEIALQRAEKSLSNSSVDISERIKGYVSGDETAVKEEKAGSTDDVNVERDIDVPVN 405
            RVNDAEIALQRAEK LS+SSVD  E  +GYVSGDE   +EEK       + E++ D  ++
Sbjct: 360  RVNDAEIALQRAEKLLSSSSVD-KETTQGYVSGDEAVREEEKWSEGRTADDEKERDASID 418

Query: 406  GDYLVSESSHDILPDKVSQSSEELYQSDELIDQENGKLNLDSPKEAEVEAEKSKNVIQTK 465
             D LV E S D L DK SQSS+ELY SD+  D ENGKLNLDS KE EVEAEKSK+ +Q K
Sbjct: 419  ADLLVGEPSIDGLLDKASQSSKELYHSDDSSDCENGKLNLDSLKEVEVEAEKSKSGVQPK 478

Query: 466  KQEMQKDLTRESS--PVNAPKTLQKKSSRFFPASFFSSAVDGTESTQASIFQGLMEYARK 523
            KQEMQKD+TRESS  P N+PK L KKSSRFF ASFFS  VDGTE T AS+FQGL++ A++
Sbjct: 479  KQEMQKDITRESSASPTNSPKALLKKSSRFFSASFFSFTVDGTELTPASVFQGLIQSAKQ 538

Query: 524  QLPKLVLGFLLFGAGVAFYANQAERSSLQLQQPDVITTSIEEASSNAKPLIREVKKLPKR 583
            Q+PKL+LG +LFGAGVAFY+N+AERS+  LQQ DV+TTSIEE SSNAKPLIR ++KLPKR
Sbjct: 539  QMPKLILGLVLFGAGVAFYSNRAERSTQMLQQTDVVTTSIEEVSSNAKPLIRHIQKLPKR 598

Query: 584  IKKLLDMLPEQE---------INEEEASLFDVLWLLLASVIFVPIFQKIPGGSPVLGYLA 634
            IKKLL MLP QE         +NEEEASLFDVLWLLLASVIFVPIFQKIPGGSPVLGYLA
Sbjct: 599  IKKLLAMLPHQEAYFPFTLFWMNEEEASLFDVLWLLLASVIFVPIFQKIPGGSPVLGYLA 658

Query: 635  AGILIGPYGLSIIRHVHGTKAIAEFGVVFLLFNIGLELSVERLSSMKKYVFGLGSAQVLV 694
            AGILIGPYGLSIIRHVHGTKAIAEFGVVFLLFNIGLELSVERLSSMKKYVFGLG+AQVLV
Sbjct: 659  AGILIGPYGLSIIRHVHGTKAIAEFGVVFLLFNIGLELSVERLSSMKKYVFGLGTAQVLV 718

Query: 695  TAVVVGLVAHFVSGLPGPASIVIGNGLALSSTAVVLQVLQERGESTSRHGRATFSVLLFQ 754
            TAV VGL +HFVSGLPGPA+IV+GNGLALSSTAVVLQVLQERGESTSRHGRATFSVLLFQ
Sbjct: 719  TAVAVGLGSHFVSGLPGPAAIVVGNGLALSSTAVVLQVLQERGESTSRHGRATFSVLLFQ 778

Query: 755  DLAVVVLLILIPLISPNSSKGGVGFQAIAEALGVAAVKAAVAITAIIAGGRLLLRPIYKQ 814
            DLAVVVLLILIPLISPNSSKGGVGFQAIAEALG+AAVKAA+AITAIIAGGRLLLRPIYKQ
Sbjct: 779  DLAVVVLLILIPLISPNSSKGGVGFQAIAEALGLAAVKAALAITAIIAGGRLLLRPIYKQ 838

Query: 815  IAENQNAEIFSANTLLVILGTSLLTARAGLSMALGAFLAGLLLAETEFSLQVESDIAPYR 874
            IAENQNAEIFSANTLLVILGTSLLTARAGLSMALGAFLAGLLLAETEFSLQVESDIAPYR
Sbjct: 839  IAENQNAEIFSANTLLVILGTSLLTARAGLSMALGAFLAGLLLAETEFSLQVESDIAPYR 898

Query: 875  GLLLGLFFMTVGMSIDPKLLLSNFPVITGALGLLIGGKTILVALVGRLFGVSVISAIRTG 934
            GLLLGLFFMTVGMSIDPKLL+SNFPVI G LGLLIGGKT+LVALVGRLFG+S+ISAIR G
Sbjct: 899  GLLLGLFFMTVGMSIDPKLLISNFPVIMGTLGLLIGGKTLLVALVGRLFGISIISAIRVG 958

Query: 935  LLLAPGGEFAFVAFGEAVNQGIMSSQLSSLLFLLVGISMALTPWLAAGGQLIASRFEQHD 994
            LLLAPGGEFAFVAFGEAVNQGIMS QLSSLLFL+VGISMALTPWLAAGGQLIASRFEQHD
Sbjct: 959  LLLAPGGEFAFVAFGEAVNQGIMSPQLSSLLFLVVGISMALTPWLAAGGQLIASRFEQHD 1018

Query: 995  VRSLLPVESETDDLQDHIILCGFGRVGQIIAQLLSERLIPFVALDVRSDRVAIGRALDLP 1054
            VRSLLPVESETDDLQDHII+CGFGRVGQIIAQLLSERLIPFVALDVRSDRVA+GRALDLP
Sbjct: 1019 VRSLLPVESETDDLQDHIIICGFGRVGQIIAQLLSERLIPFVALDVRSDRVAVGRALDLP 1078

Query: 1055 VYFGDAGSREVLHKVGAERACAAAITLDTPGANYRTVWALSKYFPNVKTFVRAHDIDHGL 1114
            V+FGDAGSREVLHKVGAERACAAAITLDTPGANYRTVWALSKYFPNVKTFVRAHD+DHGL
Sbjct: 1079 VFFGDAGSREVLHKVGAERACAAAITLDTPGANYRTVWALSKYFPNVKTFVRAHDVDHGL 1138

Query: 1115 NLEKAGATAVVPETLEPS 1132
            NLEKAGATAVVPETLEPS
Sbjct: 1139 NLEKAGATAVVPETLEPS 1156

Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi\|225454115\|ref\|XP_002269352.1\| PREDICTED: K(+) efflux antiporter 2, chloroplastic-like [Vitis vinifera]	Back alignment and taxonomy information

>gi\|356522640\|ref\|XP_003529954.1\| PREDICTED: K(+) efflux antiporter 2, chloroplastic-like [Glycine max]	Back alignment and taxonomy information

>gi\|356506274\|ref\|XP_003521911.1\| PREDICTED: K(+) efflux antiporter 2, chloroplastic-like [Glycine max]	Back alignment and taxonomy information

>gi\|449433089\|ref\|XP_004134330.1\| PREDICTED: K(+) efflux antiporter 2, chloroplastic-like [Cucumis sativus] gi\|449480375\|ref\|XP_004155876.1\| PREDICTED: K(+) efflux antiporter 2, chloroplastic-like [Cucumis sativus]	Back alignment and taxonomy information

>gi\|356568360\|ref\|XP_003552379.1\| PREDICTED: K(+) efflux antiporter 2, chloroplastic-like [Glycine max]	Back alignment and taxonomy information

>gi\|356532026\|ref\|XP_003534575.1\| PREDICTED: K(+) efflux antiporter 2, chloroplastic-like [Glycine max]	Back alignment and taxonomy information

>gi\|240255705\|ref\|NP_191972.6\| K(+) efflux antiporter 2 [Arabidopsis thaliana] gi\|298351840\|sp\|O65272.2\|KEA2_ARATH RecName: Full=K(+) efflux antiporter 2, chloroplastic; Short=AtKEA2 gi\|332656511\|gb\|AEE81911.1\| K(+) efflux antiporter 2 [Arabidopsis thaliana]	Back alignment and taxonomy information

>gi\|334186250\|ref\|NP_001190645.1\| K(+) efflux antiporter 2 [Arabidopsis thaliana] gi\|332656512\|gb\|AEE81912.1\| K(+) efflux antiporter 2 [Arabidopsis thaliana]	Back alignment and taxonomy information

>gi\|297848322\|ref\|XP_002892042.1\| hypothetical protein ARALYDRAFT_311263 [Arabidopsis lyrata subsp. lyrata] gi\|297337884\|gb\|EFH68301.1\| hypothetical protein ARALYDRAFT_311263 [Arabidopsis lyrata subsp. lyrata]	Back alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST

Original result of BLAST against Gene Ontology (AMIGO)

ID	Alignment graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		1158
TAIR\|locus:2198215		1193	KEA1 "K+ efflux antiporter 1"	0.928	0.901	0.619	0.0
TIGR_CMR\|APH_1305		571	APH_1305 "glutathione-regulate	0.447	0.907	0.367	6e-80
TIGR_CMR\|ECH_0146		568	ECH_0146 "putative glutathione	0.280	0.572	0.347	4.1e-75
TIGR_CMR\|NSE_0885		578	NSE_0885 "glutathione-regulate	0.280	0.562	0.346	8.2e-75
UNIPROTKB\|Q0C665		601	kefC "Glutathione-regulated po	0.441	0.850	0.325	2.1e-62
UNIPROTKB\|Q9KNX4		656	VC_2606 "Glutathione-regulated	0.453	0.800	0.319	2e-61
TIGR_CMR\|VC_2606		656	VC_2606 "glutathione-regulated	0.453	0.800	0.319	2e-61
TIGR_CMR\|SO_1481		589	SO_1481 "glutathione-regulated	0.272	0.536	0.328	2e-60
UNIPROTKB\|P03819		620	kefC [Escherichia coli K-12 (t	0.444	0.830	0.322	1.5e-59
TIGR_CMR\|SO_1647		648	SO_1647 "glutathione-regulated	0.273	0.489	0.320	3.1e-57

TAIR\|locus:2198215 KEA1 "K+ efflux antiporter 1" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

 Score = 3172 (1121.7 bits), Expect = 0., P = 0.
 Identities = 677/1092 (61%), Positives = 792/1092 (72%)

Query:    45 SKTRSTRNLSKSISYAGC-SKSSLVFRGNSDANLWGLYTCKSLFCSFDDFSKLSRGVCPT 103
             SK  S   L ++++ +G  +  +  F G   +    L++ KS+  +     ++  G    
Sbjct:    40 SKVHSCFRLRRNVAQSGTLNLMNACFSGRFYSG--HLHSTKSILGNGHQAKRIPFGFRLR 97

Query:   104 CQGNDSLAFIDGNGRNV-EFSENGDGPEANSLGEEERETKEDAEPPTTDELRELLMNAMK 162
             CQG++SL   D N   + E SE+ D  EA  L +   E   D+     +EL+ELL  A+K
Sbjct:    98 CQGHESLGNADSNDHRIGESSESSDETEATDLKDARVENDTDS----LEELKELLHKAIK 153

Query:   163 ELEVAQLNSTMFEEKAQRISEAAIALKDEAANAWNNVNVTLDMVHEIVNEECIAKEAVHK 222
             ELEVA+LNSTMFEEKAQRISE AIALKDEAA AW +VN TLD++ + V EE +AKEAV  
Sbjct:   154 ELEVARLNSTMFEEKAQRISERAIALKDEAATAWLDVNKTLDVIRDTVYEEALAKEAVQT 213

Query:   223 ATMALSLAEARLQVAIESLQDVKQEDDYPEGSTEDDAKSDGKEEDGLLLAAENDIKECQA 282
             ATMALSLAEARLQV +ESL+     +D P  S E +   D  +++  LLAA++DIKECQ 
Sbjct:   214 ATMALSLAEARLQVIVESLE-AGAGNDIPHVSEETEETIDVNDKEEALLAAKDDIKECQV 272

Query:   283 NLANCETELRRLQSKKEELQKEVDRLNEVAEKAQMNALKAEEDVANIMLLAEQAVAFEIE 342
             NL NCE++L  L SKK+ELQKEVD+LNE AE  Q+++LKAEEDV NIM LAEQAVAFE+E
Sbjct:   273 NLDNCESQLSALLSKKDELQKEVDKLNEFAETIQISSLKAEEDVTNIMKLAEQAVAFELE 332

Query:   343 ATQRVNDAEIALQRAEKSLSNSSVDISERIKGYVSGDETAVKEEK--AGSTDDVNVERDI 400
             ATQRVNDAEIALQRAEKSLS S     E  +G +S +ET+ ++    +G+ +DV  + + 
Sbjct:   333 ATQRVNDAEIALQRAEKSLSISQTP--EETQGQLSDEETSQEDAMVLSGNVEDVTHQVEK 390

Query:   401 DVPVNGDYLVSESSHDILPDKVSQSSEELYQSDELIDQENGKLNLDSPKEAEVEAEKSKN 460
             + P +GD  V + + +++PD V Q +++L Q  E  D ENGK +++S K  E ++EK K 
Sbjct:   391 ESPKDGDLPVVQITAELVPDIVGQRNKKLTQPYESSDHENGKPSVESSKVVEADSEKPKI 450

Query:   461 VIQTKKQEMQKDLTRESSPVNAPKTLQKKXXXXXXXXXXXXXVDGTESTQASIFQGLMEY 520
              +QTKKQE QKDL +E S +N+PK    K              DGT    A++F  L+  
Sbjct:   451 NVQTKKQETQKDLPKEGSSLNSPKASFNKSSRFFSASFFSSNPDGT----ATVFGSLVGS 506

Query:   521 ARKQLPKXXXXXXXXXXXXXXYANQAERSSLQLQQPDVITTSIEEASSNAKPLIREVKKL 580
              ++Q PK              Y+N    ++  LQQPDV +TS E+ SS+ KPLIR+V+KL
Sbjct:   507 VKQQWPKLVLGLALLGAGLTLYSNGVGGNNQLLQQPDVTSTSTEDVSSSTKPLIRQVQKL 566

Query:   581 PKRIKKLLDMLPEQEINEEEASLFDVLWLLLASVIFVPIFQKIPGGSPVLGYLAAGILIG 640
             PKRIKKLL+M+P QE+NEEEASLFD LWLLLASVIFVP+FQKIPGGSPVLGYLAAGILIG
Sbjct:   567 PKRIKKLLEMIPHQEVNEEEASLFDFLWLLLASVIFVPLFQKIPGGSPVLGYLAAGILIG 626

Query:   641 PYGLSIIRHVHGTKAIAEFGVVFLLFNIGLELSVERLSSMKKYVFGLGSAQXXXXXXXXX 700
             PYGLSIIR+VHGT+AIAEFGVVFLLFNIGLELSVERLSSMKKYVFGLGSAQ         
Sbjct:   627 PYGLSIIRNVHGTRAIAEFGVVFLLFNIGLELSVERLSSMKKYVFGLGSAQVLVTAAVVG 686

Query:   701 XXXXXXSGLPGPASIVIGNGLALSSTAVVLQVLQERGESTSRHGRATFSVLLFQDXXXXX 760
                   +G  GPA+IVIGNGLALSSTAVVLQVLQERGESTSRHGRA+FSVLLFQD     
Sbjct:   687 LLAHYVAGQAGPAAIVIGNGLALSSTAVVLQVLQERGESTSRHGRASFSVLLFQDLAVVV 746

Query:   761 XXXXXXXXSPNSSKGGVGFQXXXXXXXXXXXXXXXXXXXXXXXXRLLLRPIYKQIAENQN 820
                     SPNSSKGG+GFQ                        RLLLRPIYKQIAEN+N
Sbjct:   747 LLILIPLISPNSSKGGIGFQAIAEALGLAAVKAAVAITAIIAGGRLLLRPIYKQIAENRN 806

Query:   821 AEIFSANTLLVILGTSLLTARXXXXXXXXXXXXXXXXXETEFSLQVESDIAPYRGLLLGL 880
             AEIFSANTLLVILGTSLLTAR                 ETEFSLQVESDIAPYRGLLLGL
Sbjct:   807 AEIFSANTLLVILGTSLLTARAGLSMALGAFLAGLLLAETEFSLQVESDIAPYRGLLLGL 866

Query:   881 FFMTVGMSIDPKLLLSNFPVITGALGLLIGGKTILVALVGRLFGVSVISAIRTGLLLAPG 940
             FFMTVGMSIDPKLLLSNFPVI G LGLLI GKT+LV ++G+LFG+S+ISAIR GLLLAPG
Sbjct:   867 FFMTVGMSIDPKLLLSNFPVIVGTLGLLIVGKTMLVVIMGKLFGISIISAIRVGLLLAPG 926

Query:   941 GEFAFVAFGEAVNQGIMXXXXXXXXXXXVGISMALTPWLAAGGQLIASRFEQHDVRSLLP 1000
             GEFAFVAFGEAVNQGIM           VGISMA+TPWLAAGGQLIASRFE HDVRSLLP
Sbjct:   927 GEFAFVAFGEAVNQGIMSPQLSSLLFLVVGISMAITPWLAAGGQLIASRFELHDVRSLLP 986

Query:  1001 VESETDDLQDHIILCGFGRVGQIIAQLLSERLIPFVALDVRSDRVAIGRALDLPVYFGDA 1060
             VESETDDLQ HII+CGFGRVGQIIAQLLSERLIPFVALDV SDRV IGR+LDLPVYFGDA
Sbjct:   987 VESETDDLQGHIIICGFGRVGQIIAQLLSERLIPFVALDVSSDRVTIGRSLDLPVYFGDA 1046

Query:  1061 GSREVLHKVGAERACAAAITLDTPGANYRTVWALSKYFPNVKTFVRAHDIDHGLNLEKAG 1120
             GS+EVLHK+GA RACAA + LD PGANYR VWALSK++PNVKTFVRAHD+ HGLNLEKAG
Sbjct:  1047 GSKEVLHKIGAGRACAAVVALDAPGANYRCVWALSKFYPNVKTFVRAHDVVHGLNLEKAG 1106

Query:  1121 ATAVVPETLEPS 1132
             ATAVVPETLEPS
Sbjct:  1107 ATAVVPETLEPS 1118

GO:0000166 "nucleotide binding" evidence=IEA

GO:0006812 "cation transport" evidence=IEA

GO:0006813 "potassium ion transport" evidence=IEA

GO:0008324 "cation transmembrane transporter activity" evidence=IEA

GO:0015079 "potassium ion transmembrane transporter activity" evidence=ISS

GO:0015299 "solute:hydrogen antiporter activity" evidence=IEA

GO:0015386 "potassium:hydrogen antiporter activity" evidence=ISS

GO:0016021 "integral to membrane" evidence=IEA

GO:0055085 "transmembrane transport" evidence=IEA

GO:0009941 "chloroplast envelope" evidence=IDA

GO:0009507 "chloroplast" evidence=IDA

TIGR_CMR\|APH_1305 APH_1305 "glutathione-regulated potassium-efflux system protein" [Anaplasma phagocytophilum HZ (taxid:212042)]	Back alignment and assigned GO terms

TIGR_CMR\|ECH_0146 ECH_0146 "putative glutathione-regulated potassium-efflux system protein KefB" [Ehrlichia chaffeensis str. Arkansas (taxid:205920)]	Back alignment and assigned GO terms

TIGR_CMR\|NSE_0885 NSE_0885 "glutathione-regulated potassium-efflux system protein" [Neorickettsia sennetsu str. Miyayama (taxid:222891)]	Back alignment and assigned GO terms

UNIPROTKB\|Q0C665 kefC "Glutathione-regulated potassium-efflux system protein KefC" [Hyphomonas neptunium ATCC 15444 (taxid:228405)]	Back alignment and assigned GO terms

UNIPROTKB\|Q9KNX4 VC_2606 "Glutathione-regulated potassium-efflux system protein KefB" [Vibrio cholerae O1 biovar El Tor str. N16961 (taxid:243277)]	Back alignment and assigned GO terms

TIGR_CMR\|VC_2606 VC_2606 "glutathione-regulated potassium-efflux system protein KefB" [Vibrio cholerae O1 biovar El Tor (taxid:686)]	Back alignment and assigned GO terms

TIGR_CMR\|SO_1481 SO_1481 "glutathione-regulated potassium-efflux system protein" [Shewanella oneidensis MR-1 (taxid:211586)]	Back alignment and assigned GO terms

UNIPROTKB\|P03819 kefC [Escherichia coli K-12 (taxid:83333)]	Back alignment and assigned GO terms

TIGR_CMR\|SO_1647 SO_1647 "glutathione-regulated potassium-efflux system protein KefB, putative" [Shewanella oneidensis MR-1 (taxid:211586)]	Back alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries

Original result of BLAST against SWISS-PROT

ID	Name	Annotated EC number	Identity	Query coverage	Hit coverage	RBH(Q2H)	RBH(H2Q)
O65272	KEA2_ARATH	No assigned EC number	0.7022	0.9395	0.9267	yes	no

EC Number Prediction by Ezypred Server

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST

Original result of RPS-BLAST against CDD database part I

ID	Alignment Graph	Length	Definition	E-value
Query		1158
PRK03562		621	PRK03562, PRK03562, glutathione-regulated potassiu	1e-135
PRK03659		601	PRK03659, PRK03659, glutathione-regulated potassiu	1e-121
TIGR00932		273	TIGR00932, 2a37, transporter, monovalent cation:pr	4e-99
COG0475		397	COG0475, KefB, Kef-type K+ transport systems, memb	1e-86
pfam00999		370	pfam00999, Na_H_Exchanger, Sodium/hydrogen exchang	4e-60
PRK10669		558	PRK10669, PRK10669, putative cation:proton antipor	4e-53
COG4651		408	COG4651, RosB, Kef-type K+ transport system, predi	5e-50
pfam02254		116	pfam02254, TrkA_N, TrkA-N domain	9e-22
COG1226		212	COG1226, Kch, Kef-type K+ transport systems, predi	2e-20
COG0025		429	COG0025, NhaP, NhaP-type Na+/H+ and K+/H+ antiport	8e-16
COG0569		225	COG0569, TrkA, K+ transport systems, NAD-binding c	7e-10
COG1196		1163	COG1196, Smc, Chromosome segregation ATPases [Cell	2e-07
PLN03159		832	PLN03159, PLN03159, cation/H(+) antiporter 15; Pro	4e-07
PRK05326		562	PRK05326, PRK05326, potassium/proton antiporter; R	5e-07
COG1196		1163	COG1196, Smc, Chromosome segregation ATPases [Cell	7e-06
PRK02224		880	PRK02224, PRK02224, chromosome segregation protein	1e-05
COG1196		1163	COG1196, Smc, Chromosome segregation ATPases [Cell	1e-04
TIGR02169		1164	TIGR02169, SMC_prok_A, chromosome segregation prot	3e-04
pfam03956		191	pfam03956, DUF340, Membrane protein of unknown fun	6e-04
COG1196		1163	COG1196, Smc, Chromosome segregation ATPases [Cell	9e-04
COG1196		1163	COG1196, Smc, Chromosome segregation ATPases [Cell	0.001
TIGR02168		1179	TIGR02168, SMC_prok_B, chromosome segregation prot	0.001
COG1196		1163	COG1196, Smc, Chromosome segregation ATPases [Cell	0.002
COG5271		4600	COG5271, MDN1, AAA ATPase containing von Willebran	0.002
TIGR03082		156	TIGR03082, Gneg_AbrB_dup, membrane protein AbrB du	0.002
TIGR00924		475	TIGR00924, yjdL_sub1_fam, amino acid/peptide trans	0.002
PRK04863		1486	PRK04863, mukB, cell division protein MukB; Provis	0.004

>gnl\|CDD\|235131 PRK03562, PRK03562, glutathione-regulated potassium-efflux system protein KefC; Provisional	Back alignment and domain information

 Score =  424 bits (1093), Expect = e-135
 Identities = 204/532 (38%), Positives = 304/532 (57%), Gaps = 15/532 (2%)

Query: 610  LLASVIFVPIFQKIPGGSPVLGYLAAGILIGPYGLSIIRHVHGTKAIAEFGVVFLLFNIG 669
            L A+V+ VPI  ++  GS VLGYL AG +IGP+GL ++  V      AEFGVV +LF IG
Sbjct: 14   LGAAVLIVPIAVRLGLGS-VLGYLIAGCIIGPWGLRLVTDVESILHFAEFGVVLMLFVIG 72

Query: 670  LELSVERLSSMKKYVFGLGSAQVLVTAVVVGLVAHFVSGLPGPASIVIGNGLALSSTAVV 729
            LEL  +RL  +++ +FG G+ Q++    ++GL    + GL    +++IG GLALSSTA+ 
Sbjct: 73   LELDPQRLWKLRRSIFGGGALQMVACGGLLGLFCMLL-GLRWQVALLIGLGLALSSTAIA 131

Query: 730  LQVLQERGESTSRHGRATFSVLLFQDLAVVVLLILIPLISPNSSKGGVGFQAIAEALGVA 789
            +Q + ER    ++ GR+ F++LLFQD+A + L+ +IPL++ + +   +G      A  ++
Sbjct: 132  MQAMNERNLMVTQMGRSAFAILLFQDIAAIPLVAMIPLLAASGASTTLG------AFALS 185

Query: 790  AVKAAVAITAIIAGGRLLLRPIYKQIAENQNAEIFSANTLLVILGTSLLTARAGLSMALG 849
            A+K A A+  ++ GGR + RP  + +A +   E+F+A  L ++ G  LL    GLSMALG
Sbjct: 186  ALKVAGALALVVLGGRYVTRPALRFVARSGLREVFTAVALFLVFGFGLLMEEVGLSMALG 245

Query: 850  AFLAGLLLAETEFSLQVESDIAPYRGLLLGLFFMTVGMSIDPKLLLSNFPVITGALGLLI 909
            AFLAG+LLA +E+   +ESDI P++GLLLGLFF+ VGMSID   LL N   I   L   +
Sbjct: 246  AFLAGVLLASSEYRHALESDIEPFKGLLLGLFFIAVGMSIDFGTLLENPLRILILLLGFL 305

Query: 910  GGKTILVALVGRLFGVSVISAIRTGLLLAPGGEFAFVAFGEAVNQGIMSSQLSSLLFLLV 969
              K  ++ L+ R  GV         +LL  GGEFAFV FG A    ++  + + LL L V
Sbjct: 306  AIKIAMLWLLARPLGVPRKQRRWFAVLLGQGGEFAFVVFGAAQMANVLEPEWAKLLTLAV 365

Query: 970  GISMALTP-WLAAGGQLIASRFEQHDVRSLLPVESETDDLQDHIILCGFGRVGQIIAQLL 1028
             +SMA TP  L    +L  SR E+           E D+ Q  +I+ GFGR GQI+ +LL
Sbjct: 366  ALSMAATPLLLVLLDRLEQSRTEE------AREADEIDEQQPRVIIAGFGRFGQIVGRLL 419

Query: 1029 SERLIPFVALDVRSDRVAIGRALDLPVYFGDAGSREVLHKVGAERACAAAITLDTPGANY 1088
                +    LD   D +   R   + V++GDA   ++L   GA +A      +D P  + 
Sbjct: 420  LSSGVKMTVLDHDPDHIETLRKFGMKVFYGDATRMDLLESAGAAKAEVLINAIDDPQTSL 479

Query: 1089 RTVWALSKYFPNVKTFVRAHDIDHGLNLEKAGATAVVPETLEPSLQLAAAVL 1140
            + V  + ++FP+++   RA D+DH + L +AG      ET E +L+    VL
Sbjct: 480  QLVELVKEHFPHLQIIARARDVDHYIRLRQAGVEKPERETFEGALKSGRLVL 531

Length = 621

>gnl\|CDD\|179625 PRK03659, PRK03659, glutathione-regulated potassium-efflux system protein KefB; Provisional	Back alignment and domain information

>gnl\|CDD\|233195 TIGR00932, 2a37, transporter, monovalent cation:proton antiporter-2 (CPA2) family	Back alignment and domain information

>gnl\|CDD\|223551 COG0475, KefB, Kef-type K+ transport systems, membrane components [Inorganic ion transport and metabolism]	Back alignment and domain information

>gnl\|CDD\|216235 pfam00999, Na_H_Exchanger, Sodium/hydrogen exchanger family	Back alignment and domain information

>gnl\|CDD\|182633 PRK10669, PRK10669, putative cation:proton antiport protein; Provisional	Back alignment and domain information

>gnl\|CDD\|226998 COG4651, RosB, Kef-type K+ transport system, predicted NAD-binding component [Inorganic ion transport and metabolism]	Back alignment and domain information

>gnl\|CDD\|216949 pfam02254, TrkA_N, TrkA-N domain	Back alignment and domain information

>gnl\|CDD\|224147 COG1226, Kch, Kef-type K+ transport systems, predicted NAD-binding component [Inorganic ion transport and metabolism]	Back alignment and domain information

>gnl\|CDD\|223104 COG0025, NhaP, NhaP-type Na+/H+ and K+/H+ antiporters [Inorganic ion transport and metabolism]	Back alignment and domain information

>gnl\|CDD\|223643 COG0569, TrkA, K+ transport systems, NAD-binding component [Inorganic ion transport and metabolism]	Back alignment and domain information

>gnl\|CDD\|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning]	Back alignment and domain information

>gnl\|CDD\|215608 PLN03159, PLN03159, cation/H(+) antiporter 15; Provisional	Back alignment and domain information

>gnl\|CDD\|235410 PRK05326, PRK05326, potassium/proton antiporter; Reviewed	Back alignment and domain information

>gnl\|CDD\|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning]	Back alignment and domain information

>gnl\|CDD\|179385 PRK02224, PRK02224, chromosome segregation protein; Provisional	Back alignment and domain information

>gnl\|CDD\|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning]	Back alignment and domain information

>gnl\|CDD\|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type	Back alignment and domain information

>gnl\|CDD\|217813 pfam03956, DUF340, Membrane protein of unknown function (DUF340)	Back alignment and domain information

>gnl\|CDD\|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning]	Back alignment and domain information

>gnl\|CDD\|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning]	Back alignment and domain information

>gnl\|CDD\|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type	Back alignment and domain information

>gnl\|CDD\|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning]	Back alignment and domain information

>gnl\|CDD\|227596 COG5271, MDN1, AAA ATPase containing von Willebrand factor type A (vWA) domain [General function prediction only]	Back alignment and domain information

>gnl\|CDD\|213773 TIGR03082, Gneg_AbrB_dup, membrane protein AbrB duplication	Back alignment and domain information

>gnl\|CDD\|233189 TIGR00924, yjdL_sub1_fam, amino acid/peptide transporter (Peptide:H+ symporter), bacterial	Back alignment and domain information

>gnl\|CDD\|235316 PRK04863, mukB, cell division protein MukB; Provisional	Back alignment and domain information

Conserved Domains Detected by HHsearch

Original result of HHsearch against CDD database

ID	Alignment Graph	Length	Definition	Probability
Query		1158
PRK03562		621	glutathione-regulated potassium-efflux system prot	100.0
PRK03659		601	glutathione-regulated potassium-efflux system prot	100.0
PRK10669		558	putative cation:proton antiport protein; Provision	100.0
PLN03159		832	cation/H(+) antiporter 15; Provisional	100.0
COG0475		397	KefB Kef-type K+ transport systems, membrane compo	100.0
COG4651		408	RosB Kef-type K+ transport system, predicted NAD-b	100.0
PRK05326		562	potassium/proton antiporter; Reviewed	100.0
PF00999		380	Na_H_Exchanger: Sodium/hydrogen exchanger family;	100.0
KOG1650		769	consensus Predicted K+/H+-antiporter [Inorganic io	100.0
TIGR00932		273	2a37 transporter, monovalent cation:proton antipor	100.0
TIGR00844		810	c_cpa1 na(+)/h(+) antiporter. This model is specif	99.97
TIGR00831		525	a_cpa1 Na+/H+ antiporter, bacterial form. This mod	99.97
COG3263		574	NhaP-type Na+/H+ and K+/H+ antiporters with a uniq	99.96
COG0025		429	NhaP NhaP-type Na+/H+ and K+/H+ antiporters [Inorg	99.96
TIGR00840		559	b_cpa1 sodium/hydrogen exchanger 3. This model is	99.95
PRK10537		393	voltage-gated potassium channel; Provisional	99.89
KOG1965		575	consensus Sodium/hydrogen exchanger protein [Inorg	99.83
PF02254		116	TrkA_N: TrkA-N domain; InterPro: IPR003148 The reg	99.79
COG0569		225	TrkA K+ transport systems, NAD-binding component [	99.7
PRK14853		423	nhaA pH-dependent sodium/proton antiporter; Provis	99.63
KOG4505		467	consensus Na+/H+ antiporter [Inorganic ion transpo	99.6
PRK09496		453	trkA potassium transporter peripheral membrane com	99.56
PRK09496		453	trkA potassium transporter peripheral membrane com	99.47
COG1226		212	Kch Kef-type K+ transport systems, predicted NAD-b	99.36
KOG1966		670	consensus Sodium/hydrogen exchanger protein [Inorg	99.35
TIGR00773		373	NhaA Na+/H+ antiporter NhaA. These proteins are me	99.27
PRK14856		438	nhaA pH-dependent sodium/proton antiporter; Provis	99.12
PRK14854		383	nhaA pH-dependent sodium/proton antiporter; Provis	98.92
PRK09560		389	nhaA pH-dependent sodium/proton antiporter; Review	98.88
PRK09561		388	nhaA pH-dependent sodium/proton antiporter; Review	98.84
PRK14855		423	nhaA pH-dependent sodium/proton antiporter; Provis	98.78
PF06965		378	Na_H_antiport_1: Na+/H+ antiporter 1; InterPro: IP	98.71
COG3004		390	NhaA Na+/H+ antiporter [Inorganic ion transport an	98.66
PRK12460		312	2-keto-3-deoxygluconate permease; Provisional	98.24
PF05684		378	DUF819: Protein of unknown function (DUF819); Inte	98.07
PF03812		314	KdgT: 2-keto-3-deoxygluconate permease; InterPro:	98.07
TIGR00210		398	gltS sodium--glutamate symport carrier (gltS).	97.84
PF03616		368	Glt_symporter: Sodium/glutamate symporter; InterPr	97.79
COG0786		404	GltS Na+/glutamate symporter [Amino acid transport	97.59
TIGR00698		335	conserved hypothetical integral membrane protein.	97.55
PF03601		305	Cons_hypoth698: Conserved hypothetical protein 698	97.55
PRK06719		157	precorrin-2 dehydrogenase; Validated	97.47
TIGR00793		314	kdgT 2-keto-3-deoxygluconate transporter. This fam	97.43
COG3180		352	AbrB Putative ammonia monooxygenase [General funct	97.4
COG2855		334	Predicted membrane protein [Function unknown]	97.31
PF13593		313	DUF4137: SBF-like CPA transporter family (DUF4137)	97.09
COG0385		319	Predicted Na+-dependent transporter [General funct	96.97
PF05145		318	AmoA: Putative ammonia monooxygenase; InterPro: IP	96.72
PRK11281		1113	hypothetical protein; Provisional	96.68
PRK06718		202	precorrin-2 dehydrogenase; Reviewed	96.67
TIGR00841		286	bass bile acid transporter. Functionally character	96.62
PRK04148		134	hypothetical protein; Provisional	96.55
PRK03562		621	glutathione-regulated potassium-efflux system prot	96.54
COG3493		438	CitS Na+/citrate symporter [Energy production and	96.5
PRK03659		601	glutathione-regulated potassium-efflux system prot	96.46
COG0798		342	ACR3 Arsenite efflux pump ACR3 and related permeas	96.32
cd01075		200	NAD_bind_Leu_Phe_Val_DH NAD(P) binding domain of l	96.28
PRK06522		304	2-dehydropantoate 2-reductase; Reviewed	96.25
PF03601		305	Cons_hypoth698: Conserved hypothetical protein 698	96.24
PRK10929		1109	putative mechanosensitive channel protein; Provisi	96.19
PRK05274		326	2-keto-3-deoxygluconate permease; Provisional	96.16
TIGR00932		273	2a37 transporter, monovalent cation:proton antipor	96.1
COG0679		311	Predicted permeases [General function prediction o	96.06
PLN03159		832	cation/H(+) antiporter 15; Provisional	96.04
PF00670		162	AdoHcyase_NAD: S-adenosyl-L-homocysteine hydrolase	95.99
TIGR00832		328	acr3 arsenical-resistance protein. The first prote	95.95
PRK10669		558	putative cation:proton antiport protein; Provision	95.92
TIGR02853		287	spore_dpaA dipicolinic acid synthetase, A subunit.	95.82
PF13460		183	NAD_binding_10: NADH(P)-binding ; PDB: 3OH8_A 3E8X	95.79
TIGR01470		205	cysG_Nterm siroheme synthase, N-terminal domain. T	95.76
COG0475		397	KefB Kef-type K+ transport systems, membrane compo	95.46
TIGR00946		321	2a69 he Auxin Efflux Carrier (AEC) Family.	95.33
PF03446		163	NAD_binding_2: NAD binding domain of 6-phosphogluc	95.3
TIGR00518		370	alaDH alanine dehydrogenase. The family of known L	95.27
PF03956		191	DUF340: Membrane protein of unknown function (DUF3	95.24
CHL00194		317	ycf39 Ycf39; Provisional	95.22
PRK03818		552	putative transporter; Validated	95.15
PRK05326		562	potassium/proton antiporter; Reviewed	95.13
TIGR00698		335	conserved hypothetical integral membrane protein.	95.13
TIGR00783		347	ccs citrate carrier protein, CCS family. These pro	95.08
TIGR00844		810	c_cpa1 na(+)/h(+) antiporter. This model is specif	95.0
TIGR03802		562	Asp_Ala_antiprt aspartate-alanine antiporter. All	94.94
PF05368		233	NmrA: NmrA-like family; InterPro: IPR008030 NmrA i	94.91
TIGR00831		525	a_cpa1 Na+/H+ antiporter, bacterial form. This mod	94.91
COG2855		334	Predicted membrane protein [Function unknown]	94.9
KOG0994		1758	consensus Extracellular matrix glycoprotein Lamini	94.89
COG1748		389	LYS9 Saccharopine dehydrogenase and related protei	94.8
cd05211		217	NAD_bind_Glu_Leu_Phe_Val NAD(P) binding domain of	94.7
PF02558		151	ApbA: Ketopantoate reductase PanE/ApbA; InterPro:	94.69
TIGR03082		156	Gneg_AbrB_dup membrane protein AbrB duplication. T	94.66
PRK12921		305	2-dehydropantoate 2-reductase; Provisional	94.52
PRK08306		296	dipicolinate synthase subunit A; Reviewed	94.46
KOG4673		961	consensus Transcription factor TMF, TATA element m	94.22
TIGR00210		398	gltS sodium--glutamate symport carrier (gltS).	94.12
TIGR00872		298	gnd_rel 6-phosphogluconate dehydrogenase (decarbox	94.09
PRK09599		301	6-phosphogluconate dehydrogenase-like protein; Rev	94.07
PRK12490		299	6-phosphogluconate dehydrogenase-like protein; Rev	93.96
TIGR02964		246	xanthine_xdhC xanthine dehydrogenase accessory pro	93.94
PRK05562		223	precorrin-2 dehydrogenase; Provisional	93.85
PRK12475		338	thiamine/molybdopterin biosynthesis MoeB-like prot	93.82
cd01065		155	NAD_bind_Shikimate_DH NAD(P) binding domain of Shi	93.81
PF13241		103	NAD_binding_7: Putative NAD(P)-binding; PDB: 3DFZ_	93.53
PF03435		386	Saccharop_dh: Saccharopine dehydrogenase ; InterPr	93.47
PF06826		169	Asp-Al_Ex: Predicted Permease Membrane Region; Int	93.35
TIGR03649		285	ergot_EASG ergot alkaloid biosynthesis protein, AF	93.31
PLN02494		477	adenosylhomocysteinase	93.23
PRK04972		558	putative transporter; Provisional	93.23
KOG0994		1758	consensus Extracellular matrix glycoprotein Lamini	93.22
TIGR00936		406	ahcY adenosylhomocysteinase. This enzyme hydrolyze	93.15
PRK05476		425	S-adenosyl-L-homocysteine hydrolase; Provisional	93.0
PF05145		318	AmoA: Putative ammonia monooxygenase; InterPro: IP	92.95
PTZ00075		476	Adenosylhomocysteinase; Provisional	92.85
TIGR01692		288	HIBADH 3-hydroxyisobutyrate dehydrogenase. This en	92.82
PF03390		414	2HCT: 2-hydroxycarboxylate transporter family; Int	92.8
PF03616		368	Glt_symporter: Sodium/glutamate symporter; InterPr	92.68
TIGR02168		1179	SMC_prok_B chromosome segregation protein SMC, com	92.65
COG1893		307	ApbA Ketopantoate reductase [Coenzyme metabolism]	92.59
PRK04863		1486	mukB cell division protein MukB; Provisional	92.52
PLN02819		1042	lysine-ketoglutarate reductase/saccharopine dehydr	92.5
PRK05993		277	short chain dehydrogenase; Provisional	92.47
PRK05708		305	2-dehydropantoate 2-reductase; Provisional	92.45
PLN00141		251	Tic62-NAD(P)-related group II protein; Provisional	92.42
TIGR03082		156	Gneg_AbrB_dup membrane protein AbrB duplication. T	92.35
cd01078		194	NAD_bind_H4MPT_DH NADP binding domain of methylene	92.19
PRK07417		279	arogenate dehydrogenase; Reviewed	92.13
cd00401		413	AdoHcyase S-adenosyl-L-homocysteine hydrolase (Ado	92.13
PRK11064		415	wecC UDP-N-acetyl-D-mannosamine dehydrogenase; Pro	92.1
PF01758		187	SBF: Sodium Bile acid symporter family; InterPro:	92.05
TIGR03802		562	Asp_Ala_antiprt aspartate-alanine antiporter. All	92.04
TIGR01625		154	YidE_YbjL_dupl AspT/YidE/YbjL antiporter duplicati	92.03
PRK08229		341	2-dehydropantoate 2-reductase; Provisional	92.03
PRK00094		325	gpsA NAD(P)H-dependent glycerol-3-phosphate dehydr	91.99
PRK03818		552	putative transporter; Validated	91.8
PRK08017		256	oxidoreductase; Provisional	91.74
PLN02688		266	pyrroline-5-carboxylate reductase	91.68
COG2985		544	Predicted permease [General function prediction on	91.67
PRK09903		314	putative transporter YfdV; Provisional	91.65
PRK11559		296	garR tartronate semialdehyde reductase; Provisiona	91.62
TIGR01505		291	tartro_sem_red 2-hydroxy-3-oxopropionate reductase	91.61
COG0499		420	SAM1 S-adenosylhomocysteine hydrolase [Coenzyme me	91.54
TIGR02680		1353	conserved hypothetical protein TIGR02680. Members	91.48
PRK14106		450	murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn	91.46
PRK15178		434	Vi polysaccharide export inner membrane protein Ve	91.34
TIGR02169		1164	SMC_prok_A chromosome segregation protein SMC, pri	91.34
PF03721		185	UDPG_MGDP_dh_N: UDP-glucose/GDP-mannose dehydrogen	91.32
COG1648		210	CysG Siroheme synthase (precorrin-2 oxidase/ferroc	91.27
COG1023		300	Gnd Predicted 6-phosphogluconate dehydrogenase [Ca	91.08
COG1196		1163	Smc Chromosome segregation ATPases [Cell division	90.98
PF03807		96	F420_oxidored: NADP oxidoreductase coenzyme F420-d	90.96
PRK06182		273	short chain dehydrogenase; Validated	90.85
PLN03209		576	translocon at the inner envelope of chloroplast su	90.57
cd05291		306	HicDH_like L-2-hydroxyisocapronate dehydrogenases	90.56
KOG0996		1293	consensus Structural maintenance of chromosome pro	90.52
TIGR03185		650	DNA_S_dndD DNA sulfur modification protein DndD. T	90.5
PRK14620		326	NAD(P)H-dependent glycerol-3-phosphate dehydrogena	90.47
PRK07688		339	thiamine/molybdopterin biosynthesis ThiF/MoeB-like	90.33
COG1196		1163	Smc Chromosome segregation ATPases [Cell division	90.26
PF06008		264	Laminin_I: Laminin Domain I; InterPro: IPR009254 L	90.24
TIGR03466		328	HpnA hopanoid-associated sugar epimerase. The sequ	90.18
PRK04972		558	putative transporter; Provisional	90.12
PTZ00142		470	6-phosphogluconate dehydrogenase; Provisional	90.12
PRK15059		292	tartronate semialdehyde reductase; Provisional	90.11
COG0786		404	GltS Na+/glutamate symporter [Amino acid transport	90.0
TIGR02169		1164	SMC_prok_A chromosome segregation protein SMC, pri	89.99
PRK15461		296	NADH-dependent gamma-hydroxybutyrate dehydrogenase	89.92
PRK09260		288	3-hydroxybutyryl-CoA dehydrogenase; Validated	89.92
PF10727		127	Rossmann-like: Rossmann-like domain; InterPro: IPR	89.78
PF00261		237	Tropomyosin: Tropomyosin; InterPro: IPR000533 Trop	89.77
TIGR00873		467	gnd 6-phosphogluconate dehydrogenase, decarboxylat	89.71
cd05213		311	NAD_bind_Glutamyl_tRNA_reduct NADP-binding domain	89.62
TIGR00946		321	2a69 he Auxin Efflux Carrier (AEC) Family.	89.52
PRK06249		313	2-dehydropantoate 2-reductase; Provisional	89.48
TIGR03136		399	malonate_biotin Na+-transporting malonate decarbox	89.4
PF03977		360	OAD_beta: Na+-transporting oxaloacetate decarboxyl	89.25
PF07991		165	IlvN: Acetohydroxy acid isomeroreductase, catalyti	89.24
PRK06129		308	3-hydroxyacyl-CoA dehydrogenase; Validated	89.06
KOG3826		252	consensus Na+/H+ antiporter [Inorganic ion transpo	89.0
PRK05225		487	ketol-acid reductoisomerase; Validated	88.82
PRK06545		359	prephenate dehydrogenase; Validated	88.8
PRK07502		307	cyclohexadienyl dehydrogenase; Validated	88.7
PLN02427		386	UDP-apiose/xylose synthase	88.68
TIGR03026		411	NDP-sugDHase nucleotide sugar dehydrogenase. All o	88.62
PRK01438		480	murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn	88.41
PRK09291		257	short chain dehydrogenase; Provisional	88.37
PRK08507		275	prephenate dehydrogenase; Validated	88.36
PRK10637		457	cysG siroheme synthase; Provisional	88.22
PLN02657		390	3,8-divinyl protochlorophyllide a 8-vinyl reductas	88.15
PRK00048		257	dihydrodipicolinate reductase; Provisional	88.08
TIGR00465		314	ilvC ketol-acid reductoisomerase. This is the seco	88.07
TIGR02680		1353	conserved hypothetical protein TIGR02680. Members	88.04
COG5374		192	Uncharacterized conserved protein [Function unknow	88.03
PF03547		385	Mem_trans: Membrane transport protein; InterPro: I	87.94
PLN02695		370	GDP-D-mannose-3',5'-epimerase	87.64
COG1346		230	LrgB Putative effector of murein hydrolase [Cell e	87.52
PRK14618		328	NAD(P)H-dependent glycerol-3-phosphate dehydrogena	87.45
PRK05693		274	short chain dehydrogenase; Provisional	87.44
PF05701		522	WEMBL: Weak chloroplast movement under blue light;	87.41
PF13478		136	XdhC_C: XdhC Rossmann domain; PDB: 3ON5_A 2WE8_B 2	87.39
PRK12460		312	2-keto-3-deoxygluconate permease; Provisional	87.27
COG3180		352	AbrB Putative ammonia monooxygenase [General funct	87.01
PF00038		312	Filament: Intermediate filament protein; InterPro:	86.9
TIGR00783		347	ccs citrate carrier protein, CCS family. These pro	86.9
COG2431		297	Predicted membrane protein [Function unknown]	86.88
PRK07326		237	short chain dehydrogenase; Provisional	86.86
PRK01710		458	murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn	86.84
PF01488		135	Shikimate_DH: Shikimate / quinate 5-dehydrogenase;	86.82
PF01408		120	GFO_IDH_MocA: Oxidoreductase family, NAD-binding R	86.77
PRK11880		267	pyrroline-5-carboxylate reductase; Reviewed	86.73
COG2084		286	MmsB 3-hydroxyisobutyrate dehydrogenase and relate	86.73
PF00072		112	Response_reg: Response regulator receiver domain;	86.71
PRK12491		272	pyrroline-5-carboxylate reductase; Reviewed	86.58
PRK13302		271	putative L-aspartate dehydrogenase; Provisional	86.58
PRK08264		238	short chain dehydrogenase; Validated	86.43
PLN02896		353	cinnamyl-alcohol dehydrogenase	86.4
PRK06019		372	phosphoribosylaminoimidazole carboxylase ATPase su	86.38
TIGR03025		445	EPS_sugtrans exopolysaccharide biosynthesis polypr	86.37
PRK06953		222	short chain dehydrogenase; Provisional	86.04
PF04012		221	PspA_IM30: PspA/IM30 family; InterPro: IPR007157 T	86.02
PRK06101		240	short chain dehydrogenase; Provisional	85.99
TIGR02356		202	adenyl_thiF thiazole biosynthesis adenylyltransfer	85.95
PLN02350		493	phosphogluconate dehydrogenase (decarboxylating)	85.88
PRK13403		335	ketol-acid reductoisomerase; Provisional	85.88
PRK15057		388	UDP-glucose 6-dehydrogenase; Provisional	85.8
PRK06130		311	3-hydroxybutyryl-CoA dehydrogenase; Validated	85.76
PF01210		157	NAD_Gly3P_dh_N: NAD-dependent glycerol-3-phosphate	85.6
TIGR01109		354	Na_pump_decarbB sodium ion-translocating decarboxy	85.58
PLN02256		304	arogenate dehydrogenase	85.35
PF05276		239	SH3BP5: SH3 domain-binding protein 5 (SH3BP5); Int	85.3
PF12128		1201	DUF3584: Protein of unknown function (DUF3584); In	85.25
PRK05884		223	short chain dehydrogenase; Provisional	85.21
COG0287		279	TyrA Prephenate dehydrogenase [Amino acid transpor	85.16
cd01076		227	NAD_bind_1_Glu_DH NAD(P) binding domain of glutama	85.11
PLN02650		351	dihydroflavonol-4-reductase	85.11
PRK06914		280	short chain dehydrogenase; Provisional	85.09
TIGR02354		200	thiF_fam2 thiamine biosynthesis protein ThiF, fami	85.07
PRK05808		282	3-hydroxybutyryl-CoA dehydrogenase; Validated	85.02
PRK11908		347	NAD-dependent epimerase/dehydratase family protein	85.01
PRK10698		222	phage shock protein PspA; Provisional	85.01
PRK08293		287	3-hydroxybutyryl-CoA dehydrogenase; Validated	84.96
PRK07454		241	short chain dehydrogenase; Provisional	84.84
PF03977		360	OAD_beta: Na+-transporting oxaloacetate decarboxyl	84.79
PRK08644		212	thiamine biosynthesis protein ThiF; Provisional	84.75
COG1004		414	Ugd Predicted UDP-glucose 6-dehydrogenase [Cell en	84.68
PLN02686		367	cinnamoyl-CoA reductase	84.64
PRK08219		227	short chain dehydrogenase; Provisional	84.62
COG2085		211	Predicted dinucleotide-binding enzymes [General fu	84.42
COG1086		588	Predicted nucleoside-diphosphate sugar epimerases	84.41
COG2910		211	Putative NADH-flavin reductase [General function p	84.4
PRK03369		488	murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn	84.34
PF00999		380	Na_H_Exchanger: Sodium/hydrogen exchanger family;	84.07
cd01483		143	E1_enzyme_family Superfamily of activating enzymes	84.05
PRK07680		273	late competence protein ComER; Validated	83.97
PRK07060		245	short chain dehydrogenase; Provisional	83.91
COG5420		71	Uncharacterized conserved small protein containing	83.9
PRK07024		257	short chain dehydrogenase; Provisional	83.8
PLN02662		322	cinnamyl-alcohol dehydrogenase family protein	83.75
PRK04288		232	antiholin-like protein LrgB; Provisional	83.72
PHA02562		562	46 endonuclease subunit; Provisional	83.61
PF02826		178	2-Hacid_dh_C: D-isomer specific 2-hydroxyacid dehy	83.59
TIGR03023		451	WcaJ_sugtrans Undecaprenyl-phosphate glucose phosp	83.59
PF03390		414	2HCT: 2-hydroxycarboxylate transporter family; Int	83.41
PRK09424		509	pntA NAD(P) transhydrogenase subunit alpha; Provis	83.39
PRK02318		381	mannitol-1-phosphate 5-dehydrogenase; Provisional	83.34
KOG1420		1103	consensus Ca2+-activated K+ channel Slowpoke, alph	83.32
PRK15116		268	sulfur acceptor protein CsdL; Provisional	83.18
COG0240		329	GpsA Glycerol-3-phosphate dehydrogenase [Energy pr	83.15
COG0025		429	NhaP NhaP-type Na+/H+ and K+/H+ antiporters [Inorg	83.08
PF00056		141	Ldh_1_N: lactate/malate dehydrogenase, NAD binding	83.04
PRK12828		239	short chain dehydrogenase; Provisional	83.04
PRK06949		258	short chain dehydrogenase; Provisional	83.02
cd02067		119	B12-binding B12 binding domain (B12-BD). This doma	82.99
PRK08655		437	prephenate dehydrogenase; Provisional	82.99
PRK12439		341	NAD(P)H-dependent glycerol-3-phosphate dehydrogena	82.95
PLN02712		667	arogenate dehydrogenase	82.91
PF00899		135	ThiF: ThiF family; InterPro: IPR000594 Ubiquitin-a	82.88
PRK07074		257	short chain dehydrogenase; Provisional	82.79
PRK09903		314	putative transporter YfdV; Provisional	82.76
PF12128		1201	DUF3584: Protein of unknown function (DUF3584); In	82.69
PRK08265		261	short chain dehydrogenase; Provisional	82.65
COG1064		339	AdhP Zn-dependent alcohol dehydrogenases [General	82.62
PRK06483		236	dihydromonapterin reductase; Provisional	82.58
PF03956		191	DUF340: Membrane protein of unknown function (DUF3	82.57
TIGR01181		317	dTDP_gluc_dehyt dTDP-glucose 4,6-dehydratase. This	82.56
PRK06924		251	short chain dehydrogenase; Provisional	82.51
PRK09072		263	short chain dehydrogenase; Provisional	82.45
PRK00141		473	murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn	82.43
PLN02989		325	cinnamyl-alcohol dehydrogenase family protein	82.38
KOG1650		769	consensus Predicted K+/H+-antiporter [Inorganic io	82.36
PF05701		522	WEMBL: Weak chloroplast movement under blue light;	82.36
PF00289		110	CPSase_L_chain: Carbamoyl-phosphate synthase L cha	82.34
PRK07231		251	fabG 3-ketoacyl-(acyl-carrier-protein) reductase;	82.33
PRK06035		291	3-hydroxyacyl-CoA dehydrogenase; Validated	82.3
PF13514		1111	AAA_27: AAA domain	82.26
PLN02353		473	probable UDP-glucose 6-dehydrogenase	82.25
PRK07530		292	3-hydroxybutyryl-CoA dehydrogenase; Validated	82.23
PLN02583		297	cinnamoyl-CoA reductase	82.22
PF02310		121	B12-binding: B12 binding domain; InterPro: IPR0061	82.22
PRK07679		279	pyrroline-5-carboxylate reductase; Reviewed	82.21
PLN02712		667	arogenate dehydrogenase	82.19
TIGR00659		226	conserved hypothetical protein TIGR00659. Members	82.13
COG4651		408	RosB Kef-type K+ transport system, predicted NAD-b	81.82
PRK06482		276	short chain dehydrogenase; Provisional	81.74
PRK02705		459	murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn	81.72
PRK10538		248	malonic semialdehyde reductase; Provisional	81.71
PRK12939		250	short chain dehydrogenase; Provisional	81.63
PRK06180		277	short chain dehydrogenase; Provisional	81.54
PRK10711		231	hypothetical protein; Provisional	81.51
PRK11281		1113	hypothetical protein; Provisional	81.51
PRK11199		374	tyrA bifunctional chorismate mutase/prephenate deh	81.48
PLN00016		378	RNA-binding protein; Provisional	81.47
TIGR02977		219	phageshock_pspA phage shock protein A. Members of	81.43
COG1842		225	PspA Phage shock protein A (IM30), suppresses sigm	81.43
PRK06940		275	short chain dehydrogenase; Provisional	81.33
PRK15181		348	Vi polysaccharide biosynthesis protein TviC; Provi	81.31
cd01080		168	NAD_bind_m-THF_DH_Cyclohyd NADP binding domain of	81.28
KOG1201		300	consensus Hydroxysteroid 17-beta dehydrogenase 11	81.16
TIGR01915		219	npdG NADPH-dependent F420 reductase. This model re	81.16
PF01262		168	AlaDh_PNT_C: Alanine dehydrogenase/PNT, C-terminal	81.12
TIGR01763		305	MalateDH_bact malate dehydrogenase, NAD-dependent.	81.12
KOG1370		434	consensus S-adenosylhomocysteine hydrolase [Coenzy	81.1
PRK08267		260	short chain dehydrogenase; Provisional	81.09
PRK06179		270	short chain dehydrogenase; Provisional	81.06
PRK07774		250	short chain dehydrogenase; Provisional	80.95
PRK08177		225	short chain dehydrogenase; Provisional	80.9
TIGR01142		380	purT phosphoribosylglycinamide formyltransferase 2	80.88
TIGR03589		324	PseB UDP-N-acetylglucosamine 4,6-dehydratase. This	80.59
PRK06194		287	hypothetical protein; Provisional	80.53
KOG0161		1930	consensus Myosin class II heavy chain [Cytoskeleto	80.39
TIGR01318		467	gltD_gamma_fam glutamate synthase small subunit fa	80.25
PRK00066		315	ldh L-lactate dehydrogenase; Reviewed	80.24
PRK12429		258	3-hydroxybutyrate dehydrogenase; Provisional	80.21
PRK07523		255	gluconate 5-dehydrogenase; Provisional	80.2
PLN00106		323	malate dehydrogenase	80.01
TIGR03136		399	malonate_biotin Na+-transporting malonate decarbox	80.01

>PRK03562 glutathione-regulated potassium-efflux system protein KefC; Provisional	Back alignment and domain information

Probab=100.00  E-value=3.8e-72  Score=685.56  Aligned_cols=528  Identities=38%  Similarity=0.609  Sum_probs=472.5

Q ss_pred             hHHHHHHHHHHHHHHHHHHHHhcCCCchHHHHHHHHHhhcccccccccCchhHHHHHHHHHHHHHHHHHhcCChhHHHhc
Q 001096          601 ASLFDVLWLLLASVIFVPIFQKIPGGSPVLGYLAAGILIGPYGLSIIRHVHGTKAIAEFGVVFLLFNIGLELSVERLSSM  680 (1158)
Q Consensus       601 ~~Ll~i~lLLl~a~ilg~Ll~Rl~glP~VVG~ILaGILLGP~gLgli~~~~~l~~LaeLGLi~LLF~aGLelDl~~Lrr~  680 (1158)
                      +.++++++++.++.+++++++|+ ++|+++|||++|+++||+++|++++...+..++++|++++||.+|+|+|++.+++.
T Consensus         5 ~~l~~~~~~l~~a~i~~~l~~rl-~lp~vlgyilaGillGP~~lg~i~~~~~i~~laelGvv~LlF~iGLEl~~~~l~~~   83 (621)
T PRK03562          5 HTLIQALIYLGAAVLIVPIAVRL-GLGSVLGYLIAGCIIGPWGLRLVTDVESILHFAEFGVVLMLFVIGLELDPQRLWKL   83 (621)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHh-CCChHHHHHHHHHHhCcccccCCCCHHHHHHHHHHHHHHHHHHHHhCcCHHHHHHH
Confidence            46788999999999999999999 99999999999999999999999888889999999999999999999999999999


Q ss_pred             hhhHHHHHHHHHHHHHHHHHHHHHHHhCCChHHHHHHhhccccCcHHHHHHHHHhcCCCCchhhHHHHHHHhhhhhHHHH
Q 001096          681 KKYVFGLGSAQVLVTAVVVGLVAHFVSGLPGPASIVIGNGLALSSTAVVLQVLQERGESTSRHGRATFSVLLFQDLAVVV  760 (1158)
Q Consensus       681 ~k~il~Lai~gvllt~iivglll~~llGls~~~AlllGaiLs~TS~aVVv~iL~el~ll~s~~GrlaLs~sllnDi~aIv  760 (1158)
                      ++.++.++..+++++++++ +.+.+++|++|..++++|.+++.|||++++++|+|++.++++.|+.++++++++|+++|+
T Consensus        84 ~~~~~~~g~~qv~~~~~~~-~~~~~~~g~~~~~al~ig~~la~SStaiv~~~L~e~~~l~t~~G~~~l~~ll~~Dl~~i~  162 (621)
T PRK03562         84 RRSIFGGGALQMVACGGLL-GLFCMLLGLRWQVALLIGLGLALSSTAIAMQAMNERNLMVTQMGRSAFAILLFQDIAAIP  162 (621)
T ss_pred             HHHHHHHHHHHHHHHHHHH-HHHHHHhCCCHHHHHHHHHHHHHHHHHHHHHHHHHhccccCchHHHHHHHHHHHHHHHHH
Confidence            9999999999999987644 445567899999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHHHhcCCCCCCCcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhcchhHHHHHHHHHHHHHHHHHH
Q 001096          761 LLILIPLISPNSSKGGVGFQAIAEALGVAAVKAAVAITAIIAGGRLLLRPIYKQIAENQNAEIFSANTLLVILGTSLLTA  840 (1158)
Q Consensus       761 ll~ll~~la~~~s~g~~~~~~i~~~L~l~~l~iil~ivl~~lig~~llr~ll~~i~~~~~~el~~l~iL~v~l~~a~lae  840 (1158)
                      ++++++.+.....  +....    .++...+..++.+++++++++|+.+|+++|+.+.+.+|.++..+++++++++++++
T Consensus       163 ll~l~~~l~~~~~--~~~~~----~~~~~~~~~~~~~~~~~~~g~~l~~~l~~~~~~~~~~e~~~~~~l~lv~~~a~la~  236 (621)
T PRK03562        163 LVAMIPLLAASGA--STTLG----AFALSALKVAGALALVVLGGRYVTRPALRFVARSGLREVFTAVALFLVFGFGLLME  236 (621)
T ss_pred             HHHHHHHHccCCC--ccchh----HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhCCchHHHHHHHHHHHHHHHHHH
Confidence            9988776653211  11111    12222334445555666778899999999998888889888888889999999999


Q ss_pred             HhCchHHHHHHHHHHhhcccchhHHHHHhHHhHHHHHHHHHHHHHhcccChhhhhhhhhhHHHHHHHHHHHHHHHHHHHH
Q 001096          841 RAGLSMALGAFLAGLLLAETEFSLQVESDIAPYRGLLLGLFFMTVGMSIDPKLLLSNFPVITGALGLLIGGKTILVALVG  920 (1158)
Q Consensus       841 ~lGls~vLGAFvAGLiL~n~~~~~~l~e~l~~~~~~flPlFFvliGm~idl~~L~~~~~~vllllvl~ll~K~l~v~l~~  920 (1158)
                      .+|+|+++|||++|+++++.++++++++++++|+++|+|+||+++||++|+..+...++.++.++++.+++|++++++.+
T Consensus       237 ~~Gls~~lGAFlAGl~l~~~~~~~~le~~i~pf~~lll~lFFi~vG~~id~~~l~~~~~~il~~~~~~~~~K~~~~~~~~  316 (621)
T PRK03562        237 EVGLSMALGAFLAGVLLASSEYRHALESDIEPFKGLLLGLFFIAVGMSIDFGTLLENPLRILILLLGFLAIKIAMLWLLA  316 (621)
T ss_pred             HhCccHHHHHHHHHHHhcCCccHHHHHHHHHHHHHHHHHHHHHHhhhhccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence            99999999999999999999999999999999999999999999999999998877666666666678899999999999


Q ss_pred             HhcCCChhhHHHHhhhccccchhhHHHHHHHHhhccchhhhHHHHHHHHHHHHHhHHHHHhhhhhHHh-hhhhhcccccC
Q 001096          921 RLFGVSVISAIRTGLLLAPGGEFAFVAFGEAVNQGIMSSQLSSLLFLLVGISMALTPWLAAGGQLIAS-RFEQHDVRSLL  999 (1158)
Q Consensus       921 ~~~g~~~real~lgL~La~rG~valvla~ia~~~giIs~elfsiLvlvVVlS~IitPlL~~~~~~la~-r~~~~~~r~l~  999 (1158)
                      +++|+++++++.+|+.|+++|+++++++..+.+.|+++++.++++++++++|++++|++..+++++.. ++...  .   
T Consensus       317 ~~~g~~~~~a~~~gl~L~~~Gef~~vl~~~a~~~~~i~~~~~~~lv~~v~lS~~~tP~l~~~~~~~~~~~~~~~--~---  391 (621)
T PRK03562        317 RPLGVPRKQRRWFAVLLGQGGEFAFVVFGAAQMANVLEPEWAKLLTLAVALSMAATPLLLVLLDRLEQSRTEEA--R---  391 (621)
T ss_pred             HHhCCCHhHHHHHHHHHhccccHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHHHHHHHHHhhhHHHHHHhhhc--c---
Confidence            99999999999999999999999999999999999999999999999999999999999887654433 33211  1   


Q ss_pred             ccCcccccccccccccCCcccHHHHHHHHhhCCCCEEEEeCCchHHHHhhhCCCCEEEccCCCHHHHHhcCccccCEEEE
Q 001096         1000 PVESETDDLQDHIILCGFGRVGQIIAQLLSERLIPFVALDVRSDRVAIGRALDLPVYFGDAGSREVLHKVGAERACAAAI 1079 (1158)
Q Consensus      1000 ~~e~~~~~l~~hvVIiG~G~vG~~Ia~~L~e~g~~VvVID~d~~~v~~l~~~g~~vi~GDasd~e~L~~AgI~~A~~VIi 1079 (1158)
                      . +...++.++|++|||+|++|+.+++.|.++|++|++||.|+++++.+++.|+++++||++++++|+++|+++|+.+|+
T Consensus       392 ~-~~~~~~~~~~vII~G~Gr~G~~va~~L~~~g~~vvvID~d~~~v~~~~~~g~~v~~GDat~~~~L~~agi~~A~~vvv  470 (621)
T PRK03562        392 E-ADEIDEQQPRVIIAGFGRFGQIVGRLLLSSGVKMTVLDHDPDHIETLRKFGMKVFYGDATRMDLLESAGAAKAEVLIN  470 (621)
T ss_pred             c-ccccccccCcEEEEecChHHHHHHHHHHhCCCCEEEEECCHHHHHHHHhcCCeEEEEeCCCHHHHHhcCCCcCCEEEE
Confidence            1 112234479999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             ecCCchhhHHHHHHHHhhCCCceEEEEecChhhHHHHHHCCCCeeecCCcHHHHHHHHHHHHh
Q 001096         1080 TLDTPGANYRTVWALSKYFPNVKTFVRAHDIDHGLNLEKAGATAVVPETLEPSLQLAAAVLAQ 1142 (1158)
Q Consensus      1080 ~t~dd~~Nl~i~l~ar~l~p~~~IIara~d~e~~~~L~~aGAd~VI~p~~~a~~~LA~~vl~~ 1142 (1158)
                      +++||+.|..++..+|+++|+.+|++|++|+++.+.|+++|||+|+++...++..++++++..
T Consensus       471 ~~~d~~~n~~i~~~ar~~~p~~~iiaRa~d~~~~~~L~~~Gad~v~~e~~e~sl~l~~~~L~~  533 (621)
T PRK03562        471 AIDDPQTSLQLVELVKEHFPHLQIIARARDVDHYIRLRQAGVEKPERETFEGALKSGRLVLES  533 (621)
T ss_pred             EeCCHHHHHHHHHHHHHhCCCCeEEEEECCHHHHHHHHHCCCCEEehhhHhHHHHHHHHHHHH
Confidence            999999999999999999999999999999999999999999999999999999999999854

>PRK03659 glutathione-regulated potassium-efflux system protein KefB; Provisional	Back alignment and domain information

>PRK10669 putative cation:proton antiport protein; Provisional	Back alignment and domain information

>PLN03159 cation/H(+) antiporter 15; Provisional	Back alignment and domain information

>COG0475 KefB Kef-type K+ transport systems, membrane components [Inorganic ion transport and metabolism]	Back alignment and domain information

>COG4651 RosB Kef-type K+ transport system, predicted NAD-binding component [Inorganic ion transport and metabolism]	Back alignment and domain information

>PRK05326 potassium/proton antiporter; Reviewed	Back alignment and domain information

>PF00999 Na_H_Exchanger: Sodium/hydrogen exchanger family; InterPro: IPR006153 Sodium proton exchangers (NHEs) constitute a large family of integral membrane protein transporters that are responsible for the counter-transport of protons and sodium ions across lipid bilayers [, ]	Back alignment and domain information

>KOG1650 consensus Predicted K+/H+-antiporter [Inorganic ion transport and metabolism]	Back alignment and domain information

>TIGR00932 2a37 transporter, monovalent cation:proton antiporter-2 (CPA2) family	Back alignment and domain information

>TIGR00844 c_cpa1 na(+)/h(+) antiporter	Back alignment and domain information

>TIGR00831 a_cpa1 Na+/H+ antiporter, bacterial form	Back alignment and domain information

>COG3263 NhaP-type Na+/H+ and K+/H+ antiporters with a unique C-terminal domain [Inorganic ion transport and metabolism]	Back alignment and domain information

>COG0025 NhaP NhaP-type Na+/H+ and K+/H+ antiporters [Inorganic ion transport and metabolism]	Back alignment and domain information

>TIGR00840 b_cpa1 sodium/hydrogen exchanger 3	Back alignment and domain information

>PRK10537 voltage-gated potassium channel; Provisional	Back alignment and domain information

>KOG1965 consensus Sodium/hydrogen exchanger protein [Inorganic ion transport and metabolism]	Back alignment and domain information

>PF02254 TrkA_N: TrkA-N domain; InterPro: IPR003148 The regulator of K+ conductance (RCK) domain is found in many ligand-gated K+ channels, most often attached to the intracellular carboxy terminus	Back alignment and domain information

>COG0569 TrkA K+ transport systems, NAD-binding component [Inorganic ion transport and metabolism]	Back alignment and domain information

>PRK14853 nhaA pH-dependent sodium/proton antiporter; Provisional	Back alignment and domain information

>KOG4505 consensus Na+/H+ antiporter [Inorganic ion transport and metabolism]	Back alignment and domain information

>PRK09496 trkA potassium transporter peripheral membrane component; Reviewed	Back alignment and domain information

>PRK09496 trkA potassium transporter peripheral membrane component; Reviewed	Back alignment and domain information

>COG1226 Kch Kef-type K+ transport systems, predicted NAD-binding component [Inorganic ion transport and metabolism]	Back alignment and domain information

>KOG1966 consensus Sodium/hydrogen exchanger protein [Inorganic ion transport and metabolism]	Back alignment and domain information

>TIGR00773 NhaA Na+/H+ antiporter NhaA	Back alignment and domain information

>PRK14856 nhaA pH-dependent sodium/proton antiporter; Provisional	Back alignment and domain information

>PRK14854 nhaA pH-dependent sodium/proton antiporter; Provisional	Back alignment and domain information

>PRK09560 nhaA pH-dependent sodium/proton antiporter; Reviewed	Back alignment and domain information

>PRK09561 nhaA pH-dependent sodium/proton antiporter; Reviewed	Back alignment and domain information

>PRK14855 nhaA pH-dependent sodium/proton antiporter; Provisional	Back alignment and domain information

>PF06965 Na_H_antiport_1: Na+/H+ antiporter 1; InterPro: IPR004670 NhaA is a sodium ion/proton antiporter that uses the proton electrochemical gradient to expel sodium ions from the cytoplasm and functions primarily in the adaptation to high salinity at alkaline pH	Back alignment and domain information

>COG3004 NhaA Na+/H+ antiporter [Inorganic ion transport and metabolism]	Back alignment and domain information

>PRK12460 2-keto-3-deoxygluconate permease; Provisional	Back alignment and domain information

>PF05684 DUF819: Protein of unknown function (DUF819); InterPro: IPR008537 This family contains proteins of unknown function from archaeal, bacterial and plant species	Back alignment and domain information

>PF03812 KdgT: 2-keto-3-deoxygluconate permease; InterPro: IPR004684 This family includes the characterised 2-Keto-3-Deoxygluconate transporters from Bacillus subtilis and Erwinia chrysanthemi	Back alignment and domain information

>TIGR00210 gltS sodium--glutamate symport carrier (gltS)	Back alignment and domain information

>PF03616 Glt_symporter: Sodium/glutamate symporter; InterPro: IPR004445 This is a family of sodium/glutamate symporters (glutamate permeases), which catalyse the sodium-dependent uptake of extracellular glutamate	Back alignment and domain information

>COG0786 GltS Na+/glutamate symporter [Amino acid transport and metabolism]	Back alignment and domain information

>TIGR00698 conserved hypothetical integral membrane protein	Back alignment and domain information

>PF03601 Cons_hypoth698: Conserved hypothetical protein 698; InterPro: IPR018383 This entry represents a family of uncharacterised multi-pass membrane proteins	Back alignment and domain information

>PRK06719 precorrin-2 dehydrogenase; Validated	Back alignment and domain information

>TIGR00793 kdgT 2-keto-3-deoxygluconate transporter	Back alignment and domain information

>COG3180 AbrB Putative ammonia monooxygenase [General function prediction only]	Back alignment and domain information

>COG2855 Predicted membrane protein [Function unknown]	Back alignment and domain information

>PF13593 DUF4137: SBF-like CPA transporter family (DUF4137)	Back alignment and domain information

>COG0385 Predicted Na+-dependent transporter [General function prediction only]	Back alignment and domain information

>PF05145 AmoA: Putative ammonia monooxygenase; InterPro: IPR007820 This family contains sequences annotated as ammonia monooxygenase	Back alignment and domain information

>PRK11281 hypothetical protein; Provisional	Back alignment and domain information

>PRK06718 precorrin-2 dehydrogenase; Reviewed	Back alignment and domain information

>TIGR00841 bass bile acid transporter	Back alignment and domain information

>PRK04148 hypothetical protein; Provisional	Back alignment and domain information

>PRK03562 glutathione-regulated potassium-efflux system protein KefC; Provisional	Back alignment and domain information

>COG3493 CitS Na+/citrate symporter [Energy production and conversion]	Back alignment and domain information

>PRK03659 glutathione-regulated potassium-efflux system protein KefB; Provisional	Back alignment and domain information

>COG0798 ACR3 Arsenite efflux pump ACR3 and related permeases [Inorganic ion transport and metabolism]	Back alignment and domain information

>cd01075 NAD_bind_Leu_Phe_Val_DH NAD(P) binding domain of leucine dehydrogenase, phenylalanine dehydrogenase, and valine dehydrogenase	Back alignment and domain information

>PRK06522 2-dehydropantoate 2-reductase; Reviewed	Back alignment and domain information

>PF03601 Cons_hypoth698: Conserved hypothetical protein 698; InterPro: IPR018383 This entry represents a family of uncharacterised multi-pass membrane proteins	Back alignment and domain information

>PRK10929 putative mechanosensitive channel protein; Provisional	Back alignment and domain information

>PRK05274 2-keto-3-deoxygluconate permease; Provisional	Back alignment and domain information

>TIGR00932 2a37 transporter, monovalent cation:proton antiporter-2 (CPA2) family	Back alignment and domain information

>COG0679 Predicted permeases [General function prediction only]	Back alignment and domain information

>PLN03159 cation/H(+) antiporter 15; Provisional	Back alignment and domain information

>PF00670 AdoHcyase_NAD: S-adenosyl-L-homocysteine hydrolase, NAD binding domain; InterPro: IPR015878 S-adenosyl-L-homocysteine hydrolase (3	Back alignment and domain information

>TIGR00832 acr3 arsenical-resistance protein	Back alignment and domain information

>PRK10669 putative cation:proton antiport protein; Provisional	Back alignment and domain information

>TIGR02853 spore_dpaA dipicolinic acid synthetase, A subunit	Back alignment and domain information

>PF13460 NAD_binding_10: NADH(P)-binding ; PDB: 3OH8_A 3E8X_A 3GPI_A 3QVO_A 2Q46_B 1YBM_B 1XQ6_B 2Q4B_B 3EW7_A 3IUS_B	Back alignment and domain information

>TIGR01470 cysG_Nterm siroheme synthase, N-terminal domain	Back alignment and domain information

>COG0475 KefB Kef-type K+ transport systems, membrane components [Inorganic ion transport and metabolism]	Back alignment and domain information

>TIGR00946 2a69 he Auxin Efflux Carrier (AEC) Family	Back alignment and domain information

>PF03446 NAD_binding_2: NAD binding domain of 6-phosphogluconate dehydrogenase; InterPro: IPR006115 6-Phosphogluconate dehydrogenase (1	Back alignment and domain information

>TIGR00518 alaDH alanine dehydrogenase	Back alignment and domain information

>PF03956 DUF340: Membrane protein of unknown function (DUF340); InterPro: IPR005642 Members of this family contain a conserved core of four predicted transmembrane segments	Back alignment and domain information

>CHL00194 ycf39 Ycf39; Provisional	Back alignment and domain information

>PRK03818 putative transporter; Validated	Back alignment and domain information

>PRK05326 potassium/proton antiporter; Reviewed	Back alignment and domain information

>TIGR00698 conserved hypothetical integral membrane protein	Back alignment and domain information

>TIGR00783 ccs citrate carrier protein, CCS family	Back alignment and domain information

>TIGR00844 c_cpa1 na(+)/h(+) antiporter	Back alignment and domain information

>TIGR03802 Asp_Ala_antiprt aspartate-alanine antiporter	Back alignment and domain information

>PF05368 NmrA: NmrA-like family; InterPro: IPR008030 NmrA is a negative transcriptional regulator involved in the post-translational modification of the transcription factor AreA	Back alignment and domain information

>TIGR00831 a_cpa1 Na+/H+ antiporter, bacterial form	Back alignment and domain information

>COG2855 Predicted membrane protein [Function unknown]	Back alignment and domain information

>KOG0994 consensus Extracellular matrix glycoprotein Laminin subunit beta [Extracellular structures]	Back alignment and domain information

>COG1748 LYS9 Saccharopine dehydrogenase and related proteins [Amino acid transport and metabolism]	Back alignment and domain information

>cd05211 NAD_bind_Glu_Leu_Phe_Val NAD(P) binding domain of glutamate dehydrogenase, leucine dehydrogenase, phenylalanine dehydrogenase, and valine dehydrogenase	Back alignment and domain information

>PF02558 ApbA: Ketopantoate reductase PanE/ApbA; InterPro: IPR013332 ApbA, the ketopantoate reductase enzyme 1	Back alignment and domain information

>TIGR03082 Gneg_AbrB_dup membrane protein AbrB duplication	Back alignment and domain information

>PRK12921 2-dehydropantoate 2-reductase; Provisional	Back alignment and domain information

>PRK08306 dipicolinate synthase subunit A; Reviewed	Back alignment and domain information

>KOG4673 consensus Transcription factor TMF, TATA element modulatory factor [Transcription]	Back alignment and domain information

>TIGR00210 gltS sodium--glutamate symport carrier (gltS)	Back alignment and domain information

>TIGR00872 gnd_rel 6-phosphogluconate dehydrogenase (decarboxylating)	Back alignment and domain information

>PRK09599 6-phosphogluconate dehydrogenase-like protein; Reviewed	Back alignment and domain information

>PRK12490 6-phosphogluconate dehydrogenase-like protein; Reviewed	Back alignment and domain information

>TIGR02964 xanthine_xdhC xanthine dehydrogenase accessory protein XdhC	Back alignment and domain information

>PRK05562 precorrin-2 dehydrogenase; Provisional	Back alignment and domain information

>PRK12475 thiamine/molybdopterin biosynthesis MoeB-like protein; Provisional	Back alignment and domain information

>cd01065 NAD_bind_Shikimate_DH NAD(P) binding domain of Shikimate dehydrogenase	Back alignment and domain information

>PF13241 NAD_binding_7: Putative NAD(P)-binding; PDB: 3DFZ_B 1PJT_A 1PJS_A 1PJQ_A 1KYQ_B	Back alignment and domain information

>PF03435 Saccharop_dh: Saccharopine dehydrogenase ; InterPro: IPR005097 This entry represents saccharopine dehydrogenase and homospermidine synthase	Back alignment and domain information

>PF06826 Asp-Al_Ex: Predicted Permease Membrane Region; InterPro: IPR006512 These sequences contain a domain that is duplicated in HI0035 of Haemophilus influenzae, in YidE and YbjL of Escherichia coli, and in a number of other putative transporters	Back alignment and domain information

>TIGR03649 ergot_EASG ergot alkaloid biosynthesis protein, AFUA_2G17970 family	Back alignment and domain information

>PLN02494 adenosylhomocysteinase	Back alignment and domain information

>PRK04972 putative transporter; Provisional	Back alignment and domain information

>KOG0994 consensus Extracellular matrix glycoprotein Laminin subunit beta [Extracellular structures]	Back alignment and domain information

>TIGR00936 ahcY adenosylhomocysteinase	Back alignment and domain information

>PRK05476 S-adenosyl-L-homocysteine hydrolase; Provisional	Back alignment and domain information

>PF05145 AmoA: Putative ammonia monooxygenase; InterPro: IPR007820 This family contains sequences annotated as ammonia monooxygenase	Back alignment and domain information

>PTZ00075 Adenosylhomocysteinase; Provisional	Back alignment and domain information

>TIGR01692 HIBADH 3-hydroxyisobutyrate dehydrogenase	Back alignment and domain information

>PF03390 2HCT: 2-hydroxycarboxylate transporter family; InterPro: IPR004679 The 2-hydroxycarboxylate transporter family is a family of secondary transporters found exclusively in the bacterial kingdom	Back alignment and domain information

>PF03616 Glt_symporter: Sodium/glutamate symporter; InterPro: IPR004445 This is a family of sodium/glutamate symporters (glutamate permeases), which catalyse the sodium-dependent uptake of extracellular glutamate	Back alignment and domain information

>TIGR02168 SMC_prok_B chromosome segregation protein SMC, common bacterial type	Back alignment and domain information

>COG1893 ApbA Ketopantoate reductase [Coenzyme metabolism]	Back alignment and domain information

>PRK04863 mukB cell division protein MukB; Provisional	Back alignment and domain information

>PLN02819 lysine-ketoglutarate reductase/saccharopine dehydrogenase	Back alignment and domain information

>PRK05993 short chain dehydrogenase; Provisional	Back alignment and domain information

>PRK05708 2-dehydropantoate 2-reductase; Provisional	Back alignment and domain information

>PLN00141 Tic62-NAD(P)-related group II protein; Provisional	Back alignment and domain information

>TIGR03082 Gneg_AbrB_dup membrane protein AbrB duplication	Back alignment and domain information

>cd01078 NAD_bind_H4MPT_DH NADP binding domain of methylene tetrahydromethanopterin dehydrogenase	Back alignment and domain information

>PRK07417 arogenate dehydrogenase; Reviewed	Back alignment and domain information

>cd00401 AdoHcyase S-adenosyl-L-homocysteine hydrolase (AdoHycase) catalyzes the hydrolysis of S-adenosyl-L-homocysteine (AdoHyc) to form adenosine (Ado) and homocysteine (Hcy)	Back alignment and domain information

>PRK11064 wecC UDP-N-acetyl-D-mannosamine dehydrogenase; Provisional	Back alignment and domain information

>PF01758 SBF: Sodium Bile acid symporter family; InterPro: IPR002657 This family of proteins are found both in prokaryotes and eukaryotes	Back alignment and domain information

>TIGR03802 Asp_Ala_antiprt aspartate-alanine antiporter	Back alignment and domain information

>TIGR01625 YidE_YbjL_dupl AspT/YidE/YbjL antiporter duplication domain	Back alignment and domain information

>PRK08229 2-dehydropantoate 2-reductase; Provisional	Back alignment and domain information

>PRK00094 gpsA NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Validated	Back alignment and domain information

>PRK03818 putative transporter; Validated	Back alignment and domain information

>PRK08017 oxidoreductase; Provisional	Back alignment and domain information

>PLN02688 pyrroline-5-carboxylate reductase	Back alignment and domain information

>COG2985 Predicted permease [General function prediction only]	Back alignment and domain information

>PRK09903 putative transporter YfdV; Provisional	Back alignment and domain information

>PRK11559 garR tartronate semialdehyde reductase; Provisional	Back alignment and domain information

>TIGR01505 tartro_sem_red 2-hydroxy-3-oxopropionate reductase	Back alignment and domain information

>COG0499 SAM1 S-adenosylhomocysteine hydrolase [Coenzyme metabolism]	Back alignment and domain information

>TIGR02680 conserved hypothetical protein TIGR02680	Back alignment and domain information

>PRK14106 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional	Back alignment and domain information

>PRK15178 Vi polysaccharide export inner membrane protein VexD; Provisional	Back alignment and domain information

>TIGR02169 SMC_prok_A chromosome segregation protein SMC, primarily archaeal type	Back alignment and domain information

>PF03721 UDPG_MGDP_dh_N: UDP-glucose/GDP-mannose dehydrogenase family, NAD binding domain; InterPro: IPR001732 The UDP-glucose/GDP-mannose dehydrogenases are a small group of enzymes which possesses the ability to catalyse the NAD-dependent 2-fold oxidation of an alcohol to an acid without the release of an aldehyde intermediate [, ]	Back alignment and domain information

>COG1648 CysG Siroheme synthase (precorrin-2 oxidase/ferrochelatase domain) [Coenzyme metabolism]	Back alignment and domain information

>COG1023 Gnd Predicted 6-phosphogluconate dehydrogenase [Carbohydrate transport and metabolism]	Back alignment and domain information

>COG1196 Smc Chromosome segregation ATPases [Cell division and chromosome partitioning]	Back alignment and domain information

>PF03807 F420_oxidored: NADP oxidoreductase coenzyme F420-dependent; InterPro: IPR004455 The function of F420-dependent NADP reductase is the transfer of electrons from reduced coenzyme F420 into an electron transport chain	Back alignment and domain information

>PRK06182 short chain dehydrogenase; Validated	Back alignment and domain information

>PLN03209 translocon at the inner envelope of chloroplast subunit 62; Provisional	Back alignment and domain information

>cd05291 HicDH_like L-2-hydroxyisocapronate dehydrogenases and some bacterial L-lactate dehydrogenases	Back alignment and domain information

>KOG0996 consensus Structural maintenance of chromosome protein 4 (chromosome condensation complex Condensin, subunit C) [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning]	Back alignment and domain information

>TIGR03185 DNA_S_dndD DNA sulfur modification protein DndD	Back alignment and domain information

>PRK14620 NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Provisional	Back alignment and domain information

>PRK07688 thiamine/molybdopterin biosynthesis ThiF/MoeB-like protein; Validated	Back alignment and domain information

>COG1196 Smc Chromosome segregation ATPases [Cell division and chromosome partitioning]	Back alignment and domain information

>PF06008 Laminin_I: Laminin Domain I; InterPro: IPR009254 Laminins are glycoproteins that are major constituents of the basement membrane of cells	Back alignment and domain information

>TIGR03466 HpnA hopanoid-associated sugar epimerase	Back alignment and domain information

>PRK04972 putative transporter; Provisional	Back alignment and domain information

>PTZ00142 6-phosphogluconate dehydrogenase; Provisional	Back alignment and domain information

>PRK15059 tartronate semialdehyde reductase; Provisional	Back alignment and domain information

>COG0786 GltS Na+/glutamate symporter [Amino acid transport and metabolism]	Back alignment and domain information

>TIGR02169 SMC_prok_A chromosome segregation protein SMC, primarily archaeal type	Back alignment and domain information

>PRK15461 NADH-dependent gamma-hydroxybutyrate dehydrogenase; Provisional	Back alignment and domain information

>PRK09260 3-hydroxybutyryl-CoA dehydrogenase; Validated	Back alignment and domain information

>PF10727 Rossmann-like: Rossmann-like domain; InterPro: IPR019665 This entry represents an NAD/NADP-binding domain with a core Rossmann-type fold, found in an uncharacterised protein family thought to be putative NADP oxidoreductase coenzyme F420-dependent proteins and/or NAD-dependent glycerol-3-phosphate dehydrogenase-like proteins	Back alignment and domain information

>PF00261 Tropomyosin: Tropomyosin; InterPro: IPR000533 Tropomyosins [], are a family of closely related proteins present in muscle and non-muscle cells	Back alignment and domain information

>TIGR00873 gnd 6-phosphogluconate dehydrogenase, decarboxylating	Back alignment and domain information

>cd05213 NAD_bind_Glutamyl_tRNA_reduct NADP-binding domain of glutamyl-tRNA reductase	Back alignment and domain information

>TIGR00946 2a69 he Auxin Efflux Carrier (AEC) Family	Back alignment and domain information

>PRK06249 2-dehydropantoate 2-reductase; Provisional	Back alignment and domain information

>TIGR03136 malonate_biotin Na+-transporting malonate decarboxylase, carboxybiotin decarboxylase subunit	Back alignment and domain information

>PF03977 OAD_beta: Na+-transporting oxaloacetate decarboxylase beta subunit; InterPro: IPR005661 Members of this family are integral membrane proteins	Back alignment and domain information

>PF07991 IlvN: Acetohydroxy acid isomeroreductase, catalytic domain; InterPro: IPR013116 Acetohydroxy acid isomeroreductase catalyses the conversion of acetohydroxy acids into dihydroxy valerates	Back alignment and domain information

>PRK06129 3-hydroxyacyl-CoA dehydrogenase; Validated	Back alignment and domain information

>KOG3826 consensus Na+/H+ antiporter [Inorganic ion transport and metabolism]	Back alignment and domain information

>PRK05225 ketol-acid reductoisomerase; Validated	Back alignment and domain information

>PRK06545 prephenate dehydrogenase; Validated	Back alignment and domain information

>PRK07502 cyclohexadienyl dehydrogenase; Validated	Back alignment and domain information

>PLN02427 UDP-apiose/xylose synthase	Back alignment and domain information

>TIGR03026 NDP-sugDHase nucleotide sugar dehydrogenase	Back alignment and domain information

>PRK01438 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional	Back alignment and domain information

>PRK09291 short chain dehydrogenase; Provisional	Back alignment and domain information

>PRK08507 prephenate dehydrogenase; Validated	Back alignment and domain information

>PRK10637 cysG siroheme synthase; Provisional	Back alignment and domain information

>PLN02657 3,8-divinyl protochlorophyllide a 8-vinyl reductase	Back alignment and domain information

>PRK00048 dihydrodipicolinate reductase; Provisional	Back alignment and domain information

>TIGR00465 ilvC ketol-acid reductoisomerase	Back alignment and domain information

>TIGR02680 conserved hypothetical protein TIGR02680	Back alignment and domain information

>COG5374 Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>PF03547 Mem_trans: Membrane transport protein; InterPro: IPR004776 This entry represents a mostly uncharacterised family of membrane transport proteins found in eukaryotes, bacteria and archaea	Back alignment and domain information

>PLN02695 GDP-D-mannose-3',5'-epimerase	Back alignment and domain information

>COG1346 LrgB Putative effector of murein hydrolase [Cell envelope biogenesis, outer membrane]	Back alignment and domain information

>PRK14618 NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Provisional	Back alignment and domain information

>PRK05693 short chain dehydrogenase; Provisional	Back alignment and domain information

>PF05701 WEMBL: Weak chloroplast movement under blue light; InterPro: IPR008545 This family consists of several plant proteins of unknown function	Back alignment and domain information

>PF13478 XdhC_C: XdhC Rossmann domain; PDB: 3ON5_A 2WE8_B 2WE7_A	Back alignment and domain information

>PRK12460 2-keto-3-deoxygluconate permease; Provisional	Back alignment and domain information

>COG3180 AbrB Putative ammonia monooxygenase [General function prediction only]	Back alignment and domain information

>PF00038 Filament: Intermediate filament protein; InterPro: IPR016044 Intermediate filaments (IF) [, , ] are proteins which are primordial components of the cytoskeleton and the nuclear envelope	Back alignment and domain information

>TIGR00783 ccs citrate carrier protein, CCS family	Back alignment and domain information

>COG2431 Predicted membrane protein [Function unknown]	Back alignment and domain information

>PRK07326 short chain dehydrogenase; Provisional	Back alignment and domain information

>PRK01710 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional	Back alignment and domain information

>PF01488 Shikimate_DH: Shikimate / quinate 5-dehydrogenase; InterPro: IPR006151 This entry represents a domain found in shikimate and quinate dehydrogenases, as well as glutamyl-tRNA reductases	Back alignment and domain information

>PF01408 GFO_IDH_MocA: Oxidoreductase family, NAD-binding Rossmann fold; InterPro: IPR000683 This group of enzymes utilise NADP or NAD, and is known as the GFO/IDH/MOCA family in UniProtKB/Swiss-Prot	Back alignment and domain information

>PRK11880 pyrroline-5-carboxylate reductase; Reviewed	Back alignment and domain information

>COG2084 MmsB 3-hydroxyisobutyrate dehydrogenase and related beta-hydroxyacid dehydrogenases [Lipid metabolism]	Back alignment and domain information

>PF00072 Response_reg: Response regulator receiver domain; InterPro: IPR001789 Two-component signal transduction systems enable bacteria to sense, respond, and adapt to a wide range of environments, stressors, and growth conditions []	Back alignment and domain information

>PRK12491 pyrroline-5-carboxylate reductase; Reviewed	Back alignment and domain information

>PRK13302 putative L-aspartate dehydrogenase; Provisional	Back alignment and domain information

>PRK08264 short chain dehydrogenase; Validated	Back alignment and domain information

>PLN02896 cinnamyl-alcohol dehydrogenase	Back alignment and domain information

>PRK06019 phosphoribosylaminoimidazole carboxylase ATPase subunit; Reviewed	Back alignment and domain information

>TIGR03025 EPS_sugtrans exopolysaccharide biosynthesis polyprenyl glycosylphosphotransferase	Back alignment and domain information

>PRK06953 short chain dehydrogenase; Provisional	Back alignment and domain information

>PF04012 PspA_IM30: PspA/IM30 family; InterPro: IPR007157 This family includes PspA a protein that suppresses sigma54-dependent transcription	Back alignment and domain information

>PRK06101 short chain dehydrogenase; Provisional	Back alignment and domain information

>TIGR02356 adenyl_thiF thiazole biosynthesis adenylyltransferase ThiF, E	Back alignment and domain information

>PLN02350 phosphogluconate dehydrogenase (decarboxylating)	Back alignment and domain information

>PRK13403 ketol-acid reductoisomerase; Provisional	Back alignment and domain information

>PRK15057 UDP-glucose 6-dehydrogenase; Provisional	Back alignment and domain information

>PRK06130 3-hydroxybutyryl-CoA dehydrogenase; Validated	Back alignment and domain information

>PF01210 NAD_Gly3P_dh_N: NAD-dependent glycerol-3-phosphate dehydrogenase N-terminus; InterPro: IPR011128 NAD-dependent glycerol-3-phosphate dehydrogenase (GPDH) catalyses the interconversion of dihydroxyacetone phosphate and L-glycerol-3-phosphate	Back alignment and domain information

>TIGR01109 Na_pump_decarbB sodium ion-translocating decarboxylase, beta subunit	Back alignment and domain information

>PLN02256 arogenate dehydrogenase	Back alignment and domain information

>PF05276 SH3BP5: SH3 domain-binding protein 5 (SH3BP5); InterPro: IPR007940 The SH3 domain-binding protein inhibits the auto and transphophorylation of BTK and acts as a negative regulator of BTK-related signalling in B cells	Back alignment and domain information

>PF12128 DUF3584: Protein of unknown function (DUF3584); InterPro: IPR021979 This family consist of uncharacterised bacterial proteins	Back alignment and domain information

>PRK05884 short chain dehydrogenase; Provisional	Back alignment and domain information

>COG0287 TyrA Prephenate dehydrogenase [Amino acid transport and metabolism]	Back alignment and domain information

>cd01076 NAD_bind_1_Glu_DH NAD(P) binding domain of glutamate dehydrogenase, subgroup 1	Back alignment and domain information

>PLN02650 dihydroflavonol-4-reductase	Back alignment and domain information

>PRK06914 short chain dehydrogenase; Provisional	Back alignment and domain information

>TIGR02354 thiF_fam2 thiamine biosynthesis protein ThiF, family 2	Back alignment and domain information

>PRK05808 3-hydroxybutyryl-CoA dehydrogenase; Validated	Back alignment and domain information

>PRK11908 NAD-dependent epimerase/dehydratase family protein; Provisional	Back alignment and domain information

>PRK10698 phage shock protein PspA; Provisional	Back alignment and domain information

>PRK08293 3-hydroxybutyryl-CoA dehydrogenase; Validated	Back alignment and domain information

>PRK07454 short chain dehydrogenase; Provisional	Back alignment and domain information

>PF03977 OAD_beta: Na+-transporting oxaloacetate decarboxylase beta subunit; InterPro: IPR005661 Members of this family are integral membrane proteins	Back alignment and domain information

>PRK08644 thiamine biosynthesis protein ThiF; Provisional	Back alignment and domain information

>COG1004 Ugd Predicted UDP-glucose 6-dehydrogenase [Cell envelope biogenesis, outer membrane]	Back alignment and domain information

>PLN02686 cinnamoyl-CoA reductase	Back alignment and domain information

>PRK08219 short chain dehydrogenase; Provisional	Back alignment and domain information

>COG2085 Predicted dinucleotide-binding enzymes [General function prediction only]	Back alignment and domain information

>COG1086 Predicted nucleoside-diphosphate sugar epimerases [Cell envelope biogenesis, outer membrane / Carbohydrate transport and metabolism]	Back alignment and domain information

>COG2910 Putative NADH-flavin reductase [General function prediction only]	Back alignment and domain information

>PRK03369 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional	Back alignment and domain information

>PF00999 Na_H_Exchanger: Sodium/hydrogen exchanger family; InterPro: IPR006153 Sodium proton exchangers (NHEs) constitute a large family of integral membrane protein transporters that are responsible for the counter-transport of protons and sodium ions across lipid bilayers [, ]	Back alignment and domain information

>cd01483 E1_enzyme_family Superfamily of activating enzymes (E1) of the ubiquitin-like proteins	Back alignment and domain information

>PRK07680 late competence protein ComER; Validated	Back alignment and domain information

>PRK07060 short chain dehydrogenase; Provisional	Back alignment and domain information

>COG5420 Uncharacterized conserved small protein containing a coiled-coil domain [Function unknown]	Back alignment and domain information

>PRK07024 short chain dehydrogenase; Provisional	Back alignment and domain information

>PLN02662 cinnamyl-alcohol dehydrogenase family protein	Back alignment and domain information

>PRK04288 antiholin-like protein LrgB; Provisional	Back alignment and domain information

>PHA02562 46 endonuclease subunit; Provisional	Back alignment and domain information

>PF02826 2-Hacid_dh_C: D-isomer specific 2-hydroxyacid dehydrogenase, NAD binding domain; InterPro: IPR006140 A number of NAD-dependent 2-hydroxyacid dehydrogenases which seem to be specific for the D-isomer of their substrate have been shown to be functionally and structurally related	Back alignment and domain information

>TIGR03023 WcaJ_sugtrans Undecaprenyl-phosphate glucose phosphotransferase	Back alignment and domain information

>PF03390 2HCT: 2-hydroxycarboxylate transporter family; InterPro: IPR004679 The 2-hydroxycarboxylate transporter family is a family of secondary transporters found exclusively in the bacterial kingdom	Back alignment and domain information

>PRK09424 pntA NAD(P) transhydrogenase subunit alpha; Provisional	Back alignment and domain information

>PRK02318 mannitol-1-phosphate 5-dehydrogenase; Provisional	Back alignment and domain information

>KOG1420 consensus Ca2+-activated K+ channel Slowpoke, alpha subunit [Inorganic ion transport and metabolism; Signal transduction mechanisms]	Back alignment and domain information

>PRK15116 sulfur acceptor protein CsdL; Provisional	Back alignment and domain information

>COG0240 GpsA Glycerol-3-phosphate dehydrogenase [Energy production and conversion]	Back alignment and domain information

>COG0025 NhaP NhaP-type Na+/H+ and K+/H+ antiporters [Inorganic ion transport and metabolism]	Back alignment and domain information

>PF00056 Ldh_1_N: lactate/malate dehydrogenase, NAD binding domain Prosite entry for lactate dehydrogenase Prosite entry for malate dehydrogenase; InterPro: IPR001236 L-lactate dehydrogenases are metabolic enzymes which catalyse the conversion of L-lactate to pyruvate, the last step in anaerobic glycolysis []	Back alignment and domain information

>PRK12828 short chain dehydrogenase; Provisional	Back alignment and domain information

>PRK06949 short chain dehydrogenase; Provisional	Back alignment and domain information

>cd02067 B12-binding B12 binding domain (B12-BD)	Back alignment and domain information

>PRK08655 prephenate dehydrogenase; Provisional	Back alignment and domain information

>PRK12439 NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Provisional	Back alignment and domain information

>PLN02712 arogenate dehydrogenase	Back alignment and domain information

>PF00899 ThiF: ThiF family; InterPro: IPR000594 Ubiquitin-activating enzyme (E1 enzyme) [, ] activates ubiquitin by first adenylating with ATP its C-terminal glycine residue and thereafter linking this residue to the side chain of a cysteine residue in E1, yielding an ubiquitin-E1 thiolester and free AMP	Back alignment and domain information

>PRK07074 short chain dehydrogenase; Provisional	Back alignment and domain information

>PRK09903 putative transporter YfdV; Provisional	Back alignment and domain information

>PF12128 DUF3584: Protein of unknown function (DUF3584); InterPro: IPR021979 This family consist of uncharacterised bacterial proteins	Back alignment and domain information

>PRK08265 short chain dehydrogenase; Provisional	Back alignment and domain information

>COG1064 AdhP Zn-dependent alcohol dehydrogenases [General function prediction only]	Back alignment and domain information

>PRK06483 dihydromonapterin reductase; Provisional	Back alignment and domain information

>PF03956 DUF340: Membrane protein of unknown function (DUF340); InterPro: IPR005642 Members of this family contain a conserved core of four predicted transmembrane segments	Back alignment and domain information

>TIGR01181 dTDP_gluc_dehyt dTDP-glucose 4,6-dehydratase	Back alignment and domain information

>PRK06924 short chain dehydrogenase; Provisional	Back alignment and domain information

>PRK09072 short chain dehydrogenase; Provisional	Back alignment and domain information

>PRK00141 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional	Back alignment and domain information

>PLN02989 cinnamyl-alcohol dehydrogenase family protein	Back alignment and domain information

>KOG1650 consensus Predicted K+/H+-antiporter [Inorganic ion transport and metabolism]	Back alignment and domain information

>PF05701 WEMBL: Weak chloroplast movement under blue light; InterPro: IPR008545 This family consists of several plant proteins of unknown function	Back alignment and domain information

>PF00289 CPSase_L_chain: Carbamoyl-phosphate synthase L chain, N-terminal domain; InterPro: IPR005481 Carbamoyl phosphate synthase (CPSase) is a heterodimeric enzyme composed of a small and a large subunit (with the exception of CPSase III, see below)	Back alignment and domain information

>PRK07231 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional	Back alignment and domain information

>PRK06035 3-hydroxyacyl-CoA dehydrogenase; Validated	Back alignment and domain information

>PF13514 AAA_27: AAA domain	Back alignment and domain information

>PLN02353 probable UDP-glucose 6-dehydrogenase	Back alignment and domain information

>PRK07530 3-hydroxybutyryl-CoA dehydrogenase; Validated	Back alignment and domain information

>PLN02583 cinnamoyl-CoA reductase	Back alignment and domain information

>PF02310 B12-binding: B12 binding domain; InterPro: IPR006158 The cobalamin (vitamin B12) binding domain can bind two different forms of the cobalamin cofactor, with cobalt bonded either to a methyl group (methylcobalamin) or to 5'-deoxyadenosine (adenosylcobalamin)	Back alignment and domain information

>PRK07679 pyrroline-5-carboxylate reductase; Reviewed	Back alignment and domain information

>PLN02712 arogenate dehydrogenase	Back alignment and domain information

>TIGR00659 conserved hypothetical protein TIGR00659	Back alignment and domain information

>COG4651 RosB Kef-type K+ transport system, predicted NAD-binding component [Inorganic ion transport and metabolism]	Back alignment and domain information

>PRK06482 short chain dehydrogenase; Provisional	Back alignment and domain information

>PRK02705 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional	Back alignment and domain information

>PRK10538 malonic semialdehyde reductase; Provisional	Back alignment and domain information

>PRK12939 short chain dehydrogenase; Provisional	Back alignment and domain information

>PRK06180 short chain dehydrogenase; Provisional	Back alignment and domain information

>PRK10711 hypothetical protein; Provisional	Back alignment and domain information

>PRK11281 hypothetical protein; Provisional	Back alignment and domain information

>PRK11199 tyrA bifunctional chorismate mutase/prephenate dehydrogenase; Provisional	Back alignment and domain information

>PLN00016 RNA-binding protein; Provisional	Back alignment and domain information

>TIGR02977 phageshock_pspA phage shock protein A	Back alignment and domain information

>COG1842 PspA Phage shock protein A (IM30), suppresses sigma54-dependent transcription [Transcription / Signal transduction mechanisms]	Back alignment and domain information

>PRK06940 short chain dehydrogenase; Provisional	Back alignment and domain information

>PRK15181 Vi polysaccharide biosynthesis protein TviC; Provisional	Back alignment and domain information

>cd01080 NAD_bind_m-THF_DH_Cyclohyd NADP binding domain of methylene-tetrahydrofolate dehydrogenase/cyclohydrolase	Back alignment and domain information

>KOG1201 consensus Hydroxysteroid 17-beta dehydrogenase 11 [Secondary metabolites biosynthesis, transport and catabolism]	Back alignment and domain information

>TIGR01915 npdG NADPH-dependent F420 reductase	Back alignment and domain information

>PF01262 AlaDh_PNT_C: Alanine dehydrogenase/PNT, C-terminal domain; InterPro: IPR007698 Alanine dehydrogenases (1	Back alignment and domain information

>TIGR01763 MalateDH_bact malate dehydrogenase, NAD-dependent	Back alignment and domain information

>KOG1370 consensus S-adenosylhomocysteine hydrolase [Coenzyme transport and metabolism]	Back alignment and domain information

>PRK08267 short chain dehydrogenase; Provisional	Back alignment and domain information

>PRK06179 short chain dehydrogenase; Provisional	Back alignment and domain information

>PRK07774 short chain dehydrogenase; Provisional	Back alignment and domain information

>PRK08177 short chain dehydrogenase; Provisional	Back alignment and domain information

>TIGR01142 purT phosphoribosylglycinamide formyltransferase 2	Back alignment and domain information

>TIGR03589 PseB UDP-N-acetylglucosamine 4,6-dehydratase	Back alignment and domain information

>PRK06194 hypothetical protein; Provisional	Back alignment and domain information

>KOG0161 consensus Myosin class II heavy chain [Cytoskeleton]	Back alignment and domain information

>TIGR01318 gltD_gamma_fam glutamate synthase small subunit family protein, proteobacterial	Back alignment and domain information

>PRK00066 ldh L-lactate dehydrogenase; Reviewed	Back alignment and domain information

>PRK12429 3-hydroxybutyrate dehydrogenase; Provisional	Back alignment and domain information

>PRK07523 gluconate 5-dehydrogenase; Provisional	Back alignment and domain information

>PLN00106 malate dehydrogenase	Back alignment and domain information

>TIGR03136 malonate_biotin Na+-transporting malonate decarboxylase, carboxybiotin decarboxylase subunit	Back alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST

Original result of BLAST against Protein Data Bank

ID	Alignment Graph	Length	Definition	E-value
Query		1158
3eyw_A		413	Crystal Structure Of The C-terminal Domain Of E. Co		2e-13
3fwz_A		140	Crystal Structure Of Trka-n Domain Of Inner Membran		5e-04

>pdb|3EYW|A Chain A, Crystal Structure Of The C-terminal Domain Of E. Coli Kefc In Complex With Keff Length = 413

Back alignment and structure

Iteration: 1

Score = 75.5 bits (184), Expect = 2e-13, Method: Compositional matrix adjust. Identities = 39/119 (32%), Positives = 61/119 (51%) Query: 1012 IILCGFGRVGQIIAQLLSERLIPFVALDVRSDRVAIGRALDLPVYFGDAGSREVLHKVGA 1071 +I+ GFGR GQI +LL + V LD D + R + V++GDA ++L GA Sbjct: 7 VIIAGFGRFGQITGRLLLSSGVKMVVLDHDPDHIETLRKFGMKVFYGDATRMDLLESAGA 66 Query: 1072 ERACAAAITLDTPGANYRTVWALSKYFPNVKTFVRAHDIDHGLNLEKAGATAVVPETLE 1130 +A +D P N + + ++FP+++ RA D+DH + L +AG ET E Sbjct: 67 AKAEVLINAIDDPQTNLQLTEMVKEHFPHLQIIARARDVDHYIRLRQAGVEKPERETFE 125

PyMOL of 3eyw

>pdb|3FWZ|A Chain A, Crystal Structure Of Trka-n Domain Of Inner Membrane Protein Ybal From Escherichia Coli Length = 140

Back alignment and structure

Structure Templates Detected by RPS-BLAST

Original result of RPS-BLAST against PDB70 database

ID	Alignment Graph	Length	Definition	E-value
Query		1158
3l9w_A		413	Glutathione-regulated potassium-efflux system Pro	1e-48
3fwz_A		140	Inner membrane protein YBAL; TRKA-N domain, E.coli	3e-46
3c85_A		183	Putative glutathione-regulated potassium-efflux S	4e-33
1id1_A		153	Putative potassium channel protein; RCK domain, E.	1e-28
2aef_A		234	Calcium-gated potassium channel MTHK; rossmann fol	7e-28
1lnq_A		336	MTHK channels, potassium channel related protein;	7e-23
3llv_A		141	Exopolyphosphatase-related protein; NAD(P)-binding	2e-21
2hmt_A		144	YUAA protein; RCK, KTN, KTR, KTRA, ktrab, membrane	2e-19
1vt4_I		1221	APAF-1 related killer DARK; drosophila apoptosome,	4e-10
1vt4_I		1221	APAF-1 related killer DARK; drosophila apoptosome,	1e-08
1vt4_I		1221	APAF-1 related killer DARK; drosophila apoptosome,	5e-08
1vt4_I		1221	APAF-1 related killer DARK; drosophila apoptosome,	1e-07
1vt4_I		1221	APAF-1 related killer DARK; drosophila apoptosome,	1e-06
1c1g_A		284	Tropomyosin; contractIle protein; 7.00A {Sus scrof	1e-06
1c1g_A		284	Tropomyosin; contractIle protein; 7.00A {Sus scrof	3e-04
1c1g_A		284	Tropomyosin; contractIle protein; 7.00A {Sus scrof	4e-04
3mt5_A		726	Potassium large conductance calcium-activated CHA	1e-05
1i84_S		1184	Smooth muscle myosin heavy chain; muscle protein,	1e-05
1i84_S		1184	Smooth muscle myosin heavy chain; muscle protein,	6e-05
2g1u_A		155	Hypothetical protein TM1088A; structural genomics,	1e-05
3naf_A		798	Calcium-activated potassium channel subunit alpha;	3e-05
1lss_A		140	TRK system potassium uptake protein TRKA homolog;	5e-05
2b9c_A		147	Striated-muscle alpha tropomyosin; alpha-helix, co	2e-04

>3l9w_A Glutathione-regulated potassium-efflux system Pro linker, ancillary protein KEFF; potassium channel regulation, domains, antiport; HET: FMN AMP GSH; 1.75A {Escherichia coli} PDB: 3eyw_A* 3l9x_A* Length = 413	Back alignment and structure

 Score =  178 bits (453), Expect = 1e-48
 Identities = 46/150 (30%), Positives = 73/150 (48%), Gaps = 4/150 (2%)

Query: 1009 QDHIILCGFGRVGQIIAQLLSERLIPFVALDVRSDRVAIGRALDLPVYFGDAGSREVLHK 1068
               +I+ GFGR GQI  +LL    +  V LD   D +   R   + V++GDA   ++L  
Sbjct: 4    GMRVIIAGFGRFGQITGRLLLSSGVKMVVLDHDPDHIETLRKFGMKVFYGDATRMDLLES 63

Query: 1069 VGAERACAAAITLDTPGANYRTVWALSKYFPNVKTFVRAHDIDHGLNLEKAGATAVVPET 1128
             GA +A      +D P  N +    + ++FP+++   RA D+DH + L +AG      ET
Sbjct: 64   AGAAKAEVLINAIDDPQTNLQLTEMVKEHFPHLQIIARARDVDHYIRLRQAGVEKPERET 123

Query: 1129 LEPSLQLAAAVLAQV-IHDYQ---REKVFR 1154
             E +L+     L  + +  Y+   R  VFR
Sbjct: 124  FEGALKTGRLALESLGLGPYEARERADVFR 153

PyMOL of 3l9w

>3fwz_A Inner membrane protein YBAL; TRKA-N domain, E.coli, structural genomics, PSI-2, Pro structure initiative; HET: MSE AMP; 1.79A {Escherichia coli k-12} Length = 140	Back alignment and structure

>3c85_A Putative glutathione-regulated potassium-efflux S protein KEFB; TRKA domain; HET: AMP; 1.90A {Vibrio parahaemolyticus rimd 2210633} Length = 183	Back alignment and structure

>1id1_A Putative potassium channel protein; RCK domain, E.coli potassium channel, BK channel, rossmann fold, membrane protein; 2.40A {Escherichia coli} SCOP: c.2.1.9 Length = 153	Back alignment and structure

>2aef_A Calcium-gated potassium channel MTHK; rossmann fold, helix-turn-helix, Ca2+ binding, flexible interface; 1.70A {Methanothermobacterthermautotrophicus} PDB: 2aej_A 2aem_A 3rbx_A 2ogu_A 2fy8_A 3kxd_A Length = 234	Back alignment and structure

>1lnq_A MTHK channels, potassium channel related protein; rossman fold, helix bundle, membrane protein; 3.30A {Methanothermobacter thermautotrophicusorganism_taxid} SCOP: c.2.1.9 d.286.1.1 f.14.1.1 PDB: 3rbz_A Length = 336	Back alignment and structure

>3llv_A Exopolyphosphatase-related protein; NAD(P)-binding, rossmann, PSI, M structural genomics; 1.70A {Archaeoglobus fulgidus} Length = 141	Back alignment and structure

>2hmt_A YUAA protein; RCK, KTN, KTR, KTRA, ktrab, membrane protein, ION transporter, symporter, transport protein; HET: NAI; 2.20A {Bacillus subtilis} SCOP: c.2.1.9 PDB: 2hms_A* 2hmu_A* 2hmv_A* 2hmw_A* 1lsu_A* Length = 144	Back alignment and structure

>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221	Back alignment and structure

>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221	Back alignment and structure

>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221	Back alignment and structure

>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221	Back alignment and structure

>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221	Back alignment and structure

>1c1g_A Tropomyosin; contractIle protein; 7.00A {Sus scrofa} SCOP: h.1.5.1 PDB: 2tma_A 2w49_A 2w4u_A Length = 284	Back alignment and structure

>1c1g_A Tropomyosin; contractIle protein; 7.00A {Sus scrofa} SCOP: h.1.5.1 PDB: 2tma_A 2w49_A 2w4u_A Length = 284	Back alignment and structure

>1c1g_A Tropomyosin; contractIle protein; 7.00A {Sus scrofa} SCOP: h.1.5.1 PDB: 2tma_A 2w49_A 2w4u_A Length = 284	Back alignment and structure

>3mt5_A Potassium large conductance calcium-activated CHA subfamily M, alpha member 1; potassium channel, membrane protein, transport protein; 3.00A {Homo sapiens} PDB: 3u6n_A Length = 726	Back alignment and structure

>1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184	Back alignment and structure

>1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184	Back alignment and structure

>2g1u_A Hypothetical protein TM1088A; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: AMP; 1.50A {Thermotoga maritima} PDB: 3l4b_A* Length = 155	Back alignment and structure

>3naf_A Calcium-activated potassium channel subunit alpha; ION channel, gating ring, rossman fold, transport, ION trans; 3.10A {Homo sapiens} Length = 798	Back alignment and structure

>1lss_A TRK system potassium uptake protein TRKA homolog; KTN domain, NAD, RCK domain, potassium transport, potassium channel, KTRA; HET: NAD; 2.30A {Methanocaldococcus jannaschii} SCOP: c.2.1.9 Length = 140	Back alignment and structure

>2b9c_A Striated-muscle alpha tropomyosin; alpha-helix, coiled coil, alanine, axial stagger, radius, SIDE-chain packing, crystal packing; 2.30A {Rattus norvegicus} SCOP: h.1.5.1 Length = 147	Back alignment and structure

Structure Templates Detected by HHsearch

Original result of HHsearch against PDB70 database

ID	Alignment Graph	Length	Definition	Probability
Query		1158
3fwz_A		140	Inner membrane protein YBAL; TRKA-N domain, E.coli	99.86
1zcd_A		388	Na(+)/H(+) antiporter 1; membrane protein; 3.45A {	99.81
4gx0_A		565	TRKA domain protein; membrane protein, ION channel	99.8
3l9w_A		413	Glutathione-regulated potassium-efflux system Pro	99.79
1id1_A		153	Putative potassium channel protein; RCK domain, E.	99.78
1lnq_A		336	MTHK channels, potassium channel related protein;	99.78
3llv_A		141	Exopolyphosphatase-related protein; NAD(P)-binding	99.76
2aef_A		234	Calcium-gated potassium channel MTHK; rossmann fol	99.73
3c85_A		183	Putative glutathione-regulated potassium-efflux S	99.7
3l4b_C		218	TRKA K+ channel protien TM1088B; potassium channel	99.7
4g65_A		461	TRK system potassium uptake protein TRKA; structur	99.67
4gx0_A		565	TRKA domain protein; membrane protein, ION channel	99.66
2hmt_A		144	YUAA protein; RCK, KTN, KTR, KTRA, ktrab, membrane	99.58
1lss_A		140	TRK system potassium uptake protein TRKA homolog;	99.52
4g65_A		461	TRK system potassium uptake protein TRKA; structur	99.51
2g1u_A		155	Hypothetical protein TM1088A; structural genomics,	99.51
3naf_A		798	Calcium-activated potassium channel subunit alpha;	99.35
3mt5_A		726	Potassium large conductance calcium-activated CHA	99.26
4hpf_A		722	Potassium channel subfamily U member 1; PH-gated,	98.84
3zux_A		332	Transporter, ASBTNM; transport protein, membrane p	97.78
3ic5_A		118	Putative saccharopine dehydrogenase; structural ge	97.66
1kyq_A		274	Met8P, siroheme biosynthesis protein Met8; homodim	96.51
3dfz_A		223	SIRC, precorrin-2 dehydrogenase; NAD dehydrogenase	96.36
1hdo_A		206	Biliverdin IX beta reductase; foetal metabolism, H	95.95
2jl1_A		287	Triphenylmethane reductase; oxidoreductase, biorem	95.64
3ius_A		286	Uncharacterized conserved protein; APC63810, silic	95.39
2zcu_A		286	Uncharacterized oxidoreductase YTFG; alpha-beta sa	95.28
2rir_A		300	Dipicolinate synthase, A chain; structural genomic	95.28
1qyd_A		313	Pinoresinol-lariciresinol reductase; NADPH-depende	95.27
2r6j_A		318	Eugenol synthase 1; phenylpropene, PIP reductase,	95.25
3e48_A		289	Putative nucleoside-diphosphate-sugar epimerase; a	95.2
3i6i_A		346	Putative leucoanthocyanidin reductase 1; rossmann	95.12
3g0o_A		303	3-hydroxyisobutyrate dehydrogenase; NAD(P), valine	95.08
1qyc_A		308	Phenylcoumaran benzylic ether reductase PT1; NADPH	95.04
3h2s_A		224	Putative NADH-flavin reductase; Q03B84, NESG, LCR1	95.0
2ew2_A		316	2-dehydropantoate 2-reductase, putative; alpha-str	94.98
2gas_A		307	Isoflavone reductase; NADPH-dependent reductase, o	94.95
2wm3_A		299	NMRA-like family domain containing protein 1; unkn	94.88
3qha_A		296	Putative oxidoreductase; seattle structural genomi	94.85
2z2v_A		365	Hypothetical protein PH1688; L-lysine dehydrogenas	94.76
3qvo_A		236	NMRA family protein; structural genomics, PSI-biol	94.75
3r6d_A		221	NAD-dependent epimerase/dehydratase; structural ge	94.75
2h78_A		302	Hibadh, 3-hydroxyisobutyrate dehydrogenase; APC601	94.69
3dqp_A		219	Oxidoreductase YLBE; alpha-beta protein., structur	94.69
3ktd_A		341	Prephenate dehydrogenase; structural genomics, joi	94.68
3pef_A		287	6-phosphogluconate dehydrogenase, NAD-binding; gam	94.68
3d4o_A		293	Dipicolinate synthase subunit A; NP_243269.1, stru	94.66
3c1o_A		321	Eugenol synthase; phenylpropene, PIP reductase, sh	94.65
4dll_A		320	2-hydroxy-3-oxopropionate reductase; structural ge	94.6
3doj_A		310	AT3G25530, dehydrogenase-like protein; gamma-hydro	94.55
3abi_A		365	Putative uncharacterized protein PH1688; L-lysine	94.51
3ew7_A		221	LMO0794 protein; Q8Y8U8_lismo, putative NAD-depend	94.5
1ff9_A		450	Saccharopine reductase; lysine biosynthesis, alpha	94.46
3naf_A		798	Calcium-activated potassium channel subunit alpha;	94.45
3vkg_A		3245	Dynein heavy chain, cytoplasmic; AAA+ protein, mol	94.41
1pjq_A		457	CYSG, siroheme synthase; rossman fold, nucleotide	94.39
1txg_A		335	Glycerol-3-phosphate dehydrogenase [NAD(P)+]; oxid	94.36
3dhn_A		227	NAD-dependent epimerase/dehydratase; reductase, PF	94.26
3l6d_A		306	Putative oxidoreductase; structural genomics, prot	94.22
3vkg_A		3245	Dynein heavy chain, cytoplasmic; AAA+ protein, mol	94.19
3e8x_A		236	Putative NAD-dependent epimerase/dehydratase; stru	94.13
1vpd_A		299	Tartronate semialdehyde reductase; structural geno	94.06
3cky_A		301	2-hydroxymethyl glutarate dehydrogenase; rossmann	94.0
1jw9_B		249	Molybdopterin biosynthesis MOEB protein; MOEB: mod	93.88
3pdu_A		287	3-hydroxyisobutyrate dehydrogenase family protein;	93.86
2x4g_A		342	Nucleoside-diphosphate-sugar epimerase; isomerase;	93.68
2f1k_A		279	Prephenate dehydrogenase; tyrosine synthesis, X-RA	93.67
2we8_A		386	Xanthine dehydrogenase; oxidoreductase; 2.30A {Myc	93.57
2cvz_A		289	Dehydrogenase, 3-hydroxyisobutyrate dehydrogenase;	93.53
4ina_A		405	Saccharopine dehydrogenase; structural genomics, P	93.39
3ggo_A		314	Prephenate dehydrogenase; TYRA, HPP, NADH, alpha-b	93.35
4gbj_A		297	6-phosphogluconate dehydrogenase NAD-binding; stru	93.24
4ezb_A		317	Uncharacterized conserved protein; structural geno	93.09
2akf_A		32	Coronin-1A; coiled coil, protein binding; 1.20A {S	93.08
1xgk_A		352	Nitrogen metabolite repression regulator NMRA; ros	93.03
3on5_A		362	BH1974 protein; structural genomics, joint center	92.97
3ego_A		307	Probable 2-dehydropantoate 2-reductase; structural	92.97
2g5c_A		281	Prephenate dehydrogenase; TYRA, oxidoreductase; HE	92.83
1bg6_A		359	N-(1-D-carboxylethyl)-L-norvaline dehydrogenase; L	92.66
1xq6_A		253	Unknown protein; structural genomics, protein stru	92.66
2eez_A		369	Alanine dehydrogenase; TTHA0216, structural genomi	92.65
3d1l_A		266	Putative NADP oxidoreductase BF3122; structural ge	92.52
2gf2_A		296	Hibadh, 3-hydroxyisobutyrate dehydrogenase; struct	92.49
3hn2_A		312	2-dehydropantoate 2-reductase; PSI-2, NYSGXRC, str	92.39
4id9_A		347	Short-chain dehydrogenase/reductase; putative dehy	92.38
1yb4_A		295	Tartronic semialdehyde reductase; structural genom	92.34
4hpf_A		722	Potassium channel subfamily U member 1; PH-gated,	92.24
3tri_A		280	Pyrroline-5-carboxylate reductase; amino acid bios	92.17
2vns_A		215	Metalloreductase steap3; metal-binding, transmembr	92.16
3m2p_A		311	UDP-N-acetylglucosamine 4-epimerase; SGXNY, 11155J	92.14
3obb_A		300	Probable 3-hydroxyisobutyrate dehydrogenase; struc	92.08
3gpi_A		286	NAD-dependent epimerase/dehydratase; structural ge	92.07
1lld_A		319	L-lactate dehydrogenase; oxidoreductase(CHOH (D)-N	92.06
4e21_A		358	6-phosphogluconate dehydrogenase (decarboxylating;	92.01
3hwr_A		318	2-dehydropantoate 2-reductase; YP_299159.1, PANE/A	92.0
1i84_S		1184	Smooth muscle myosin heavy chain; muscle protein,	92.0
2p4q_A		497	6-phosphogluconate dehydrogenase, decarboxylating;	91.86
3c24_A		286	Putative oxidoreductase; YP_511008.1, structural g	91.79
1mv8_A		436	GMD, GDP-mannose 6-dehydrogenase; rossman fold, do	91.73
3ce6_A		494	Adenosylhomocysteinase; protein-substrate complex,	91.66
2axq_A		467	Saccharopine dehydrogenase; rossmann fold variant,	91.56
2uyy_A		316	N-PAC protein; long-chain dehydrogenase, cytokine;	91.54
3gt0_A		247	Pyrroline-5-carboxylate reductase; structural geno	91.44
2qyt_A		317	2-dehydropantoate 2-reductase; APC81190, porphyrom	91.41
3to5_A		134	CHEY homolog; alpha(5)beta(5), chemotaxis, FLIM, p	91.4
1i36_A		264	Conserved hypothetical protein MTH1747; NADP bindi	91.22
2c5a_A		379	GDP-mannose-3', 5'-epimerase; short chain dehydrat	91.1
3eod_A		130	Protein HNR; response regulator, phosphoprotein, t	91.08
1cyd_A		244	Carbonyl reductase; short-chain dehydrogenase, oxi	91.06
2y0c_A		478	BCEC, UDP-glucose dehydrogenase; oxidoreductase, c	90.93
4gwg_A		484	6-phosphogluconate dehydrogenase, decarboxylating;	90.87
1i84_S		1184	Smooth muscle myosin heavy chain; muscle protein,	90.82
2bka_A		242	CC3, TAT-interacting protein TIP30; NADPH, PEG600,	90.74
3ruf_A		351	WBGU; rossmann fold, UDP-hexose 4-epimerase, isome	90.72
3b1f_A		290	Putative prephenate dehydrogenase; enzyme, 4-hydro	90.7
1ks9_A		291	KPA reductase;, 2-dehydropantoate 2-reductase; PAN	90.7
3n58_A		464	Adenosylhomocysteinase; ssgcid, hydrolase, structu	90.65
3ojo_A		431	CAP5O; rossmann fold, complex with cofactor NAD an	90.56
1dlj_A		402	UDP-glucose dehydrogenase; rossmann fold, ternary	90.52
3orq_A		377	N5-carboxyaminoimidazole ribonucleotide synthetas;	90.51
3qsg_A		312	NAD-binding phosphogluconate dehydrogenase-like P;	90.45
1c1g_A		284	Tropomyosin; contractIle protein; 7.00A {Sus scrof	90.43
3d3w_A		244	L-xylulose reductase; uronate cycle, short-chain d	90.42
3gg2_A		450	Sugar dehydrogenase, UDP-glucose/GDP-mannose dehyd	90.41
2zyd_A		480	6-phosphogluconate dehydrogenase, decarboxylating;	90.3
1leh_A		364	Leucine dehydrogenase; oxidoreductase; 2.20A {Lysi	90.2
3sxp_A		362	ADP-L-glycero-D-mannoheptose-6-epimerase; rossman	90.07
1hyh_A		309	L-hicdh, L-2-hydroxyisocaproate dehydrogenase; L-2	90.06
1np3_A		338	Ketol-acid reductoisomerase; A DEEP figure-OF-eigh	90.01
3hzh_A		157	Chemotaxis response regulator (CHEY-3); phosphatas	89.99
2ahr_A		259	Putative pyrroline carboxylate reductase; pyrrolin	89.95
3p2y_A		381	Alanine dehydrogenase/pyridine nucleotide transhy;	89.94
1wwk_A		307	Phosphoglycerate dehydrogenase; riken structural g	89.91
3oj0_A		144	Glutr, glutamyl-tRNA reductase; structural genomic	89.8
1y1p_A		342	ARII, aldehyde reductase II; rossmann fold, short	89.63
2efr_A		155	General control protein GCN4 and tropomyosin 1 Al;	89.63
2qxy_A		142	Response regulator; regulation of transcription, N	89.61
1yqg_A		263	Pyrroline-5-carboxylate reductase; structural geno	89.55
2izz_A		322	Pyrroline-5-carboxylate reductase 1; amino-acid bi	89.54
3pqe_A		326	L-LDH, L-lactate dehydrogenase; FBP, oxidoreductas	89.41
3dtt_A		245	NADP oxidoreductase; structural genomics, joint ce	89.33
4huj_A		220	Uncharacterized protein; PSI-biology, nysgrc, stru	89.3
1a5z_A		319	L-lactate dehydrogenase; oxidoreductase, glycolysi	89.26
1lu9_A		287	Methylene tetrahydromethanopterin dehydrogenase; a	89.26
3h9u_A		436	Adenosylhomocysteinase; NAD CO-factor complex, str	89.25
2pgd_A		482	6-phosphogluconate dehydrogenase; oxidoreductase (	89.17
3kto_A		136	Response regulator receiver protein; PSI-II,struct	89.04
3i83_A		320	2-dehydropantoate 2-reductase; structural genomics	89.03
3k96_A		356	Glycerol-3-phosphate dehydrogenase [NAD(P)+]; GPSA	89.03
3ko8_A		312	NAD-dependent epimerase/dehydratase; isomerase, UD	89.0
2gn4_A		344	FLAA1 protein, UDP-GLCNAC C6 dehydratase; rossmann	88.88
4e12_A		283	Diketoreductase; oxidoreductase, NADH; HET: 1PE; 1	88.88
1tmy_A		120	CHEY protein, TMY; chemotaxis, phosphoryl transfer	88.74
3f6c_A		134	Positive transcription regulator EVGA; structural	88.74
2iz1_A		474	6-phosphogluconate dehydrogenase, decarboxylating;	88.67
1sb8_A		352	WBPP; epimerase, 4-epimerase, UDP-galnac, UDP-GLCN	88.66
3ghy_A		335	Ketopantoate reductase protein; oxidoreductase, NA	88.59
3kht_A		144	Response regulator; PSI-II, 11023K, structural gen	88.29
3d64_A		494	Adenosylhomocysteinase; structural genomics, ssgci	88.28
2raf_A		209	Putative dinucleotide-binding oxidoreductase; NP_7	88.19
1pgj_A		478	6PGDH, 6-PGDH, 6-phosphogluconate dehydrogenase; o	88.13
3u59_A		101	Tropomyosin beta chain; muscle contraction, actin,	88.1
1z82_A		335	Glycerol-3-phosphate dehydrogenase; TM0378, struct	88.0
2ehd_A		234	Oxidoreductase, oxidoreductase, short-chain dehydr	87.73
3o38_A		266	Short chain dehydrogenase; tuberculosis, ortholog	87.67
2o3j_A		481	UDP-glucose 6-dehydrogenase; structural genomics,	87.57
2g76_A		335	3-PGDH, D-3-phosphoglycerate dehydrogenase; oxidor	87.55
1v8b_A		479	Adenosylhomocysteinase; hydrolase; HET: NAD ADN; 2	87.54
4e7p_A		150	Response regulator; DNA binding, cytosol, transcri	87.37
3f9i_A		249	3-oxoacyl-[acyl-carrier-protein] reductase; 3-keto	87.34
2pzm_A		330	Putative nucleotide sugar epimerase/ dehydratase;	87.25
4e4t_A		419	Phosphoribosylaminoimidazole carboxylase, ATPase;	87.24
3cnb_A		143	DNA-binding response regulator, MERR family; signa	87.12
3slg_A		372	PBGP3 protein; structural genomics, seattle struct	87.09
1orr_A		347	CDP-tyvelose-2-epimerase; rossmann fold, short-cha	87.04
3gt7_A		154	Sensor protein; structural genomics, signal receiv	87.01
4ffl_A		363	PYLC; amino acid, biosynthesis of pyrrolysine, iso	86.94
2ag5_A		246	DHRS6, dehydrogenase/reductase (SDR family) member	86.91
3gvp_A		435	Adenosylhomocysteinase 3; protein CO-factor comple	86.88
1jay_A		212	Coenzyme F420H2:NADP+ oxidoreductase (FNO); rossma	86.87
2rjn_A		154	Response regulator receiver:metal-dependent phosph	86.86
3ged_A		247	Short-chain dehydrogenase/reductase SDR; SCOR, ros	86.73
2qv0_A		143	Protein MRKE; structural genomics, transcription,	86.71
3q2o_A		389	Phosphoribosylaminoimidazole carboxylase, ATPase;	86.69
2pk3_A		321	GDP-6-deoxy-D-LYXO-4-hexulose reductase; SDR, shor	86.62
3hdg_A		137	Uncharacterized protein; two-component sensor acti	86.6
3jte_A		143	Response regulator receiver protein; structural ge	86.58
1zej_A		293	HBD-9, 3-hydroxyacyl-COA dehydrogenase; structural	86.47
3eag_A		326	UDP-N-acetylmuramate:L-alanyl-gamma-D-glutamyl-ME	86.45
4dio_A		405	NAD(P) transhydrogenase subunit alpha PART 1; stru	86.43
3lk7_A		451	UDP-N-acetylmuramoylalanine--D-glutamate ligase; a	86.43
1dbw_A		126	Transcriptional regulatory protein FIXJ; doubly wo	86.38
3p19_A		266	BFPVVD8, putative blue fluorescent protein; rossma	86.26
2c20_A		330	UDP-glucose 4-epimerase; carbohydrate metabolism,	86.25
2vhw_A		377	Alanine dehydrogenase; NAD, secreted, oxidoreducta	86.15
2qr3_A		140	Two-component system response regulator; structura	86.11
1oc2_A		348	DTDP-glucose 4,6-dehydratase; lyase, NADH, rhamnos	86.06
1uls_A		245	Putative 3-oxoacyl-acyl carrier protein reductase;	86.03
1qkk_A		155	DCTD, C4-dicarboxylate transport transcriptional r	86.02
2yy7_A		312	L-threonine dehydrogenase; thermolabIle, flavobact	85.97
3u1c_A		101	Tropomyosin alpha-1 chain; anti-parallel coiled co	85.87
3p7m_A		321	Malate dehydrogenase; putative dehydrogenase, enzy	85.83
2rh8_A		338	Anthocyanidin reductase; flavonoids, rossmann fold	85.81
3vku_A		326	L-LDH, L-lactate dehydrogenase; rossmann fold, NAD	85.8
2rcy_A		262	Pyrroline carboxylate reductase; malaria, structur	85.55
3nzo_A		399	UDP-N-acetylglucosamine 4,6-dehydratase; structura	85.35
1ek6_A		348	UDP-galactose 4-epimerase; short-chain dehydrogena	85.33
2j48_A		119	Two-component sensor kinase; pseudo-receiver, circ	85.24
2q1s_A		377	Putative nucleotide sugar epimerase/ dehydratase;	85.12
2dpo_A		319	L-gulonate 3-dehydrogenase; structural genomics, N	85.12
2nwq_A		272	Probable short-chain dehydrogenase; oxidoreductase	85.11
3mt5_A		726	Potassium large conductance calcium-activated CHA	85.11
2d5c_A		263	AROE, shikimate 5-dehydrogenase; substrate, dimer,	85.07
3zux_A		332	Transporter, ASBTNM; transport protein, membrane p	85.04
2gcg_A		330	Glyoxylate reductase/hydroxypyruvate reductase; NA	84.99
2c29_D		337	Dihydroflavonol 4-reductase; flavonoids, short deh	84.98
1f0y_A		302	HCDH, L-3-hydroxyacyl-COA dehydrogenase; abortive	84.92
2pi1_A		334	D-lactate dehydrogenase; oxidoreductase, D-LDH, NA	84.91
2v6g_A		364	Progesterone 5-beta-reductase; tyrosine-dependent	84.88
3lua_A		140	Response regulator receiver protein; two-component	84.87
1fmc_A		255	7 alpha-hydroxysteroid dehydrogenase; short-chain	84.86
2v6b_A		304	L-LDH, L-lactate dehydrogenase; oxidoreductase, ra	84.84
2bll_A		345	Protein YFBG; decarboxylase, short chain dehydroge	84.84
3hdv_A		136	Response regulator; PSI-II, structural genomics, P	84.74
1l7d_A		384	Nicotinamide nucleotide transhydrogenase, subunit	84.73
3rft_A		267	Uronate dehydrogenase; apoenzyme, rossmann fold, N	84.71
3ak4_A		263	NADH-dependent quinuclidinone reductase; SDR, (R)-	84.7
2ekl_A		313	D-3-phosphoglycerate dehydrogenase; structural gen	84.69
3vtf_A		444	UDP-glucose 6-dehydrogenase; two discrete alpha/be	84.58
3dii_A		247	Short-chain dehydrogenase/reductase SDR; SCOR, ros	84.56
3ek2_A		271	Enoyl-(acyl-carrier-protein) reductase (NADH); ssg	84.46
3gvi_A		324	Malate dehydrogenase; NAD, oxidoreductase, tricarb	84.43
3crn_A		132	Response regulator receiver domain protein, CHEY-;	84.38
2q1w_A		333	Putative nucleotide sugar epimerase/ dehydratase;	84.36
1zcj_A		463	Peroxisomal bifunctional enzyme; peroxisomal multi	84.36
3enk_A		341	UDP-glucose 4-epimerase; seattle structural genomi	84.3
1smk_A		326	Malate dehydrogenase, glyoxysomal; tricarboxylic c	84.2
2pv7_A		298	T-protein [includes: chorismate mutase (EC 5.4.99	84.17
3jtm_A		351	Formate dehydrogenase, mitochondrial; mitochondrio	84.15
2w2k_A		348	D-mandelate dehydrogenase; 2-hydroxyacid dehydroge	84.12
3hv2_A		153	Response regulator/HD domain protein; PSI-2, NYSGX	84.1
1rkx_A		357	CDP-glucose-4,6-dehydratase; SDR, lyase; HET: NAD;	84.07
2p5y_A		311	UDP-glucose 4-epimerase; TTHA0591, structural geno	84.01
3gem_A		260	Short chain dehydrogenase; structural genomics, AP	84.01
2h7i_A		269	Enoyl-[acyl-carrier-protein] reductase [NADH]; oxi	83.96
2pd6_A		264	Estradiol 17-beta-dehydrogenase 8; short-chain deh	83.96
3cz5_A		153	Two-component response regulator, LUXR family; str	83.8
1x13_A		401	NAD(P) transhydrogenase subunit alpha; NAD(H)-bind	83.8
1xu9_A		286	Corticosteroid 11-beta-dehydrogenase, isozyme 1; h	83.72
3l6e_A		235	Oxidoreductase, short-chain dehydrogenase/reducta;	83.69
3kkj_A		336	Amine oxidase, flavin-containing; oxidoreductase,	83.68
3e18_A		359	Oxidoreductase; dehydrogenase, NAD-binding, struct	83.62
3eul_A		152	Possible nitrate/nitrite response transcriptional	83.6
1n7h_A		381	GDP-D-mannose-4,6-dehydratase; rossmann fold, SDR,	83.53
3pid_A		432	UDP-glucose 6-dehydrogenase; rossmann fold, oxidor	83.51
1yo6_A		250	Putative carbonyl reductase sniffer; tyrosine-depe	83.46
3njr_A		204	Precorrin-6Y methylase; methyltransferase, decarbo	83.43
4e5n_A		330	Thermostable phosphite dehydrogenase; D-2-hydroxya	83.3
2pln_A		137	HP1043, response regulator; signaling protein; 1.8	83.27
1qsg_A		265	Enoyl-[acyl-carrier-protein] reductase; enoyl redu	83.24
2pd4_A		275	Enoyl-[acyl-carrier-protein] reductase [NADH]; ant	83.2
2q3e_A		467	UDP-glucose 6-dehydrogenase; hexamer, structural g	83.18
1evy_A		366	Glycerol-3-phosphate dehydrogenase; rossmann fold,	83.14
1guz_A		310	Malate dehydrogenase; oxidoreductase, tricarboxyli	83.11
4a7p_A		446	UDP-glucose dehydrogenase; oxidoreductase, carbohy	83.05
1zk4_A		251	R-specific alcohol dehydrogenase; short chain redu	83.04
1y7t_A		327	Malate dehydrogenase; NAD-dependent-MDH-NADPH comp	82.98
3ay3_A		267	NAD-dependent epimerase/dehydratase; glucuronic ac	82.97
4dad_A		146	Putative pilus assembly-related protein; response	82.84
2a35_A		215	Hypothetical protein PA4017; alpha-beta-alpha sand	82.83
3oz2_A		397	Digeranylgeranylglycerophospholipid reductase; str	82.76
3asu_A		248	Short-chain dehydrogenase/reductase SDR; SDR famil	82.76
3pp8_A		315	Glyoxylate/hydroxypyruvate reductase A; structural	82.74
3gl9_A		122	Response regulator; beta-sheet, surrounded by alph	82.65
2p91_A		285	Enoyl-[acyl-carrier-protein] reductase [NADH]; NAD	82.53
1eq2_A		310	ADP-L-glycero-D-mannoheptose 6-epimerase; N-termin	82.52
4g2n_A		345	D-isomer specific 2-hydroxyacid dehydrogenase, Na;	82.52
2wyu_A		261	Enoyl-[acyl carrier protein] reductase; oxidoreduc	82.4
2dbq_A		334	Glyoxylate reductase; D-3-phosphoglycerate dehydro	82.39
2z1m_A		345	GDP-D-mannose dehydratase; short-chain dehydrogena	82.33
4b79_A		242	PA4098, probable short-chain dehydrogenase; oxidor	82.29
3afn_B		258	Carbonyl reductase; alpha/beta/alpha, rossmann-fol	82.27
3nep_X		314	Malate dehydrogenase; halophIle, molecular adpatat	82.19
1hdc_A		254	3-alpha, 20 beta-hydroxysteroid dehydrogenase; oxi	82.17
2bgk_A		278	Rhizome secoisolariciresinol dehydrogenase; oxidor	82.15
1pjc_A		361	Protein (L-alanine dehydrogenase); oxidoreductase,	82.07
3awd_A		260	GOX2181, putative polyol dehydrogenase; oxidoreduc	82.05
2z1n_A		260	Dehydrogenase; reductase, SDR, oxidoreductase; 1.8	82.02
1pzg_A		331	LDH, lactate dehydrogenase; apicomplexa, APAD, tet	82.0
3rqi_A		184	Response regulator protein; structural genomics, s	81.96
1pqw_A		198	Polyketide synthase; rossmann fold, dimer, structu	81.88
3h7a_A		252	Short chain dehydrogenase; oxidoreductase, PSI-2,	81.72
3cu5_A		141	Two component transcriptional regulator, ARAC FAM;	81.71
3imf_A		257	Short chain dehydrogenase; structural genomics, in	81.67
3l77_A		235	Short-chain alcohol dehydrogenase; oxidoreductase;	81.6
1p9l_A		245	Dihydrodipicolinate reductase; oxidoreductase, lys	81.53
1i24_A		404	Sulfolipid biosynthesis protein SQD1; SDR, short-c	81.49
1hxh_A		253	3BETA/17BETA-hydroxysteroid dehydrogenase; alpha-b	81.47
3h5n_A		353	MCCB protein; ubiquitin-activating enzyme, microci	81.47
2wsb_A		254	Galactitol dehydrogenase; oxidoreductase, SDR, ros	81.45
1yio_A		208	Response regulatory protein; transcription regulat	81.36
3ppi_A		281	3-hydroxyacyl-COA dehydrogenase type-2; ssgcid, de	81.34
3ax6_A		380	Phosphoribosylaminoimidazole carboxylase, ATPase;	81.32
1xkq_A		280	Short-chain reductase family member (5D234); parra	81.26
1srr_A		124	SPO0F, sporulation response regulatory protein; as	81.23
2j6i_A		364	Formate dehydrogenase; oxidoreductase, D-specific-	81.21
2cfc_A		250	2-(R)-hydroxypropyl-COM dehydrogenase; NAD, oxidor	81.18
1iy8_A		267	Levodione reductase; oxidoreductase; HET: NAD; 1.6	81.15
4e6p_A		259	Probable sorbitol dehydrogenase (L-iditol 2-dehyd;	81.06
3nyw_A		250	Putative oxidoreductase; fatty acid synthesis,3-ox	81.02
2hjr_A		328	Malate dehydrogenase; malaria, structural genomics	81.0
1tlt_A		319	Putative oxidoreductase (virulence factor MVIM HO;	81.0
3g79_A		478	NDP-N-acetyl-D-galactosaminuronic acid dehydrogen;	80.96
3rd5_A		291	Mypaa.01249.C; ssgcid, structural genomics, seattl	80.95
2pnf_A		248	3-oxoacyl-[acyl-carrier-protein] reductase; short	80.92
3h1g_A		129	Chemotaxis protein CHEY homolog; sulfate-bound CHE	80.91
2zqz_A		326	L-LDH, L-lactate dehydrogenase; oxidoreductase, ro	80.89
3m1a_A		281	Putative dehydrogenase; short, PSI, MCSG, structur	80.82
3tnl_A		315	Shikimate dehydrogenase; structural genomics, cent	80.74
1yqd_A		366	Sinapyl alcohol dehydrogenase; lignin, monolignol,	80.72
1ur5_A		309	Malate dehydrogenase; oxidoreductase, tricarboxyli	80.66
3ucx_A		264	Short chain dehydrogenase; ssgcid, seattle structu	80.64
4egb_A		346	DTDP-glucose 4,6-dehydratase; rhamnose pathway, ce	80.57
3ai3_A		263	NADPH-sorbose reductase; rossmann-fold, NADPH-depe	80.54
3qiv_A		253	Short-chain dehydrogenase or 3-oxoacyl-[acyl-CARR	80.44
3a10_A		116	Response regulator; phosphoacceptor, signaling pro	80.44
1rpn_A		335	GDP-mannose 4,6-dehydratase; short-chain dehydroge	80.4
3b2n_A		133	Uncharacterized protein Q99UF4; structural genomic	80.39
4hv4_A		494	UDP-N-acetylmuramate--L-alanine ligase; MURC, yers	80.39
1yde_A		270	Retinal dehydrogenase/reductase 3; oxidoreductase,	80.33
3oig_A		266	Enoyl-[acyl-carrier-protein] reductase [NADH]; fat	80.32
3bio_A		304	Oxidoreductase, GFO/IDH/MOCA family; structural ge	80.29
3cg0_A		140	Response regulator receiver modulated diguanylate	80.24
2a4k_A		263	3-oxoacyl-[acyl carrier protein] reductase; reduct	80.18
1jbe_A		128	Chemotaxis protein CHEY; signaling protein; 1.08A	80.14
3grc_A		140	Sensor protein, kinase; protein structure initiati	80.12
4eso_A		255	Putative oxidoreductase; NADP, structural genomics	80.1
3rkr_A		262	Short chain oxidoreductase; rossmann fold; HET: NA	80.02

>3fwz_A Inner membrane protein YBAL; TRKA-N domain, E.coli, structural genomics, PSI-2, Pro structure initiative; HET: MSE AMP; 1.79A {Escherichia coli k-12}	Back alignment and structure

Probab=99.86  E-value=2.6e-21  Score=192.90  Aligned_cols=139  Identities=23%  Similarity=0.294  Sum_probs=133.8

Q ss_pred             ccccccccccccCCcccHHHHHHHHhhCCCCEEEEeCCchHHHHhhhCCCCEEEccCCCHHHHHhcCccccCEEEEecCC
Q 001096         1004 ETDDLQDHIILCGFGRVGQIIAQLLSERLIPFVALDVRSDRVAIGRALDLPVYFGDAGSREVLHKVGAERACAAAITLDT 1083 (1158)
Q Consensus      1004 ~~~~l~~hvVIiG~G~vG~~Ia~~L~e~g~~VvVID~d~~~v~~l~~~g~~vi~GDasd~e~L~~AgI~~A~~VIi~t~d 1083 (1158)
                      +.+++++|++|||+|++|+.+++.|.+.|++|+++|.|+++++.+++.|+++++||++++++|+++++++|+++|+++++
T Consensus         2 ~~~~~~~~viIiG~G~~G~~la~~L~~~g~~v~vid~~~~~~~~~~~~g~~~i~gd~~~~~~l~~a~i~~ad~vi~~~~~   81 (140)
T 3fwz_A            2 NAVDICNHALLVGYGRVGSLLGEKLLASDIPLVVIETSRTRVDELRERGVRAVLGNAANEEIMQLAHLECAKWLILTIPN   81 (140)
T ss_dssp             CCCCCCSCEEEECCSHHHHHHHHHHHHTTCCEEEEESCHHHHHHHHHTTCEEEESCTTSHHHHHHTTGGGCSEEEECCSC
T ss_pred             CcccCCCCEEEECcCHHHHHHHHHHHHCCCCEEEEECCHHHHHHHHHcCCCEEECCCCCHHHHHhcCcccCCEEEEECCC
Confidence            35678999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             chhhHHHHHHHHhhCCCceEEEEecChhhHHHHHHCCCCeeecCCcHHHHHHHHHHHHh
Q 001096         1084 PGANYRTVWALSKYFPNVKTFVRAHDIDHGLNLEKAGATAVVPETLEPSLQLAAAVLAQ 1142 (1158)
Q Consensus      1084 d~~Nl~i~l~ar~l~p~~~IIara~d~e~~~~L~~aGAd~VI~p~~~a~~~LA~~vl~~ 1142 (1158)
                      +..|..++..+|+++|+.+||+|+++.++.+.|+++|+|.||+|+..++..|++++.+|
T Consensus        82 ~~~n~~~~~~a~~~~~~~~iiar~~~~~~~~~l~~~G~d~vi~p~~~~a~~i~~~l~~~  140 (140)
T 3fwz_A           82 GYEAGEIVASARAKNPDIEIIARAHYDDEVAYITERGANQVVMGEREIARTMLELLETP  140 (140)
T ss_dssp             HHHHHHHHHHHHHHCSSSEEEEEESSHHHHHHHHHTTCSEEEEHHHHHHHHHHHHHHCC
T ss_pred             hHHHHHHHHHHHHHCCCCeEEEEECCHHHHHHHHHCCCCEEECchHHHHHHHHHHhhCC
Confidence            99999999999999999999999999999999999999999999999999999988765

PyMOL of 3fwz

>1zcd_A Na(+)/H(+) antiporter 1; membrane protein; 3.45A {Escherichia coli} PDB: 3fi1_A	Back alignment and structure

>4gx0_A TRKA domain protein; membrane protein, ION channel, ADP binding, NAD binding, MEM transport protein; HET: MAL GLC; 2.60A {Geobacter sulfurreducens} PDB: 4gx1_A* 4gx2_A* 4gx5_A 4gvl_A*	Back alignment and structure

>3l9w_A Glutathione-regulated potassium-efflux system Pro linker, ancillary protein KEFF; potassium channel regulation, domains, antiport; HET: FMN AMP GSH; 1.75A {Escherichia coli} PDB: 3eyw_A* 3l9x_A*	Back alignment and structure

>1id1_A Putative potassium channel protein; RCK domain, E.coli potassium channel, BK channel, rossmann fold, membrane protein; 2.40A {Escherichia coli} SCOP: c.2.1.9	Back alignment and structure

>1lnq_A MTHK channels, potassium channel related protein; rossman fold, helix bundle, membrane protein; 3.30A {Methanothermobacter thermautotrophicusorganism_taxid} SCOP: c.2.1.9 d.286.1.1 f.14.1.1 PDB: 3rbz_A	Back alignment and structure

>3llv_A Exopolyphosphatase-related protein; NAD(P)-binding, rossmann, PSI, M structural genomics; 1.70A {Archaeoglobus fulgidus}	Back alignment and structure

>2aef_A Calcium-gated potassium channel MTHK; rossmann fold, helix-turn-helix, Ca2+ binding, flexible interface; 1.70A {Methanothermobacterthermautotrophicus} PDB: 2aej_A 2aem_A 3rbx_A 2ogu_A 2fy8_A 3kxd_A	Back alignment and structure

>3c85_A Putative glutathione-regulated potassium-efflux S protein KEFB; TRKA domain; HET: AMP; 1.90A {Vibrio parahaemolyticus rimd 2210633}	Back alignment and structure

>3l4b_C TRKA K+ channel protien TM1088B; potassium channel, ring-gating complex, structural GEN PSI-2-2, protein structure initiative; HET: AMP; 3.45A {Thermotoga maritima}	Back alignment and structure

>4g65_A TRK system potassium uptake protein TRKA; structural genomics, center for structural genomics of infec diseases, csgid, niaid; HET: MSE; 2.09A {Vibrio vulnificus}	Back alignment and structure

>4gx0_A TRKA domain protein; membrane protein, ION channel, ADP binding, NAD binding, MEM transport protein; HET: MAL GLC; 2.60A {Geobacter sulfurreducens} PDB: 4gx1_A* 4gx2_A* 4gx5_A 4gvl_A*	Back alignment and structure

>2hmt_A YUAA protein; RCK, KTN, KTR, KTRA, ktrab, membrane protein, ION transporter, symporter, transport protein; HET: NAI; 2.20A {Bacillus subtilis} SCOP: c.2.1.9 PDB: 2hms_A* 2hmu_A* 2hmv_A* 2hmw_A* 1lsu_A*	Back alignment and structure

>1lss_A TRK system potassium uptake protein TRKA homolog; KTN domain, NAD, RCK domain, potassium transport, potassium channel, KTRA; HET: NAD; 2.30A {Methanocaldococcus jannaschii} SCOP: c.2.1.9	Back alignment and structure

>4g65_A TRK system potassium uptake protein TRKA; structural genomics, center for structural genomics of infec diseases, csgid, niaid; HET: MSE; 2.09A {Vibrio vulnificus}	Back alignment and structure

>2g1u_A Hypothetical protein TM1088A; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: AMP; 1.50A {Thermotoga maritima} PDB: 3l4b_A*	Back alignment and structure

>3naf_A Calcium-activated potassium channel subunit alpha; ION channel, gating ring, rossman fold, transport, ION trans; 3.10A {Homo sapiens}	Back alignment and structure

>3mt5_A Potassium large conductance calcium-activated CHA subfamily M, alpha member 1; potassium channel, membrane protein, transport protein; 3.00A {Homo sapiens} PDB: 3u6n_A	Back alignment and structure

>4hpf_A Potassium channel subfamily U member 1; PH-gated, membrane protein, transport Pro; 3.40A {Homo sapiens}	Back alignment and structure

>3zux_A Transporter, ASBTNM; transport protein, membrane protein; HET: TCH LDA PTY; 2.20A {Neisseria meningitidis} PDB: 3zuy_A*	Back alignment and structure

>3ic5_A Putative saccharopine dehydrogenase; structural genomics, APC63807.2, N-terminal domain, saccharo dehydrogenase, PSI-2; HET: MSE; 2.08A {Ruegeria pomeroyi}	Back alignment and structure

>1kyq_A Met8P, siroheme biosynthesis protein Met8; homodimer, oxidoreductase, lyase; HET: NAD; 2.20A {Saccharomyces cerevisiae} SCOP: c.2.1.11 e.37.1.1	Back alignment and structure

>3dfz_A SIRC, precorrin-2 dehydrogenase; NAD dehydrogenase, cobalamin biosynthesis, NAD, oxidoreducta porphyrin biosynthesis; 2.30A {Bacillus megaterium}	Back alignment and structure

>1hdo_A Biliverdin IX beta reductase; foetal metabolism, HAEM degradation, flavin reductase, diaphorase, green HAEM binding protein; HET: NAP; 1.15A {Homo sapiens} SCOP: c.2.1.2 PDB: 1he2_A* 1he3_A* 1he4_A* 1he5_A*	Back alignment and structure

>2jl1_A Triphenylmethane reductase; oxidoreductase, bioremediation; HET: NAP GOL; 1.96A {Citrobacter SP} PDB: 2vrb_A* 2vrc_A 2vrc_D	Back alignment and structure

>3ius_A Uncharacterized conserved protein; APC63810, silicibacter pomeroyi DSS, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.66A {Ruegeria pomeroyi dss-3}	Back alignment and structure

>2zcu_A Uncharacterized oxidoreductase YTFG; alpha-beta sandwich; 1.80A {Escherichia coli} PDB: 2zcv_A*	Back alignment and structure

>2rir_A Dipicolinate synthase, A chain; structural genomics, APC1343, PSI-2, structure initiative; HET: MSE NAP; 2.79A {Bacillus subtilis}	Back alignment and structure

>1qyd_A Pinoresinol-lariciresinol reductase; NADPH-dependent aromatic alcohol reductases, pcber, PLR, IFR, lignans, isoflavonoids, plant protein; 2.50A {Thuja plicata} SCOP: c.2.1.2	Back alignment and structure

>2r6j_A Eugenol synthase 1; phenylpropene, PIP reductase, short-chain dehydrogenase/reductase, plant protein; HET: NDP; 1.50A {Ocimum basilicum} PDB: 2qys_A 2qx7_A* 2qzz_A* 2r2g_A* 3c3x_A* 2qw8_A*	Back alignment and structure

>3e48_A Putative nucleoside-diphosphate-sugar epimerase; alpha-beta protein., structural genomics, PSI-2, protein STR initiative; 1.60A {Staphylococcus aureus subsp}	Back alignment and structure

>3i6i_A Putative leucoanthocyanidin reductase 1; rossmann fold, short chain dehydrogenase reductase, flavonoi oxidoreductase; HET: NDP; 1.75A {Vitis vinifera} PDB: 3i5m_A 3i52_A* 3i6q_A*	Back alignment and structure

>3g0o_A 3-hydroxyisobutyrate dehydrogenase; NAD(P), valine catabolism, tartaric acid, target 11128H, NYSGXRC, PSI-2, structural genomics; HET: TLA; 1.80A {Salmonella typhimurium}	Back alignment and structure

>1qyc_A Phenylcoumaran benzylic ether reductase PT1; NADPH-dependent aromatic alcohol reductases, pcber, PLR, IFR, lignans, isoflavonoids, plant protein; 2.20A {Pinus taeda} SCOP: c.2.1.2	Back alignment and structure

>3h2s_A Putative NADH-flavin reductase; Q03B84, NESG, LCR19, structural genomics, PSI-2, protein structure initiative; HET: NDP; 1.78A {Lactobacillus casei atcc 334}	Back alignment and structure

>2ew2_A 2-dehydropantoate 2-reductase, putative; alpha-structure, alpha-beta structure, structural genomics, protein structure initiative; HET: MSE; 2.00A {Enterococcus faecalis}	Back alignment and structure

>2gas_A Isoflavone reductase; NADPH-dependent reductase, oxidoreductase; 1.60A {Medicago sativa}	Back alignment and structure

>2wm3_A NMRA-like family domain containing protein 1; unknown function; HET: NAP NFL; 1.85A {Homo sapiens} PDB: 2wmd_A* 2exx_A* 3dxf_A 3e5m_A	Back alignment and structure

>3qha_A Putative oxidoreductase; seattle structural genomics center for infectious disease, S mycobacterium avium 104, rossmann fold; 2.25A {Mycobacterium avium}	Back alignment and structure

>3qvo_A NMRA family protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, unknown function; HET: MNB; 2.30A {Shigella flexneri 2A}	Back alignment and structure

>3r6d_A NAD-dependent epimerase/dehydratase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, veillo parvula; HET: MLZ; 1.25A {Veillonella parvula dsm 2008} PDB: 4hng_A 4hnh_A* 3r14_A*	Back alignment and structure

>3dqp_A Oxidoreductase YLBE; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; 1.40A {Lactococcus lactis subsp}	Back alignment and structure

>3ktd_A Prephenate dehydrogenase; structural genomics, joint center F structural genomics, JCSG, protein structure initiative; 2.60A {Corynebacterium glutamicum atcc 13032}	Back alignment and structure

>3pef_A 6-phosphogluconate dehydrogenase, NAD-binding; gamma-hydroxybutyrate dehydrogenase, succinic semialdehyde R geobacter metallireducens; HET: NAP; 2.07A {Geobacter metallireducens}	Back alignment and structure

>3d4o_A Dipicolinate synthase subunit A; NP_243269.1, structural GEN joint center for structural genomics, JCSG, protein structu initiative, PSI-2; HET: MSE TAR; 2.10A {Bacillus halodurans}	Back alignment and structure

>3c1o_A Eugenol synthase; phenylpropene, PIP reductase, short-chain dehydrogenase/reductase, oxidoreductase; HET: NAP; 1.80A {Clarkia breweri}	Back alignment and structure

>4dll_A 2-hydroxy-3-oxopropionate reductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, oxidoreductase; 2.11A {Polaromonas SP}	Back alignment and structure

>3doj_A AT3G25530, dehydrogenase-like protein; gamma-hydroxybutyrate dehydrogenase, 4-hydroxybutyrate dehydrogenase; 2.10A {Arabidopsis thaliana}	Back alignment and structure

>3abi_A Putative uncharacterized protein PH1688; L-lysine dehydrogenase, oxidoreductase; HET: NAD; 2.44A {Pyrococcus horikoshii}	Back alignment and structure

>3ew7_A LMO0794 protein; Q8Y8U8_lismo, putative NAD-dependent epimerase/dehydratase, LMR162, NESG, structural genomics, PSI-2; 2.73A {Listeria monocytogenes}	Back alignment and structure

>1ff9_A Saccharopine reductase; lysine biosynthesis, alpha-aminoadipate pathway, dehydrogenase, oxidoreductase; 2.00A {Magnaporthe grisea} SCOP: c.2.1.3 d.81.1.2 PDB: 1e5l_A* 1e5q_A	Back alignment and structure

>3naf_A Calcium-activated potassium channel subunit alpha; ION channel, gating ring, rossman fold, transport, ION trans; 3.10A {Homo sapiens}	Back alignment and structure

>3vkg_A Dynein heavy chain, cytoplasmic; AAA+ protein, molecular motor, microtubles, motor protein; HET: ADP SPM; 2.81A {Dictyostelium discoideum} PDB: 3vkh_A*	Back alignment and structure

>1pjq_A CYSG, siroheme synthase; rossman fold, nucleotide binding motif, SAM, NAD, phosphoserine, transferase/oxidoreductase/lyase complex; HET: SEP PGE SAH; 2.21A {Salmonella typhimurium} SCOP: c.2.1.11 c.90.1.1 e.37.1.1 PDB: 1pjs_A* 1pjt_A*	Back alignment and structure

>1txg_A Glycerol-3-phosphate dehydrogenase [NAD(P)+]; oxidoreductase; 1.70A {Archaeoglobus fulgidus} SCOP: a.100.1.6 c.2.1.6	Back alignment and structure

>3dhn_A NAD-dependent epimerase/dehydratase; reductase, PF01370, Q89Z24_bactn, NESG, BTR310, structural genomics, PSI-2; 2.00A {Bacteroides thetaiotaomicron}	Back alignment and structure

>3l6d_A Putative oxidoreductase; structural genomics, protein structure initiative, oxidoredu PSI-2; HET: MSE; 1.90A {Pseudomonas putida}	Back alignment and structure

>3vkg_A Dynein heavy chain, cytoplasmic; AAA+ protein, molecular motor, microtubles, motor protein; HET: ADP SPM; 2.81A {Dictyostelium discoideum} PDB: 3vkh_A*	Back alignment and structure

>3e8x_A Putative NAD-dependent epimerase/dehydratase; structural genomics, APC7755, NADP, P protein structure initiative; HET: MSE NAP; 2.10A {Bacillus halodurans}	Back alignment and structure

>1vpd_A Tartronate semialdehyde reductase; structural genomics, MCSG, protein structure initiative, PSI, midwest center for structural genomics; HET: MSE TLA; 1.65A {Salmonella typhimurium} SCOP: a.100.1.1 c.2.1.6	Back alignment and structure

>3cky_A 2-hydroxymethyl glutarate dehydrogenase; rossmann fold, two domain enzyme, oxidoreductase; 2.30A {Eubacterium barkeri}	Back alignment and structure

>1jw9_B Molybdopterin biosynthesis MOEB protein; MOEB: modified rossmann fold, (2) Cys-X-X-Cys zinc-binding M MOAD: ubiquitin-like fold; 1.70A {Escherichia coli} SCOP: c.111.1.1 PDB: 1jwa_B* 1jwb_B*	Back alignment and structure

>3pdu_A 3-hydroxyisobutyrate dehydrogenase family protein; gamma-hydroxybutyrate dehydrogenase, succinic semialdehyde R glyoxylate metabolism; HET: NAP; 1.89A {Geobacter sulfurreducens}	Back alignment and structure

>2x4g_A Nucleoside-diphosphate-sugar epimerase; isomerase; 2.65A {Pseudomonas aeruginosa}	Back alignment and structure

>2f1k_A Prephenate dehydrogenase; tyrosine synthesis, X-RA crystallography structure, oxidoreductase; HET: OMT NAP; 1.55A {Synechocystis SP} SCOP: a.100.1.12 c.2.1.6	Back alignment and structure

>2we8_A Xanthine dehydrogenase; oxidoreductase; 2.30A {Mycobacterium smegmatis} PDB: 2we7_A	Back alignment and structure

>2cvz_A Dehydrogenase, 3-hydroxyisobutyrate dehydrogenase; valine catabolism, NADP+, structural GEN riken structural genomics/proteomics initiative; HET: NDP; 1.80A {Thermus thermophilus} SCOP: a.100.1.1 c.2.1.6 PDB: 1wp4_A*	Back alignment and structure

>4ina_A Saccharopine dehydrogenase; structural genomics, PSI-biology, northeast structural genom consortium, NESG, oxidoreductas; 2.49A {Wolinella succinogenes}	Back alignment and structure

>3ggo_A Prephenate dehydrogenase; TYRA, HPP, NADH, alpha-beta, oxidoreductase; HET: NAI ENO; 2.15A {Aquifex aeolicus} PDB: 3ggg_D* 3ggp_A*	Back alignment and structure

>4gbj_A 6-phosphogluconate dehydrogenase NAD-binding; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; 2.05A {Dyadobacter fermentans}	Back alignment and structure

>4ezb_A Uncharacterized conserved protein; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium; 2.10A {Sinorhizobium meliloti}	Back alignment and structure

>2akf_A Coronin-1A; coiled coil, protein binding; 1.20A {Synthetic}	Back alignment and structure

>1xgk_A Nitrogen metabolite repression regulator NMRA; rossmann fold, transcriptional regulation, short chain dehyd reductase, NADP binding; 1.40A {Emericella nidulans} SCOP: c.2.1.2 PDB: 1k6x_A* 1k6j_A 1k6i_A* 1ti7_A* 2vus_A 2vut_A* 2vuu_A*	Back alignment and structure

>3on5_A BH1974 protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-biology, oxidoreductase; 2.80A {Bacillus halodurans}	Back alignment and structure

>3ego_A Probable 2-dehydropantoate 2-reductase; structural genomics, PANE, unknown function, cytoplasm, NADP, oxidoreductase; 1.90A {Bacillus subtilis}	Back alignment and structure

>2g5c_A Prephenate dehydrogenase; TYRA, oxidoreductase; HET: NAD; 1.90A {Aquifex aeolicus} SCOP: a.100.1.12 c.2.1.6	Back alignment and structure

>1bg6_A N-(1-D-carboxylethyl)-L-norvaline dehydrogenase; L) stereospecific opine dehydrogenase, oxidoreductase; 1.80A {Arthrobacter SP} SCOP: a.100.1.5 c.2.1.6	Back alignment and structure

>1xq6_A Unknown protein; structural genomics, protein structure initiative, CESG, AT5G02240, NADP, center for eukaryotic structural genomics; HET: NAP; 1.80A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 1ybm_A* 2q46_A* 2q4b_A*	Back alignment and structure

>2eez_A Alanine dehydrogenase; TTHA0216, structural genomic NPPSFA, national project on protein structural and function analyses; 2.71A {Thermus thermophilus}	Back alignment and structure

>3d1l_A Putative NADP oxidoreductase BF3122; structural genomics, PSI-2, protein structure initiative, M center for structural genomics, MCSG; 2.19A {Bacteroides fragilis}	Back alignment and structure

>2gf2_A Hibadh, 3-hydroxyisobutyrate dehydrogenase; structural genomics, structural genomics consortium, SGC, oxidoreductase; 2.38A {Homo sapiens} PDB: 2i9p_A*	Back alignment and structure

>3hn2_A 2-dehydropantoate 2-reductase; PSI-2, NYSGXRC, structural GE protein structure initiative; 2.50A {Geobacter metallireducens}	Back alignment and structure

>4id9_A Short-chain dehydrogenase/reductase; putative dehydrogenase, enzyme function initiative, EFI, STR genomics, oxidoreductase; HET: NAD; 1.60A {Agrobacterium fabrum} PDB: 4idg_A*	Back alignment and structure

>1yb4_A Tartronic semialdehyde reductase; structural genomics, oxidoreductase, salmonella typhimurium LT2, PSI, protein ST initiative; 2.40A {Salmonella typhimurium}	Back alignment and structure

>4hpf_A Potassium channel subfamily U member 1; PH-gated, membrane protein, transport Pro; 3.40A {Homo sapiens}	Back alignment and structure

>3tri_A Pyrroline-5-carboxylate reductase; amino acid biosynthesis, oxidoreductase; HET: NAP; 2.50A {Coxiella burnetii}	Back alignment and structure

>2vns_A Metalloreductase steap3; metal-binding, transmembrane, rossmann fold, transport, cell cycle, transferrin, flavoprotein, alternative splicing; HET: CIT; 2.0A {Homo sapiens} PDB: 2vq3_A*	Back alignment and structure

>3m2p_A UDP-N-acetylglucosamine 4-epimerase; SGXNY, 11155J, isomerase, structural genomics, PSI-2, protein structure initiative; HET: UDP; 2.95A {Bacillus cereus}	Back alignment and structure

>3obb_A Probable 3-hydroxyisobutyrate dehydrogenase; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics; HET: EPE; 2.20A {Pseudomonas aeruginosa} PDB: 3q3c_A*	Back alignment and structure

>3gpi_A NAD-dependent epimerase/dehydratase; structural genomics, unknown function, PSI-2, protein structure initiative; 1.44A {Methylobacillus flagellatus KT}	Back alignment and structure

>1lld_A L-lactate dehydrogenase; oxidoreductase(CHOH (D)-NAD (A)); HET: NAD; 2.00A {Bifidobacterium longum subsp} SCOP: c.2.1.5 d.162.1.1 PDB: 1lth_T*	Back alignment and structure

>4e21_A 6-phosphogluconate dehydrogenase (decarboxylating; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.30A {Geobacter metallireducens}	Back alignment and structure

>3hwr_A 2-dehydropantoate 2-reductase; YP_299159.1, PANE/APBA family ketopantoate reductase, struct genomics, joint center for structural genomics; HET: NDP BCN; 2.15A {Ralstonia eutropha}	Back alignment and structure

>1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A	Back alignment and structure

>2p4q_A 6-phosphogluconate dehydrogenase, decarboxylating; rossmann fold, oxidoreductase; HET: FLC; 2.37A {Saccharomyces cerevisiae}	Back alignment and structure

>3c24_A Putative oxidoreductase; YP_511008.1, structural genomics, center for structural genomics, JCSG, protein structure INI PSI-2; HET: MSE; 1.62A {Jannaschia SP}	Back alignment and structure

>1mv8_A GMD, GDP-mannose 6-dehydrogenase; rossman fold, domain-swapped dimer, enzyme complex with COFA product, oxidoreductase; HET: SUC NAD GDX; 1.55A {Pseudomonas aeruginosa} SCOP: a.100.1.4 c.2.1.6 c.26.3.1 PDB: 1mfz_A* 1muu_A*	Back alignment and structure

>3ce6_A Adenosylhomocysteinase; protein-substrate complex, dimer of dimers, NAD binding DOMA amino acid insertional region, hydrolase; HET: ADN NAD; 1.60A {Mycobacterium tuberculosis} PDB: 3dhy_A* 2zj0_A* 2ziz_A* 2zj1_A*	Back alignment and structure

>2axq_A Saccharopine dehydrogenase; rossmann fold variant, saccharopine reductase fold (domain II), alpha/beta protein; 1.70A {Saccharomyces cerevisiae}	Back alignment and structure

>2uyy_A N-PAC protein; long-chain dehydrogenase, cytokine; HET: NA7; 2.5A {Homo sapiens}	Back alignment and structure

>3gt0_A Pyrroline-5-carboxylate reductase; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG; 2.00A {Bacillus cereus atcc 14579}	Back alignment and structure

>2qyt_A 2-dehydropantoate 2-reductase; APC81190, porphyromonas gingi W83, structural genomics, PSI-2; HET: MSE; 2.15A {Porphyromonas gingivalis}	Back alignment and structure

>3to5_A CHEY homolog; alpha(5)beta(5), chemotaxis, FLIM, phosphorylation, motor AC signaling protein; 1.65A {Vibrio cholerae}	Back alignment and structure

>1i36_A Conserved hypothetical protein MTH1747; NADP binding domain, protein NADP complex, structural genomics, PSI; HET: NAP; 2.00A {Methanothermobacterthermautotrophicus} SCOP: a.100.1.8 c.2.1.6	Back alignment and structure

>2c5a_A GDP-mannose-3', 5'-epimerase; short chain dehydratase/reductase, GDP-gulose, GDP-galactose, keto intermediate, vitamin C, SDR; HET: GDC NAD BTB; 1.4A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 2c59_A* 2c54_A* 2c5e_A*	Back alignment and structure

>3eod_A Protein HNR; response regulator, phosphoprotein, two-component regulatory system, signaling protein; 1.75A {Escherichia coli K12}	Back alignment and structure

>1cyd_A Carbonyl reductase; short-chain dehydrogenase, oxidoreductase; HET: NAP; 1.80A {Mus musculus} SCOP: c.2.1.2	Back alignment and structure

>2y0c_A BCEC, UDP-glucose dehydrogenase; oxidoreductase, carbohydrate synthesis, exopolysaccharide, C fibrosis; HET: UGA; 1.75A {Burkholderia cepacia} PDB: 2y0d_A* 2y0e_A*	Back alignment and structure

>4gwg_A 6-phosphogluconate dehydrogenase, decarboxylating; 6-phosphoglyconate dehydrogenase, NADP, oxido; HET: MES; 1.39A {Homo sapiens} PDB: 4gwk_A* 2jkv_A* 2pgd_A 1pgo_A* 1pgp_A* 1pgq_A* 1pgn_A	Back alignment and structure

>1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A	Back alignment and structure

>2bka_A CC3, TAT-interacting protein TIP30; NADPH, PEG600, transcription; HET: NDP PE8; 1.7A {Homo sapiens} SCOP: c.2.1.2 PDB: 2fmu_A	Back alignment and structure

>3ruf_A WBGU; rossmann fold, UDP-hexose 4-epimerase, isomerase; HET: NAD UDP; 2.00A {Plesiomonas shigelloides} SCOP: c.2.1.2 PDB: 3ru9_A* 3rud_A* 3rue_A* 3rua_A* 3ruh_A* 3ruc_A* 3ru7_A* 3lu1_A*	Back alignment and structure

>3b1f_A Putative prephenate dehydrogenase; enzyme, 4-hydroxyphenylpyruvate, oxidative decarboxylation pathway, tyrosine biosynthesis, oxidoreduct; HET: NAD; 2.10A {Streptococcus mutans} PDB: 3dzb_A	Back alignment and structure

>1ks9_A KPA reductase;, 2-dehydropantoate 2-reductase; PANE, APBA, ketopantoate reductase, rossman fold, monomer, APO, oxidoreductase; 1.70A {Escherichia coli} SCOP: a.100.1.7 c.2.1.6 PDB: 1yon_A* 1yjq_A* 2ofp_A*	Back alignment and structure

>3n58_A Adenosylhomocysteinase; ssgcid, hydrolase, structural genomics, seattle structural G center for infectious disease; HET: ADN NAD; 2.39A {Brucella melitensis biovar abortus}	Back alignment and structure

>3ojo_A CAP5O; rossmann fold, complex with cofactor NAD and EU(PDC)3, oxidi conformation, oxidoreductase; HET: NAD PDC; 2.50A {Staphylococcus aureus} PDB: 3ojl_A*	Back alignment and structure

>1dlj_A UDP-glucose dehydrogenase; rossmann fold, ternary complex, crystallographic dimer, oxidoreductase; HET: NAI UGA; 1.80A {Streptococcus pyogenes} SCOP: a.100.1.4 c.2.1.6 c.26.3.1 PDB: 1dli_A*	Back alignment and structure

>3orq_A N5-carboxyaminoimidazole ribonucleotide synthetas; ATP-grAsp superfamily, ligase,biosynthetic protein; HET: MSE ADP; 2.23A {Staphylococcus aureus subsp} PDB: 3orr_A	Back alignment and structure

>3qsg_A NAD-binding phosphogluconate dehydrogenase-like P; structural genomics, PSI-biology, midwest center for structu genomics; 1.90A {Alicyclobacillus acidocaldarius subsp}	Back alignment and structure

>1c1g_A Tropomyosin; contractIle protein; 7.00A {Sus scrofa} SCOP: h.1.5.1 PDB: 2tma_A 2w49_A 2w4u_A	Back alignment and structure

>3d3w_A L-xylulose reductase; uronate cycle, short-chain dehydrogenase/reductase(SDR) superfamily, glucose metabolism, acetylation, carbohydrate metabolism; HET: NAP; 1.87A {Homo sapiens} PDB: 1wnt_A* 1pr9_A*	Back alignment and structure

>3gg2_A Sugar dehydrogenase, UDP-glucose/GDP-mannose dehydrogenase family; structural genomics, oxidoreductase, PSI-2; HET: UGA; 1.70A {Porphyromonas gingivalis}	Back alignment and structure

>2zyd_A 6-phosphogluconate dehydrogenase, decarboxylating; NADP, pentose phosphate pathway, oxidoreductase, 6-phosphogl dehydrogenase; HET: GLO; 1.50A {Escherichia coli} PDB: 2zya_A* 3fwn_A* 2zyg_A 2w8z_A* 2w90_A*	Back alignment and structure

>1leh_A Leucine dehydrogenase; oxidoreductase; 2.20A {Lysinibacillus sphaericus} SCOP: c.2.1.7 c.58.1.1	Back alignment and structure

>3sxp_A ADP-L-glycero-D-mannoheptose-6-epimerase; rossman fold, NAD binding, isomerase; HET: NAD; 2.55A {Helicobacter pylori}	Back alignment and structure

>1hyh_A L-hicdh, L-2-hydroxyisocaproate dehydrogenase; L-2-hydroxycarboxylate dehydrogenase, L-lactate dehydrogenas oxidoreductase (CHOH(D)-NAD+(A)); HET: NAD; 2.20A {Weissella confusa} SCOP: c.2.1.5 d.162.1.1	Back alignment and structure

>1np3_A Ketol-acid reductoisomerase; A DEEP figure-OF-eight knot, C-terminal alpha-helical domain oxidoreductase; 2.00A {Pseudomonas aeruginosa} SCOP: a.100.1.2 c.2.1.6	Back alignment and structure

>3hzh_A Chemotaxis response regulator (CHEY-3); phosphatase, complex, response regulator, receiver domain, two-component signal transduction; HET: BFD; 1.96A {Borrelia burgdorferi}	Back alignment and structure

>2ahr_A Putative pyrroline carboxylate reductase; pyrroline reductase, proline biosynthesis, NAD(P protein, rossmann fold, doain swapping; HET: NAP; 2.15A {Streptococcus pyogenes} SCOP: a.100.1.10 c.2.1.6 PDB: 2amf_A	Back alignment and structure

>3p2y_A Alanine dehydrogenase/pyridine nucleotide transhy; seattle structural genomics center for infectious disease, S tuberculosis; 1.82A {Mycobacterium smegmatis str}	Back alignment and structure

>1wwk_A Phosphoglycerate dehydrogenase; riken structural genomics/proteomics initiative, RSGI, structural genomics, oxidoreductase; HET: NAD; 1.90A {Pyrococcus horikoshii}	Back alignment and structure

>3oj0_A Glutr, glutamyl-tRNA reductase; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: MSE SO4; 1.65A {Thermoplasma volcanium}	Back alignment and structure

>1y1p_A ARII, aldehyde reductase II; rossmann fold, short chain dehydrogenase reductase, oxidoreductase; HET: NMN AMP; 1.60A {Sporidiobolus salmonicolor} SCOP: c.2.1.2 PDB: 1ujm_A* 1zze_A	Back alignment and structure

>2efr_A General control protein GCN4 and tropomyosin 1 Al; destabilizing cluster, hydrophobic core, contractIle protein; 1.80A {Saccharomyces cerevisiae} PDB: 2efs_A 2d3e_A	Back alignment and structure

>2qxy_A Response regulator; regulation of transcription, NYSGXRC, protein structure initiative II (PSI II), structural genomics; 1.95A {Thermotoga maritima}	Back alignment and structure

>1yqg_A Pyrroline-5-carboxylate reductase; structural genomics, PSI, structure initiative, midwest center for structural genomic oxidoreductase; 1.90A {Neisseria meningitidis} SCOP: a.100.1.10 c.2.1.6 PDB: 2ag8_A*	Back alignment and structure

>2izz_A Pyrroline-5-carboxylate reductase 1; amino-acid biosynthesis, NADP, oxidoreductase, proline biosy; HET: NAD; 1.95A {Homo sapiens} PDB: 2ger_A 2gr9_A* 2gra_A*	Back alignment and structure

>3pqe_A L-LDH, L-lactate dehydrogenase; FBP, oxidoreductase; 2.20A {Bacillus subtilis} PDB: 3pqf_A* 3pqd_A*	Back alignment and structure

>3dtt_A NADP oxidoreductase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: NAP; 1.70A {Arthrobacter SP}	Back alignment and structure

>4huj_A Uncharacterized protein; PSI-biology, nysgrc, structural genomics, NEW YORK structura genomics research consortium, dinucleotide-binding; 1.77A {Sinorhizobium meliloti}	Back alignment and structure

>1a5z_A L-lactate dehydrogenase; oxidoreductase, glycolysis, hyperthermophiles, thermotoga MA protein stability; HET: FBP NAD; 2.10A {Thermotoga maritima} SCOP: c.2.1.5 d.162.1.1	Back alignment and structure

>1lu9_A Methylene tetrahydromethanopterin dehydrogenase; alpha/beta twisted open sheet structure, oxidoreductase; 1.90A {Methylobacterium extorquens} SCOP: c.2.1.7 c.58.1.4 PDB: 1lua_A*	Back alignment and structure

>3h9u_A Adenosylhomocysteinase; NAD CO-factor complex, structural genomics, SGC stockholm, S genomics consortium, SGC, hydrolase, NAD; HET: NAD ADN PG4; 1.90A {Trypanosoma brucei} PDB: 3g1u_A* 1b3r_A* 1k0u_A* 1ky4_A* 2h5l_A* 1xwf_A* 1d4f_A* 1ky5_A* 3nj4_A* 1li4_A* 1a7a_A*	Back alignment and structure

>2pgd_A 6-phosphogluconate dehydrogenase; oxidoreductase (CHOH(D)-NADP+(A)); 2.00A {Ovis aries} SCOP: a.100.1.1 c.2.1.6 PDB: 1pgo_A* 1pgp_A* 1pgq_A* 1pgn_A 2jkv_A*	Back alignment and structure

>3kto_A Response regulator receiver protein; PSI-II,structural genomics, protein structure initiative; 1.98A {Pseudoalteromonas atlantica T6C} SCOP: c.23.1.0	Back alignment and structure

>3i83_A 2-dehydropantoate 2-reductase; structural genomics, oxidoreductase, NADP, pantothenate BIOS PSI-2, protein structure initiative; 1.90A {Methylococcus capsulatus}	Back alignment and structure

>3k96_A Glycerol-3-phosphate dehydrogenase [NAD(P)+]; GPSA, IDP01976, oxidoreductase, phospholipid biosynthesis; HET: EPE; 2.10A {Coxiella burnetii}	Back alignment and structure

>3ko8_A NAD-dependent epimerase/dehydratase; isomerase, UDP-galactose 4-epimerase; HET: NAD; 1.80A {Pyrobaculum calidifontis} SCOP: c.2.1.0 PDB: 3icp_A* 3aw9_A*	Back alignment and structure

>2gn4_A FLAA1 protein, UDP-GLCNAC C6 dehydratase; rossmann fold, TYK triad, SDR, enzyme, NADP, NADPH, lyase; HET: NDP UD1 MES; 1.90A {Helicobacter pylori} PDB: 2gn6_A* 2gn8_A* 2gn9_A* 2gna_A*	Back alignment and structure

>4e12_A Diketoreductase; oxidoreductase, NADH; HET: 1PE; 1.93A {Acinetobacter baylyi} PDB: 4dyd_A* 4e13_A*	Back alignment and structure

>1tmy_A CHEY protein, TMY; chemotaxis, phosphoryl transfer, signal transduction; 1.90A {Thermotoga maritima} SCOP: c.23.1.1 PDB: 2tmy_A 3tmy_A 4tmy_A 1u0s_Y	Back alignment and structure

>3f6c_A Positive transcription regulator EVGA; structural genomics, PSI-2, protein structure initiative, PO transcription regulator EVGA; 1.45A {Escherichia coli k-12}	Back alignment and structure

>2iz1_A 6-phosphogluconate dehydrogenase, decarboxylating; pentose shunt, oxidoreductase, gluconate utilization; HET: ATR RES P33; 2.30A {Lactococcus lactis} PDB: 2iz0_A* 2iyp_A* 2iyo_A*	Back alignment and structure

>1sb8_A WBPP; epimerase, 4-epimerase, UDP-galnac, UDP-GLCNAC, SDR, G SYK, UDP, N-acetylglucosamine, N- acetylgalactosamine, UDP-GLC, isomerase; HET: NAD UD2; 2.10A {Pseudomonas aeruginosa} SCOP: c.2.1.2 PDB: 1sb9_A*	Back alignment and structure

>3ghy_A Ketopantoate reductase protein; oxidoreductase, NAD-binding domain, PSI-2, NYSGXRC, structur genomics, protein structure initiative; 2.00A {Ralstonia solanacearum}	Back alignment and structure

>3kht_A Response regulator; PSI-II, 11023K, structural genomics, Pro structure initiative, NEW YORK SGX research center for STRU genomics, nysgxrc; 2.10A {Hahella chejuensis} SCOP: c.23.1.0	Back alignment and structure

>3d64_A Adenosylhomocysteinase; structural genomics, ssgcid, S-adenosyl-L-homocysteine hydro NAD, one-carbon metabolism; HET: NAD; 2.30A {Burkholderia pseudomallei} PDB: 3glq_A*	Back alignment and structure

>2raf_A Putative dinucleotide-binding oxidoreductase; NP_786167.1, NADP oxidoreductase coenzyme F420-dependent, structural genomics; HET: MSE NAP; 1.60A {Lactobacillus plantarum WCFS1}	Back alignment and structure

>1pgj_A 6PGDH, 6-PGDH, 6-phosphogluconate dehydrogenase; oxidoreductase, CHOH(D)-NADP+(B); 2.82A {Trypanosoma brucei} SCOP: a.100.1.1 c.2.1.6	Back alignment and structure

>3u59_A Tropomyosin beta chain; muscle contraction, actin, contractIle protein; 2.50A {Gallus gallus}	Back alignment and structure

>1z82_A Glycerol-3-phosphate dehydrogenase; TM0378, structural genom joint center for structural genomics, JCSG, protein structu initiative, PSI; HET: MSE NDP G3H G3P; 2.00A {Thermotoga maritima}	Back alignment and structure

>2ehd_A Oxidoreductase, oxidoreductase, short-chain dehydrogenase/reducta; rossman fold, structural genomics, NPPSFA; 2.40A {Thermus thermophilus}	Back alignment and structure

>3o38_A Short chain dehydrogenase; tuberculosis, ortholog from A non-pathogenic dehydrogenase, structural genomics; 1.95A {Mycobacterium smegmatis}	Back alignment and structure

>2o3j_A UDP-glucose 6-dehydrogenase; structural genomics, PSI-2, prote structure initiative, NEW YORK SGX research center for STRU genomics; 1.88A {Caenorhabditis elegans}	Back alignment and structure

>2g76_A 3-PGDH, D-3-phosphoglycerate dehydrogenase; oxidoreductase, phosphoglycerate dehydrogenase deficiency, S metabolism, 2-hydroxyacid dehydrogenases; HET: NAD; 1.70A {Homo sapiens}	Back alignment and structure

>1v8b_A Adenosylhomocysteinase; hydrolase; HET: NAD ADN; 2.40A {Plasmodium falciparum} SCOP: c.2.1.4 c.23.12.3	Back alignment and structure

>4e7p_A Response regulator; DNA binding, cytosol, transcription regulator; 1.89A {Streptococcus pneumoniae} PDB: 4e7o_A	Back alignment and structure

>3f9i_A 3-oxoacyl-[acyl-carrier-protein] reductase; 3-ketoacyl-(acyl-carrier-protein) reductase, FAT biosynthesis, lipid synthesis, NADP; 2.25A {Rickettsia prowazekii} SCOP: c.2.1.0	Back alignment and structure

>2pzm_A Putative nucleotide sugar epimerase/ dehydratase; rossman fold, protein-NAD complex, protein-nucleotide comple binding protein; HET: NAD UDP; 2.00A {Bordetella bronchiseptica} PDB: 2pzl_A* 2pzk_A*	Back alignment and structure

>4e4t_A Phosphoribosylaminoimidazole carboxylase, ATPase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; 1.55A {Burkholderia ambifaria} PDB: 3uvz_A	Back alignment and structure

>3cnb_A DNA-binding response regulator, MERR family; signal receiver domain, DNA binding protein, protein structu initiative, PSI-2; 2.00A {Colwellia psychrerythraea}	Back alignment and structure

>3slg_A PBGP3 protein; structural genomics, seattle structural genomics center for infectious disease, ssgcid, melioidosis, glanders; 2.10A {Burkholderia pseudomallei}	Back alignment and structure

>1orr_A CDP-tyvelose-2-epimerase; rossmann fold, short-chain dehydrogenase/reductase, isomeras; HET: NAD CDP; 1.50A {Salmonella typhi} SCOP: c.2.1.2	Back alignment and structure

>3gt7_A Sensor protein; structural genomics, signal receiver domain, kinase, PSI-2, protein structure initiative; 2.30A {Syntrophus aciditrophicus SB}	Back alignment and structure

>4ffl_A PYLC; amino acid, biosynthesis of pyrrolysine, isopeptide bond for ATP-grAsp fold, ligase, ATP-binding, L-lysine and 3R-methyl ornithine; HET: LYS ADP ATP; 1.50A {Methanosarcina barkeri} PDB: 4ffm_A* 4ffn_A* 4ffo_A* 4ffp_A* 4ffr_A*	Back alignment and structure

>2ag5_A DHRS6, dehydrogenase/reductase (SDR family) member 6; protein-CO-factor complex, structural genomics, structural G consortium, SGC, oxidoreductase; HET: NAD; 1.84A {Homo sapiens} SCOP: c.2.1.2	Back alignment and structure

>3gvp_A Adenosylhomocysteinase 3; protein CO-factor complex, hydrolase, NAD, one-carbon metabolism, phosphoprotein; HET: NAD; 2.25A {Homo sapiens} PDB: 3mtg_A*	Back alignment and structure

>1jay_A Coenzyme F420H2:NADP+ oxidoreductase (FNO); rossman fold, structural genomics; HET: NAP F42; 1.65A {Archaeoglobus fulgidus} SCOP: c.2.1.6 PDB: 1jax_A*	Back alignment and structure

>2rjn_A Response regulator receiver:metal-dependent phosphohydrolase, HD subdomain; structural genomics, oceanospirillum SP. MED92; 2.10A {Neptuniibacter caesariensis}	Back alignment and structure

>3ged_A Short-chain dehydrogenase/reductase SDR; SCOR, rossmann fold, oxidoreductase; 1.70A {Clostridium thermocellum atcc 27405} PDB: 3geg_A*	Back alignment and structure

>2qv0_A Protein MRKE; structural genomics, transcription, PSI-2, protein structure initiative; 2.40A {Klebsiella pneumoniae}	Back alignment and structure

>3q2o_A Phosphoribosylaminoimidazole carboxylase, ATPase; carboxylates, ATP binding, lyase; 1.96A {Bacillus anthracis} PDB: 3qff_A* 3r5h_A*	Back alignment and structure

>2pk3_A GDP-6-deoxy-D-LYXO-4-hexulose reductase; SDR, short-chain dehydrogenase/reductase, rossmann fold, oxidoreductase; HET: A2R GDD; 1.82A {Aneurinibacillus thermoaerophilus}	Back alignment and structure

>3hdg_A Uncharacterized protein; two-component sensor activity, response regulator, PSI-II, 11227F, NYSGXRC, structural genomics; 2.27A {Wolinella succinogenes} SCOP: c.23.1.0	Back alignment and structure

>3jte_A Response regulator receiver protein; structural genomics, nysgrc, response regulator receiver DOM target 11226E, PSI-2; 1.90A {Clostridium thermocellum atcc 27405}	Back alignment and structure

>1zej_A HBD-9, 3-hydroxyacyl-COA dehydrogenase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI; HET: PE8; 2.00A {Archaeoglobus fulgidus}	Back alignment and structure

>3eag_A UDP-N-acetylmuramate:L-alanyl-gamma-D-glutamyl-ME diaminopimelate ligase; UDP-N-acetylmuramate:L-alanyl-G glutamyl-MESO-diaminopimelate ligase; 2.55A {Neisseria meningitidis MC58}	Back alignment and structure

>4dio_A NAD(P) transhydrogenase subunit alpha PART 1; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.60A {Sinorhizobium meliloti}	Back alignment and structure

>3lk7_A UDP-N-acetylmuramoylalanine--D-glutamate ligase; agalacitae, PSI, MCSG, structural genomics, midwest center for structural genomics; HET: MSE; 1.50A {Streptococcus agalactiae}	Back alignment and structure

>1dbw_A Transcriptional regulatory protein FIXJ; doubly wound five-stranded beta/alpha fold, nitrogen fixatio regulation; HET: 15P; 1.60A {Sinorhizobium meliloti} SCOP: c.23.1.1 PDB: 1dck_A* 1dcm_A 1d5w_A*	Back alignment and structure

>3p19_A BFPVVD8, putative blue fluorescent protein; rossmann-fold, oxidoreductase; HET: NAP; 2.05A {Vibrio vulnificus}	Back alignment and structure

>2c20_A UDP-glucose 4-epimerase; carbohydrate metabolism, galactose metabolism, isomerase, NAD, spine; HET: NAD; 2.7A {Bacillus anthracis}	Back alignment and structure

>2vhw_A Alanine dehydrogenase; NAD, secreted, oxidoreductase; HET: NAI; 2.0A {Mycobacterium tuberculosis} PDB: 2vhx_A* 2vhy_A 2vhz_A* 2vhv_A* 2voe_A 2voj_A*	Back alignment and structure

>2qr3_A Two-component system response regulator; structural genomics, signal receiver, PSI-2, protein structu initiative; 1.80A {Bacteroides fragilis}	Back alignment and structure

>1oc2_A DTDP-glucose 4,6-dehydratase; lyase, NADH, rhamnose; HET: TDX NAD; 1.5A {Streptococcus suis} SCOP: c.2.1.2 PDB: 1ker_A* 1ket_A* 1kep_A*	Back alignment and structure

>1uls_A Putative 3-oxoacyl-acyl carrier protein reductase; structural genomics, riken structural genomics/proteomics initiative, RSGI; 2.40A {Thermus thermophilus} SCOP: c.2.1.2	Back alignment and structure

>1qkk_A DCTD, C4-dicarboxylate transport transcriptional regulatory protein; receiver domain, 2-component signal transduction; 1.7A {Sinorhizobium meliloti} SCOP: c.23.1.1 PDB: 1l5z_A 1l5y_A	Back alignment and structure

>2yy7_A L-threonine dehydrogenase; thermolabIle, flavobacterium FRIG KUC-1, oxidoreductase; HET: PE8 NAD MES; 2.06A {Flavobacterium frigidimaris}	Back alignment and structure

>3u1c_A Tropomyosin alpha-1 chain; anti-parallel coiled coil, contractIle protein; 1.80A {Gallus gallus} PDB: 3u1a_A	Back alignment and structure

>3p7m_A Malate dehydrogenase; putative dehydrogenase, enzyme, structural genomics, center structural genomics of infectious diseases, csgid; 2.20A {Francisella tularensis}	Back alignment and structure

>2rh8_A Anthocyanidin reductase; flavonoids, rossmann fold, short chain dehydrogenase/reductase, oxidoreductase; 2.22A {Vitis vinifera} PDB: 3hfs_A	Back alignment and structure

>3vku_A L-LDH, L-lactate dehydrogenase; rossmann fold, NADH binding, oxidoreductase; 1.96A {Lactobacillus casei} PDB: 2zqz_A 2zqy_A 3vkv_A* 1llc_A*	Back alignment and structure

>2rcy_A Pyrroline carboxylate reductase; malaria, structural genomics, pyrroline reductase, oxidoredu structural genomics consortium, SGC; HET: NAP; 2.30A {Plasmodium falciparum}	Back alignment and structure

>1ek6_A UDP-galactose 4-epimerase; short-chain dehydrogenase, galactosemia, isomerase; HET: NAI UPG; 1.50A {Homo sapiens} SCOP: c.2.1.2 PDB: 1ek5_A* 1hzj_A* 1i3k_A* 1i3l_A* 1i3m_A* 1i3n_A*	Back alignment and structure

>2j48_A Two-component sensor kinase; pseudo-receiver, circadian clock, transferase, response regulator, histidine protein kinase; NMR {Synechococcus elongatus}	Back alignment and structure

>2q1s_A Putative nucleotide sugar epimerase/ dehydratase; rossman fold, protein-NADH complex, sugar binding protein; HET: NAI; 1.50A {Bordetella bronchiseptica} PDB: 2pzj_A* 2q1t_A* 2q1u_A*	Back alignment and structure

>2nwq_A Probable short-chain dehydrogenase; oxidoreductase; 2.30A {Pseudomonas aeruginosa}	Back alignment and structure

>3mt5_A Potassium large conductance calcium-activated CHA subfamily M, alpha member 1; potassium channel, membrane protein, transport protein; 3.00A {Homo sapiens} PDB: 3u6n_A	Back alignment and structure

>2d5c_A AROE, shikimate 5-dehydrogenase; substrate, dimer, structural genomics, NPPSFA, Na project on protein structural and functional analyses; HET: SKM; 1.65A {Thermus thermophilus} PDB: 1wxd_A* 2cy0_A* 2ev9_A*	Back alignment and structure

>3zux_A Transporter, ASBTNM; transport protein, membrane protein; HET: TCH LDA PTY; 2.20A {Neisseria meningitidis} PDB: 3zuy_A*	Back alignment and structure

>2gcg_A Glyoxylate reductase/hydroxypyruvate reductase; NAD(P) rossmann fold, formate/glycerate dehydrogenase substr binding domain, oxidoreductase; HET: NDP; 2.20A {Homo sapiens} PDB: 2wwr_A 2h1s_A 2q50_A	Back alignment and structure

>2c29_D Dihydroflavonol 4-reductase; flavonoids, short dehydrogenase reductase, NADPH, dihydroquercetin, rossmann fold, oxidoreductase; HET: NAP DQH; 1.81A {Vitis vinifera} PDB: 2iod_A* 2nnl_D* 3bxx_A* 3c1t_A*	Back alignment and structure

>1f0y_A HCDH, L-3-hydroxyacyl-COA dehydrogenase; abortive ternary complex, oxidoreductase; HET: CAA NAD; 1.80A {Homo sapiens} SCOP: a.100.1.3 c.2.1.6 PDB: 3rqs_A 1lsj_A* 1il0_A* 1lso_A* 1m76_A* 1m75_A* 1f14_A 1f12_A 1f17_A* 3had_A* 2hdh_A* 3hdh_A*	Back alignment and structure

>2v6g_A Progesterone 5-beta-reductase; tyrosine-dependent oxidoreductase, oxidoreductase, SDR, cardenolides, cardiac glycosides; HET: NAP; 2.3A {Digitalis lanata} PDB: 2v6f_A*	Back alignment and structure

>3lua_A Response regulator receiver protein; two-component signal transduction system, histidine kinase, phosphorelay, receiver domain, nysgxrc; 2.40A {Clostridium thermocellum}	Back alignment and structure

>1fmc_A 7 alpha-hydroxysteroid dehydrogenase; short-chain dehydrogenase/reductase, bIle acid catabolism, oxidoreductase; HET: CHO NAD; 1.80A {Escherichia coli} SCOP: c.2.1.2 PDB: 1ahi_A* 1ahh_A*	Back alignment and structure

>2v6b_A L-LDH, L-lactate dehydrogenase; oxidoreductase, radioresistance, NAD, cytoplasm, mesophilic, glycolysis; 2.50A {Deinococcus radiodurans}	Back alignment and structure

>2bll_A Protein YFBG; decarboxylase, short chain dehydrogenase, L-ARA4N biosynthes methyltransferase, transferase; 2.3A {Escherichia coli} SCOP: c.2.1.2 PDB: 1u9j_A 1z73_A 1z75_A 1z7b_A 1z74_A	Back alignment and structure

>3hdv_A Response regulator; PSI-II, structural genomics, Pro structure initiative, NEW YORK SGX research center for STRU genomics, nysgxrc; 2.09A {Pseudomonas putida} SCOP: c.23.1.0	Back alignment and structure

>1l7d_A Nicotinamide nucleotide transhydrogenase, subunit alpha 1; transhydrogenase domain I, oxidoreductase; 1.81A {Rhodospirillum rubrum} SCOP: c.2.1.4 c.23.12.2 PDB: 1hzz_A* 1f8g_A 1l7e_A* 1u28_A* 1u2d_A* 1u2g_A* 1xlt_A* 2oo5_A* 2oor_A* 2frd_A* 2fsv_A* 1nm5_A* 2fr8_A* 1ptj_A*	Back alignment and structure

>3rft_A Uronate dehydrogenase; apoenzyme, rossmann fold, NAD binding, oxidoreductase; 1.90A {Agrobacterium tumefaciens} PDB: 3rfv_A* 3rfx_A*	Back alignment and structure

>3ak4_A NADH-dependent quinuclidinone reductase; SDR, (R)-3-quinuclidinol, chiral alcohol, oxidoreductase; HET: NAD; 2.00A {Agrobacterium tumefaciens}	Back alignment and structure

>2ekl_A D-3-phosphoglycerate dehydrogenase; structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: NAD; 1.77A {Sulfolobus tokodaii}	Back alignment and structure

>3vtf_A UDP-glucose 6-dehydrogenase; two discrete alpha/beta domains, oxidoreducta; HET: UPG; 2.00A {Pyrobaculum islandicum}	Back alignment and structure

>3ek2_A Enoyl-(acyl-carrier-protein) reductase (NADH); ssgcid, oxidoreductase, structural genomics; 1.90A {Burkholderia pseudomallei 1710B} SCOP: c.2.1.2	Back alignment and structure

>3gvi_A Malate dehydrogenase; NAD, oxidoreductase, tricarboxylic acid cycle, structural genomics; HET: ADP; 2.25A {Brucella melitensis biovar ABORTUS2308} PDB: 3gvh_A*	Back alignment and structure

>3crn_A Response regulator receiver domain protein, CHEY-; structural genomics, signal regulator receiver domain; HET: PHD; 1.58A {Methanospirillum hungatei jf-1}	Back alignment and structure

>2q1w_A Putative nucleotide sugar epimerase/ dehydratase; rossman fold, protein-NAD complex, sugar binding protein; HET: NAD; 2.19A {Bordetella bronchiseptica}	Back alignment and structure

>1zcj_A Peroxisomal bifunctional enzyme; peroxisomal multifunctional enzyme type 1, L-bifunction enzyme, MFE-1, fatty acid beta oxidation; 1.90A {Rattus norvegicus}	Back alignment and structure

>3enk_A UDP-glucose 4-epimerase; seattle structural genomics center for infectious disease, ssgcid, isomerase, NAD; HET: NAD GUD; 1.90A {Burkholderia pseudomallei 1710B} SCOP: c.2.1.0	Back alignment and structure

>1smk_A Malate dehydrogenase, glyoxysomal; tricarboxylic cycle, glyoxysome, NAD, glyoxylate bypass, oxidoreductase; HET: CIT; 2.50A {Citrullus lanatus} PDB: 1sev_A	Back alignment and structure

>2pv7_A T-protein [includes: chorismate mutase (EC 5.4.99 and prephenate dehydrogenase (EC...; 1574749, chorismate mutase type II; HET: MSE TYR NAD; 2.00A {Haemophilus influenzae} SCOP: a.100.1.12 c.2.1.6	Back alignment and structure

>3jtm_A Formate dehydrogenase, mitochondrial; mitochondrion, NAD, oxidoreductase, T peptide; 1.30A {Arabidopsis thaliana} PDB: 3n7u_A* 3naq_A	Back alignment and structure

>2w2k_A D-mandelate dehydrogenase; 2-hydroxyacid dehydrogenase, oxidoreductase; 1.85A {Rhodotorula graminis} PDB: 2w2l_A* 2w2l_D* 2w2k_B	Back alignment and structure

>3hv2_A Response regulator/HD domain protein; PSI-2, NYSGXRC, structural genomics, protein structure initiative; 1.50A {Pseudomonas fluorescens pf-5}	Back alignment and structure

>1rkx_A CDP-glucose-4,6-dehydratase; SDR, lyase; HET: NAD; 1.80A {Yersinia pseudotuberculosis} SCOP: c.2.1.2 PDB: 1wvg_A*	Back alignment and structure

>2p5y_A UDP-glucose 4-epimerase; TTHA0591, structural genomics, PSI; HET: NAD; 1.92A {Thermus thermophilus HB8} PDB: 2p5u_A*	Back alignment and structure

>3gem_A Short chain dehydrogenase; structural genomics, APC65077, oxidoreductase, PSI-2, protein structure initiative; 1.83A {Pseudomonas syringae PV}	Back alignment and structure

>2h7i_A Enoyl-[acyl-carrier-protein] reductase [NADH]; oxidoreductase, INHA, enoyl acyl carrier reductase, pyrrolid carboxamide; HET: NAD 566; 1.62A {Mycobacterium tuberculosis} SCOP: c.2.1.2 PDB: 1p44_A* 1p45_A* 2b35_A* 2b36_A* 2b37_A* 2aq8_A* 2h7l_A* 2h7m_A* 2h7n_A* 2h7p_A* 2nsd_A* 2pr2_A* 2x22_A* 2x23_A* 3fne_A* 3fnf_A* 3fng_A* 3fnh_A* 3oew_A* 2aqh_A* ...	Back alignment and structure

>2pd6_A Estradiol 17-beta-dehydrogenase 8; short-chain dehydrogenase/reductase, steroid metabolism, LIP metabolism, structural genomics; HET: NAD; 2.00A {Homo sapiens}	Back alignment and structure

>3cz5_A Two-component response regulator, LUXR family; structural genomics, protein structure initiative; 2.70A {Aurantimonas SP}	Back alignment and structure

>1x13_A NAD(P) transhydrogenase subunit alpha; NAD(H)-binding domain, rossmann fold, oxidoreductase; 1.90A {Escherichia coli} PDB: 1x14_A* 1x15_A* 2bru_A*	Back alignment and structure

>1xu9_A Corticosteroid 11-beta-dehydrogenase, isozyme 1; hydroxysteroid, SDR, oxidoreductase; HET: NDP CPS MES; 1.55A {Homo sapiens} SCOP: c.2.1.2 PDB: 1xu7_A* 3bzu_A* 3czr_A* 3d3e_A* 3d4n_A* 3fco_A* 3frj_A* 3h6k_A* 3hfg_A* 3oq1_A* 3qqp_A* 3pdj_A* 3d5q_A* 2rbe_A* 3byz_A* 3ey4_A* 3tfq_A* 3ch6_A* 2irw_A* 2ilt_A* ...	Back alignment and structure

>3l6e_A Oxidoreductase, short-chain dehydrogenase/reducta; structural genomics, PSI-2, protein structure initiative; 2.30A {Aeromonas hydrophila subsp} SCOP: c.2.1.0	Back alignment and structure

>3kkj_A Amine oxidase, flavin-containing; oxidoreductase, PSR10, Q888A4, X-RAY, structure, PSI, protein structure initiative; HET: FAD; 2.50A {Pseudomonas syringae PV}	Back alignment and structure

>3e18_A Oxidoreductase; dehydrogenase, NAD-binding, structural genom protein structure initiative, PSI, NEW YORK structural GENO research consortium; HET: NAD; 1.95A {Listeria innocua}	Back alignment and structure

>3eul_A Possible nitrate/nitrite response transcriptional regulatory protein NARL (DNA-binding...; central beta strand flanked by alpha helices; 1.90A {Mycobacterium tuberculosis}	Back alignment and structure

>1n7h_A GDP-D-mannose-4,6-dehydratase; rossmann fold, SDR, short-chain dehydrogenase/reductase, LYA; HET: NDP GDP; 1.80A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 1n7g_A*	Back alignment and structure

>3pid_A UDP-glucose 6-dehydrogenase; rossmann fold, oxidoreductase; 1.40A {Klebsiella pneumoniae} PDB: 3pln_A* 3pjg_A* 3phl_A* 3plr_A*	Back alignment and structure

>1yo6_A Putative carbonyl reductase sniffer; tyrosine-dependent oxidoreductase (SDR family), structural genomics, PSI; 2.60A {Caenorhabditis elegans} SCOP: c.2.1.2	Back alignment and structure

>3njr_A Precorrin-6Y methylase; methyltransferase, decarboxylase, transferase; HET: SAH PG4; 2.70A {Rhodobacter capsulatus}	Back alignment and structure

>4e5n_A Thermostable phosphite dehydrogenase; D-2-hydroxyacid dehydrogenase, oxidoreductase; HET: NAD; 1.70A {Pseudomonas stutzeri} PDB: 4e5k_A* 4ebf_A* 4e5p_A* 4e5m_A*	Back alignment and structure

>2pln_A HP1043, response regulator; signaling protein; 1.80A {Helicobacter pylori} PDB: 2hqo_A	Back alignment and structure

>1qsg_A Enoyl-[acyl-carrier-protein] reductase; enoyl reductase, oxidoreductase; HET: GLC NAD TCL; 1.75A {Escherichia coli} SCOP: c.2.1.2 PDB: 1c14_A* 1i2z_A* 1i30_A* 1lx6_A* 1lxc_A* 1mfp_A* 2fhs_A 1qg6_A* 1dfg_A* 1dfh_A* 1d8a_A* 1dfi_A* 3pje_A* 3pjd_A* 3pjf_A*	Back alignment and structure

>2pd4_A Enoyl-[acyl-carrier-protein] reductase [NADH]; antibacterial target, type II fatty acid biosynthesis, enoyl-ACP-reductase, FABI; HET: NAD DCN; 2.30A {Helicobacter pylori} SCOP: c.2.1.2 PDB: 2pd3_A*	Back alignment and structure

>2q3e_A UDP-glucose 6-dehydrogenase; hexamer, structural genomics, S genomics consortium, SGC, oxidoreductase; HET: NAD UPG; 2.00A {Homo sapiens} PDB: 2qg4_A* 3khu_A* 3itk_A* 3tdk_A* 3ptz_A* 3prj_A* 3tf5_A	Back alignment and structure

>1evy_A Glycerol-3-phosphate dehydrogenase; rossmann fold, oxidoreductase; HET: MYS; 1.75A {Leishmania mexicana} SCOP: a.100.1.6 c.2.1.6 PDB: 1evz_A* 1jdj_A* 1m66_A* 1m67_A* 1n1e_A* 1n1g_A*	Back alignment and structure

>1guz_A Malate dehydrogenase; oxidoreductase, tricarboxylic acid cycle, NAD; HET: NAD; 2.0A {Chlorobium vibrioforme} SCOP: c.2.1.5 d.162.1.1 PDB: 1gv1_A 1gv0_A*	Back alignment and structure

>4a7p_A UDP-glucose dehydrogenase; oxidoreductase, carbohydrate synthesis, exopolysaccharide; HET: NAD; 3.40A {Sphingomonas elodea}	Back alignment and structure

>1zk4_A R-specific alcohol dehydrogenase; short chain reductases/dehydrogenases, magnesium dependence, oxidoreductase; HET: NAP; 1.00A {Lactobacillus brevis} SCOP: c.2.1.2 PDB: 1nxq_A* 1zjy_A* 1zjz_A* 1zk0_A* 1zk1_A* 1zk2_A 1zk3_A	Back alignment and structure

>1y7t_A Malate dehydrogenase; NAD-dependent-MDH-NADPH complex, oxidoreductase; HET: NDP; 1.65A {Thermus thermophilus} SCOP: c.2.1.5 d.162.1.1 PDB: 1iz9_A* 2cvq_A* 1bmd_A* 1bdm_A* 1wze_A* 1wzi_A*	Back alignment and structure

>3ay3_A NAD-dependent epimerase/dehydratase; glucuronic acid dehydrogeanse, oxidoreductase; 2.10A {Chromohalobacter salexigens}	Back alignment and structure

>4dad_A Putative pilus assembly-related protein; response regulator receiver domain, CHEY-related protein, ST genomics; 2.50A {Burkholderia pseudomallei} PDB: 4dn6_A	Back alignment and structure

>2a35_A Hypothetical protein PA4017; alpha-beta-alpha sandwich, structura genomics, PSI, protein structure initiative; 1.50A {Pseudomonas aeruginosa} SCOP: c.2.1.2	Back alignment and structure

>3oz2_A Digeranylgeranylglycerophospholipid reductase; structural genomics, joint center for structural genomics; HET: MSE FAD OZ2; 1.60A {Thermoplasma acidophilum}	Back alignment and structure

>3asu_A Short-chain dehydrogenase/reductase SDR; SDR family, rossmann-fold, short-chain dehydrogenase/reducta ALLO-threonine dehydrogenase; 1.90A {Escherichia coli} PDB: 3asv_A*	Back alignment and structure

>3pp8_A Glyoxylate/hydroxypyruvate reductase A; structural genomics, center for structural genomics of infec diseases, csgid; 2.10A {Salmonella enterica subsp} PDB: 3kbo_A	Back alignment and structure

>3gl9_A Response regulator; beta-sheet, surrounded by alpha helices, BOTH sides, signaling protein; HET: BFD; 1.80A {Thermotoga maritima} SCOP: c.23.1.0 PDB: 3dgf_C 3dge_C	Back alignment and structure

>2p91_A Enoyl-[acyl-carrier-protein] reductase [NADH]; NADH-dependent enoyl-ACP reductase, FABI, aquifex A VF5, structural genomics, PSI; 2.00A {Aquifex aeolicus}	Back alignment and structure

>1eq2_A ADP-L-glycero-D-mannoheptose 6-epimerase; N-terminal domain rossmann fold, C-terminal mixed alpha/beta domain; HET: NAP ADQ; 2.00A {Escherichia coli} SCOP: c.2.1.2	Back alignment and structure

>4g2n_A D-isomer specific 2-hydroxyacid dehydrogenase, Na; structural genomics, protein structure initiative, nysgrc, P biology; 1.70A {Polaromonas SP}	Back alignment and structure

>2wyu_A Enoyl-[acyl carrier protein] reductase; oxidoreductase, fatty acid biosynthesis, oxidation reduction; 1.50A {Thermus thermophilus} PDB: 1ulu_A 2wyv_A* 2wyw_A* 2yw9_A*	Back alignment and structure

>2dbq_A Glyoxylate reductase; D-3-phosphoglycerate dehydrogenase, ST genomics, NPPSFA; HET: NAP; 1.70A {Pyrococcus horikoshii} PDB: 2dbr_A* 2dbz_A*	Back alignment and structure

>2z1m_A GDP-D-mannose dehydratase; short-chain dehydrogenase/reductase, lyase, structural genom NPPSFA; HET: NDP GDP; 2.00A {Aquifex aeolicus} PDB: 2z95_A*	Back alignment and structure

>4b79_A PA4098, probable short-chain dehydrogenase; oxidoreductase, infectious disease, structure-based inhibito; HET: NAD; 1.98A {Pseudomonas aeruginosa PAO1}	Back alignment and structure

>3afn_B Carbonyl reductase; alpha/beta/alpha, rossmann-fold, oxidoreductase; HET: NAP; 1.63A {Sphingomonas SP} PDB: 3afm_A*	Back alignment and structure

>3nep_X Malate dehydrogenase; halophIle, molecular adpatation, NAD, oxidoreductase, tricarboxylic acid cycle; 1.55A {Salinibacter ruber}	Back alignment and structure

>1hdc_A 3-alpha, 20 beta-hydroxysteroid dehydrogenase; oxidoreductase; HET: CBO; 2.20A {Streptomyces exfoliatus} SCOP: c.2.1.2 PDB: 2hsd_A*	Back alignment and structure

>2bgk_A Rhizome secoisolariciresinol dehydrogenase; oxidoreductase; 1.6A {Podophyllum peltatum} SCOP: c.2.1.2 PDB: 2bgl_A* 2bgm_A*	Back alignment and structure

>1pjc_A Protein (L-alanine dehydrogenase); oxidoreductase, NAD; HET: NAD; 2.00A {Phormidium lapideum} SCOP: c.2.1.4 c.23.12.2 PDB: 1pjb_A* 1say_A	Back alignment and structure

>3awd_A GOX2181, putative polyol dehydrogenase; oxidoreductase; 1.80A {Gluconobacter oxydans}	Back alignment and structure

>2z1n_A Dehydrogenase; reductase, SDR, oxidoreductase; 1.80A {Aeropyrum pernix}	Back alignment and structure

>1pzg_A LDH, lactate dehydrogenase; apicomplexa, APAD, tetramer, rossmann fold, oxidoreductase; HET: CME A3D; 1.60A {Toxoplasma gondii} SCOP: c.2.1.5 d.162.1.1 PDB: 1pzf_A* 1pze_A* 1pzh_A* 3om9_A* 1sov_A 1sow_A* 3czm_A*	Back alignment and structure

>3rqi_A Response regulator protein; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: PHD CIT; 1.70A {Burkholderia pseudomallei}	Back alignment and structure

>1pqw_A Polyketide synthase; rossmann fold, dimer, structural genomics, PSI, protein STRU initiative; 2.66A {Mycobacterium tuberculosis} SCOP: c.2.1.1	Back alignment and structure

>3h7a_A Short chain dehydrogenase; oxidoreductase, PSI-2, NYSGXRC, structural genomics, protein structure initiative; 1.87A {Rhodopseudomonas palustris}	Back alignment and structure

>3cu5_A Two component transcriptional regulator, ARAC FAM; structural genomics, protein structure initiative; 2.60A {Clostridium phytofermentans isdg}	Back alignment and structure

>3imf_A Short chain dehydrogenase; structural genomics, infectious D center for structural genomics of infectious diseases, oxidoreductase, csgid; HET: MSE; 1.99A {Bacillus anthracis str}	Back alignment and structure

>3l77_A Short-chain alcohol dehydrogenase; oxidoreductase; HET: NJP PG4; 1.60A {Thermococcus sibiricus} SCOP: c.2.1.0 PDB: 3tn7_A*	Back alignment and structure

>1p9l_A Dihydrodipicolinate reductase; oxidoreductase, lysine biosynthesis, NADH binding specificity, TB structural genomics consortium; HET: NAD PDC PG4; 2.30A {Mycobacterium tuberculosis} SCOP: c.2.1.3 d.81.1.3 PDB: 1c3v_A* 1yl5_A 1yl7_A* 1yl6_A*	Back alignment and structure

>1i24_A Sulfolipid biosynthesis protein SQD1; SDR, short-chain dehydrogenase/reductase, rossmann fold, BIO protein; HET: NAD UPG; 1.20A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 1i2c_A* 1i2b_A* 1qrr_A*	Back alignment and structure

>1hxh_A 3BETA/17BETA-hydroxysteroid dehydrogenase; alpha-beta, rossmann fold, short-chain dehydrogenase, oxidoreductase; 1.22A {Comamonas testosteroni} SCOP: c.2.1.2	Back alignment and structure

>3h5n_A MCCB protein; ubiquitin-activating enzyme, microcin, protein structure, MCCC7, peptide antibiotics, N-P bond formation, transferase; HET: ATP; 1.90A {Escherichia coli} PDB: 3h5r_A 3h9g_A 3h9j_A* 3h9q_A 3h5a_A	Back alignment and structure

>2wsb_A Galactitol dehydrogenase; oxidoreductase, SDR, rossmann fold, tagatose; HET: NAD; 1.25A {Rhodobacter sphaeroides} PDB: 2wdz_A* 3lqf_A*	Back alignment and structure

>1yio_A Response regulatory protein; transcription regulation, DNA binding protein; 2.20A {Pseudomonas fluorescens} SCOP: a.4.6.2 c.23.1.1 PDB: 1zn2_A	Back alignment and structure

>3ppi_A 3-hydroxyacyl-COA dehydrogenase type-2; ssgcid, dehydrogenas mycobacterium avium, structural genomics; 2.00A {Mycobacterium avium}	Back alignment and structure

>3ax6_A Phosphoribosylaminoimidazole carboxylase, ATPase; structural genomics, riken structural genomics/proteomics in RSGI, ATP grAsp, ATP binding; HET: ADP; 2.20A {Thermotoga maritima}	Back alignment and structure

>1xkq_A Short-chain reductase family member (5D234); parrallel beta-sheet of seven strands in the order 3214567; HET: NDP; 2.10A {Caenorhabditis elegans} SCOP: c.2.1.2	Back alignment and structure

>1srr_A SPO0F, sporulation response regulatory protein; aspartate pocket, two component system; 1.90A {Bacillus subtilis} SCOP: c.23.1.1 PDB: 1pey_A 3q15_C 2ftk_E* 1fsp_A 1nat_A 1pux_A 2fsp_A 2jvj_A 2jvk_A 2jvi_A 1f51_E	Back alignment and structure

>2j6i_A Formate dehydrogenase; oxidoreductase, D-specific-2- hydroxy acid dehydrogenase, cofactor regenerator, yeast, CBFDH; HET: PG4; 1.55A {Candida boidinii} PDB: 2fss_A	Back alignment and structure

>2cfc_A 2-(R)-hydroxypropyl-COM dehydrogenase; NAD, oxidoreductase; HET: NAD KPC; 1.8A {Xanthobacter autotrophicus}	Back alignment and structure

>1iy8_A Levodione reductase; oxidoreductase; HET: NAD; 1.60A {Leifsonia aquatica} SCOP: c.2.1.2	Back alignment and structure

>4e6p_A Probable sorbitol dehydrogenase (L-iditol 2-dehyd; NAD(P)-binding, structural genomics, PSI-biology; HET: MSE; 2.10A {Sinorhizobium meliloti} PDB: 1k2w_A	Back alignment and structure

>3nyw_A Putative oxidoreductase; fatty acid synthesis,3-oxoacyl-[ACP] reductase, NADP+ bindin rossman fold, PSI-II, nysgxrc; 2.16A {Bacteroides thetaiotaomicron}	Back alignment and structure

>2hjr_A Malate dehydrogenase; malaria, structural genomics, structural genomics consortium, SGC, oxidoreductase; HET: CIT APR; 2.20A {Cryptosporidium parvum}	Back alignment and structure

>1tlt_A Putative oxidoreductase (virulence factor MVIM HO; structural genomics, NYSGXRC, PSI, protein structure initiative; 2.70A {Escherichia coli} SCOP: c.2.1.3 d.81.1.5	Back alignment and structure

>3g79_A NDP-N-acetyl-D-galactosaminuronic acid dehydrogen; structural genomics, protein structure initiative; 2.40A {Methanosarcina mazei GO1}	Back alignment and structure

>3rd5_A Mypaa.01249.C; ssgcid, structural genomics, seattle structural genomics CEN infectious disease, oxidoreductase; HET: EPE; 1.50A {Mycobacterium paratuberculosis}	Back alignment and structure

>2pnf_A 3-oxoacyl-[acyl-carrier-protein] reductase; short chain oxidoreductase, rossmann fold, oxidoreductase; HET: 1PE MES; 1.80A {Aquifex aeolicus} PDB: 2p68_A*	Back alignment and structure

>3h1g_A Chemotaxis protein CHEY homolog; sulfate-bound CHEY, cytoplasm, flagellar rotatio magnesium, metal-binding, phosphoprotein; 1.70A {Helicobacter pylori} SCOP: c.23.1.1 PDB: 3gwg_A 3h1e_A 3h1f_A	Back alignment and structure

>2zqz_A L-LDH, L-lactate dehydrogenase; oxidoreductase, rossmann fold, cytoplasm, glycolysis, NAD, phosphoprotein; 2.50A {Lactobacillus casei} PDB: 2zqy_A 3vkv_A* 1llc_A*	Back alignment and structure

>3m1a_A Putative dehydrogenase; short, PSI, MCSG, structural genomics, midwest center for structural genomics, protein structure initiative; 2.00A {Streptomyces avermitilis}	Back alignment and structure

>3tnl_A Shikimate dehydrogenase; structural genomics, center for structural genomics of infec diseases, csgid; HET: NAD SKM; 1.45A {Listeria monocytogenes} PDB: 3toz_A*	Back alignment and structure

>1yqd_A Sinapyl alcohol dehydrogenase; lignin, monolignol, oxidoreductase, zinc-dependent, plant DE biosynthesis, substrate inhibition; HET: NAP; 1.65A {Populus tremuloides} PDB: 1yqx_A*	Back alignment and structure

>1ur5_A Malate dehydrogenase; oxidoreductase, tricarboxylic acid cycle; HET: NAD; 1.75A {Chloroflexus aurantiacus} SCOP: c.2.1.5 d.162.1.1 PDB: 1uxg_A* 1guy_A* 1uxk_A* 1uxh_A* 1uxj_A* 1uxi_A*	Back alignment and structure

>3ucx_A Short chain dehydrogenase; ssgcid, seattle structural genomics center for infectious DI dehydrogenase, oxidoreductase; HET: 1PE; 1.85A {Mycobacterium smegmatis} SCOP: c.2.1.0	Back alignment and structure

>4egb_A DTDP-glucose 4,6-dehydratase; rhamnose pathway, center for structural genomics of infectio diseases, csgid, niaid; HET: NAD SUC; 3.00A {Bacillus anthracis}	Back alignment and structure

>3ai3_A NADPH-sorbose reductase; rossmann-fold, NADPH-dependent reductase, short chain dehydrogenase/reductase, oxidoreductase; HET: NAP SOL SOE; 1.80A {Gluconobacter frateurii} PDB: 3ai2_A* 3ai1_A*	Back alignment and structure

>3qiv_A Short-chain dehydrogenase or 3-oxoacyl-[acyl-CARR protein] reductase; structural genomics; 2.25A {Mycobacterium avium subsp}	Back alignment and structure

>3a10_A Response regulator; phosphoacceptor, signaling protein; HET: MSE PG4; 1.63A {Thermotoga maritima} PDB: 3a0r_B* 3a0u_A*	Back alignment and structure

>1rpn_A GDP-mannose 4,6-dehydratase; short-chain dehydrogenase/reductase, rossmann fold, lyase; HET: NDP GDP; 2.15A {Pseudomonas aeruginosa} SCOP: c.2.1.2	Back alignment and structure

>3b2n_A Uncharacterized protein Q99UF4; structural genomics, PSI-2, protein structure initiative, NE SGX research center for structural genomics; 2.04A {Staphylococcus aureus}	Back alignment and structure

>4hv4_A UDP-N-acetylmuramate--L-alanine ligase; MURC, yersinia pestis peptidoglycan synthesis; HET: AMP; 2.25A {Yersinia pestis} PDB: 2f00_A	Back alignment and structure

>1yde_A Retinal dehydrogenase/reductase 3; oxidoreductase, structural genomics, structural genomics CON SGC; 2.40A {Homo sapiens} SCOP: c.2.1.2	Back alignment and structure

>3oig_A Enoyl-[acyl-carrier-protein] reductase [NADH]; fatty acid synthesis, rossmann-like fold, enoyl-ACP reductas binding; HET: NAD IMJ; 1.25A {Bacillus subtilis} SCOP: c.2.1.2 PDB: 3oif_A* 2qio_A* 3oje_A 3ojf_A*	Back alignment and structure

>3bio_A Oxidoreductase, GFO/IDH/MOCA family; structural genomics, MCSG, PSI-2, GFO/IDH/MO family, protein structure initiative; HET: MSE EPE; 1.80A {Porphyromonas gingivalis}	Back alignment and structure

>3cg0_A Response regulator receiver modulated diguanylate with PAS/PAC sensor; signal receiver domain, diguanylate cyclase; 2.15A {Desulfovibrio desulfuricans subsp}	Back alignment and structure

>2a4k_A 3-oxoacyl-[acyl carrier protein] reductase; reductase,hyperthermophIle, structural genomics, PSI, protei structure initiative; 2.30A {Thermus thermophilus} SCOP: c.2.1.2	Back alignment and structure

>1jbe_A Chemotaxis protein CHEY; signaling protein; 1.08A {Escherichia coli} SCOP: c.23.1.1 PDB: 3chy_A 1a0o_A 1cey_A 1bdj_A 1eay_A 1f4v_A 1ffg_A 1ffs_A 1ffw_A 1fqw_A 2b1j_A 1chn_A 1djm_A 1kmi_Y* 1d4z_A 3olx_A 3olw_A 1cye_A 2che_A 2chf_A ...	Back alignment and structure

>3grc_A Sensor protein, kinase; protein structure initiative II(PSI II), NYSGXRC, 11025B, structural genomics; 2.21A {Polaromonas SP}	Back alignment and structure

>4eso_A Putative oxidoreductase; NADP, structural genomics, PSI-biology, NEW structural genomics research consortium, nysgrc; HET: MSE NAP; 1.91A {Sinorhizobium meliloti} PDB: 3vc7_A	Back alignment and structure

>3rkr_A Short chain oxidoreductase; rossmann fold; HET: NAP; 2.42A {Uncultured bacterium BIO5}	Back alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST

Original result of RPS-BLAST against SCOP70(version1.75) database

ID	Alignment Graph	Length	Definition	E-value
Query		1158
d2fy8a1		129	c.2.1.9 (A:116-244) Potassium channel-related prot	4e-19
d1id1a_		153	c.2.1.9 (A:) Rck domain from putative potassium ch	2e-18
d2hmva1		134	c.2.1.9 (A:7-140) Ktn bsu222 {Bacillus subtilis [T	4e-16
d1lssa_		132	c.2.1.9 (A:) Ktn Mja218 {Archaeon Methanococcus ja	2e-13

>d2fy8a1 c.2.1.9 (A:116-244) Potassium channel-related protein MthK {Archaeon Methanothermobacter thermautotrophicus [TaxId: 145262]} Length = 129	Back information, alignment and structure


class: Alpha and beta proteins (a/b)
fold: NAD(P)-binding Rossmann-fold domains
superfamily: NAD(P)-binding Rossmann-fold domains
family: Potassium channel NAD-binding domain
domain: Potassium channel-related protein MthK
species: Archaeon Methanothermobacter thermautotrophicus [TaxId: 145262]

 Score = 82.2 bits (202), Expect = 4e-19
 Identities = 19/129 (14%), Positives = 42/129 (32%), Gaps = 2/129 (1%)

Query: 1011 HIILCGFGRVGQIIAQLLSERLIPFVALDVRSDRVAIGRALDLPVYFGDAGSREVLHKVG 1070
            H+++CG+        + L    +  +      +              GD      L K  
Sbjct: 2    HVVICGWSESTLECLRELRGSEVFVL--AEDENVRKKVLRSGANFVHGDPTRVSDLEKAN 59

Query: 1071 AERACAAAITLDTPGANYRTVWALSKYFPNVKTFVRAHDIDHGLNLEKAGATAVVPETLE 1130
               A A  + L++       +  + K   +V+    A   ++   L  AGA  V+   + 
Sbjct: 60   VRGARAVIVNLESDSETIHCILGIRKIDESVRIIAEAERYENIEQLRMAGADQVISPFVI 119

Query: 1131 PSLQLAAAV 1139
                ++ ++
Sbjct: 120  SGRLMSRSI 128

PyMOL of d2fy8a1

>d1id1a_ c.2.1.9 (A:) Rck domain from putative potassium channel Kch {Escherichia coli [TaxId: 562]} Length = 153	Back information, alignment and structure

>d2hmva1 c.2.1.9 (A:7-140) Ktn bsu222 {Bacillus subtilis [TaxId: 1423]} Length = 134	Back information, alignment and structure

>d1lssa_ c.2.1.9 (A:) Ktn Mja218 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Length = 132	Back information, alignment and structure

Homologous Domains Detected by HHsearch

Original result of HHsearch against SCOP70(version1.75) database

ID	Alignment Graph	Length	Definition	Probability
Query		1158
d1id1a_		153	Rck domain from putative potassium channel Kch {Es	99.86
d2hmva1		134	Ktn bsu222 {Bacillus subtilis [TaxId: 1423]}	99.85
d2fy8a1		129	Potassium channel-related protein MthK {Archaeon M	99.84
d1lssa_		132	Ktn Mja218 {Archaeon Methanococcus jannaschii [Tax	99.83
d1e5qa1		182	Saccharopine reductase {Rice blast fungus (Magnapo	97.15
d1hdoa_		205	Biliverdin IX beta reductase {Human (Homo sapiens)	96.87
d1bg6a2		184	N-(1-D-carboxylethyl)-L-norvaline dehydrogenase {A	96.69
d2f1ka2		165	Prephenate dehydrogenase TyrA {Synechocystis sp. p	96.36
d1pjqa1		113	Siroheme synthase CysG, domain 1 {Salmonella typhi	96.15
d1v8ba1		163	S-adenosylhomocystein hydrolase {Plasmodium falcip	95.33
d1vpda2		161	Hydroxyisobutyrate dehydrogenase {Salmonella typhi	95.32
d2pgda2		176	6-phosphogluconate dehydrogenase {Sheep (Ovis orie	95.11
d1li4a1		163	S-adenosylhomocystein hydrolase {Human (Homo sapie	94.87
d1kyqa1		150	Bifunctional dehydrogenase/ferrochelatase Met8p, N	94.79
d3cuma2		162	Hydroxyisobutyrate dehydrogenase {Pseudomonas aeru	94.78
d1mv8a2		202	GDP-mannose 6-dehydrogenase {Pseudomonas aeruginos	94.17
d1qyda_		312	Pinoresinol-lariciresinol reductase {Giant arborvi	94.02
d1kjqa2		111	Glycinamide ribonucleotide transformylase PurT, N-	93.77
d1pgja2		178	6-phosphogluconate dehydrogenase {Trypanosoma bruc	93.75
d1i36a2		152	Conserved hypothetical protein MTH1747 {Archaeon M	93.69
d2jfga1		93	UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase	93.53
d2g5ca2		171	Prephenate dehydrogenase TyrA {Aquifex aeolicus [T	93.44
d1u0sy_		118	CheY protein {Thermotoga maritima [TaxId: 2336]}	93.13
d1yqga2		152	Pyrroline-5-carboxylate reductase ProC {Neisseria	93.02
d1p3da1		96	UDP-N-acetylmuramate-alanine ligase MurC {Haemophi	92.54
d1c1da1		201	Phenylalanine dehydrogenase {Rhodococcus sp., M4 [	92.35
d1peya_		119	Sporulation response regulator Spo0F {Bacillus sub	92.16
d1ks9a2		167	Ketopantoate reductase PanE {Escherichia coli [Tax	92.13
d1e3ja2		170	Ketose reductase (sorbitol dehydrogenase) {Silverl	92.06
d1ez4a1		146	Lactate dehydrogenase {Lactobacillus pentosus [Tax	91.95
d1xgka_		350	Negative transcriptional regulator NmrA {Aspergill	91.92
d1qkka_		140	Transcriptional regulatory protein DctD, receiver	91.48
d2pv7a2		152	Prephenate dehydrogenase TyrA {Haemophilus influen	91.27
d2q46a1		252	Hypothetical protein At5g02240 (T7H20_290) {Thale	91.18
d1piwa2		168	Cinnamyl alcohol dehydrogenase, ADH6 {Baker's yeas	91.11
d1pl8a2		171	Ketose reductase (sorbitol dehydrogenase) {Human (	91.01
d1dbwa_		123	Transcriptional regulatory protein FixJ, receiver	90.99
d1qyca_		307	Phenylcoumaran benzylic ether reductase {Loblolly	90.66
d1luaa1		191	Methylene-tetrahydromethanopterin dehydrogenase {M	90.59
d1l7da1		183	Nicotinamide nucleotide transhydrogenase dI compon	90.16
d2ahra2		152	Pyrroline-5-carboxylate reductase ProC {Streptococ	89.67
d1i0za1		160	Lactate dehydrogenase {Human (Homo sapiens), heart	89.51
d1ebda2		117	Dihydrolipoamide dehydrogenase {Bacillus stearothe	89.19
d1pr9a_		244	Carbonyl reductase {Human (Homo sapiens) [TaxId: 9	89.01
d1j6ua1		89	UDP-N-acetylmuramate-alanine ligase MurC {Thermoto	89.01
d1cyda_		242	Carbonyl reductase {Mouse (Mus musculus) [TaxId: 1	88.78
d1xhca2		122	NADH oxidase /nitrite reductase {Pyrococcus furios	88.74
d1ulsa_		242	beta-keto acyl carrier protein reductase {Thermus	88.73
d1p0fa2		174	Alcohol dehydrogenase {Frog (Rana perezi) [TaxId:	88.71
d1yb1a_		244	17-beta-hydroxysteroid dehydrogenase type XI {Huma	88.7
d1uufa2		168	Hypothetical protein YahK {Escherichia coli [TaxId	88.53
d1a04a2		138	Nitrate/nitrite response regulator (NarL), receive	88.49
d1kgsa2		122	PhoB receiver domain {Thermotoga maritima [TaxId:	88.45
d1vj0a2		182	Hypothetical protein TM0436 {Thermotoga maritima [	88.37
d1p2fa2		120	Response regulator DrrB {Thermotoga maritima [TaxI	88.11
d1ps9a3		179	2,4-dienoyl-CoA reductase, middle domain {Escheric	88.05
d2pl1a1		119	PhoP receiver domain {Escherichia coli [TaxId: 562	88.05
d1zgza1		120	TorCAD operon transcriptional regulator TorD, N-te	87.95
d1mlda1		144	Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 982	87.84
d1dlja2		196	UDP-glucose dehydrogenase (UDPGDH) {Streptococcus	87.55
d1d1ta2		176	Alcohol dehydrogenase {Human (Homo sapiens), diffe	87.4
d1gpja2		159	Glutamyl tRNA-reductase middle domain {Archaeon Me	87.34
d1p6qa_		129	CheY protein {Sinorhizobium meliloti, CheY2 [TaxId	87.3
d1ldna1		148	Lactate dehydrogenase {Bacillus stearothermophilus	87.27
d1h6va2		122	Mammalian thioredoxin reductase {Rat (Rattus norve	86.91
d1llua2		166	Alcohol dehydrogenase {Pseudomonas aeruginosa [Tax	86.84
d2bgka1		268	Rhizome secoisolariciresinol dehydrogenase {Mayapp	86.78
d1krwa_		123	NTRC receiver domain {Salmonella typhimurium [TaxI	86.78
d1mvoa_		121	PhoP receiver domain {Bacillus subtilis [TaxId: 14	86.73
d1txga2		180	Glycerol-3- phosphate dehydrogenase {Archaeoglobus	86.69
d1v59a2		122	Dihydrolipoamide dehydrogenase {Baker's yeast (Sac	86.62
d2i76a2		153	Hypothetical protein TM1727 {Thermotoga maritima [	86.32
d1gesa2		116	Glutathione reductase {Escherichia coli [TaxId: 56	86.25
d1djqa3		233	Trimethylamine dehydrogenase, middle domain {Methy	86.19
d1y6ja1		142	Lactate dehydrogenase {Clostridium thermocellum [T	86.1
d1ny5a1		137	Transcriptional activator sigm54 (NtrC1), N-termin	86.0
d1xhfa1		121	Aerobic respiration control protein ArcA, N-termin	85.93
d2d1ya1		248	Hypothetical protein TTHA0369 {Thermus thermophilu	85.91
d1hyha1		146	L-2-hydroxyisocapronate dehydrogenase, L-HICDH {La	85.9
d1jbea_		128	CheY protein {Escherichia coli [TaxId: 562]}	85.6
d1jqba2		174	Bacterial secondary alcohol dehydrogenase {Clostri	85.43
d1ydea1		250	Retinal dehydrogenase/reductase 3 {Human (Homo sap	85.41
d1gega_		255	meso-2,3-butanediol dehydrogenase {Klebsiella pneu	85.18
d1e3ia2		174	Alcohol dehydrogenase {Mouse (Mus musculus), class	85.14
d1a9xa4		121	Carbamoyl phosphate synthetase (CPS), large subuni	85.09
d2a4ka1		241	beta-keto acyl carrier protein reductase {Thermus	85.05
d1f0ya2		192	Short chain L-3-hydroxyacyl CoA dehydrogenase {Hum	84.99
d1ys7a2		121	Transcriptional regulatory protein PrrA, N-termina	84.94
d2ldxa1		159	Lactate dehydrogenase {Mouse (Mus musculus) [TaxId	84.91
d1xg5a_		257	Putative dehydrogenase ARPG836 (MGC4172) {Human (H	84.7
d1udca_		338	Uridine diphosphogalactose-4-epimerase (UDP-galact	84.64
d1pjca1		168	L-alanine dehydrogenase {Phormidium lapideum [TaxI	84.33
d1q7ba_		243	beta-keto acyl carrier protein reductase {Escheric	84.2
d1zesa1		121	PhoB receiver domain {Escherichia coli [TaxId: 562	83.75
d1rkxa_		356	CDP-glucose-4,6-dehydratase {Yersinia pseudotuberc	83.66
d1hdca_		254	3-alpha,20-beta-hydroxysteroid dehydrogenase {Stre	83.65
d1pzga1		154	Lactate dehydrogenase {Toxoplasma gondii [TaxId: 5	83.59
d1zk4a1		251	R-specific alcohol dehydrogenase {Lactobacillus br	83.55
d1nffa_		244	Putative oxidoreductase Rv2002 {Mycobacterium tube	83.52
d1dxla2		123	Dihydrolipoamide dehydrogenase {Garden pea (Pisum	83.46
d1leha1		230	Leucine dehydrogenase {Bacillus sphaericus [TaxId:	83.4
d1w25a1		139	Response regulator PleD, receiver domain {Caulobac	82.89
d2ayxa1		133	Sensor kinase protein RcsC, C-terminal domain {Esc	82.86
d1hxha_		253	3beta/17beta hydroxysteroid dehydrogenase {Comamon	82.78
d1k0ia1		292	p-Hydroxybenzoate hydroxylase, PHBH {Pseudomonas a	82.56
d1qo0d_		189	Positive regulator of the amidase operon AmiR {Pse	82.55
d1uxja1		142	Malate dehydrogenase {Chloroflexus aurantiacus [Ta	82.51
d1bdba_		276	Cis-biphenyl-2,3-dihydrodiol-2,3-dehydrogenase {Ps	82.44
d1w6ua_		294	2,4-dienoyl-CoA reductase, mitochondrial (DECR) {H	82.29
d1ae1a_		258	Tropinone reductase {Jimsonweed (Datura stramonium	82.22
d1zema1		260	Xylitol dehydrogenase {Gluconobacter oxydans [TaxI	82.21
d2ae2a_		259	Tropinone reductase {Jimsonweed (Datura stramonium	82.11
d3grsa2		125	Glutathione reductase {Human (Homo sapiens) [TaxId	82.02
d1ek6a_		346	Uridine diphosphogalactose-4-epimerase (UDP-galact	82.0
d1rpna_		321	GDP-mannose 4,6-dehydratase {Pseudomonas aeruginos	81.99
d1k2wa_		256	Sorbitol dehydrogenase {Rhodobacter sphaeroides [T	81.87
d1rjwa2		168	Alcohol dehydrogenase {Bacillus stearothermophilus	81.86
d3lada2		119	Dihydrolipoamide dehydrogenase {Azotobacter vinela	81.84
d1wdka3		186	Fatty oxidation complex alpha subunit, middle doma	81.65
d1c0pa1		268	D-aminoacid oxidase, N-terminal domain {Rhodotorul	81.34
d1z45a2		347	Uridine diphosphogalactose-4-epimerase (UDP-galact	81.27
d1jaya_		212	Coenzyme F420H2:NADP+ oxidoreductase (FNO) {Archae	81.16
d1a9xa3		127	Carbamoyl phosphate synthetase (CPS), large subuni	81.04
d2voua1		265	Dihydroxypyridine hydroxylase DhpH {Arthrobacter n	80.84
d1a5za1		140	Lactate dehydrogenase {Thermotoga maritima [TaxId:	80.78
d1qp8a1		181	Putative formate dehydrogenase {Archaeon Pyrobacul	80.64
d1fmca_		255	7-alpha-hydroxysteroid dehydrogenase {Escherichia	80.63
d1yioa2		128	Response regulatory protein StyR, N-terminal domai	80.36
d2rhca1		257	beta-keto acyl carrier protein reductase {Streptom	80.35
d2ag5a1		245	Dehydrogenase/reductase SDR family member 6, DHRS6	80.29
d1xeaa1		167	Putative oxidoreductase VCA1048 {Vibrio cholerae [	80.26
d2blla1		342	Polymyxin resistance protein ArnA (PrmI) {Escheric	80.23
d2cvza2		156	Hydroxyisobutyrate dehydrogenase {Thermus thermoph	80.05

>d1id1a_ c.2.1.9 (A:) Rck domain from putative potassium channel Kch {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: NAD(P)-binding Rossmann-fold domains
superfamily: NAD(P)-binding Rossmann-fold domains
family: Potassium channel NAD-binding domain
domain: Rck domain from putative potassium channel Kch
species: Escherichia coli [TaxId: 562]

Probab=99.86  E-value=6.5e-22  Score=197.87  Aligned_cols=139  Identities=20%  Similarity=0.205  Sum_probs=130.0

Q ss_pred             ccccccccCCcccHHHHHHHHhhCCCCEEEEeCCchH----HHHhhhCCCCEEEccCCCHHHHHhcCccccCEEEEecCC
Q 001096         1008 LQDHIILCGFGRVGQIIAQLLSERLIPFVALDVRSDR----VAIGRALDLPVYFGDAGSREVLHKVGAERACAAAITLDT 1083 (1158)
Q Consensus      1008 l~~hvVIiG~G~vG~~Ia~~L~e~g~~VvVID~d~~~----v~~l~~~g~~vi~GDasd~e~L~~AgI~~A~~VIi~t~d 1083 (1158)
                      .++|+||||+|++|+.+++.|.+.|++|++||.|++.    .+.....|+.+++||++++++|+++|+++|+++|++++|
T Consensus         2 ~knHiII~G~g~~g~~l~~~L~~~~~~v~vId~d~~~~~~~~~~~~~~~~~vi~Gd~~d~~~L~~a~i~~a~~vi~~~~~   81 (153)
T d1id1a_           2 RKDHFIVCGHSILAINTILQLNQRGQNVTVISNLPEDDIKQLEQRLGDNADVIPGDSNDSSVLKKAGIDRCRAILALSDN   81 (153)
T ss_dssp             CCSCEEEECCSHHHHHHHHHHHHTTCCEEEEECCCHHHHHHHHHHHCTTCEEEESCTTSHHHHHHHTTTTCSEEEECSSC
T ss_pred             CCCEEEEECCCHHHHHHHHHHHHcCCCEEEEeccchhHHHHHHHhhcCCcEEEEccCcchHHHHHhccccCCEEEEcccc
Confidence            4789999999999999999999999999999999875    344566799999999999999999999999999999999


Q ss_pred             chhhHHHHHHHHhhCCCceEEEEecChhhHHHHHHCCCCeeecCCcHHHHHHHHHHHHhhhhh
Q 001096         1084 PGANYRTVWALSKYFPNVKTFVRAHDIDHGLNLEKAGATAVVPETLEPSLQLAAAVLAQVIHD 1146 (1158)
Q Consensus      1084 d~~Nl~i~l~ar~l~p~~~IIara~d~e~~~~L~~aGAd~VI~p~~~a~~~LA~~vl~~~i~~ 1146 (1158)
                      |..|+.+++.+|+++|+.+||++++++++.+.|+++|+|.||.|...++..|++.+..+.+..
T Consensus        82 d~~n~~~~~~~r~~~~~~~iia~~~~~~~~~~l~~~Gad~vi~p~~~~~~~l~~~l~~~~v~~  144 (153)
T d1id1a_          82 DADNAFVVLSAKDMSSDVKTVLAVSDSKNLNKIKMVHPDIILSPQLFGSEILARVLNGEEINN  144 (153)
T ss_dssp             HHHHHHHHHHHHHHTSSSCEEEECSSGGGHHHHHTTCCSEEECHHHHHHHHHHHHHTTCCCCH
T ss_pred             HHHHHHHHHHHHHhCCCCceEEEEcCHHHHHHHHHCCCCEEECHHHHHHHHHHHHhCcCCCCH
Confidence            999999999999999999999999999999999999999999999999999999887776643

PyMOL of d1id1a_

>d2hmva1 c.2.1.9 (A:7-140) Ktn bsu222 {Bacillus subtilis [TaxId: 1423]}	Back information, alignment and structure

>d2fy8a1 c.2.1.9 (A:116-244) Potassium channel-related protein MthK {Archaeon Methanothermobacter thermautotrophicus [TaxId: 145262]}	Back information, alignment and structure

>d1lssa_ c.2.1.9 (A:) Ktn Mja218 {Archaeon Methanococcus jannaschii [TaxId: 2190]}	Back information, alignment and structure

>d1e5qa1 c.2.1.3 (A:2-124,A:392-450) Saccharopine reductase {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]}	Back information, alignment and structure

>d1hdoa_ c.2.1.2 (A:) Biliverdin IX beta reductase {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1bg6a2 c.2.1.6 (A:4-187) N-(1-D-carboxylethyl)-L-norvaline dehydrogenase {Arthrobacter, strain 1c [TaxId: 1663]}	Back information, alignment and structure

>d2f1ka2 c.2.1.6 (A:1-165) Prephenate dehydrogenase TyrA {Synechocystis sp. pcc 6803 [TaxId: 1148]}	Back information, alignment and structure

>d1pjqa1 c.2.1.11 (A:1-113) Siroheme synthase CysG, domain 1 {Salmonella typhimurium [TaxId: 90371]}	Back information, alignment and structure

>d1v8ba1 c.2.1.4 (A:235-397) S-adenosylhomocystein hydrolase {Plasmodium falciparum, isolate 3D7 [TaxId: 5833]}	Back information, alignment and structure

>d1vpda2 c.2.1.6 (A:3-163) Hydroxyisobutyrate dehydrogenase {Salmonella typhimurium [TaxId: 90371]}	Back information, alignment and structure

>d2pgda2 c.2.1.6 (A:1-176) 6-phosphogluconate dehydrogenase {Sheep (Ovis orientalis aries) [TaxId: 9940]}	Back information, alignment and structure

>d1li4a1 c.2.1.4 (A:190-352) S-adenosylhomocystein hydrolase {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1kyqa1 c.2.1.11 (A:1-150) Bifunctional dehydrogenase/ferrochelatase Met8p, N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d3cuma2 c.2.1.6 (A:1-162) Hydroxyisobutyrate dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]}	Back information, alignment and structure

>d1mv8a2 c.2.1.6 (A:1-202) GDP-mannose 6-dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]}	Back information, alignment and structure

>d1qyda_ c.2.1.2 (A:) Pinoresinol-lariciresinol reductase {Giant arborvitae (Thuja plicata) [TaxId: 3316]}	Back information, alignment and structure

>d1kjqa2 c.30.1.1 (A:2-112) Glycinamide ribonucleotide transformylase PurT, N-domain {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1pgja2 c.2.1.6 (A:1-178) 6-phosphogluconate dehydrogenase {Trypanosoma brucei [TaxId: 5691]}	Back information, alignment and structure

>d1i36a2 c.2.1.6 (A:1-152) Conserved hypothetical protein MTH1747 {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]}	Back information, alignment and structure

>d2jfga1 c.5.1.1 (A:1-93) UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase MurD {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d2g5ca2 c.2.1.6 (A:30-200) Prephenate dehydrogenase TyrA {Aquifex aeolicus [TaxId: 63363]}	Back information, alignment and structure

>d1u0sy_ c.23.1.1 (Y:) CheY protein {Thermotoga maritima [TaxId: 2336]}	Back information, alignment and structure

>d1yqga2 c.2.1.6 (A:1-152) Pyrroline-5-carboxylate reductase ProC {Neisseria meningitidis, serogroup B [TaxId: 487]}	Back information, alignment and structure

>d1p3da1 c.5.1.1 (A:11-106) UDP-N-acetylmuramate-alanine ligase MurC {Haemophilus influenzae [TaxId: 727]}	Back information, alignment and structure

>d1c1da1 c.2.1.7 (A:149-349) Phenylalanine dehydrogenase {Rhodococcus sp., M4 [TaxId: 1831]}	Back information, alignment and structure

>d1peya_ c.23.1.1 (A:) Sporulation response regulator Spo0F {Bacillus subtilis [TaxId: 1423]}	Back information, alignment and structure

>d1ks9a2 c.2.1.6 (A:1-167) Ketopantoate reductase PanE {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1e3ja2 c.2.1.1 (A:143-312) Ketose reductase (sorbitol dehydrogenase) {Silverleaf whitefly (Bemisia argentifolii) [TaxId: 77855]}	Back information, alignment and structure

>d1ez4a1 c.2.1.5 (A:16-162) Lactate dehydrogenase {Lactobacillus pentosus [TaxId: 1589]}	Back information, alignment and structure

>d1xgka_ c.2.1.2 (A:) Negative transcriptional regulator NmrA {Aspergillus nidulans [TaxId: 162425]}	Back information, alignment and structure

>d1qkka_ c.23.1.1 (A:) Transcriptional regulatory protein DctD, receiver domain {Sinorhizobium meliloti [TaxId: 382]}	Back information, alignment and structure

>d2pv7a2 c.2.1.6 (A:92-243) Prephenate dehydrogenase TyrA {Haemophilus influenzae [TaxId: 727]}	Back information, alignment and structure

>d2q46a1 c.2.1.2 (A:2-253) Hypothetical protein At5g02240 (T7H20_290) {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}	Back information, alignment and structure

>d1piwa2 c.2.1.1 (A:153-320) Cinnamyl alcohol dehydrogenase, ADH6 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1pl8a2 c.2.1.1 (A:146-316) Ketose reductase (sorbitol dehydrogenase) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1dbwa_ c.23.1.1 (A:) Transcriptional regulatory protein FixJ, receiver domain {Rhizobium meliloti [TaxId: 382]}	Back information, alignment and structure

>d1qyca_ c.2.1.2 (A:) Phenylcoumaran benzylic ether reductase {Loblolly pine (Pinus taeda) [TaxId: 3352]}	Back information, alignment and structure

>d1luaa1 c.2.1.7 (A:98-288) Methylene-tetrahydromethanopterin dehydrogenase {Methylobacterium extorquens [TaxId: 408]}	Back information, alignment and structure

>d1l7da1 c.2.1.4 (A:144-326) Nicotinamide nucleotide transhydrogenase dI component {Rhodospirillum rubrum [TaxId: 1085]}	Back information, alignment and structure

>d2ahra2 c.2.1.6 (A:1-152) Pyrroline-5-carboxylate reductase ProC {Streptococcus pyogenes [TaxId: 1314]}	Back information, alignment and structure

>d1i0za1 c.2.1.5 (A:1-160) Lactate dehydrogenase {Human (Homo sapiens), heart isoform (H chain) [TaxId: 9606]}	Back information, alignment and structure

>d1ebda2 c.3.1.5 (A:155-271) Dihydrolipoamide dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]}	Back information, alignment and structure

>d1pr9a_ c.2.1.2 (A:) Carbonyl reductase {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1j6ua1 c.5.1.1 (A:0-88) UDP-N-acetylmuramate-alanine ligase MurC {Thermotoga maritima [TaxId: 2336]}	Back information, alignment and structure

>d1cyda_ c.2.1.2 (A:) Carbonyl reductase {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1xhca2 c.3.1.5 (A:104-225) NADH oxidase /nitrite reductase {Pyrococcus furiosus [TaxId: 2261]}	Back information, alignment and structure

>d1ulsa_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Thermus thermophilus [TaxId: 274]}	Back information, alignment and structure

>d1p0fa2 c.2.1.1 (A:1164-1337) Alcohol dehydrogenase {Frog (Rana perezi) [TaxId: 8403]}	Back information, alignment and structure

>d1yb1a_ c.2.1.2 (A:) 17-beta-hydroxysteroid dehydrogenase type XI {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1uufa2 c.2.1.1 (A:145-312) Hypothetical protein YahK {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1a04a2 c.23.1.1 (A:5-142) Nitrate/nitrite response regulator (NarL), receiver domain {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1kgsa2 c.23.1.1 (A:2-123) PhoB receiver domain {Thermotoga maritima [TaxId: 2336]}	Back information, alignment and structure

>d1vj0a2 c.2.1.1 (A:156-337) Hypothetical protein TM0436 {Thermotoga maritima [TaxId: 2336]}	Back information, alignment and structure

>d1p2fa2 c.23.1.1 (A:1-120) Response regulator DrrB {Thermotoga maritima [TaxId: 2336]}	Back information, alignment and structure

>d1ps9a3 c.4.1.1 (A:331-465,A:628-671) 2,4-dienoyl-CoA reductase, middle domain {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d2pl1a1 c.23.1.1 (A:1-119) PhoP receiver domain {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1zgza1 c.23.1.1 (A:2-121) TorCAD operon transcriptional regulator TorD, N-terminal domain {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1mlda1 c.2.1.5 (A:1-144) Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 9823]}	Back information, alignment and structure

>d1dlja2 c.2.1.6 (A:1-196) UDP-glucose dehydrogenase (UDPGDH) {Streptococcus pyogenes [TaxId: 1314]}	Back information, alignment and structure

>d1d1ta2 c.2.1.1 (A:163-338) Alcohol dehydrogenase {Human (Homo sapiens), different isozymes [TaxId: 9606]}	Back information, alignment and structure

>d1gpja2 c.2.1.7 (A:144-302) Glutamyl tRNA-reductase middle domain {Archaeon Methanopyrus kandleri [TaxId: 2320]}	Back information, alignment and structure

>d1p6qa_ c.23.1.1 (A:) CheY protein {Sinorhizobium meliloti, CheY2 [TaxId: 382]}	Back information, alignment and structure

>d1ldna1 c.2.1.5 (A:15-162) Lactate dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]}	Back information, alignment and structure

>d1h6va2 c.3.1.5 (A:171-292) Mammalian thioredoxin reductase {Rat (Rattus norvegicus) [TaxId: 10116]}	Back information, alignment and structure

>d1llua2 c.2.1.1 (A:144-309) Alcohol dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]}	Back information, alignment and structure

>d2bgka1 c.2.1.2 (A:11-278) Rhizome secoisolariciresinol dehydrogenase {Mayapple (Podophyllum peltatum) [TaxId: 35933]}	Back information, alignment and structure

>d1krwa_ c.23.1.1 (A:) NTRC receiver domain {Salmonella typhimurium [TaxId: 90371]}	Back information, alignment and structure

>d1mvoa_ c.23.1.1 (A:) PhoP receiver domain {Bacillus subtilis [TaxId: 1423]}	Back information, alignment and structure

>d1txga2 c.2.1.6 (A:1-180) Glycerol-3- phosphate dehydrogenase {Archaeoglobus fulgidus [TaxId: 2234]}	Back information, alignment and structure

>d1v59a2 c.3.1.5 (A:161-282) Dihydrolipoamide dehydrogenase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d2i76a2 c.2.1.6 (A:2-154) Hypothetical protein TM1727 {Thermotoga maritima [TaxId: 2336]}	Back information, alignment and structure

>d1gesa2 c.3.1.5 (A:147-262) Glutathione reductase {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1djqa3 c.4.1.1 (A:341-489,A:646-729) Trimethylamine dehydrogenase, middle domain {Methylophilus methylotrophus, w3a1 [TaxId: 17]}	Back information, alignment and structure

>d1y6ja1 c.2.1.5 (A:7-148) Lactate dehydrogenase {Clostridium thermocellum [TaxId: 1515]}	Back information, alignment and structure

>d1ny5a1 c.23.1.1 (A:1-137) Transcriptional activator sigm54 (NtrC1), N-terminal domain {Aquifex aeolicus [TaxId: 63363]}	Back information, alignment and structure

>d1xhfa1 c.23.1.1 (A:2-122) Aerobic respiration control protein ArcA, N-terminal domain {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d2d1ya1 c.2.1.2 (A:2-249) Hypothetical protein TTHA0369 {Thermus thermophilus [TaxId: 274]}	Back information, alignment and structure

>d1hyha1 c.2.1.5 (A:21-166) L-2-hydroxyisocapronate dehydrogenase, L-HICDH {Lactobacillus confusus [TaxId: 1583]}	Back information, alignment and structure

>d1jqba2 c.2.1.1 (A:1140-1313) Bacterial secondary alcohol dehydrogenase {Clostridium beijerinckii [TaxId: 1520]}	Back information, alignment and structure

>d1ydea1 c.2.1.2 (A:4-253) Retinal dehydrogenase/reductase 3 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1gega_ c.2.1.2 (A:) meso-2,3-butanediol dehydrogenase {Klebsiella pneumoniae [TaxId: 573]}	Back information, alignment and structure

>d1e3ia2 c.2.1.1 (A:168-341) Alcohol dehydrogenase {Mouse (Mus musculus), class II [TaxId: 10090]}	Back information, alignment and structure

>d1a9xa4 c.30.1.1 (A:556-676) Carbamoyl phosphate synthetase (CPS), large subunit PreATP-grasp domains {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d2a4ka1 c.2.1.2 (A:2-242) beta-keto acyl carrier protein reductase {Thermus thermophilus, TTHB020 [TaxId: 274]}	Back information, alignment and structure

>d1f0ya2 c.2.1.6 (A:12-203) Short chain L-3-hydroxyacyl CoA dehydrogenase {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1ys7a2 c.23.1.1 (A:7-127) Transcriptional regulatory protein PrrA, N-terminal domain {Mycobacterium tuberculosis [TaxId: 1773]}	Back information, alignment and structure

>d2ldxa1 c.2.1.5 (A:1-159) Lactate dehydrogenase {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1xg5a_ c.2.1.2 (A:) Putative dehydrogenase ARPG836 (MGC4172) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1udca_ c.2.1.2 (A:) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1pjca1 c.2.1.4 (A:136-303) L-alanine dehydrogenase {Phormidium lapideum [TaxId: 32060]}	Back information, alignment and structure

>d1q7ba_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1zesa1 c.23.1.1 (A:3-123) PhoB receiver domain {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1rkxa_ c.2.1.2 (A:) CDP-glucose-4,6-dehydratase {Yersinia pseudotuberculosis [TaxId: 633]}	Back information, alignment and structure

>d1hdca_ c.2.1.2 (A:) 3-alpha,20-beta-hydroxysteroid dehydrogenase {Streptomyces hydrogenans [TaxId: 1905]}	Back information, alignment and structure

>d1pzga1 c.2.1.5 (A:14-163) Lactate dehydrogenase {Toxoplasma gondii [TaxId: 5811]}	Back information, alignment and structure

>d1zk4a1 c.2.1.2 (A:1-251) R-specific alcohol dehydrogenase {Lactobacillus brevis [TaxId: 1580]}	Back information, alignment and structure

>d1nffa_ c.2.1.2 (A:) Putative oxidoreductase Rv2002 {Mycobacterium tuberculosis [TaxId: 1773]}	Back information, alignment and structure

>d1dxla2 c.3.1.5 (A:153-275) Dihydrolipoamide dehydrogenase {Garden pea (Pisum sativum) [TaxId: 3888]}	Back information, alignment and structure

>d1leha1 c.2.1.7 (A:135-364) Leucine dehydrogenase {Bacillus sphaericus [TaxId: 1421]}	Back information, alignment and structure

>d1w25a1 c.23.1.1 (A:2-140) Response regulator PleD, receiver domain {Caulobacter crescentus [TaxId: 155892]}	Back information, alignment and structure

>d2ayxa1 c.23.1.1 (A:817-949) Sensor kinase protein RcsC, C-terminal domain {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1hxha_ c.2.1.2 (A:) 3beta/17beta hydroxysteroid dehydrogenase {Comamonas testosteroni [TaxId: 285]}	Back information, alignment and structure

>d1k0ia1 c.3.1.2 (A:1-173,A:276-394) p-Hydroxybenzoate hydroxylase, PHBH {Pseudomonas aeruginosa [TaxId: 287]}	Back information, alignment and structure

>d1qo0d_ c.23.1.3 (D:) Positive regulator of the amidase operon AmiR {Pseudomonas aeruginosa [TaxId: 287]}	Back information, alignment and structure

>d1uxja1 c.2.1.5 (A:2-143) Malate dehydrogenase {Chloroflexus aurantiacus [TaxId: 1108]}	Back information, alignment and structure

>d1bdba_ c.2.1.2 (A:) Cis-biphenyl-2,3-dihydrodiol-2,3-dehydrogenase {Pseudomonas sp., lb400 [TaxId: 306]}	Back information, alignment and structure

>d1w6ua_ c.2.1.2 (A:) 2,4-dienoyl-CoA reductase, mitochondrial (DECR) {Human (Homo sapiens), [TaxId: 9606]}	Back information, alignment and structure

>d1ae1a_ c.2.1.2 (A:) Tropinone reductase {Jimsonweed (Datura stramonium), I [TaxId: 4076]}	Back information, alignment and structure

>d1zema1 c.2.1.2 (A:3-262) Xylitol dehydrogenase {Gluconobacter oxydans [TaxId: 442]}	Back information, alignment and structure

>d2ae2a_ c.2.1.2 (A:) Tropinone reductase {Jimsonweed (Datura stramonium), II [TaxId: 4076]}	Back information, alignment and structure

>d3grsa2 c.3.1.5 (A:166-290) Glutathione reductase {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1ek6a_ c.2.1.2 (A:) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1rpna_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Pseudomonas aeruginosa [TaxId: 287]}	Back information, alignment and structure

>d1k2wa_ c.2.1.2 (A:) Sorbitol dehydrogenase {Rhodobacter sphaeroides [TaxId: 1063]}	Back information, alignment and structure

>d1rjwa2 c.2.1.1 (A:138-305) Alcohol dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]}	Back information, alignment and structure

>d3lada2 c.3.1.5 (A:159-277) Dihydrolipoamide dehydrogenase {Azotobacter vinelandii [TaxId: 354]}	Back information, alignment and structure

>d1wdka3 c.2.1.6 (A:311-496) Fatty oxidation complex alpha subunit, middle domain {Pseudomonas fragi [TaxId: 296]}	Back information, alignment and structure

>d1c0pa1 c.4.1.2 (A:999-1193,A:1289-1361) D-aminoacid oxidase, N-terminal domain {Rhodotorula gracilis [TaxId: 5286]}	Back information, alignment and structure

>d1z45a2 c.2.1.2 (A:11-357) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1jaya_ c.2.1.6 (A:) Coenzyme F420H2:NADP+ oxidoreductase (FNO) {Archaeon Archaeoglobus fulgidus [TaxId: 2234]}	Back information, alignment and structure

>d1a9xa3 c.30.1.1 (A:1-127) Carbamoyl phosphate synthetase (CPS), large subunit PreATP-grasp domains {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d2voua1 c.3.1.2 (A:2-163,A:292-394) Dihydroxypyridine hydroxylase DhpH {Arthrobacter nicotinovorans [TaxId: 29320]}	Back information, alignment and structure

>d1a5za1 c.2.1.5 (A:22-163) Lactate dehydrogenase {Thermotoga maritima [TaxId: 2336]}	Back information, alignment and structure

>d1qp8a1 c.2.1.4 (A:83-263) Putative formate dehydrogenase {Archaeon Pyrobaculum aerophilum [TaxId: 13773]}	Back information, alignment and structure

>d1fmca_ c.2.1.2 (A:) 7-alpha-hydroxysteroid dehydrogenase {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1yioa2 c.23.1.1 (A:3-130) Response regulatory protein StyR, N-terminal domain {Pseudomonas fluorescens [TaxId: 294]}	Back information, alignment and structure

>d2rhca1 c.2.1.2 (A:5-261) beta-keto acyl carrier protein reductase {Streptomyces coelicolor [TaxId: 1902]}	Back information, alignment and structure

>d2ag5a1 c.2.1.2 (A:1-245) Dehydrogenase/reductase SDR family member 6, DHRS6 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1xeaa1 c.2.1.3 (A:2-122,A:267-312) Putative oxidoreductase VCA1048 {Vibrio cholerae [TaxId: 666]}	Back information, alignment and structure

>d2blla1 c.2.1.2 (A:316-657) Polymyxin resistance protein ArnA (PrmI) {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d2cvza2 c.2.1.6 (A:2-157) Hydroxyisobutyrate dehydrogenase {Thermus thermophilus [TaxId: 274]}	Back information, alignment and structure