Citrus Sinensis ID: 001109

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820-------830-------840-------850-------860-------870-------880-------890-------900-------910-------920-------930-------940-------950-------960-------970-------980-------990------1000------1010------1020------1030------1040------1050------1060------1070------1080------1090------1100------1110------1120------1130------1140------1150-----
MFTKIFKKATKQPSPPRQNDEIKENLTSKDFDPRVTLHYGIPSTASILAFDHVQSLLAIGTQDGRIKVIGGDNIEGLLVSPKQLAFKHLEFLQNQGFLVSISSGNEIQLWDLEARRITSTLPWESNITAFSVIFGTSYMYIGDEYGMVYVLKYDTEEGKLIHSPYYVPKDVIEVFNHLLLEFCPNHIQREKGKAAFNASLLFYCMPPDESGFIDFIIRSKLRFFVEIRLLQFQKHVNSTLGFSQLLLVYANGLIILWDVSEDKVVLVRGSKDLQLKTEIVDDPSKNAGHNLSETVSDNEQVEKEISSLCWASNDGSVLAVGYVDGDILLWNLRAAASTKDWKSENSSTDFGKLQLSSGNRRLPVITLHWSAERSRNDCRGQLFVFGGDEIGSEEVLTMLYLNWSSRIESLKCIGRVDLERKGSFVDMVLLPNGMNESHGTLPCVLTNPGKLQVYDRPRFSPKKSQEKKKISSSSLQYPMLIPTIEPHMTVGKLCMVCRDGKLSVELSKTLSAAKVRASHTPSTQLTGSTTKWPLTGGIPCQLHDAEDYLVERLYIAGYRDGSTRIWDATYPTLSLIHVFGSELPGIRTATESESVSALEFCSVTLNLAIGSSSGLVWLYNLIKSSNEETLNLVTETGKEVHILPGGDGPQCKALFSVLNSPICNLKFSNFGARLAVGFECSQVAMLDISTFSVLFITDSLSNSNSPVLYLAVKSLSDTSNLTISPKDSDINSSNDTKKETLFFMTKDAHIVVCDSTTGHILFSRSIHHQESNAIYMCIIEGGNFFSETSSEKQSLNTPQNSKATSEPDQTNANTGSDPVVAELETSTEATYLERIFEHLFVLLCYEDALWLYPLKSLIQGHTDSIHKVNLLKPCCWTTSFKKNEKECGLVVLYQTGDIEIRVLPYLEVGGQTSLMSLLRWNYKTNMEETLCSSDSGEIVLVDFSSIPVSYPHLHDKVLEAAADATIDLSPAQRKEEGTALGILGGIIKGFKADKAEQNVLIPEVSNKTCAHLDSIFSNPPFLKPSTDIPDDKGVIELNIDDIDIDGPLIVTSSSQTSKNDRKDKGTERKKLFEGAATDTKPKSRTVDEIKAKYKKSEVQGTAAAAAQAKDKLAERGEKLEMLRERTEELQNGAQNFADLAGELAKRMERRKWWQL
cHHHHHHHcccccccccccHHHHccccccccccEEEEEEccccccEEEEEcccccEEEEEEccccEEEEccccEEEEEEccccccEEEEEEEccccEEEEEEccccEEEEEcccccEEEEccccccEEEEEEEccccEEEEEcccccEEEEEEEccccEEEEcccccccccEEEEccEEEEEcccccccccccccccccEEEEEccccccccEEEEEEccccEEEEEEEEEEEEEEcccccccEEEEEEcccEEEEEEEcccEEEEEEcccccccEEEEEccccccccccccccccccccccccEEEEEEEcccccEEEEEEEcccEEEEEccccccccccccccccccccccccccccccccEEEEEEEEcccccccccEEEEEccccccccccEEEEEEcccccEEEEEEEcccccccccEEEEEEEEccccccccccccEEEcccccEEEEcccccccccccccccccccccccccccccccccccEEEEEEEcccccccHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccEEEEEEEEcccEEEEEEcccccEEEEEEEcccccccccccccccEEEEEEcccccEEEEEEcccEEEEEEEccccccccEEEEcccccEEEEccccccccEEEEEEEccccEEEEEEcccccEEEEEEcccEEEEEEccccEEEEEEccccccccccEEEEEEccccccccccccccccccccccccccEEEEEEccccEEEEEcccccEEEEEcccccccEEEEEEEEccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEEEccEEEEEEcccccccccccEEEEEcccccccEEEEEccccEEEEEEEEEcccEEEEEccccccccEEccccEEEcccccccccEEEEcccccEEEEEccccccccccccccccccccccccccccHHHcccccccccccccccccccccccccccccccccccHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHccccccccccccccHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccc
cHHHHHHccccccccccccHHHHHHccHHHccHHHHHHccccccccEEcccHHHEEEEEEccccEEEEEcccccEEEEEccccccEEEEEEEccccEEEEEEcccEEEEEEEEcccccEEEccccEEEEEEEcccccEEEEEccccEEEEEEEcccccEEccccccccHcEEEEEEEccccccEEEEcccccccEEEEEEEEEEccccccccEEEEcccccccccccccccEEEHEcccccccEEEEEEcccEEEEEEcccccEEEEEccEEccccccccccccccccccccccHHHHccccccEEEEEEEEccccEEEEEEccccEEEEEccccccccccccccccccccccccHHHccEcEEEEEEEEEEEcccccccEEEEEEccccccccEEEEEEcccccccccEEEEEEccEEEEEccccEEEEcccccccccccEEEccccccEEEHHHHHHHHEEEHcccccccccccccEEcccccccEEHHHHHHccccccccccHHHHHHHHHHHcccccccccccccccccccccccccccccccccccEEEEEEcccccEEEEccccHcHHHHEEEcccccEEccccccccEEEEEEcccccEEEEEccccEEEEEEEcccccccEEEEEEcccEEEEEEEcccccEEEEEEEEccccEEEEEEcccccEEEEEccccEEEEEEccccEEEEEEEccccccccEEEEEEEEcccccccccccccccccccccccccEEEEEEcccEEEEEEcccccEEcccccccccccEEEEEEEcccccccccccccccccccccccccccccccccccccccccccccccccccccHccccccEEEEEEHcEEEEEEHHHHHcccccEEEEEccccccEEEEEEEcccccEEEEEEEEccEEEEEccccHHHHEHHHHHHHHccccccccccEEEEccccEEEEEcccccccccccccHHHHHHHHHHcccccHHHHHcccccccccccEEccccccccccccccccccccHHHHHHHHHccccccccccccccccccEEccccccHcccccccccccccccccccccHHHHHHHHcccccccccccccHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHcccccc
MFTKIFKKatkqpspprqndeikenltskdfdprvtlhygipstaSILAFDHVQSLLAigtqdgrikviggdniegllvspkqLAFKHLEFLQNQGFLVSISSGNEIQLWDLEARRitstlpwesniTAFSVIFGTSYMYIGDEYGMVYVLKydteegklihspyyvpkDVIEVFNHLLLEFCPNHIQREKGKAAFNASLLfycmppdesgfiDFIIRSKLRFFVEIRLLQFQKHVNSTLGFSQLLLVYANGLIILWDVSEDKVVLVRGskdlqlkteivddpsknaghnlsetvsdNEQVEKEISSLcwasndgsvlavgyvdgdILLWNLRAAAstkdwksensstdfgklqlssgnrrlpvitlhwsaersrndcrgqlfvfggdeigseEVLTMLYLNWSSRIESLKcigrvdlerkgsfvdmvllpngmneshgtlpcvltnpgklqvydrprfspkksqekkkisssslqypmliptiephmtvGKLCMVCRDGKLSVELSKTLSAAKVrashtpstqltgsttkwpltggipcqlhdAEDYLVERLYIAgyrdgstriwdatyptlSLIHVFgselpgirtatesesVSALEFCSVTLNLAIGSSSGLVWLYNLIKSSNEETLNLVTETgkevhilpggdgpqcKALFSVlnspicnlkfsnfgarLAVGFECSQVAMLDISTFSVLFITdslsnsnspVLYLAVKSLsdtsnltispkdsdinssndtkkETLFFMtkdahivvcdsttghiLFSRSIHHQESNAIYMCIIEggnffsetssekqslntpqnskatsepdqtnantgsdpvvAELETSTEATYLERIFEHLFVLLCYEdalwlyplksliqghtdsihkvnllkpccwttsfkknekecGLVVLYQtgdieirvlpylevggqtsLMSLLRWNYKtnmeetlcssdsgeivlvdfssipvsyphlHDKVLEAAADatidlspaqrkeeGTALGILGGIikgfkadkaeqnvlipevsnktcahldsifsnppflkpstdipddkgvielniddididgplivtsssqtskndrkdkgterkklfegaatdtkpksrtvDEIKAKYKKSEVQGTAAAAAQAKDKLAERGEKLEMLRERTEELQNGAQNFADLAGELAKRMERRKWWQL
mftkifkkatkqpspprqndeikenltskdfdprVTLHYGIPSTASILAFDHVQSLLAIGTQDGRIKVIGGDNIEGLLVSPKQLAFKHLEFLQNQGFLVSISSGNEIQLWDLEARRITstlpwesniTAFSVIFGTSYMYIGDEYGMVYVLKYDTEEGKLIHSPYYVPKDVIEVFNHLLLEFCPNHIQREKGKAAFNASLLFYCMPPDESGFIDFIIRSKLRFFVEIRLLQFQKHVNSTLGFSQLLLVYANGLIILWDVSEDKVVLVRGskdlqlkteivddpsknaghnlsetvsdneQVEKEISSLCWASNDGSVLAVGYVDGDILLWNLRAAAstkdwksensstdfgklqlssgnrRLPVITLhwsaersrndcRGQLFVFGGDEIGSEEVLTMLYLNWSSRIESLKCIGRVDLERKGSFVDMVLLPNGMNESHGTLPCVLTNPGKLQVydrprfspkksqekkkisssslqypmLIPTIEPHMTVGKLCMVCRDGKLSVELSKTLSAakvrashtpstqltgsttkwpltGGIPCQLHDAEDYLVERLYIAGYRDGSTRIWDATYPTLSLIHVFGSELPGIRTATESESVSALEFCSVTLNLAIGSSSGLVWLYNLIKSSNEETLNLVTETGKEVHILPGGDGPQCKALFSVLNSPICNLKFSNFGARLAVGFECSQVAMLDISTFSVLFITDSLSNSNSPVLYLAVKSLSdtsnltispkdsdinssndTKKETLFFMTKDAHIVVCDSTTGHILFSRSIHHQESNAIYMCIIEGGNFFSETSSEKQSlntpqnskatsepdqtnantgsdpVVAELETSTEATYLERIFEHLFVLLCYEDALWLYPLKSLIQGHTDSIHKVNLLKPCCWTTSFKKNEKECGLVVLYQTGDIEIRVLPYLEVGGQTSLMSLLRWNYKTNMEETLCSSDSGEIVLVDFSSIPVSYPHLHDKVLEAAADATIDLSPAQRKEEGTALGILGGIIKGFKADKAEQNVLIPEVSNKTCAHLDSIFSNPPFLKPSTDIPDDKGVIELNiddididgplivtsssqtskndrkdkgterkklfegaatdtkpksrtvdeikakykksevqgtaAAAAQAKDKLAERGEKLEMLRERTEELQNGAQNFADLAGELAKRMERRKWWQL
MFTKIFKKATKQPSPPRQNDEIKENLTSKDFDPRVTLHYGIPSTASILAFDHVQSLLAIGTQDGRIKVIGGDNIEGLLVSPKQLAFKHLEFLQNQGFLVSISSGNEIQLWDLEARRITSTLPWESNITAFSVIFGTSYMYIGDEYGMVYVLKYDTEEGKLIHSPYYVPKDVIEVFNHLLLEFCPNHIQREKGKAAFNASLLFYCMPPDESGFIDFIIRSKLRFFVEIRLLQFQKHVNSTLGFSQLLLVYANGLIILWDVSEDKVVLVRGSKDLQLKTEIVDDPSKNAGHNLSETVSDNEQVEKEISSLCWASNDGSVLAVGYVDGDILLWNLRAAASTKDWKSENSSTDFGKLQLSSGNRRLPVITLHWSAERSRNDCRGQLFVFGGDEIGSEEVLTMLYLNWSSRIESLKCIGRVDLERKGSFVDMVLLPNGMNESHGTLPCVLTNPGKLQVYDRPRFspkksqekkkissssLQYPMLIPTIEPHMTVGKLCMVCRDGKLSVELSKTLSAAKVRASHTPSTQLTGSTTKWPLTGGIPCQLHDAEDYLVERLYIAGYRDGSTRIWDATYPTLSLIHVFGSELPGIRTATESESVSALEFCSVTLNLAIGSSSGLVWLYNLIKSSNEETLNLVTETGKEVHILPGGDGPQCKALFSVLNSPICNLKFSNFGARLAVGFECSQVAMLDISTFSVLFITDSLSNSNSPVLYLAVKSLSDTSNLTISPKDSDINSSNDTKKETLFFMTKDAHIVVCDSTTGHILFSRSIHHQESNAIYMCIIEGGNFFSETSSEKQSLNTPQNSKATSEPDQTNANTGSDPVVAELETSTEATYLERIFEHLFVLLCYEDALWLYPLKSLIQGHTDSIHKVNLLKPCCWTTSFKKNEKECGLVVLYQTGDIEIRVLPYLEVGGQTSLMSLLRWNYKTNMEETLCSSDSGEIVLVDFSSIPVSYPHLHDKVLEAAADATIDLSPAQRKEEGTAlgilggiiKGFKADKAEQNVLIPEVSNKTCAHLDSIFSNPPFLKPSTDIPDDKGVIELNIDDIDIDGPLIVTSSSQTSKNDRKDKGTERKKLFEGAATDTKPKSRTVDEIKAKYKKSEVQGTaaaaaqaKDKLAERGEKLEMLRERTEELQNGAQNFADLAGELAKRMERRKWWQL
********************************PRVTLHYGIPSTASILAFDHVQSLLAIGTQDGRIKVIGGDNIEGLLVSPKQLAFKHLEFLQNQGFLVSISSGNEIQLWDLEARRITSTLPWESNITAFSVIFGTSYMYIGDEYGMVYVLKYDTEEGKLIHSPYYVPKDVIEVFNHLLLEFCPNHIQREKGKAAFNASLLFYCMPPDESGFIDFIIRSKLRFFVEIRLLQFQKHVNSTLGFSQLLLVYANGLIILWDVSEDKVVLVRGSKDLQL*****************************ISSLCWASNDGSVLAVGYVDGDILLWNLRAAAST*********************RRLPVITLHWSAERSRNDCRGQLFVFGGDEIGSEEVLTMLYLNWSSRIESLKCIGRVDLERKGSFVDMVLLPNGMNESHGTLPCVLTNPGKLQVY**********************YPMLIPTIEPHMTVGKLCMVCRDGKLSVELSK*******************STTKWPLTGGIPCQLHDAEDYLVERLYIAGYRDGSTRIWDATYPTLSLIHVFGSELPGIRTATESESVSALEFCSVTLNLAIGSSSGLVWLYNLIKSSNEETLNLVTETGKEVHILPGGDGPQCKALFSVLNSPICNLKFSNFGARLAVGFECSQVAMLDISTFSVLFITDSLSNSNSPVLYLAVK**************************TLFFMTKDAHIVVCDSTTGHILFSRSIHHQESNAIYMCIIEGGNFF*****************************************TEATYLERIFEHLFVLLCYEDALWLYPLKSLIQGHTDSIHKVNLLKPCCWTTSFKKNEKECGLVVLYQTGDIEIRVLPYLEVGGQTSLMSLLRWNYKTNMEETLCSSDSGEIVLVDFSSIPVSYPHLHDKVLEAAADATIDL********GTALGILGGIIKGFKADKAEQNVLIPEVSNKTCAHLDSIFSNPPFLKPSTDIPDDKGVIELNIDDIDIDGPLIV*********************************************************************************************************
******************************FDPRVTLHYGIPSTASILAFDHVQSLLAIGTQDGRIKVIGGDNIEGLLVSPKQLAFKHLEFLQNQGFLVSISSGNEIQLWDLEARRITSTLPWESNITAFSVIFGTSYMYIGDEYGMVYVLKYDTEEGKLIHSPYYVPKDVIEVFNHLLLEFCPNHIQREKGKAAFNASLLFYCMPPDESGFIDFIIRSKLRFFVEIRLLQFQKHVNSTLGFSQLLLVYANGLIILWDVSEDKVVLVRGSKDLQLKTEIVDDPSKNAGHNLSETVSDNEQVEKEISSLCWASNDGSVLAVGYVDGDILLWNLRAA***********STDFGKLQLSSGNRRLPVITLHWSAERSRNDCRGQLFVFGGDEIGSEEVLTMLYLNWSSRIESLKCIGRVDLERKGSFVDMVLLPNGMNESHGTLPCVLTNPGKLQVYDRPRFSPKKSQEKKKISSSSLQYPMLIPTIEPHMTVGKLCMVCRDGKLSVELSKTLSAAKVRASHTP**QLTGSTTKWPLTGGIPCQLHDAEDYLVERLYIAGYRDGSTRIWDATYPTLSLIHVFGSELPGIRTATESESVSALEFCSVTLNLAIGSSSGLVWLYNLIKSSNEE********GKEVHILPGGDGPQCKALFSVLNSPICNLKFSNFGARLAVGFECSQVAMLDISTFSVLFITDSLSNSNSPVLYLAV*********************NDTKKETLFFMTKDAHIVVCDSTTGHILFSRSIHHQESNAIYMCIIEGGNFFSETSSEKQ*********************************************LFVLLCYEDALWLYPLKSL*****DSIHKVNLLKPCCWTTSFKKNEKECGLVVLYQTGDIEIRVLPYLEVGGQTSLMSLLR*************SDSGEIVLVDFSSIPVSYPHLHDKVLEAAADATID***************LGGII**********************************************VIELNIDD******************************************************************************************************AKRMERRKWWQL
********************EIKENLTSKDFDPRVTLHYGIPSTASILAFDHVQSLLAIGTQDGRIKVIGGDNIEGLLVSPKQLAFKHLEFLQNQGFLVSISSGNEIQLWDLEARRITSTLPWESNITAFSVIFGTSYMYIGDEYGMVYVLKYDTEEGKLIHSPYYVPKDVIEVFNHLLLEFCPNHIQREKGKAAFNASLLFYCMPPDESGFIDFIIRSKLRFFVEIRLLQFQKHVNSTLGFSQLLLVYANGLIILWDVSEDKVVLVRGSKDLQLKTEIVDDPSKNAGHNLSETVSDNEQVEKEISSLCWASNDGSVLAVGYVDGDILLWNLRAAA**************GKLQLSSGNRRLPVITLHWSAERSRNDCRGQLFVFGGDEIGSEEVLTMLYLNWSSRIESLKCIGRVDLERKGSFVDMVLLPNGMNESHGTLPCVLTNPGKLQVYDRP****************SLQYPMLIPTIEPHMTVGKLCMVCRDGKLSVELSKTL*****************STTKWPLTGGIPCQLHDAEDYLVERLYIAGYRDGSTRIWDATYPTLSLIHVFGSELPGIRTATESESVSALEFCSVTLNLAIGSSSGLVWLYNLIKSSNEETLNLVTETGKEVHILPGGDGPQCKALFSVLNSPICNLKFSNFGARLAVGFECSQVAMLDISTFSVLFITDSLSNSNSPVLYLAVKSLSDTSNLTISPKDSDINSSNDTKKETLFFMTKDAHIVVCDSTTGHILFSRSIHHQESNAIYMCIIEGGNFFS*****************************SDPVVAELETSTEATYLERIFEHLFVLLCYEDALWLYPLKSLIQGHTDSIHKVNLLKPCCWTTSFKKNEKECGLVVLYQTGDIEIRVLPYLEVGGQTSLMSLLRWNYKTNMEETLCSSDSGEIVLVDFSSIPVSYPHLHDKVLEAAADATIDLSPAQRKEEGTALGILGGIIKGFKADKAEQNVLIPEVSNKTCAHLDSIFSNPPFLKPSTDIPDDKGVIELNIDDIDIDGPLIVTSS*************ERKKLFEGAATDTKPKSRTVDEIKAKY******************LAERGEKLEMLRERTEELQNGAQNFADLAGELAKRMERRKWWQL
******************NDEIKENLTSKDFDPRVTLHYGIPSTASILAFDHVQSLLAIGTQDGRIKVIGGDNIEGLLVSPKQLAFKHLEFLQNQGFLVSISSGNEIQLWDLEARRITSTLPWESNITAFSVIFGTSYMYIGDEYGMVYVLKYDTEEGKLIHSPYYVPKDVIEVFNHLLLEFCPNHIQREKGKAAFNASLLFYCMPPDESGFIDFIIRSKLRFFVEIRLLQFQKHVNSTLGFSQLLLVYANGLIILWDVSEDKVVLVRGSKDLQLKTEIVDDPS******LSETVSDNEQVEKEISSLCWASNDGSVLAVGYVDGDILLWNLRAA*********NSSTDFGKLQLSSGNRRLPVITLHWSAERSRNDCRGQLFVFGGDEIGSEEVLTMLYLNWSSRIESLKCIGRVDLERKGSFVDMVLLPNGMNESHGTLPCVLTNPGKLQVYDRPRFSPKKSQEKKKISSSSLQYPMLIPTIEPHMTVGKLCMVCRDGKLSVELSKTLSAAKVRASH*********TTKWPLTGGIPCQLHDAEDYLVERLYIAGYRDGSTRIWDATYPTLSLIHVFGSELPGIRTATESESVSALEFCSVTLNLAIGSSSGLVWLYNLIKSSNEETLNLVTETGKEVHILPGGDGPQCKALFSVLNSPICNLKFSNFGARLAVGFECSQVAMLDISTFSVLFITDSLSNSNSPVLYLAVKSLSDTSNLT*********SSNDTKKETLFFMTKDAHIVVCDSTTGHILFSRSIHHQESNAIYMCIIEGG************************************************YL*RIFEHLFVLLCYEDALWLYPLKSLIQGHTDSIHKVNLLKPCCWTTSFKKNEKECGLVVLYQTGDIEIRVLPYLEVGGQTSLMSLLRWNYKTNMEETLCSSDSGEIVLVDFSSIPVSYPHLHDKVLEAAADATIDLSPAQ**EEGTALGI****IKGFK*************************SNPPFLKPSTDIPDDKGVIELNIDDIDIDGP***********************************SRTVDEIKAKYKKSEVQGTAAAAAQ*KDKLAERGEKLEMLRERTEELQNGAQNFADLAGELAKRMERRKWWQL
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MFTKIFKKATKQPSPPRQNDEIKENLTSKDFDPRVTLHYGIPSTASILAFDHVQSLLAIGTQDGRIKVIGGDNIEGLLVSPKQLAFKHLEFLQNQGFLVSISSGNEIQLWDLEARRITSTLPWESNITAFSVIFGTSYMYIGDEYGMVYVLKYDTEEGKLIHSPYYVPKDVIEVFNHLLLEFCPNHIQREKGKAAFNASLLFYCMPPDESGFIDFIIRSKLRFFVEIRLLQFQKHVNSTLGFSQLLLVYANGLIILWDVSEDKVVLVRGSKDLQLKTEIVDDPSKNAGHNLSETVSDNEQVEKEISSLCWASNDGSVLAVGYVDGDILLWNLRAAASTKDWKSENSSTDFGKLQLSSGNRRLPVITLHWSAERSRNDCRGQLFVFGGDEIGSEEVLTMLYLNWSSRIESLKCIGRVDLERKGSFVDMVLLPNGMNESHGTLPCVLTNPGKLQVYDRPRFSPKKSQEKKKISSSSLQYPMLIPTIEPHMTVGKLCMVCRDGKLSVELSKTLSAAKVRASHTPSTQLTGSTTKWPLTGGIPCQLHDAEDYLVERLYIAGYRDGSTRIWDATYPTLSLIHVFGSELPGIRTATESESVSALEFCSVTLNLAIGSSSGLVWLYNLIKSSNEETLNLVTETGKEVHILPGGDGPQCKALFSVLNSPICNLKFSNFGARLAVGFECSQVAMLDISTFSVLFITDSLSNSNSPVLYLAVKSLSDTSNLTISPKDSDINSSNDTKKETLFFMTKDAHIVVCDSTTGHILFSRSIHHQESNAIYMCIIEGGNFFSETSSEKQSLNTPQNSKATSEPDQTNANTGSDPVVAELETSTEATYLERIFEHLFVLLCYEDALWLYPLKSLIQGHTDSIHKVNLLKPCCWTTSFKKNEKECGLVVLYQTGDIEIRVLPYLEVGGQTSLMSLLRWNYKTNMEETLCSSDSGEIVLVDFSSIPVSYPHLHDKVLEAAADATIDLSPAQRKEEGTALGILGGIIKGFKADKAEQNVLIPEVSNKTCAHLDSIFSNPPFLKPSTDIPDDKGVIELNIDDIDIDGPLIVTSSSQTSKNDRKDKGTERKKLFEGAATDTKPKSRTVDEIKAKYKKSEVQGTAAAxxxxxxxxxxxxxxxxxxxxxxxxxQNGAQNFADLAGELAKRMERRKWWQL
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query1155 2.2.26 [Sep-21-2011]
Q9Y2K91186 Syntaxin-binding protein yes no 0.117 0.114 0.345 3e-15
Q5DQR41185 Syntaxin-binding protein yes no 0.119 0.116 0.349 4e-15
Q5T5C01151 Syntaxin-binding protein no no 0.122 0.122 0.319 3e-14
Q8K4001152 Syntaxin-binding protein no no 0.122 0.122 0.312 4e-14
Q9WU701152 Syntaxin-binding protein yes no 0.122 0.122 0.312 4e-14
Q5SQE21159 Syntaxin-binding protein no no 0.127 0.126 0.278 9e-10
P381631010 Lethal(2) giant larvae pr yes no 0.197 0.225 0.218 3e-09
Q084701166 Protein lethal(2) giant l no no 0.122 0.121 0.308 3e-09
P081111161 Lethal(2) giant larvae pr no no 0.126 0.125 0.294 2e-08
Q5RCX21019 Lethal(2) giant larvae pr no no 0.211 0.239 0.201 8e-07
>sp|Q9Y2K9|STB5L_HUMAN Syntaxin-binding protein 5-like OS=Homo sapiens GN=STXBP5L PE=2 SV=2 Back     alignment and function desciption
 Score = 84.7 bits (208), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 48/139 (34%), Positives = 79/139 (56%), Gaps = 3/139 (2%)

Query: 20  DEIKENLTSKDFDPRVTLHYGIPSTASILAFDHVQSLLAIGTQDGRIKVIGGDNIEGLLV 79
           +EI+E LTS+ F    T+ +G P   + LAFD VQ +LAIGT+ G I+++G   ++    
Sbjct: 48  EEIQETLTSEYFQICKTVRHGFPHQPTALAFDPVQKILAIGTRTGAIRILGRPGVDCYCQ 107

Query: 80  SPKQLAFKHLEFLQNQGFLVSISSGNEIQLWDLEARR--ITSTLPW-ESNITAFSVIFGT 136
                A   L+FL N+G LVS SS + + LW+L  +R  I  +L +    IT   + F +
Sbjct: 108 HESGAAVLQLQFLINEGALVSASSDDTLHLWNLRQKRPAILHSLKFNRERITYCHLPFQS 167

Query: 137 SYMYIGDEYGMVYVLKYDT 155
            ++Y+G E G  +++  ++
Sbjct: 168 KWLYVGTERGNTHIVNIES 186
May play a role in vesicle trafficking and exocytosis.
Homo sapiens (taxid: 9606)
>sp|Q5DQR4|STB5L_MOUSE Syntaxin-binding protein 5-like OS=Mus musculus GN=Stxbp5l PE=1 SV=1 Back     alignment and function description
>sp|Q5T5C0|STXB5_HUMAN Syntaxin-binding protein 5 OS=Homo sapiens GN=STXBP5 PE=1 SV=1 Back     alignment and function description
>sp|Q8K400|STXB5_MOUSE Syntaxin-binding protein 5 OS=Mus musculus GN=Stxbp5 PE=1 SV=3 Back     alignment and function description
>sp|Q9WU70|STXB5_RAT Syntaxin-binding protein 5 OS=Rattus norvegicus GN=Stxbp5 PE=1 SV=1 Back     alignment and function description
>sp|Q5SQE2|STB5L_DANRE Syntaxin-binding protein 5-like OS=Danio rerio GN=stxbp5l PE=3 SV=1 Back     alignment and function description
>sp|P38163|SRO77_YEAST Lethal(2) giant larvae protein homolog SRO77 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SRO77 PE=1 SV=2 Back     alignment and function description
>sp|Q08470|L2GL_DROPS Protein lethal(2) giant larvae OS=Drosophila pseudoobscura pseudoobscura GN=l(2)gl PE=1 SV=3 Back     alignment and function description
>sp|P08111|L2GL_DROME Lethal(2) giant larvae protein OS=Drosophila melanogaster GN=l(2)gl PE=1 SV=2 Back     alignment and function description
>sp|Q5RCX2|L2GL2_PONAB Lethal(2) giant larvae protein homolog 2 OS=Pongo abelii GN=LLGL2 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query1155
2241093041112 predicted protein [Populus trichocarpa] 0.928 0.964 0.552 0.0
2254484591108 PREDICTED: uncharacterized protein LOC10 0.943 0.983 0.528 0.0
2977365951137 unnamed protein product [Vitis vinifera] 0.943 0.958 0.514 0.0
2960831691127 unnamed protein product [Vitis vinifera] 0.922 0.944 0.490 0.0
2254394081176 PREDICTED: uncharacterized protein LOC10 0.922 0.905 0.490 0.0
2241011591063 predicted protein [Populus trichocarpa] 0.883 0.959 0.490 0.0
4495078191120 PREDICTED: uncharacterized LOC101208658 0.942 0.972 0.483 0.0
4494609451119 PREDICTED: uncharacterized protein LOC10 0.941 0.972 0.483 0.0
3574927331114 Syntaxin-binding protein 5-like protein 0.941 0.975 0.477 0.0
3341874371099 syntaxin binding protein 5 (tomosyn) [Ar 0.915 0.961 0.475 0.0
>gi|224109304|ref|XP_002315153.1| predicted protein [Populus trichocarpa] gi|222864193|gb|EEF01324.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
 Score = 1225 bits (3169), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 645/1167 (55%), Positives = 815/1167 (69%), Gaps = 95/1167 (8%)

Query: 26   LTSKDFDPRVTLHYGIPSTASILAFDHVQSLLAIGTQDGRIKVIGGDNIEGLLVSPKQLA 85
            LT KD +PR+ LHYGIPSTASILAFDHVQSLLAIGT DGRIKVIGG+NIEGLLVSPKQ  
Sbjct: 4    LTPKDINPRIALHYGIPSTASILAFDHVQSLLAIGTLDGRIKVIGGNNIEGLLVSPKQSP 63

Query: 86   FKHLEFLQNQGFLVSISSGNEIQLWDLEARRITSTLPWESNITAFSVIFGTSYMYIGDEY 145
            FK+LEFLQNQGFLVS+S+ NEIQ+WDLE RRI S+L WESNITAFSVIF +SYMY+GDEY
Sbjct: 64   FKYLEFLQNQGFLVSVSNENEIQVWDLEQRRIASSLQWESNITAFSVIFCSSYMYVGDEY 123

Query: 146  GMVYVLKYDTEEGKLIHSPYYVPKDVIEVFNHLLLEFCPNHIQREKGKAAFNASLLFYCM 205
            GMVYVLKYD EE KL+  PY+VP DV    + +               +  N S++    
Sbjct: 124  GMVYVLKYDAEEVKLVPMPYHVPADVAADASGM--------------SSPKNRSVVGVLP 169

Query: 206  PPDESGFIDFIIRSKLRFFVEIRLLQFQKHVNSTLGFSQLLLVYANGLIILWDVSEDKVV 265
             P   G                               +++L+ Y +GLII+WDVSEDKVV
Sbjct: 170  QPSSQG-------------------------------NKVLIAYEDGLIIIWDVSEDKVV 198

Query: 266  LVRGSKDLQLKTEIVDDPSKNAGHNLSETVSDNEQVEKEISSLCWASNDGSVLAVGYVDG 325
            LV+G+KDL+LK +I  D  K+ G  LS+ +SD + +EKEI++LCWAS DGSVLAVGYVDG
Sbjct: 199  LVKGNKDLELKCKITADSHKDTGPELSDDISDYQPLEKEIAALCWASTDGSVLAVGYVDG 258

Query: 326  DILLWNLRAAASTKDWKSENSSTDFGKLQLSSGNRRLPVITLHWSAERSRNDCRGQLFVF 385
            DILLWNL +  S KD  +  SS D  KL LS+G+RRLPVI LHWSA RS NDCRG+LFV+
Sbjct: 259  DILLWNLSSTTSAKDMHAAKSSNDVVKLLLSTGDRRLPVIVLHWSAHRSHNDCRGRLFVY 318

Query: 386  GGDEIGSEEVLTMLYLNWSSRIESLKCIGRVDLERKGSFVDMVLLPNGMNESHGTLPCVL 445
            GGD IGSEE LT+L L+WSS IESLKC GRVDL   GSF DMVLLP+G +    +   +L
Sbjct: 319  GGDAIGSEEALTILSLDWSSGIESLKCTGRVDLTLNGSFADMVLLPSGGDMGTSS-TLIL 377

Query: 446  TNPGKLQVYDRPRFSPKKSQEKKKISSSSLQYPMLIPTIEPHMTVGKLCMVCRDGKLSVE 505
            TNPG+L +Y+    S   S  +K+   SS+QYPM+IPTIEP +T+ KL +V RDGK S  
Sbjct: 378  TNPGQLNLYNDAGLSSSISLLEKRNYVSSIQYPMVIPTIEPQLTLAKLGLVFRDGKFSKA 437

Query: 506  LSKTLSAAKVRASHTPSTQLTGSTTKWPLTGGIPCQLHDAEDYLVERLYIAGYRDGSTRI 565
            LS+ +S+ K++A+H P       +T WPLTGG+P QL DAE Y VERLY+AGY+DG+ +I
Sbjct: 438  LSEEISSRKLQATHCP------RSTNWPLTGGVPSQLQDAEKYQVERLYMAGYQDGTVKI 491

Query: 566  WDATYPTLSLIHVFGSELPGIRT--ATESESVSALEFCSVTLNLAIGSSSGLVWLYNLIK 623
            WDATYPT +LI+V G E+ GI    A  + SVSALEFCS TL+LAIG+  G+V LY L++
Sbjct: 492  WDATYPTFALIYVLGPEVKGINVADADANASVSALEFCSDTLSLAIGNERGMVCLYKLVR 551

Query: 624  SSNEETLNLVTETGKE-------------------VHILPGGDGPQCKALFSVLNSPICN 664
            S++E TL  VT T KE                   V+ L  GDGPQC A+FS L+SPI  
Sbjct: 552  SADEMTLKFVTGTEKEGITLCILFIFYSLTFNIYAVYTLDQGDGPQCTAVFSFLSSPINA 611

Query: 665  LKFSNFGARLAVGFECSQVAMLDISTFSVLFITDSLSNSNSPVLYLAVKSLSDTSNLTIS 724
            L+F+NFG RLAVGF CSQVA+LD ST SVLF+TDSLS SNSP+  LAV+  SD+S+L  +
Sbjct: 612  LQFANFGTRLAVGFHCSQVALLDTSTSSVLFLTDSLSGSNSPITSLAVRLFSDSSDLINN 671

Query: 725  PKDSDINSSNDTKKETLFFMTKDAHIVVCDSTTGHILFSRSIH-HQESNAIYMCIIEGGN 783
             +D++  +  D  +  +F MTKDAH VV D  TG IL S+SI   +E  +  + IIEG  
Sbjct: 672  REDTESKTMEDHVRLEVFVMTKDAHTVVIDGNTGGILCSQSIKSEKELTSPSLYIIEGDY 731

Query: 784  FFSETSSEKQSLNTPQNSKATSEPDQTNANTGSDPVVAELETSTEATYLERIFEHLFVLL 843
              SE S  K   N+ Q S+A SEP    A + S P+  + E S +A++ ++  E+  +L 
Sbjct: 732  LISEMSRGKHVSNSSQKSEAKSEPVPDVACSESAPLKVDHEASAKASHFKQRVENFLLLF 791

Query: 844  CYEDALWLYPLKSLIQGHTDSIHKVNLLKPCCWTTSFKKNEKECGLVVLYQTGDIEIRVL 903
            C EDAL LY L  +     + I KVNL+KPCCW+T FKK++K+CG+++LYQTG+IEIR L
Sbjct: 792  CCEDALDLYSLNEV---DINPIRKVNLMKPCCWSTQFKKDDKDCGVILLYQTGEIEIRSL 848

Query: 904  PYLEVGGQTSLMSLLRWNYKTNMEETLCSSDSGEIVLV---DFSS-----------IPVS 949
            P LEV G++SLMS+LRWN+KTNME+T+CSS++ +I+LV   +F++           IP S
Sbjct: 849  PDLEVVGESSLMSILRWNFKTNMEKTICSSENAQIILVNGCEFAAISLLACENDFRIPES 908

Query: 950  YPHLHDKVLEAAADATIDLSPAQRKEEGTALGILGGIIKGFKADKAEQNVLIPEVSNKTC 1009
             P LHDK+L AAADATI  SP Q+  +G + GILGG+IKGF+   AE +V + EV     
Sbjct: 909  LPSLHDKLLTAAADATISFSPNQKITQGASSGILGGLIKGFQGSMAEHDVDLFEVCKNNF 968

Query: 1010 AHLDSIFSNPPFLKPSTDIPDDKGVIELNIDDIDIDGPLIVTSSSQ-TSKNDRKDKGTER 1068
            AHL+ IFS+PPFLKPS D+ DD+ V+EL IDDIDID PL V+SSS+  SKND KD+GTER
Sbjct: 969  AHLEGIFSSPPFLKPSIDLVDDQKVVELRIDDIDIDEPLFVSSSSEMMSKNDTKDRGTER 1028

Query: 1069 KKLFEGAATDTKPKSRTVDEIKAKYKKSEVQGTAAAAAQAKDKLAERGEKLEMLRERTEE 1128
            ++LFEGA+TD++PK +T DEIKAKY+K +V   +A AA+AKDKL +R EKLE L ERT E
Sbjct: 1029 ERLFEGASTDSQPKLKTADEIKAKYRKEDV---SAVAARAKDKLIQRQEKLERLSERTAE 1085

Query: 1129 LQNGAQNFADLAGELAKRMERRKWWQL 1155
            LQ+GA+NF  +A ELAK+ME+RKWW +
Sbjct: 1086 LQSGAENFGSMANELAKQMEKRKWWNI 1112

Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|225448459|ref|XP_002272182.1| PREDICTED: uncharacterized protein LOC100250143 [Vitis vinifera] Back     alignment and taxonomy information
>gi|297736595|emb|CBI25466.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|296083169|emb|CBI22805.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|225439408|ref|XP_002263824.1| PREDICTED: uncharacterized protein LOC100257563 [Vitis vinifera] Back     alignment and taxonomy information
>gi|224101159|ref|XP_002312164.1| predicted protein [Populus trichocarpa] gi|222851984|gb|EEE89531.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|449507819|ref|XP_004163137.1| PREDICTED: uncharacterized LOC101208658 [Cucumis sativus] Back     alignment and taxonomy information
>gi|449460945|ref|XP_004148204.1| PREDICTED: uncharacterized protein LOC101208658 [Cucumis sativus] Back     alignment and taxonomy information
>gi|357492733|ref|XP_003616655.1| Syntaxin-binding protein 5-like protein [Medicago truncatula] gi|355517990|gb|AES99613.1| Syntaxin-binding protein 5-like protein [Medicago truncatula] Back     alignment and taxonomy information
>gi|334187437|ref|NP_001190229.1| syntaxin binding protein 5 (tomosyn) [Arabidopsis thaliana] gi|332003508|gb|AED90891.1| syntaxin binding protein 5 (tomosyn) [Arabidopsis thaliana] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query1155
TAIR|locus:21696721124 AT5G05570 "AT5G05570" [Arabido 0.595 0.612 0.421 2.1e-182
FB|FBgn0030412 1470 tomosyn "tomosyn" [Drosophila 0.165 0.129 0.296 4.2e-25
MGI|MGI:19260581152 Stxbp5 "syntaxin binding prote 0.125 0.125 0.315 6.2e-24
RGD|7085171152 Stxbp5 "syntaxin binding prote 0.125 0.125 0.315 1.2e-23
UNIPROTKB|F1S7R81115 STXBP5 "Uncharacterized protei 0.125 0.130 0.328 4.6e-23
UNIPROTKB|Q5T5C01151 STXBP5 "Syntaxin-binding prote 0.125 0.125 0.322 1.2e-22
UNIPROTKB|E1BNK41152 STXBP5 "Uncharacterized protei 0.125 0.125 0.322 3.2e-22
UNIPROTKB|E2R4G21116 STXBP5 "Uncharacterized protei 0.124 0.129 0.317 6.5e-22
UNIPROTKB|E2R4F71152 STXBP5 "Uncharacterized protei 0.124 0.125 0.317 8.2e-22
UNIPROTKB|C9JQS31129 STXBP5L "Syntaxin-binding prot 0.117 0.120 0.345 1.7e-20
TAIR|locus:2169672 AT5G05570 "AT5G05570" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1245 (443.3 bits), Expect = 2.1e-182, Sum P(2) = 2.1e-182
 Identities = 307/729 (42%), Positives = 409/729 (56%)

Query:   243 SQLLLVYANGLIILWDVSEDKVVLVRGSKDLQLKTEIVDDPSKNAGHNLSETVSDNEQVE 302
             ++LL+ ++NGL+ LWD SED VVLVRG+KDL ++ + V D S  A H   + +S+ E   
Sbjct:   200 TRLLIAFSNGLLFLWDASEDHVVLVRGNKDLPVEGKTVAD-SLEASH---DELSNLELDG 255

Query:   303 KEISSLCWASNDGSVLAVGYVDGDILLWNLRAAASTKDWKSENSSTDFGKLQLSSGNRRL 362
             KEISSLCWAS DGSVLAVGYVDGDIL W+        D +    S    KLQLSS  +RL
Sbjct:   256 KEISSLCWASTDGSVLAVGYVDGDILFWDF------SDGQKGKPSNHVVKLQLSSAEKRL 309

Query:   363 PVITLHWSAERSRNDCRGQLFVFGGDEIGSEEVLTMLYLNWSSRIESLKCIGRVDLERKG 422
             PVI +HW  + SR    G+LF++GGD IGS+EVLTML L+WSS +  LKC+GR DL   G
Sbjct:   310 PVIVMHWCLDVSRKSSGGKLFIYGGDIIGSDEVLTMLGLDWSSGMGGLKCVGRADLTLSG 369

Query:   423 SFVDMVLLPNGMNESHGTLPCVLTNPGKLQVYDRPRFXXXXXXXXXXXXXXXLQYPMLIP 482
             SF DMVL P   +   G    +LTNPG+LQ YD                   L YPM++P
Sbjct:   370 SFADMVLSPIASSRQSGVFLFLLTNPGQLQAYDDTSLASLMSQKENKISVSPLPYPMVVP 429

Query:   483 TIEPHMTVGKLCMVCRDGKLSVELSKTLSAAKVRASHTPSTQLTGSTTKWPLTGGIPCQL 542
             T++PHMTV     +  + K S+ LS+ + AAK R   TPS    G + +WPLTGG+P  +
Sbjct:   430 TMDPHMTVATFSALNVNDKTSLALSEIVLAAKARTPRTPS----GESAQWPLTGGVPSHV 485

Query:   543 HDAEDYLVERLYIAGYRDGSTRIWDATYPTLSLIHVFGSELPGIRTATESESVSALEFCS 602
                +DY +ERLY+AGY+DGS RIWDATYP LSLI++   +   I       SV+A  FCS
Sbjct:   486 ---DDYKLERLYMAGYQDGSMRIWDATYPCLSLIYILEPKASVIDITGVDASVTAFCFCS 542

Query:   603 VTLNLAIGSSSGLVWLYNLIKSSNEETLNLVTETGKE-VHILPGGDGPQCKALFSVLNSP 661
              T  LA+G+  G+V LY L+  ++  TL +VT T K+ + I+       C AL   + S 
Sbjct:   543 KTSCLAVGNECGMVRLYKLVGHTSGGTLEVVTNTEKKGLAIVTTLTLWICYALSHAVGSL 602

Query:   662 -ICNLKFSNFGAR--LAVGFECSQVAMLDI--ST--FSVLFITDSLS--NSNSPVLYLAV 712
              + +      G +   A  F  S V  L    ST   +V F    ++  +   P +    
Sbjct:   603 LVAHHLHQEDGPQWLAAFSFLSSPVCTLQFVQSTRRLAVGFKCGKVAVLDIGVPSVLFVT 662

Query:   713 KSLSDT------------SNLTISPKD-SDINSSNDTKKETLFFMTKDAHIVVCDSTTGH 759
              SLSD+            S  T S  D +D NS N      L  MTKD   ++ D  TG 
Sbjct:   663 NSLSDSGSPIKSLYVKSSSAPTGSKSDPTDHNSINSEDDLLLCAMTKDGQTILLDGNTGK 722

Query:   760 ILFSRSIHHQESNAIYMCIIEGGNFFSETSSEKQSLNTPQNSKATSEPDQTNANTGSDPV 819
             IL S     +   AI M IIE      ET SEK + N     K  ++     A+    P 
Sbjct:   723 ILASCLRPLKNPTAICMHIIENCYENYETPSEKPAENPSGKDKHENKSHIIKASESHSPD 782

Query:   820 VAELETSTEATYLERIFEHLFVLLCYEDALWLYPLKSLIQGHTDSIHKVNLLKPCCWTTS 879
               E    TE   +++IF +   L+C EDAL LY +KSL QG  +SI +VNL +PCCW   
Sbjct:   783 -GEQNAVTETKLIDQIFANSLFLMCSEDALRLYTVKSLSQGSLESIMEVNLPRPCCWMGI 841

Query:   880 FKKNEKECGLVVLYQTGDIEIRVLPYLEVGGQTSLMSLLRWNYKTNMEETLCSSDSGEIV 939
              KK+ +EC +++ Y+TG IEIR  P LEV G++SL+SLLRWN+K NME+T+CS D G +V
Sbjct:   842 LKKDGRECAVLLFYRTGHIEIRSFPNLEVVGESSLLSLLRWNFKPNMEKTVCSDDFGHVV 901

Query:   940 LVDFSSIPV 948
             LV+   + +
Sbjct:   902 LVNGCEVAI 910
GO:0000166 "nucleotide binding" evidence=ISS
GO:0003676 "nucleic acid binding" evidence=IEA
GO:0005634 "nucleus" evidence=ISM
GO:0008168 "methyltransferase activity" evidence=IEA
GO:0016021 "integral to membrane" evidence=IEA
GO:0016192 "vesicle-mediated transport" evidence=IEA
GO:0032259 "methylation" evidence=IEA
GO:0005886 "plasma membrane" evidence=IDA
FB|FBgn0030412 tomosyn "tomosyn" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
MGI|MGI:1926058 Stxbp5 "syntaxin binding protein 5 (tomosyn)" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
RGD|708517 Stxbp5 "syntaxin binding protein 5 (tomosyn)" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|F1S7R8 STXBP5 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|Q5T5C0 STXBP5 "Syntaxin-binding protein 5" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|E1BNK4 STXBP5 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|E2R4G2 STXBP5 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|E2R4F7 STXBP5 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|C9JQS3 STXBP5L "Syntaxin-binding protein 5-like" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query1155
pfam0095789 pfam00957, Synaptobrevin, Synaptobrevin 6e-09
>gnl|CDD|201526 pfam00957, Synaptobrevin, Synaptobrevin Back     alignment and domain information 
 Score = 54.1 bits (131), Expect = 6e-09
 Identities = 22/60 (36%), Positives = 36/60 (60%), Gaps = 4/60 (6%)

Query: 1095 KSEVQGTAAAAAQAKDKLAERGEKLEMLRERTEELQNGAQNFADLAGELAKRMERRKWWQ 1154
            +++V        +  DK+ ERGEKL++L ++TE LQ+ AQ F   A +L ++M    WW+
Sbjct: 9    QAQVDEVKDIMTENIDKVLERGEKLDLLVDKTENLQSSAQQFRKQARKLKRKM----WWK 64

Length = 89

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 1155
KOG0319775 consensus WD40-repeat-containing subunit of the 18 100.0
KOG0318603 consensus WD40 repeat stress protein/actin interac 100.0
KOG0319775 consensus WD40-repeat-containing subunit of the 18 100.0
KOG0271480 consensus Notchless-like WD40 repeat-containing pr 100.0
KOG0291893 consensus WD40-repeat-containing subunit of the 18 100.0
KOG0318603 consensus WD40 repeat stress protein/actin interac 100.0
KOG0271480 consensus Notchless-like WD40 repeat-containing pr 100.0
KOG0306888 consensus WD40-repeat-containing subunit of the 18 100.0
KOG0291893 consensus WD40-repeat-containing subunit of the 18 100.0
KOG0306888 consensus WD40-repeat-containing subunit of the 18 100.0
KOG0272459 consensus U4/U6 small nuclear ribonucleoprotein Pr 100.0
KOG0272459 consensus U4/U6 small nuclear ribonucleoprotein Pr 99.98
KOG0315311 consensus G-protein beta subunit-like protein (con 99.97
KOG0286343 consensus G-protein beta subunit [General function 99.97
KOG14081080 consensus WD40 repeat protein [Function unknown] 99.96
KOG1983993 consensus Tomosyn and related SNARE-interacting pr 99.96
KOG0273524 consensus Beta-transducin family (WD-40 repeat) pr 99.96
KOG0296399 consensus Angio-associated migratory cell protein 99.96
KOG0315311 consensus G-protein beta subunit-like protein (con 99.96
KOG0279315 consensus G protein beta subunit-like protein [Sig 99.96
KOG0263707 consensus Transcription initiation factor TFIID, s 99.96
KOG0273524 consensus Beta-transducin family (WD-40 repeat) pr 99.96
KOG0286343 consensus G-protein beta subunit [General function 99.96
KOG0292 1202 consensus Vesicle coat complex COPI, alpha subunit 99.95
KOG0296399 consensus Angio-associated migratory cell protein 99.95
KOG0295406 consensus WD40 repeat-containing protein [Function 99.95
KOG1539910 consensus WD repeat protein [General function pred 99.95
KOG0279315 consensus G protein beta subunit-like protein [Sig 99.95
PLN00181793 protein SPA1-RELATED; Provisional 99.94
KOG2106626 consensus Uncharacterized conserved protein, conta 99.94
KOG0285460 consensus Pleiotropic regulator 1 [RNA processing 99.94
KOG1539910 consensus WD repeat protein [General function pred 99.94
PLN00181793 protein SPA1-RELATED; Provisional 99.94
KOG0292 1202 consensus Vesicle coat complex COPI, alpha subunit 99.94
KOG0263707 consensus Transcription initiation factor TFIID, s 99.94
KOG0645312 consensus WD40 repeat protein [General function pr 99.93
KOG0276794 consensus Vesicle coat complex COPI, beta' subunit 99.93
cd00200289 WD40 WD40 domain, found in a number of eukaryotic 99.93
KOG0284464 consensus Polyadenylation factor I complex, subuni 99.93
KOG0276794 consensus Vesicle coat complex COPI, beta' subunit 99.93
KOG0265338 consensus U5 snRNP-specific protein-like factor an 99.93
KOG14081080 consensus WD40 repeat protein [Function unknown] 99.93
KOG2048691 consensus WD40 repeat protein [General function pr 99.92
KOG1063764 consensus RNA polymerase II elongator complex, sub 99.92
KOG0282503 consensus mRNA splicing factor [Function unknown] 99.92
KOG0266456 consensus WD40 repeat-containing protein [General 99.92
KOG0266456 consensus WD40 repeat-containing protein [General 99.92
cd00200289 WD40 WD40 domain, found in a number of eukaryotic 99.92
KOG0645312 consensus WD40 repeat protein [General function pr 99.92
KOG1407313 consensus WD40 repeat protein [Function unknown] 99.92
KOG0285460 consensus Pleiotropic regulator 1 [RNA processing 99.91
KOG0284464 consensus Polyadenylation factor I complex, subuni 99.91
KOG0295406 consensus WD40 repeat-containing protein [Function 99.91
KOG0293519 consensus WD40 repeat-containing protein [Function 99.91
KOG1063764 consensus RNA polymerase II elongator complex, sub 99.91
KOG0281499 consensus Beta-TrCP (transducin repeats containing 99.91
KOG0265338 consensus U5 snRNP-specific protein-like factor an 99.9
KOG0281499 consensus Beta-TrCP (transducin repeats containing 99.9
KOG0310487 consensus Conserved WD40 repeat-containing protein 99.9
KOG0643327 consensus Translation initiation factor 3, subunit 99.89
KOG0293519 consensus WD40 repeat-containing protein [Function 99.89
KOG0278334 consensus Serine/threonine kinase receptor-associa 99.88
KOG0282503 consensus mRNA splicing factor [Function unknown] 99.88
KOG0268433 consensus Sof1-like rRNA processing protein (conta 99.88
KOG0313423 consensus Microtubule binding protein YTM1 (contai 99.88
KOG0641350 consensus WD40 repeat protein [General function pr 99.88
KOG0316307 consensus Conserved WD40 repeat-containing protein 99.88
KOG0640430 consensus mRNA cleavage stimulating factor complex 99.87
KOG0313423 consensus Microtubule binding protein YTM1 (contai 99.87
PTZ00421493 coronin; Provisional 99.86
KOG2048691 consensus WD40 repeat protein [General function pr 99.86
KOG0316307 consensus Conserved WD40 repeat-containing protein 99.86
KOG0288459 consensus WD40 repeat protein TipD [General functi 99.86
KOG1407313 consensus WD40 repeat protein [Function unknown] 99.85
KOG0643327 consensus Translation initiation factor 3, subunit 99.85
PTZ00420568 coronin; Provisional 99.85
KOG0310487 consensus Conserved WD40 repeat-containing protein 99.85
KOG0772641 consensus Uncharacterized conserved protein, conta 99.85
KOG0275508 consensus Conserved WD40 repeat-containing protein 99.84
KOG0299479 consensus U3 snoRNP-associated protein (contains W 99.84
KOG0772641 consensus Uncharacterized conserved protein, conta 99.84
KOG0275508 consensus Conserved WD40 repeat-containing protein 99.84
KOG0305484 consensus Anaphase promoting complex, Cdc20, Cdh1, 99.84
KOG0640430 consensus mRNA cleavage stimulating factor complex 99.84
KOG0274537 consensus Cdc4 and related F-box and WD-40 protein 99.84
KOG0283712 consensus WD40 repeat-containing protein [Function 99.84
KOG0646476 consensus WD40 repeat protein [General function pr 99.84
KOG0274537 consensus Cdc4 and related F-box and WD-40 protein 99.83
KOG2106626 consensus Uncharacterized conserved protein, conta 99.83
KOG0305484 consensus Anaphase promoting complex, Cdc20, Cdh1, 99.83
PTZ00421493 coronin; Provisional 99.82
KOG0278334 consensus Serine/threonine kinase receptor-associa 99.82
KOG2096420 consensus WD40 repeat protein [General function pr 99.82
KOG0277311 consensus Peroxisomal targeting signal type 2 rece 99.82
KOG0289506 consensus mRNA splicing factor [General function p 99.82
KOG0288459 consensus WD40 repeat protein TipD [General functi 99.81
KOG0277311 consensus Peroxisomal targeting signal type 2 rece 99.81
PTZ00420568 coronin; Provisional 99.81
KOG0973942 consensus Histone transcription regulator HIRA, WD 99.81
KOG0300481 consensus WD40 repeat-containing protein [Function 99.8
KOG0283712 consensus WD40 repeat-containing protein [Function 99.8
KOG0299479 consensus U3 snoRNP-associated protein (contains W 99.79
KOG1446311 consensus Histone H3 (Lys4) methyltransferase comp 99.79
KOG1963792 consensus WD40 repeat protein [General function pr 99.79
KOG0308735 consensus Conserved WD40 repeat-containing protein 99.78
KOG0973 942 consensus Histone transcription regulator HIRA, WD 99.78
KOG0294362 consensus WD40 repeat-containing protein [Function 99.78
TIGR03866300 PQQ_ABC_repeats PQQ-dependent catabolism-associate 99.77
TIGR03866300 PQQ_ABC_repeats PQQ-dependent catabolism-associate 99.77
KOG14451012 consensus Tumor-specific antigen (contains WD repe 99.77
KOG0308735 consensus Conserved WD40 repeat-containing protein 99.77
KOG1036323 consensus Mitotic spindle checkpoint protein BUB3, 99.77
KOG0289506 consensus mRNA splicing factor [General function p 99.76
PF08596395 Lgl_C: Lethal giant larvae(Lgl) like, C-terminal; 99.76
KOG0301 745 consensus Phospholipase A2-activating protein (con 99.76
KOG0300481 consensus WD40 repeat-containing protein [Function 99.75
KOG0268433 consensus Sof1-like rRNA processing protein (conta 99.75
KOG0647347 consensus mRNA export protein (contains WD40 repea 99.75
KOG1332299 consensus Vesicle coat complex COPII, subunit SEC1 99.75
KOG0647347 consensus mRNA export protein (contains WD40 repea 99.74
KOG4283397 consensus Transcription-coupled repair protein CSA 99.74
KOG2055514 consensus WD40 repeat protein [General function pr 99.74
KOG1036323 consensus Mitotic spindle checkpoint protein BUB3, 99.74
KOG0641350 consensus WD40 repeat protein [General function pr 99.73
KOG1446311 consensus Histone H3 (Lys4) methyltransferase comp 99.73
KOG0294362 consensus WD40 repeat-containing protein [Function 99.73
KOG0269839 consensus WD40 repeat-containing protein [Function 99.73
KOG1332299 consensus Vesicle coat complex COPII, subunit SEC1 99.73
KOG0301745 consensus Phospholipase A2-activating protein (con 99.72
KOG2096420 consensus WD40 repeat protein [General function pr 99.72
KOG0264422 consensus Nucleosome remodeling factor, subunit CA 99.7
KOG0650733 consensus WD40 repeat nucleolar protein Bop1, invo 99.7
KOG14451012 consensus Tumor-specific antigen (contains WD repe 99.7
KOG0264422 consensus Nucleosome remodeling factor, subunit CA 99.69
KOG1274 933 consensus WD40 repeat protein [General function pr 99.68
KOG0639705 consensus Transducin-like enhancer of split protei 99.67
KOG0639705 consensus Transducin-like enhancer of split protei 99.66
COG2319466 FOG: WD40 repeat [General function prediction only 99.66
KOG4283397 consensus Transcription-coupled repair protein CSA 99.66
KOG0267 825 consensus Microtubule severing protein katanin p80 99.66
KOG2445361 consensus Nuclear pore complex component (sc Seh1) 99.65
KOG0646476 consensus WD40 repeat protein [General function pr 99.65
KOG2055514 consensus WD40 repeat protein [General function pr 99.65
KOG0321720 consensus WD40 repeat-containing protein L2DTL [Fu 99.65
KOG0321720 consensus WD40 repeat-containing protein L2DTL [Fu 99.64
KOG0860116 consensus Synaptobrevin/VAMP-like protein [Intrace 99.63
KOG2445361 consensus Nuclear pore complex component (sc Seh1) 99.62
KOG0302440 consensus Ribosome Assembly protein [General funct 99.62
KOG1274933 consensus WD40 repeat protein [General function pr 99.62
KOG1538 1081 consensus Uncharacterized conserved protein WDR10, 99.61
KOG4328498 consensus WD40 protein [Function unknown] 99.61
KOG0267825 consensus Microtubule severing protein katanin p80 99.61
KOG0322323 consensus G-protein beta subunit-like protein GNB1 99.61
KOG0269 839 consensus WD40 repeat-containing protein [Function 99.6
KOG0650733 consensus WD40 repeat nucleolar protein Bop1, invo 99.6
KOG1273405 consensus WD40 repeat protein [General function pr 99.59
KOG0270463 consensus WD40 repeat-containing protein [Function 99.58
KOG0270463 consensus WD40 repeat-containing protein [Function 99.58
KOG0322323 consensus G-protein beta subunit-like protein GNB1 99.56
KOG1034385 consensus Transcriptional repressor EED/ESC/FIE, r 99.55
KOG1273405 consensus WD40 repeat protein [General function pr 99.55
COG2319466 FOG: WD40 repeat [General function prediction only 99.55
KOG0302440 consensus Ribosome Assembly protein [General funct 99.54
KOG1034385 consensus Transcriptional repressor EED/ESC/FIE, r 99.53
KOG2919406 consensus Guanine nucleotide-binding protein [Gene 99.53
KOG0859217 consensus Synaptobrevin/VAMP-like protein [Intrace 99.52
KOG15381081 consensus Uncharacterized conserved protein WDR10, 99.52
KOG4378673 consensus Nuclear protein COP1 [Signal transductio 99.51
KOG15171387 consensus Guanine nucleotide binding protein MIP1 99.51
KOG12401431 consensus Protein kinase containing WD40 repeats [ 99.47
KOG15171387 consensus Guanine nucleotide binding protein MIP1 99.46
KOG2919406 consensus Guanine nucleotide-binding protein [Gene 99.45
KOG4328498 consensus WD40 protein [Function unknown] 99.45
KOG1963792 consensus WD40 repeat protein [General function pr 99.45
KOG03071049 consensus Vesicle coat complex COPII, subunit SEC3 99.43
KOG4227609 consensus WD40 repeat protein [General function pr 99.42
KOG0771398 consensus Prolactin regulatory element-binding pro 99.41
KOG06441113 consensus Uncharacterized conserved protein, conta 99.39
PF0095789 Synaptobrevin: Synaptobrevin; InterPro: IPR001388 99.39
KOG4378673 consensus Nuclear protein COP1 [Signal transductio 99.38
KOG0303472 consensus Actin-binding protein Coronin, contains 99.38
KOG1007370 consensus WD repeat protein TSSC1, WD repeat super 99.37
KOG0642577 consensus Cell-cycle nuclear protein, contains WD- 99.37
KOG1587555 consensus Cytoplasmic dynein intermediate chain [C 99.35
KOG0771398 consensus Prolactin regulatory element-binding pro 99.34
KOG1009434 consensus Chromatin assembly complex 1 subunit B/C 99.34
KOG1188376 consensus WD40 repeat protein [General function pr 99.34
PRK11028330 6-phosphogluconolactonase; Provisional 99.33
KOG1587555 consensus Cytoplasmic dynein intermediate chain [C 99.3
KOG12401431 consensus Protein kinase containing WD40 repeats [ 99.29
KOG2394636 consensus WD40 protein DMR-N9 [General function pr 99.27
PRK01742429 tolB translocation protein TolB; Provisional 99.27
KOG1009434 consensus Chromatin assembly complex 1 subunit B/C 99.27
KOG0642577 consensus Cell-cycle nuclear protein, contains WD- 99.25
KOG4227609 consensus WD40 repeat protein [General function pr 99.24
KOG1524737 consensus WD40 repeat-containing protein CHE-2 [Ge 99.23
KOG03071049 consensus Vesicle coat complex COPII, subunit SEC3 99.23
KOG0303472 consensus Actin-binding protein Coronin, contains 99.22
PRK11028330 6-phosphogluconolactonase; Provisional 99.22
KOG0290364 consensus Conserved WD40 repeat-containing protein 99.21
KOG1188376 consensus WD40 repeat protein [General function pr 99.21
KOG19121062 consensus WD40 repeat protein [General function pr 99.2
KOG4497447 consensus Uncharacterized conserved protein WDR8, 99.2
KOG0649325 consensus WD40 repeat protein [General function pr 99.2
KOG2111346 consensus Uncharacterized conserved protein, conta 99.17
PRK03629429 tolB translocation protein TolB; Provisional 99.17
KOG1007370 consensus WD repeat protein TSSC1, WD repeat super 99.16
KOG06441113 consensus Uncharacterized conserved protein, conta 99.15
KOG0649325 consensus WD40 repeat protein [General function pr 99.15
KOG1524737 consensus WD40 repeat-containing protein CHE-2 [Ge 99.15
KOG0290364 consensus Conserved WD40 repeat-containing protein 99.14
KOG2110391 consensus Uncharacterized conserved protein, conta 99.12
PRK01742429 tolB translocation protein TolB; Provisional 99.09
KOG1523361 consensus Actin-related protein Arp2/3 complex, su 99.08
KOG2321703 consensus WD40 repeat protein [General function pr 99.08
PF02239369 Cytochrom_D1: Cytochrome D1 heme domain; PDB: 1NNO 99.07
PF08662194 eIF2A: Eukaryotic translation initiation factor eI 99.07
PRK04922433 tolB translocation protein TolB; Provisional 99.05
PRK05137435 tolB translocation protein TolB; Provisional 99.02
KOG1310758 consensus WD40 repeat protein [General function pr 99.01
PF04762928 IKI3: IKI3 family; InterPro: IPR006849 Members of 99.01
PRK02889427 tolB translocation protein TolB; Provisional 98.95
KOG1334559 consensus WD40 repeat protein [General function pr 98.94
KOG1272545 consensus WD40-repeat-containing subunit of the 18 98.94
PF08662194 eIF2A: Eukaryotic translation initiation factor eI 98.93
PRK05137435 tolB translocation protein TolB; Provisional 98.92
PRK03629429 tolB translocation protein TolB; Provisional 98.92
PRK02889427 tolB translocation protein TolB; Provisional 98.91
KOG1334559 consensus WD40 repeat protein [General function pr 98.89
COG5354561 Uncharacterized protein, contains Trp-Asp (WD) rep 98.89
KOG0974967 consensus WD-repeat protein WDR6, WD repeat superf 98.89
KOG2139445 consensus WD40 repeat protein [General function pr 98.88
KOG1310 758 consensus WD40 repeat protein [General function pr 98.86
KOG2110391 consensus Uncharacterized conserved protein, conta 98.86
PF02239369 Cytochrom_D1: Cytochrome D1 heme domain; PDB: 1NNO 98.85
KOG3881412 consensus Uncharacterized conserved protein [Funct 98.85
KOG4497447 consensus Uncharacterized conserved protein WDR8, 98.84
TIGR02800417 propeller_TolB tol-pal system beta propeller repea 98.8
PRK04922433 tolB translocation protein TolB; Provisional 98.79
KOG2111346 consensus Uncharacterized conserved protein, conta 98.74
PRK00178430 tolB translocation protein TolB; Provisional 98.73
KOG2394636 consensus WD40 protein DMR-N9 [General function pr 98.72
KOG3881412 consensus Uncharacterized conserved protein [Funct 98.72
TIGR02800417 propeller_TolB tol-pal system beta propeller repea 98.71
PRK04792448 tolB translocation protein TolB; Provisional 98.71
KOG2314698 consensus Translation initiation factor 3, subunit 98.7
KOG10642439 consensus RAVE (regulator of V-ATPase assembly) co 98.68
KOG1523361 consensus Actin-related protein Arp2/3 complex, su 98.67
PF04762928 IKI3: IKI3 family; InterPro: IPR006849 Members of 98.65
KOG2321703 consensus WD40 repeat protein [General function pr 98.64
KOG2139445 consensus WD40 repeat protein [General function pr 98.61
KOG1912 1062 consensus WD40 repeat protein [General function pr 98.61
PRK01029428 tolB translocation protein TolB; Provisional 98.59
KOG4547541 consensus WD40 repeat-containing protein [General 98.58
PRK04792448 tolB translocation protein TolB; Provisional 98.58
KOG3914390 consensus WD repeat protein WDR4 [Function unknown 98.56
KOG4547541 consensus WD40 repeat-containing protein [General 98.56
KOG1272545 consensus WD40-repeat-containing subunit of the 18 98.55
PRK00178430 tolB translocation protein TolB; Provisional 98.54
KOG20411189 consensus WD40 repeat protein [General function pr 98.54
KOG2315566 consensus Predicted translation initiation factor 98.52
KOG0974 967 consensus WD-repeat protein WDR6, WD repeat superf 98.52
KOG2315566 consensus Predicted translation initiation factor 98.51
PF10282345 Lactonase: Lactonase, 7-bladed beta-propeller; Int 98.5
PF10282345 Lactonase: Lactonase, 7-bladed beta-propeller; Int 98.46
KOG41901034 consensus Uncharacterized conserved protein [Funct 98.42
KOG1354433 consensus Serine/threonine protein phosphatase 2A, 98.41
TIGR02658352 TTQ_MADH_Hv methylamine dehydrogenase heavy chain. 98.41
KOG1354433 consensus Serine/threonine protein phosphatase 2A, 98.39
PLN029191057 haloacid dehalogenase-like hydrolase family protei 98.38
PF15492282 Nbas_N: Neuroblastoma-amplified sequence, N termin 98.33
PLN029191057 haloacid dehalogenase-like hydrolase family protei 98.31
KOG3914390 consensus WD repeat protein WDR4 [Function unknown 98.31
TIGR02658352 TTQ_MADH_Hv methylamine dehydrogenase heavy chain. 98.29
TIGR03300377 assembly_YfgL outer membrane assembly lipoprotein 98.28
COG5143190 SNC1 Synaptobrevin/VAMP-like protein [Intracellula 98.27
PF0040039 WD40: WD domain, G-beta repeat; InterPro: IPR01978 98.27
TIGR03300377 assembly_YfgL outer membrane assembly lipoprotein 98.26
KOG2041 1189 consensus WD40 repeat protein [General function pr 98.26
PRK01029428 tolB translocation protein TolB; Provisional 98.22
KOG1409404 consensus Uncharacterized conserved protein, conta 98.18
PRK04043419 tolB translocation protein TolB; Provisional 98.15
KOG0309 1081 consensus Conserved WD40 repeat-containing protein 98.11
COG4946668 Uncharacterized protein related to the periplasmic 98.1
KOG0861198 consensus SNARE protein YKT6, synaptobrevin/VAMP s 98.1
COG2706346 3-carboxymuconate cyclase [Carbohydrate transport 98.09
KOG1409404 consensus Uncharacterized conserved protein, conta 98.08
COG2706346 3-carboxymuconate cyclase [Carbohydrate transport 98.05
COG4946668 Uncharacterized protein related to the periplasmic 97.97
KOG2695425 consensus WD40 repeat protein [General function pr 97.96
KOG2314698 consensus Translation initiation factor 3, subunit 97.94
COG5354561 Uncharacterized protein, contains Trp-Asp (WD) rep 97.92
KOG10642439 consensus RAVE (regulator of V-ATPase assembly) co 97.91
KOG0280339 consensus Uncharacterized conserved protein [Amino 97.86
KOG4532344 consensus WD40-like repeat containing protein [Gen 97.85
COG5170460 CDC55 Serine/threonine protein phosphatase 2A, reg 97.84
PRK04043419 tolB translocation protein TolB; Provisional 97.84
KOG0280339 consensus Uncharacterized conserved protein [Amino 97.84
KOG41901034 consensus Uncharacterized conserved protein [Funct 97.81
KOG2066846 consensus Vacuolar assembly/sorting protein VPS41 97.78
PF0040039 WD40: WD domain, G-beta repeat; InterPro: IPR01978 97.71
PF08450246 SGL: SMP-30/Gluconolaconase/LRE-like region; Inter 97.62
KOG4714319 consensus Nucleoporin [Nuclear structure] 97.56
KOG3621 726 consensus WD40 repeat-containing protein [General 97.53
PF13360238 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 97.52
KOG4532344 consensus WD40-like repeat containing protein [Gen 97.52
KOG03091081 consensus Conserved WD40 repeat-containing protein 97.48
PRK11138394 outer membrane biogenesis protein BamB; Provisiona 97.47
KOG2114933 consensus Vacuolar assembly/sorting protein PEP5/V 97.46
KOG2066 846 consensus Vacuolar assembly/sorting protein VPS41 97.45
KOG1645463 consensus RING-finger-containing E3 ubiquitin liga 97.41
PF15492282 Nbas_N: Neuroblastoma-amplified sequence, N termin 97.4
KOG3617 1416 consensus WD40 and TPR repeat-containing protein [ 97.39
KOG4714319 consensus Nucleoporin [Nuclear structure] 97.32
KOG3617 1416 consensus WD40 and TPR repeat-containing protein [ 97.29
PF11768545 DUF3312: Protein of unknown function (DUF3312); In 97.25
KOG2695425 consensus WD40 repeat protein [General function pr 97.25
KOG0882558 consensus Cyclophilin-related peptidyl-prolyl cis- 97.23
PF11768545 DUF3312: Protein of unknown function (DUF3312); In 97.2
PF08450246 SGL: SMP-30/Gluconolaconase/LRE-like region; Inter 97.17
KOG18321516 consensus HIV-1 Vpr-binding protein [Cell cycle co 97.15
PF07433305 DUF1513: Protein of unknown function (DUF1513); In 97.08
PF07433305 DUF1513: Protein of unknown function (DUF1513); In 97.0
KOG3621 726 consensus WD40 repeat-containing protein [General 96.96
PF13360238 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 96.87
PRK11138394 outer membrane biogenesis protein BamB; Provisiona 96.85
KOG0882558 consensus Cyclophilin-related peptidyl-prolyl cis- 96.82
smart0032040 WD40 WD40 repeats. Note that these repeats are per 96.76
PF14783111 BBS2_Mid: Ciliary BBSome complex subunit 2, middle 96.72
KOG1920 1265 consensus IkappaB kinase complex, IKAP component [ 96.72
KOG4640 665 consensus Anaphase-promoting complex (APC), subuni 96.7
PF03178321 CPSF_A: CPSF A subunit region; InterPro: IPR004871 96.69
PRK02888635 nitrous-oxide reductase; Validated 96.65
PF08596395 Lgl_C: Lethal giant larvae(Lgl) like, C-terminal; 96.63
KOG2079 1206 consensus Vacuolar assembly/sorting protein VPS8 [ 96.38
PF00780275 CNH: CNH domain; InterPro: IPR001180 Based on sequ 96.26
KOG0862216 consensus Synaptobrevin/VAMP-like protein SEC22 [I 96.25
KOG19201265 consensus IkappaB kinase complex, IKAP component [ 95.9
PF1289447 Apc4_WD40: Anaphase-promoting complex subunit 4 WD 95.89
PF06433342 Me-amine-dh_H: Methylamine dehydrogenase heavy cha 95.89
PF06977248 SdiA-regulated: SdiA-regulated; InterPro: IPR00972 95.85
PF14783111 BBS2_Mid: Ciliary BBSome complex subunit 2, middle 95.83
KOG1645463 consensus RING-finger-containing E3 ubiquitin liga 95.66
COG5170460 CDC55 Serine/threonine protein phosphatase 2A, reg 95.62
COG3391381 Uncharacterized conserved protein [Function unknow 95.57
KOG4640665 consensus Anaphase-promoting complex (APC), subuni 95.57
KOG12751118 consensus PAB-dependent poly(A) ribonuclease, subu 95.57
KOG2114 933 consensus Vacuolar assembly/sorting protein PEP5/V 95.55
PF08553794 VID27: VID27 cytoplasmic protein; InterPro: IPR013 95.51
KOG1275 1118 consensus PAB-dependent poly(A) ribonuclease, subu 95.36
COG5143190 SNC1 Synaptobrevin/VAMP-like protein [Intracellula 95.23
KOG20791206 consensus Vacuolar assembly/sorting protein VPS8 [ 95.1
PF04841410 Vps16_N: Vps16, N-terminal region; InterPro: IPR00 95.04
PF02897414 Peptidase_S9_N: Prolyl oligopeptidase, N-terminal 95.01
smart0032040 WD40 WD40 repeats. Note that these repeats are per 94.99
COG0823425 TolB Periplasmic component of the Tol biopolymer t 94.81
COG3386307 Gluconolactonase [Carbohydrate transport and metab 94.54
PF00780275 CNH: CNH domain; InterPro: IPR001180 Based on sequ 94.48
KOG18321516 consensus HIV-1 Vpr-binding protein [Cell cycle co 94.47
PF1289447 Apc4_WD40: Anaphase-promoting complex subunit 4 WD 94.0
PF08553794 VID27: VID27 cytoplasmic protein; InterPro: IPR013 93.95
KOG1008783 consensus Uncharacterized conserved protein, conta 93.5
PF06433342 Me-amine-dh_H: Methylamine dehydrogenase heavy cha 93.45
PF04053443 Coatomer_WDAD: Coatomer WD associated region ; Int 93.3
PRK02888635 nitrous-oxide reductase; Validated 93.23
KOG2395644 consensus Protein involved in vacuole import and d 92.99
KOG2444238 consensus WD40 repeat protein [General function pr 92.94
PRK13616591 lipoprotein LpqB; Provisional 92.86
COG3391381 Uncharacterized conserved protein [Function unknow 92.86
PRK13616591 lipoprotein LpqB; Provisional 92.76
PF04053443 Coatomer_WDAD: Coatomer WD associated region ; Int 92.51
cd00216488 PQQ_DH Dehydrogenases with pyrrolo-quinoline quino 92.38
PF10395 670 Utp8: Utp8 family; InterPro: IPR018843 Utp8 is an 92.28
COG3204316 Uncharacterized protein conserved in bacteria [Fun 92.26
cd00216488 PQQ_DH Dehydrogenases with pyrrolo-quinoline quino 91.99
KOG4499310 consensus Ca2+-binding protein Regucalcin/SMP30 [I 91.86
PF10647253 Gmad1: Lipoprotein LpqB beta-propeller domain; Int 91.57
PF03178321 CPSF_A: CPSF A subunit region; InterPro: IPR004871 91.38
PF06977248 SdiA-regulated: SdiA-regulated; InterPro: IPR00972 91.36
KOG4649354 consensus PQQ (pyrrolo-quinoline quinone) repeat p 90.93
KOG4649354 consensus PQQ (pyrrolo-quinoline quinone) repeat p 90.85
COG0823425 TolB Periplasmic component of the Tol biopolymer t 90.72
KOG2444238 consensus WD40 repeat protein [General function pr 90.6
PF14655415 RAB3GAP2_N: Rab3 GTPase-activating protein regulat 90.52
PF04841410 Vps16_N: Vps16, N-terminal region; InterPro: IPR00 90.27
COG3490366 Uncharacterized protein conserved in bacteria [Fun 89.48
PF10168717 Nup88: Nuclear pore component; InterPro: IPR019321 88.95
COG3386307 Gluconolactonase [Carbohydrate transport and metab 88.9
KOG1008783 consensus Uncharacterized conserved protein, conta 88.38
PF08366105 LLGL: LLGL2; InterPro: IPR013577 This domain is fo 88.29
PF14655415 RAB3GAP2_N: Rab3 GTPase-activating protein regulat 87.77
PF08728717 CRT10: CRT10; InterPro: IPR014839 CRT10 is a trans 87.58
PF00930353 DPPIV_N: Dipeptidyl peptidase IV (DPP IV) N-termin 87.58
PF07569219 Hira: TUP1-like enhancer of split; InterPro: IPR01 87.48
COG3490366 Uncharacterized protein conserved in bacteria [Fun 87.15
KOG18971096 consensus Damage-specific DNA binding complex, sub 86.62
PF1031343 DUF2415: Uncharacterised protein domain (DUF2415); 86.29
TIGR03075527 PQQ_enz_alc_DH PQQ-dependent dehydrogenase, methan 86.09
PF10647253 Gmad1: Lipoprotein LpqB beta-propeller domain; Int 85.7
KOG1916 1283 consensus Nuclear protein, contains WD40 repeats [ 85.5
PLN00033398 photosystem II stability/assembly factor; Provisio 85.17
PF14761215 HPS3_N: Hermansky-Pudlak syndrome 3 84.7
PF14870302 PSII_BNR: Photosynthesis system II assembly factor 84.55
PF05096264 Glu_cyclase_2: Glutamine cyclotransferase; InterPr 84.43
PF11715547 Nup160: Nucleoporin Nup120/160; InterPro: IPR02171 83.45
COG3204316 Uncharacterized protein conserved in bacteria [Fun 83.26
PF11715547 Nup160: Nucleoporin Nup120/160; InterPro: IPR02171 82.98
KOG2395644 consensus Protein involved in vacuole import and d 82.8
PF14781136 BBS2_N: Ciliary BBSome complex subunit 2, N-termin 82.4
PF14870302 PSII_BNR: Photosynthesis system II assembly factor 81.88
PHA02713557 hypothetical protein; Provisional 81.67
PF05694461 SBP56: 56kDa selenium binding protein (SBP56); Int 80.9
PF14781136 BBS2_N: Ciliary BBSome complex subunit 2, N-termin 80.82
PRK13684334 Ycf48-like protein; Provisional 80.81
PF02897414 Peptidase_S9_N: Prolyl oligopeptidase, N-terminal 80.69
PF08728717 CRT10: CRT10; InterPro: IPR014839 CRT10 is a trans 80.57
PF05096264 Glu_cyclase_2: Glutamine cyclotransferase; InterPr 80.48
>KOG0319 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification] Back     alignment and domain information 
Probab=100.00  E-value=3.3e-40  Score=378.49  Aligned_cols=495  Identities=18%  Similarity=0.198  Sum_probs=355.3

Q ss_pred             CCCCceEEEEcCCCCEEEEEEcCCeEEEEccCCceEEEEcC-CCCCEEEEEEEcCCcE--EEEEecCCeEEEEECCCCce
Q 001109           41 IPSTASILAFDHVQSLLAIGTQDGRIKVIGGDNIEGLLVSP-KQLAFKHLEFLQNQGF--LVSISSGNEIQLWDLEARRI  117 (1155)
Q Consensus        41 ~~~~vs~lafsp~g~lLAsgs~DG~I~vw~~~~~~~~~~~~-~~~~V~~l~Fs~dg~~--LvS~s~Dg~I~vWDl~t~~~  117 (1155)
                      |.++|..++|+|.|.+||+|+.||.|+|||..+..++..+. |.+.|..+.|.|+..+  |+++..|+++++||+.+++.
T Consensus       104 He~Pvi~ma~~~~g~LlAtggaD~~v~VWdi~~~~~th~fkG~gGvVssl~F~~~~~~~lL~sg~~D~~v~vwnl~~~~t  183 (775)
T KOG0319|consen  104 HEAPVITMAFDPTGTLLATGGADGRVKVWDIKNGYCTHSFKGHGGVVSSLLFHPHWNRWLLASGATDGTVRVWNLNDKRT  183 (775)
T ss_pred             cCCCeEEEEEcCCCceEEeccccceEEEEEeeCCEEEEEecCCCceEEEEEeCCccchhheeecCCCceEEEEEcccCch
Confidence            88999999999999999999999999999999999988774 5889999999998654  78899999999999996654


Q ss_pred             -eeeecCC-CceeEEEEecCCCEEEEEeCCCcEEEEEecCCCceeeccceeccCCceeeeceeEeeEecccccccccccc
Q 001109          118 -TSTLPWE-SNITAFSVIFGTSYMYIGDEYGMVYVLKYDTEEGKLIHSPYYVPKDVIEVFNHLLLEFCPNHIQREKGKAA  195 (1155)
Q Consensus       118 -~~~l~~~-~~Vtsva~spd~~~l~~G~~dG~V~vw~~d~~~~~l~~~~~~i~~~~~~~~~~~~l~~~p~~~~~~~~~~~  195 (1155)
                       ++++..| +.|++++|++|+..+++++.|..+.||++..-+ ++.                                  
T Consensus       184 cl~~~~~H~S~vtsL~~~~d~~~~ls~~RDkvi~vwd~~~~~-~l~----------------------------------  228 (775)
T KOG0319|consen  184 CLHTMILHKSAVTSLAFSEDSLELLSVGRDKVIIVWDLVQYK-KLK----------------------------------  228 (775)
T ss_pred             HHHHHHhhhhheeeeeeccCCceEEEeccCcEEEEeehhhhh-hhh----------------------------------
Confidence             7777777 899999999999999999999999999872211 110                                  


Q ss_pred             cccceeeecCCCCCCCcccccccccccceeeEEEEeecccccccccccEEEEEEcCCeEEEEEccCCeEEEEeccccccc
Q 001109          196 FNASLLFYCMPPDESGFIDFIIRSKLRFFVEIRLLQFQKHVNSTLGFSQLLLVYANGLIILWDVSEDKVVLVRGSKDLQL  275 (1155)
Q Consensus       196 ~~~~~~~~~~~~~~~~~~~~~~~~v~~~~v~~v~~~p~~~~~~~~~~~~llsg~~dG~I~lWd~~~~~~~~~~~~~~~~~  275 (1155)
                                           ..++.. .++++.+-++..+..   ..++.+++++|.+++||..+++++..+.-.+   
T Consensus       229 ---------------------~lp~ye-~~E~vv~l~~~~~~~---~~~~~TaG~~g~~~~~d~es~~~~~~~~~~~---  280 (775)
T KOG0319|consen  229 ---------------------TLPLYE-SLESVVRLREELGGK---GEYIITAGGSGVVQYWDSESGKCVYKQRQSD---  280 (775)
T ss_pred             ---------------------eechhh-heeeEEEechhcCCc---ceEEEEecCCceEEEEecccchhhhhhccCC---
Confidence                                 001111 233355555422100   1479999999999999998887654311100   


Q ss_pred             ccccccCCCC-CCCCC---Cccc---cc---------ccccccCCccEEEEEecCCCeEEEEEcCCcEEEEEcCCCCCcc
Q 001109          276 KTEIVDDPSK-NAGHN---LSET---VS---------DNEQVEKEISSLCWASNDGSVLAVGYVDGDILLWNLRAAASTK  339 (1155)
Q Consensus       276 ~~~~~~~~~~-~~~~~---~~~~---~~---------~~~~~~~~V~sl~~s~pdG~~lasg~~DG~I~lWd~~s~~~~~  339 (1155)
                      ..++...... ..+..   ..++   .+         .--+...+|..++|-.|+.++||++++.+.+|+++.++..+..
T Consensus       281 ~~e~~~~~~~~~~~~~l~vtaeQnl~l~d~~~l~i~k~ivG~ndEI~Dm~~lG~e~~~laVATNs~~lr~y~~~~~~c~i  360 (775)
T KOG0319|consen  281 SEEIDHLLAIESMSQLLLVTAEQNLFLYDEDELTIVKQIVGYNDEILDMKFLGPEESHLAVATNSPELRLYTLPTSYCQI  360 (775)
T ss_pred             chhhhcceeccccCceEEEEccceEEEEEccccEEehhhcCCchhheeeeecCCccceEEEEeCCCceEEEecCCCceEE
Confidence            0001000000 00000   0000   00         0003457899999987889999999999999999888765421


Q ss_pred             ccccCCCCCCcccccccCCCCCccEEEEE-ecccCCCCCCCceEEEecCCCCCCcceEEEEEccCCcccccceeceeeee
Q 001109          340 DWKSENSSTDFGKLQLSSGNRRLPVITLH-WSAERSRNDCRGQLFVFGGDEIGSEEVLTMLYLNWSSRIESLKCIGRVDL  418 (1155)
Q Consensus       340 ~~~~~~~~~~i~kl~l~~~~~~~pI~~l~-w~~~~~~~~~~~~llv~gg~d~~~~~~ltvl~l~~~~~~~~~~~~~~~~l  418 (1155)
                                       ..+|...|.++. |        ..|-++++++.|    +.+.+|.++-....  .-|. ....
T Consensus       361 -----------------i~GH~e~vlSL~~~--------~~g~llat~sKD----~svilWr~~~~~~~--~~~~-a~~~  408 (775)
T KOG0319|consen  361 -----------------IPGHTEAVLSLDVW--------SSGDLLATGSKD----KSVILWRLNNNCSK--SLCV-AQAN  408 (775)
T ss_pred             -----------------EeCchhheeeeeec--------ccCcEEEEecCC----ceEEEEEecCCcch--hhhh-hhhc
Confidence                             236778888885 3        345688888886    78888877432211  1111 1123


Q ss_pred             cCCCceeEEEEecCCCCCCCceeEEEEcCCCeeEEecCCCCCCcccccccccCCCcccCCcccccCCCcceEEEEeeecC
Q 001109          419 ERKGSFVDMVLLPNGMNESHGTLPCVLTNPGKLQVYDRPRFSPKKSQEKKKISSSSLQYPMLIPTIEPHMTVGKLCMVCR  498 (1155)
Q Consensus       419 ~~~~~v~d~~~~~~~~~~~~~~~l~v~~~~G~l~~~d~~~~~~~l~~~~~~~~~~~~~~~~~~~~h~~~It~~~~~~~~~  498 (1155)
                      .|...+..+...     ......++.++.|+++.+|+...     +. +... +......++...|+..|+|        
T Consensus       409 gH~~svgava~~-----~~~asffvsvS~D~tlK~W~l~~-----s~-~~~~-~~~~~~~~t~~aHdKdIN~--------  468 (775)
T KOG0319|consen  409 GHTNSVGAVAGS-----KLGASFFVSVSQDCTLKLWDLPK-----SK-ETAF-PIVLTCRYTERAHDKDINC--------  468 (775)
T ss_pred             ccccccceeeec-----ccCccEEEEecCCceEEEecCCC-----cc-cccc-cceehhhHHHHhhcccccc--------
Confidence            344444444431     12345788889999999999752     00 0000 0000111122223333222        


Q ss_pred             CCchhHHHHHHHHhhccccCCCCCccccCCCccCcccCCCCCcccccccCCcCcEEEEEECCCcEEEEeCCCCCeeeeee
Q 001109          499 DGKLSVELSKTLSAAKVRASHTPSTQLTGSTTKWPLTGGIPCQLHDAEDYLVERLYIAGYRDGSTRIWDATYPTLSLIHV  578 (1155)
Q Consensus       499 ~~~~s~~~~~~~~~~~~~~~~~~s~~~~~~~~~w~l~gg~~~~~~l~~~s~~~~lLaTgs~DgtVrlWD~~~~~l~~l~~  578 (1155)
                                                                   + +++|+..++||||+|+++++|++...  ..+.+
T Consensus       469 ---------------------------------------------V-aia~ndkLiAT~SqDktaKiW~le~~--~l~~v  500 (775)
T KOG0319|consen  469 ---------------------------------------------V-AIAPNDKLIATGSQDKTAKIWDLEQL--RLLGV  500 (775)
T ss_pred             ---------------------------------------------e-EecCCCceEEecccccceeeecccCc--eEEEE
Confidence                                                         2 66788889999999999999999843  34455


Q ss_pred             eCCCcCccccCCCCCCeEEEEEecCCCeEEEEeCCCeEEEEEeccCccccceeeeccCCceEEEecCCCCCceeEEeecC
Q 001109          579 FGSELPGIRTATESESVSALEFCSVTLNLAIGSSSGLVWLYNLIKSSNEETLNLVTETGKEVHILPGGDGPQCKALFSVL  658 (1155)
Q Consensus       579 l~~~~~~i~~~gh~~~V~~lafspdg~~Lasgs~dG~V~lwd~~~~~~~~~~~~v~~~~~~~~~~~~~~g~~~~~~l~~h  658 (1155)
                      +.         ||+..|++|.|+|..+.||+++.|++|+||.+.+                         +.|..+|.||
T Consensus       501 Ls---------GH~RGvw~V~Fs~~dq~laT~SgD~TvKIW~is~-------------------------fSClkT~eGH  546 (775)
T KOG0319|consen  501 LS---------GHTRGVWCVSFSKNDQLLATCSGDKTVKIWSIST-------------------------FSCLKTFEGH  546 (775)
T ss_pred             ee---------CCccceEEEEeccccceeEeccCCceEEEEEecc-------------------------ceeeeeecCc
Confidence            54         8999999999999999999999999999999987                         3467899999


Q ss_pred             CCCeEEEEEcCCCCEEEEEeCCCcEEEEecCCccEEEEeccCCCCCCCeeEEEEeecCCCCccccCCCCCCCCCCCCCCC
Q 001109          659 NSPICNLKFSNFGARLAVGFECSQVAMLDISTFSVLFITDSLSNSNSPVLYLAVKSLSDTSNLTISPKDSDINSSNDTKK  738 (1155)
Q Consensus       659 ~~~VtslafSpdg~~LAsGs~Dg~V~lWDi~~~~~l~~~~~~~~h~~~V~slafs~~~~~~~~~~~~~~~~~~~~~~pd~  738 (1155)
                      +..|.-++|-.+|+.|++++.||.|+||++.++.|+.+.   .+|.+.|++|+-+                      |.+
T Consensus       547 ~~aVlra~F~~~~~qliS~~adGliKlWnikt~eC~~tl---D~H~DrvWaL~~~----------------------~~~  601 (775)
T KOG0319|consen  547 TSAVLRASFIRNGKQLISAGADGLIKLWNIKTNECEMTL---DAHNDRVWALSVS----------------------PLL  601 (775)
T ss_pred             cceeEeeeeeeCCcEEEeccCCCcEEEEeccchhhhhhh---hhccceeEEEeec----------------------Ccc
Confidence            999999999999999999999999999999999998754   5699999999998                      677


Q ss_pred             cEEEEEeCCceEEEEECCC
Q 001109          739 ETLFFMTKDAHIVVCDSTT  757 (1155)
Q Consensus       739 ~~L~s~s~Dg~I~vwd~~t  757 (1155)
                      .++++|+.||.|.+|--.|
T Consensus       602 ~~~~tgg~Dg~i~~wkD~T  620 (775)
T KOG0319|consen  602 DMFVTGGGDGRIIFWKDVT  620 (775)
T ss_pred             ceeEecCCCeEEEEeecCc
Confidence            7899999999999997554

>KOG0318 consensus WD40 repeat stress protein/actin interacting protein [Cytoskeleton] Back     alignment and domain information
>KOG0319 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification] Back     alignment and domain information
>KOG0271 consensus Notchless-like WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0291 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification] Back     alignment and domain information
>KOG0318 consensus WD40 repeat stress protein/actin interacting protein [Cytoskeleton] Back     alignment and domain information
>KOG0271 consensus Notchless-like WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0306 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification] Back     alignment and domain information
>KOG0291 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification] Back     alignment and domain information
>KOG0306 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification] Back     alignment and domain information
>KOG0272 consensus U4/U6 small nuclear ribonucleoprotein Prp4 (contains WD40 repeats) [RNA processing and modification] Back     alignment and domain information
>KOG0272 consensus U4/U6 small nuclear ribonucleoprotein Prp4 (contains WD40 repeats) [RNA processing and modification] Back     alignment and domain information
>KOG0315 consensus G-protein beta subunit-like protein (contains WD40 repeats) [General function prediction only] Back     alignment and domain information
>KOG0286 consensus G-protein beta subunit [General function prediction only] Back     alignment and domain information
>KOG1408 consensus WD40 repeat protein [Function unknown] Back     alignment and domain information
>KOG1983 consensus Tomosyn and related SNARE-interacting proteins [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0273 consensus Beta-transducin family (WD-40 repeat) protein [Chromatin structure and dynamics] Back     alignment and domain information
>KOG0296 consensus Angio-associated migratory cell protein (contains WD40 repeats) [Function unknown] Back     alignment and domain information
>KOG0315 consensus G-protein beta subunit-like protein (contains WD40 repeats) [General function prediction only] Back     alignment and domain information
>KOG0279 consensus G protein beta subunit-like protein [Signal transduction mechanisms] Back     alignment and domain information
>KOG0263 consensus Transcription initiation factor TFIID, subunit TAF5 (also component of histone acetyltransferase SAGA) [Transcription] Back     alignment and domain information
>KOG0273 consensus Beta-transducin family (WD-40 repeat) protein [Chromatin structure and dynamics] Back     alignment and domain information
>KOG0286 consensus G-protein beta subunit [General function prediction only] Back     alignment and domain information
>KOG0292 consensus Vesicle coat complex COPI, alpha subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0296 consensus Angio-associated migratory cell protein (contains WD40 repeats) [Function unknown] Back     alignment and domain information
>KOG0295 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG1539 consensus WD repeat protein [General function prediction only] Back     alignment and domain information
>KOG0279 consensus G protein beta subunit-like protein [Signal transduction mechanisms] Back     alignment and domain information
>PLN00181 protein SPA1-RELATED; Provisional Back     alignment and domain information
>KOG2106 consensus Uncharacterized conserved protein, contains HELP and WD40 domains [Function unknown] Back     alignment and domain information
>KOG0285 consensus Pleiotropic regulator 1 [RNA processing and modification] Back     alignment and domain information
>KOG1539 consensus WD repeat protein [General function prediction only] Back     alignment and domain information
>PLN00181 protein SPA1-RELATED; Provisional Back     alignment and domain information
>KOG0292 consensus Vesicle coat complex COPI, alpha subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0263 consensus Transcription initiation factor TFIID, subunit TAF5 (also component of histone acetyltransferase SAGA) [Transcription] Back     alignment and domain information
>KOG0645 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0276 consensus Vesicle coat complex COPI, beta' subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>cd00200 WD40 WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and botto Back     alignment and domain information
>KOG0284 consensus Polyadenylation factor I complex, subunit PFS2 [RNA processing and modification] Back     alignment and domain information
>KOG0276 consensus Vesicle coat complex COPI, beta' subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0265 consensus U5 snRNP-specific protein-like factor and related proteins [RNA processing and modification] Back     alignment and domain information
>KOG1408 consensus WD40 repeat protein [Function unknown] Back     alignment and domain information
>KOG2048 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG1063 consensus RNA polymerase II elongator complex, subunit ELP2, WD repeat superfamily [Chromatin structure and dynamics; Transcription] Back     alignment and domain information
>KOG0282 consensus mRNA splicing factor [Function unknown] Back     alignment and domain information
>KOG0266 consensus WD40 repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG0266 consensus WD40 repeat-containing protein [General function prediction only] Back     alignment and domain information
>cd00200 WD40 WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and botto Back     alignment and domain information
>KOG0645 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG1407 consensus WD40 repeat protein [Function unknown] Back     alignment and domain information
>KOG0285 consensus Pleiotropic regulator 1 [RNA processing and modification] Back     alignment and domain information
>KOG0284 consensus Polyadenylation factor I complex, subunit PFS2 [RNA processing and modification] Back     alignment and domain information
>KOG0295 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0293 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG1063 consensus RNA polymerase II elongator complex, subunit ELP2, WD repeat superfamily [Chromatin structure and dynamics; Transcription] Back     alignment and domain information
>KOG0281 consensus Beta-TrCP (transducin repeats containing)/Slimb proteins [Function unknown] Back     alignment and domain information
>KOG0265 consensus U5 snRNP-specific protein-like factor and related proteins [RNA processing and modification] Back     alignment and domain information
>KOG0281 consensus Beta-TrCP (transducin repeats containing)/Slimb proteins [Function unknown] Back     alignment and domain information
>KOG0310 consensus Conserved WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0643 consensus Translation initiation factor 3, subunit i (eIF-3i)/TGF-beta receptor-interacting protein (TRIP-1) [Translation, ribosomal structure and biogenesis; Signal transduction mechanisms] Back     alignment and domain information
>KOG0293 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0278 consensus Serine/threonine kinase receptor-associated protein [Lipid transport and metabolism] Back     alignment and domain information
>KOG0282 consensus mRNA splicing factor [Function unknown] Back     alignment and domain information
>KOG0268 consensus Sof1-like rRNA processing protein (contains WD40 repeats) [RNA processing and modification] Back     alignment and domain information
>KOG0313 consensus Microtubule binding protein YTM1 (contains WD40 repeats) [Cytoskeleton] Back     alignment and domain information
>KOG0641 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0316 consensus Conserved WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0640 consensus mRNA cleavage stimulating factor complex; subunit 1 [RNA processing and modification] Back     alignment and domain information
>KOG0313 consensus Microtubule binding protein YTM1 (contains WD40 repeats) [Cytoskeleton] Back     alignment and domain information
>PTZ00421 coronin; Provisional Back     alignment and domain information
>KOG2048 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0316 consensus Conserved WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0288 consensus WD40 repeat protein TipD [General function prediction only] Back     alignment and domain information
>KOG1407 consensus WD40 repeat protein [Function unknown] Back     alignment and domain information
>KOG0643 consensus Translation initiation factor 3, subunit i (eIF-3i)/TGF-beta receptor-interacting protein (TRIP-1) [Translation, ribosomal structure and biogenesis; Signal transduction mechanisms] Back     alignment and domain information
>PTZ00420 coronin; Provisional Back     alignment and domain information
>KOG0310 consensus Conserved WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0772 consensus Uncharacterized conserved protein, contains WD40 repeat [Function unknown] Back     alignment and domain information
>KOG0275 consensus Conserved WD40 repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG0299 consensus U3 snoRNP-associated protein (contains WD40 repeats) [RNA processing and modification] Back     alignment and domain information
>KOG0772 consensus Uncharacterized conserved protein, contains WD40 repeat [Function unknown] Back     alignment and domain information
>KOG0275 consensus Conserved WD40 repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG0305 consensus Anaphase promoting complex, Cdc20, Cdh1, and Ama1 subunits [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0640 consensus mRNA cleavage stimulating factor complex; subunit 1 [RNA processing and modification] Back     alignment and domain information
>KOG0274 consensus Cdc4 and related F-box and WD-40 proteins [General function prediction only] Back     alignment and domain information
>KOG0283 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0646 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0274 consensus Cdc4 and related F-box and WD-40 proteins [General function prediction only] Back     alignment and domain information
>KOG2106 consensus Uncharacterized conserved protein, contains HELP and WD40 domains [Function unknown] Back     alignment and domain information
>KOG0305 consensus Anaphase promoting complex, Cdc20, Cdh1, and Ama1 subunits [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PTZ00421 coronin; Provisional Back     alignment and domain information
>KOG0278 consensus Serine/threonine kinase receptor-associated protein [Lipid transport and metabolism] Back     alignment and domain information
>KOG2096 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0277 consensus Peroxisomal targeting signal type 2 receptor [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0289 consensus mRNA splicing factor [General function prediction only] Back     alignment and domain information
>KOG0288 consensus WD40 repeat protein TipD [General function prediction only] Back     alignment and domain information
>KOG0277 consensus Peroxisomal targeting signal type 2 receptor [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PTZ00420 coronin; Provisional Back     alignment and domain information
>KOG0973 consensus Histone transcription regulator HIRA, WD repeat superfamily [Cell cycle control, cell division, chromosome partitioning; Transcription] Back     alignment and domain information
>KOG0300 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0283 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0299 consensus U3 snoRNP-associated protein (contains WD40 repeats) [RNA processing and modification] Back     alignment and domain information
>KOG1446 consensus Histone H3 (Lys4) methyltransferase complex and RNA cleavage factor II complex, subunit SWD2 [RNA processing and modification; Chromatin structure and dynamics; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1963 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0308 consensus Conserved WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0973 consensus Histone transcription regulator HIRA, WD repeat superfamily [Cell cycle control, cell division, chromosome partitioning; Transcription] Back     alignment and domain information
>KOG0294 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>TIGR03866 PQQ_ABC_repeats PQQ-dependent catabolism-associated beta-propeller protein Back     alignment and domain information
>TIGR03866 PQQ_ABC_repeats PQQ-dependent catabolism-associated beta-propeller protein Back     alignment and domain information
>KOG1445 consensus Tumor-specific antigen (contains WD repeats) [Cytoskeleton] Back     alignment and domain information
>KOG0308 consensus Conserved WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG1036 consensus Mitotic spindle checkpoint protein BUB3, WD repeat superfamily [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0289 consensus mRNA splicing factor [General function prediction only] Back     alignment and domain information
>PF08596 Lgl_C: Lethal giant larvae(Lgl) like, C-terminal; InterPro: IPR013905 The Lethal giant larvae (Lgl) tumour suppressor protein is conserved from yeast to mammals Back     alignment and domain information
>KOG0301 consensus Phospholipase A2-activating protein (contains WD40 repeats) [Lipid transport and metabolism] Back     alignment and domain information
>KOG0300 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0268 consensus Sof1-like rRNA processing protein (contains WD40 repeats) [RNA processing and modification] Back     alignment and domain information
>KOG0647 consensus mRNA export protein (contains WD40 repeats) [RNA processing and modification] Back     alignment and domain information
>KOG1332 consensus Vesicle coat complex COPII, subunit SEC13 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0647 consensus mRNA export protein (contains WD40 repeats) [RNA processing and modification] Back     alignment and domain information
>KOG4283 consensus Transcription-coupled repair protein CSA, contains WD40 domain [Transcription; Replication, recombination and repair] Back     alignment and domain information
>KOG2055 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG1036 consensus Mitotic spindle checkpoint protein BUB3, WD repeat superfamily [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0641 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG1446 consensus Histone H3 (Lys4) methyltransferase complex and RNA cleavage factor II complex, subunit SWD2 [RNA processing and modification; Chromatin structure and dynamics; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0294 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0269 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG1332 consensus Vesicle coat complex COPII, subunit SEC13 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0301 consensus Phospholipase A2-activating protein (contains WD40 repeats) [Lipid transport and metabolism] Back     alignment and domain information
>KOG2096 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0264 consensus Nucleosome remodeling factor, subunit CAF1/NURF55/MSI1 [Chromatin structure and dynamics] Back     alignment and domain information
>KOG0650 consensus WD40 repeat nucleolar protein Bop1, involved in ribosome biogenesis [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG1445 consensus Tumor-specific antigen (contains WD repeats) [Cytoskeleton] Back     alignment and domain information
>KOG0264 consensus Nucleosome remodeling factor, subunit CAF1/NURF55/MSI1 [Chromatin structure and dynamics] Back     alignment and domain information
>KOG1274 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0639 consensus Transducin-like enhancer of split protein (contains WD40 repeats) [Chromatin structure and dynamics] Back     alignment and domain information
>KOG0639 consensus Transducin-like enhancer of split protein (contains WD40 repeats) [Chromatin structure and dynamics] Back     alignment and domain information
>COG2319 FOG: WD40 repeat [General function prediction only] Back     alignment and domain information
>KOG4283 consensus Transcription-coupled repair protein CSA, contains WD40 domain [Transcription; Replication, recombination and repair] Back     alignment and domain information
>KOG0267 consensus Microtubule severing protein katanin p80 subunit B (contains WD40 repeats) [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG2445 consensus Nuclear pore complex component (sc Seh1) [Nuclear structure; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0646 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG2055 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0321 consensus WD40 repeat-containing protein L2DTL [Function unknown] Back     alignment and domain information
>KOG0321 consensus WD40 repeat-containing protein L2DTL [Function unknown] Back     alignment and domain information
>KOG0860 consensus Synaptobrevin/VAMP-like protein [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG2445 consensus Nuclear pore complex component (sc Seh1) [Nuclear structure; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0302 consensus Ribosome Assembly protein [General function prediction only] Back     alignment and domain information
>KOG1274 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG1538 consensus Uncharacterized conserved protein WDR10, contains WD40 repeats [General function prediction only] Back     alignment and domain information
>KOG4328 consensus WD40 protein [Function unknown] Back     alignment and domain information
>KOG0267 consensus Microtubule severing protein katanin p80 subunit B (contains WD40 repeats) [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0322 consensus G-protein beta subunit-like protein GNB1L, contains WD repeats [General function prediction only] Back     alignment and domain information
>KOG0269 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0650 consensus WD40 repeat nucleolar protein Bop1, involved in ribosome biogenesis [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG1273 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0270 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0270 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0322 consensus G-protein beta subunit-like protein GNB1L, contains WD repeats [General function prediction only] Back     alignment and domain information
>KOG1034 consensus Transcriptional repressor EED/ESC/FIE, required for transcriptional silencing, WD repeat superfamily [Transcription] Back     alignment and domain information
>KOG1273 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>COG2319 FOG: WD40 repeat [General function prediction only] Back     alignment and domain information
>KOG0302 consensus Ribosome Assembly protein [General function prediction only] Back     alignment and domain information
>KOG1034 consensus Transcriptional repressor EED/ESC/FIE, required for transcriptional silencing, WD repeat superfamily [Transcription] Back     alignment and domain information
>KOG2919 consensus Guanine nucleotide-binding protein [General function prediction only] Back     alignment and domain information
>KOG0859 consensus Synaptobrevin/VAMP-like protein [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1538 consensus Uncharacterized conserved protein WDR10, contains WD40 repeats [General function prediction only] Back     alignment and domain information
>KOG4378 consensus Nuclear protein COP1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG1517 consensus Guanine nucleotide binding protein MIP1 [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG1240 consensus Protein kinase containing WD40 repeats [Signal transduction mechanisms] Back     alignment and domain information
>KOG1517 consensus Guanine nucleotide binding protein MIP1 [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG2919 consensus Guanine nucleotide-binding protein [General function prediction only] Back     alignment and domain information
>KOG4328 consensus WD40 protein [Function unknown] Back     alignment and domain information
>KOG1963 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0307 consensus Vesicle coat complex COPII, subunit SEC31 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG4227 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0771 consensus Prolactin regulatory element-binding protein/Protein transport protein SEC12p [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0644 consensus Uncharacterized conserved protein, contains WD40 repeat and BROMO domains [General function prediction only] Back     alignment and domain information
>PF00957 Synaptobrevin: Synaptobrevin; InterPro: IPR001388 Synaptobrevin is an intrinsic membrane protein of small synaptic vesicles [], specialised secretory organelles of neurons that actively accumulate neurotransmitters and participate in their calcium-dependent release by exocytosis Back     alignment and domain information
>KOG4378 consensus Nuclear protein COP1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0303 consensus Actin-binding protein Coronin, contains WD40 repeats [Cytoskeleton] Back     alignment and domain information
>KOG1007 consensus WD repeat protein TSSC1, WD repeat superfamily [Function unknown] Back     alignment and domain information
>KOG0642 consensus Cell-cycle nuclear protein, contains WD-40 repeats [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG1587 consensus Cytoplasmic dynein intermediate chain [Cytoskeleton] Back     alignment and domain information
>KOG0771 consensus Prolactin regulatory element-binding protein/Protein transport protein SEC12p [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1009 consensus Chromatin assembly complex 1 subunit B/CAC2 (contains WD40 repeats) [Chromatin structure and dynamics; Replication, recombination and repair] Back     alignment and domain information
>KOG1188 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PRK11028 6-phosphogluconolactonase; Provisional Back     alignment and domain information
>KOG1587 consensus Cytoplasmic dynein intermediate chain [Cytoskeleton] Back     alignment and domain information
>KOG1240 consensus Protein kinase containing WD40 repeats [Signal transduction mechanisms] Back     alignment and domain information
>KOG2394 consensus WD40 protein DMR-N9 [General function prediction only] Back     alignment and domain information
>PRK01742 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG1009 consensus Chromatin assembly complex 1 subunit B/CAC2 (contains WD40 repeats) [Chromatin structure and dynamics; Replication, recombination and repair] Back     alignment and domain information
>KOG0642 consensus Cell-cycle nuclear protein, contains WD-40 repeats [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG4227 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG1524 consensus WD40 repeat-containing protein CHE-2 [General function prediction only] Back     alignment and domain information
>KOG0307 consensus Vesicle coat complex COPII, subunit SEC31 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0303 consensus Actin-binding protein Coronin, contains WD40 repeats [Cytoskeleton] Back     alignment and domain information
>PRK11028 6-phosphogluconolactonase; Provisional Back     alignment and domain information
>KOG0290 consensus Conserved WD40 repeat-containing protein AN11 [Function unknown] Back     alignment and domain information
>KOG1188 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG1912 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG4497 consensus Uncharacterized conserved protein WDR8, contains WD repeats [General function prediction only] Back     alignment and domain information
>KOG0649 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG2111 consensus Uncharacterized conserved protein, contains WD40 repeats [Function unknown] Back     alignment and domain information
>PRK03629 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG1007 consensus WD repeat protein TSSC1, WD repeat superfamily [Function unknown] Back     alignment and domain information
>KOG0644 consensus Uncharacterized conserved protein, contains WD40 repeat and BROMO domains [General function prediction only] Back     alignment and domain information
>KOG0649 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG1524 consensus WD40 repeat-containing protein CHE-2 [General function prediction only] Back     alignment and domain information
>KOG0290 consensus Conserved WD40 repeat-containing protein AN11 [Function unknown] Back     alignment and domain information
>KOG2110 consensus Uncharacterized conserved protein, contains WD40 repeats [Function unknown] Back     alignment and domain information
>PRK01742 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG1523 consensus Actin-related protein Arp2/3 complex, subunit ARPC1/p41-ARC [Cytoskeleton] Back     alignment and domain information
>KOG2321 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PF02239 Cytochrom_D1: Cytochrome D1 heme domain; PDB: 1NNO_B 1HZU_A 1N15_B 1N50_A 1GJQ_A 1BL9_B 1NIR_B 1N90_B 1HZV_A 1AOQ_A Back     alignment and domain information
>PF08662 eIF2A: Eukaryotic translation initiation factor eIF2A; InterPro: IPR013979 This entry contains beta propellor domains found in eukaryotic translation initiation factors and TolB domain-containing proteins Back     alignment and domain information
>PRK04922 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK05137 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG1310 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PF04762 IKI3: IKI3 family; InterPro: IPR006849 Members of this family are components of the elongator multi-subunit component of a novel RNA polymerase II holoenzyme for transcriptional elongation [] Back     alignment and domain information
>PRK02889 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG1334 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG1272 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification] Back     alignment and domain information
>PF08662 eIF2A: Eukaryotic translation initiation factor eIF2A; InterPro: IPR013979 This entry contains beta propellor domains found in eukaryotic translation initiation factors and TolB domain-containing proteins Back     alignment and domain information
>PRK05137 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK03629 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK02889 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG1334 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>COG5354 Uncharacterized protein, contains Trp-Asp (WD) repeat [General function prediction only] Back     alignment and domain information
>KOG0974 consensus WD-repeat protein WDR6, WD repeat superfamily [General function prediction only] Back     alignment and domain information
>KOG2139 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG1310 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG2110 consensus Uncharacterized conserved protein, contains WD40 repeats [Function unknown] Back     alignment and domain information
>PF02239 Cytochrom_D1: Cytochrome D1 heme domain; PDB: 1NNO_B 1HZU_A 1N15_B 1N50_A 1GJQ_A 1BL9_B 1NIR_B 1N90_B 1HZV_A 1AOQ_A Back     alignment and domain information
>KOG3881 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG4497 consensus Uncharacterized conserved protein WDR8, contains WD repeats [General function prediction only] Back     alignment and domain information
>TIGR02800 propeller_TolB tol-pal system beta propeller repeat protein TolB Back     alignment and domain information
>PRK04922 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG2111 consensus Uncharacterized conserved protein, contains WD40 repeats [Function unknown] Back     alignment and domain information
>PRK00178 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG2394 consensus WD40 protein DMR-N9 [General function prediction only] Back     alignment and domain information
>KOG3881 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>TIGR02800 propeller_TolB tol-pal system beta propeller repeat protein TolB Back     alignment and domain information
>PRK04792 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG2314 consensus Translation initiation factor 3, subunit b (eIF-3b) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG1064 consensus RAVE (regulator of V-ATPase assembly) complex subunit RAV1/DMX protein, WD repeat superfamily [General function prediction only] Back     alignment and domain information
>KOG1523 consensus Actin-related protein Arp2/3 complex, subunit ARPC1/p41-ARC [Cytoskeleton] Back     alignment and domain information
>PF04762 IKI3: IKI3 family; InterPro: IPR006849 Members of this family are components of the elongator multi-subunit component of a novel RNA polymerase II holoenzyme for transcriptional elongation [] Back     alignment and domain information
>KOG2321 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG2139 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG1912 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PRK01029 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG4547 consensus WD40 repeat-containing protein [General function prediction only] Back     alignment and domain information
>PRK04792 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG3914 consensus WD repeat protein WDR4 [Function unknown] Back     alignment and domain information
>KOG4547 consensus WD40 repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG1272 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification] Back     alignment and domain information
>PRK00178 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG2041 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG2315 consensus Predicted translation initiation factor related to eIF-3a [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG0974 consensus WD-repeat protein WDR6, WD repeat superfamily [General function prediction only] Back     alignment and domain information
>KOG2315 consensus Predicted translation initiation factor related to eIF-3a [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PF10282 Lactonase: Lactonase, 7-bladed beta-propeller; InterPro: IPR019405 6-phosphogluconolactonases (6PGL) 3 Back     alignment and domain information
>PF10282 Lactonase: Lactonase, 7-bladed beta-propeller; InterPro: IPR019405 6-phosphogluconolactonases (6PGL) 3 Back     alignment and domain information
>KOG4190 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1354 consensus Serine/threonine protein phosphatase 2A, regulatory subunit [Signal transduction mechanisms] Back     alignment and domain information
>TIGR02658 TTQ_MADH_Hv methylamine dehydrogenase heavy chain Back     alignment and domain information
>KOG1354 consensus Serine/threonine protein phosphatase 2A, regulatory subunit [Signal transduction mechanisms] Back     alignment and domain information
>PLN02919 haloacid dehalogenase-like hydrolase family protein Back     alignment and domain information
>PF15492 Nbas_N: Neuroblastoma-amplified sequence, N terminal Back     alignment and domain information
>PLN02919 haloacid dehalogenase-like hydrolase family protein Back     alignment and domain information
>KOG3914 consensus WD repeat protein WDR4 [Function unknown] Back     alignment and domain information
>TIGR02658 TTQ_MADH_Hv methylamine dehydrogenase heavy chain Back     alignment and domain information
>TIGR03300 assembly_YfgL outer membrane assembly lipoprotein YfgL Back     alignment and domain information
>COG5143 SNC1 Synaptobrevin/VAMP-like protein [Intracellular trafficking and secretion] Back     alignment and domain information
>PF00400 WD40: WD domain, G-beta repeat; InterPro: IPR019781 WD-40 repeats (also known as WD or beta-transducin repeats) are short ~40 amino acid motifs, often terminating in a Trp-Asp (W-D) dipeptide Back     alignment and domain information
>TIGR03300 assembly_YfgL outer membrane assembly lipoprotein YfgL Back     alignment and domain information
>KOG2041 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PRK01029 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG1409 consensus Uncharacterized conserved protein, contains WD40 repeats and FYVE domains [Function unknown] Back     alignment and domain information
>PRK04043 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG0309 consensus Conserved WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>COG4946 Uncharacterized protein related to the periplasmic component of the Tol biopolymer transport system [Function unknown] Back     alignment and domain information
>KOG0861 consensus SNARE protein YKT6, synaptobrevin/VAMP syperfamily [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>COG2706 3-carboxymuconate cyclase [Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG1409 consensus Uncharacterized conserved protein, contains WD40 repeats and FYVE domains [Function unknown] Back     alignment and domain information
>COG2706 3-carboxymuconate cyclase [Carbohydrate transport and metabolism] Back     alignment and domain information
>COG4946 Uncharacterized protein related to the periplasmic component of the Tol biopolymer transport system [Function unknown] Back     alignment and domain information
>KOG2695 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG2314 consensus Translation initiation factor 3, subunit b (eIF-3b) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>COG5354 Uncharacterized protein, contains Trp-Asp (WD) repeat [General function prediction only] Back     alignment and domain information
>KOG1064 consensus RAVE (regulator of V-ATPase assembly) complex subunit RAV1/DMX protein, WD repeat superfamily [General function prediction only] Back     alignment and domain information
>KOG0280 consensus Uncharacterized conserved protein [Amino acid transport and metabolism] Back     alignment and domain information
>KOG4532 consensus WD40-like repeat containing protein [General function prediction only] Back     alignment and domain information
>COG5170 CDC55 Serine/threonine protein phosphatase 2A, regulatory subunit [Signal transduction mechanisms] Back     alignment and domain information
>PRK04043 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG0280 consensus Uncharacterized conserved protein [Amino acid transport and metabolism] Back     alignment and domain information
>KOG4190 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2066 consensus Vacuolar assembly/sorting protein VPS41 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF00400 WD40: WD domain, G-beta repeat; InterPro: IPR019781 WD-40 repeats (also known as WD or beta-transducin repeats) are short ~40 amino acid motifs, often terminating in a Trp-Asp (W-D) dipeptide Back     alignment and domain information
>PF08450 SGL: SMP-30/Gluconolaconase/LRE-like region; InterPro: IPR013658 This family describes a region that is found in proteins expressed by a variety of eukaryotic and prokaryotic species Back     alignment and domain information
>KOG4714 consensus Nucleoporin [Nuclear structure] Back     alignment and domain information
>KOG3621 consensus WD40 repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF13360 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 3Q54_A 2YH3_A 3PRW_A 3P1L_A 3Q7M_A 3Q7O_A 3Q7N_A Back     alignment and domain information
>KOG4532 consensus WD40-like repeat containing protein [General function prediction only] Back     alignment and domain information
>KOG0309 consensus Conserved WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>PRK11138 outer membrane biogenesis protein BamB; Provisional Back     alignment and domain information
>KOG2114 consensus Vacuolar assembly/sorting protein PEP5/VPS11 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG2066 consensus Vacuolar assembly/sorting protein VPS41 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1645 consensus RING-finger-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF15492 Nbas_N: Neuroblastoma-amplified sequence, N terminal Back     alignment and domain information
>KOG3617 consensus WD40 and TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG4714 consensus Nucleoporin [Nuclear structure] Back     alignment and domain information
>KOG3617 consensus WD40 and TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF11768 DUF3312: Protein of unknown function (DUF3312); InterPro: IPR024511 This is a eukaryotic family of uncharacterised proteins that contain WD40 repeats Back     alignment and domain information
>KOG2695 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0882 consensus Cyclophilin-related peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF11768 DUF3312: Protein of unknown function (DUF3312); InterPro: IPR024511 This is a eukaryotic family of uncharacterised proteins that contain WD40 repeats Back     alignment and domain information
>PF08450 SGL: SMP-30/Gluconolaconase/LRE-like region; InterPro: IPR013658 This family describes a region that is found in proteins expressed by a variety of eukaryotic and prokaryotic species Back     alignment and domain information
>KOG1832 consensus HIV-1 Vpr-binding protein [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PF07433 DUF1513: Protein of unknown function (DUF1513); InterPro: IPR008311 There are currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function Back     alignment and domain information
>PF07433 DUF1513: Protein of unknown function (DUF1513); InterPro: IPR008311 There are currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function Back     alignment and domain information
>KOG3621 consensus WD40 repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF13360 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 3Q54_A 2YH3_A 3PRW_A 3P1L_A 3Q7M_A 3Q7O_A 3Q7N_A Back     alignment and domain information
>PRK11138 outer membrane biogenesis protein BamB; Provisional Back     alignment and domain information
>KOG0882 consensus Cyclophilin-related peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>smart00320 WD40 WD40 repeats Back     alignment and domain information
>PF14783 BBS2_Mid: Ciliary BBSome complex subunit 2, middle region Back     alignment and domain information
>KOG1920 consensus IkappaB kinase complex, IKAP component [Transcription] Back     alignment and domain information
>KOG4640 consensus Anaphase-promoting complex (APC), subunit 4 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF03178 CPSF_A: CPSF A subunit region; InterPro: IPR004871 This family includes a region that lies towards the C terminus of the cleavage and polyadenylation specificity factor (CPSF) A (160 kDa) subunit Back     alignment and domain information
>PRK02888 nitrous-oxide reductase; Validated Back     alignment and domain information
>PF08596 Lgl_C: Lethal giant larvae(Lgl) like, C-terminal; InterPro: IPR013905 The Lethal giant larvae (Lgl) tumour suppressor protein is conserved from yeast to mammals Back     alignment and domain information
>KOG2079 consensus Vacuolar assembly/sorting protein VPS8 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF00780 CNH: CNH domain; InterPro: IPR001180 Based on sequence similarities a domain of homology has been identified in the following proteins []: Citron and Citron kinase Back     alignment and domain information
>KOG0862 consensus Synaptobrevin/VAMP-like protein SEC22 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1920 consensus IkappaB kinase complex, IKAP component [Transcription] Back     alignment and domain information
>PF12894 Apc4_WD40: Anaphase-promoting complex subunit 4 WD40 domain Back     alignment and domain information
>PF06433 Me-amine-dh_H: Methylamine dehydrogenase heavy chain (MADH); InterPro: IPR009451 Methylamine dehydrogenase (1 Back     alignment and domain information
>PF06977 SdiA-regulated: SdiA-regulated; InterPro: IPR009722 This entry represents a conserved region approximately 100 residues long within a number of hypothetical bacterial proteins that may be regulated by SdiA, a member of the LuxR family of transcriptional regulators [] Back     alignment and domain information
>PF14783 BBS2_Mid: Ciliary BBSome complex subunit 2, middle region Back     alignment and domain information
>KOG1645 consensus RING-finger-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5170 CDC55 Serine/threonine protein phosphatase 2A, regulatory subunit [Signal transduction mechanisms] Back     alignment and domain information
>COG3391 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG4640 consensus Anaphase-promoting complex (APC), subunit 4 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1275 consensus PAB-dependent poly(A) ribonuclease, subunit PAN2 [Replication, recombination and repair] Back     alignment and domain information
>KOG2114 consensus Vacuolar assembly/sorting protein PEP5/VPS11 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF08553 VID27: VID27 cytoplasmic protein; InterPro: IPR013863 This entry represents fungal and plant proteins and contains many hypothetical proteins Back     alignment and domain information
>KOG1275 consensus PAB-dependent poly(A) ribonuclease, subunit PAN2 [Replication, recombination and repair] Back     alignment and domain information
>COG5143 SNC1 Synaptobrevin/VAMP-like protein [Intracellular trafficking and secretion] Back     alignment and domain information
>KOG2079 consensus Vacuolar assembly/sorting protein VPS8 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF04841 Vps16_N: Vps16, N-terminal region; InterPro: IPR006926 This protein forms part of the Class C vacuolar protein sorting (Vps) complex Back     alignment and domain information
>PF02897 Peptidase_S9_N: Prolyl oligopeptidase, N-terminal beta-propeller domain; InterPro: IPR004106 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>smart00320 WD40 WD40 repeats Back     alignment and domain information
>COG0823 TolB Periplasmic component of the Tol biopolymer transport system [Intracellular trafficking and secretion] Back     alignment and domain information
>COG3386 Gluconolactonase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PF00780 CNH: CNH domain; InterPro: IPR001180 Based on sequence similarities a domain of homology has been identified in the following proteins []: Citron and Citron kinase Back     alignment and domain information
>KOG1832 consensus HIV-1 Vpr-binding protein [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PF12894 Apc4_WD40: Anaphase-promoting complex subunit 4 WD40 domain Back     alignment and domain information
>PF08553 VID27: VID27 cytoplasmic protein; InterPro: IPR013863 This entry represents fungal and plant proteins and contains many hypothetical proteins Back     alignment and domain information
>KOG1008 consensus Uncharacterized conserved protein, contains WD40 repeats [Function unknown] Back     alignment and domain information
>PF06433 Me-amine-dh_H: Methylamine dehydrogenase heavy chain (MADH); InterPro: IPR009451 Methylamine dehydrogenase (1 Back     alignment and domain information
>PF04053 Coatomer_WDAD: Coatomer WD associated region ; InterPro: IPR006692 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>PRK02888 nitrous-oxide reductase; Validated Back     alignment and domain information
>KOG2395 consensus Protein involved in vacuole import and degradation [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG2444 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PRK13616 lipoprotein LpqB; Provisional Back     alignment and domain information
>COG3391 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK13616 lipoprotein LpqB; Provisional Back     alignment and domain information
>PF04053 Coatomer_WDAD: Coatomer WD associated region ; InterPro: IPR006692 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>cd00216 PQQ_DH Dehydrogenases with pyrrolo-quinoline quinone (PQQ) as cofactor, like ethanol, methanol, and membrane bound glucose dehydrogenases Back     alignment and domain information
>PF10395 Utp8: Utp8 family; InterPro: IPR018843 Utp8 is an essential component of the nuclear tRNA export machinery in Saccharomyces cerevisiae (Baker's yeast) Back     alignment and domain information
>COG3204 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>cd00216 PQQ_DH Dehydrogenases with pyrrolo-quinoline quinone (PQQ) as cofactor, like ethanol, methanol, and membrane bound glucose dehydrogenases Back     alignment and domain information
>KOG4499 consensus Ca2+-binding protein Regucalcin/SMP30 [Inorganic ion transport and metabolism; Signal transduction mechanisms] Back     alignment and domain information
>PF10647 Gmad1: Lipoprotein LpqB beta-propeller domain; InterPro: IPR018910 The Gmad1 domain is found associated with IPR019606 from INTERPRO, in bacterial spore formation Back     alignment and domain information
>PF03178 CPSF_A: CPSF A subunit region; InterPro: IPR004871 This family includes a region that lies towards the C terminus of the cleavage and polyadenylation specificity factor (CPSF) A (160 kDa) subunit Back     alignment and domain information
>PF06977 SdiA-regulated: SdiA-regulated; InterPro: IPR009722 This entry represents a conserved region approximately 100 residues long within a number of hypothetical bacterial proteins that may be regulated by SdiA, a member of the LuxR family of transcriptional regulators [] Back     alignment and domain information
>KOG4649 consensus PQQ (pyrrolo-quinoline quinone) repeat protein [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>KOG4649 consensus PQQ (pyrrolo-quinoline quinone) repeat protein [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>COG0823 TolB Periplasmic component of the Tol biopolymer transport system [Intracellular trafficking and secretion] Back     alignment and domain information
>KOG2444 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PF14655 RAB3GAP2_N: Rab3 GTPase-activating protein regulatory subunit N-terminus Back     alignment and domain information
>PF04841 Vps16_N: Vps16, N-terminal region; InterPro: IPR006926 This protein forms part of the Class C vacuolar protein sorting (Vps) complex Back     alignment and domain information
>COG3490 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF10168 Nup88: Nuclear pore component; InterPro: IPR019321 Nup88 can be divided into two structural domains; the N-terminal two-thirds of the protein have no obvious structural motifs Back     alignment and domain information
>COG3386 Gluconolactonase [Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG1008 consensus Uncharacterized conserved protein, contains WD40 repeats [Function unknown] Back     alignment and domain information
>PF08366 LLGL: LLGL2; InterPro: IPR013577 This domain is found in lethal giant larvae homologue 2 (LLGL2) proteins and syntaxin-binding proteins like tomosyn [] Back     alignment and domain information
>PF14655 RAB3GAP2_N: Rab3 GTPase-activating protein regulatory subunit N-terminus Back     alignment and domain information
>PF08728 CRT10: CRT10; InterPro: IPR014839 CRT10 is a transcriptional regulator of ribonucleotide reductase (RNR) genes [] Back     alignment and domain information
>PF00930 DPPIV_N: Dipeptidyl peptidase IV (DPP IV) N-terminal region; InterPro: IPR002469 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>PF07569 Hira: TUP1-like enhancer of split; InterPro: IPR011494 The Hira proteins are found in a range of eukaryotes and are implicated in the assembly of repressive chromatin Back     alignment and domain information
>COG3490 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>KOG1897 consensus Damage-specific DNA binding complex, subunit DDB1 [Replication, recombination and repair] Back     alignment and domain information
>PF10313 DUF2415: Uncharacterised protein domain (DUF2415); InterPro: IPR019417 This entry represents a short (30 residues) domain of unknown function found in a family of fungal proteins Back     alignment and domain information
>TIGR03075 PQQ_enz_alc_DH PQQ-dependent dehydrogenase, methanol/ethanol family Back     alignment and domain information
>PF10647 Gmad1: Lipoprotein LpqB beta-propeller domain; InterPro: IPR018910 The Gmad1 domain is found associated with IPR019606 from INTERPRO, in bacterial spore formation Back     alignment and domain information
>KOG1916 consensus Nuclear protein, contains WD40 repeats [General function prediction only] Back     alignment and domain information
>PLN00033 photosystem II stability/assembly factor; Provisional Back     alignment and domain information
>PF14761 HPS3_N: Hermansky-Pudlak syndrome 3 Back     alignment and domain information
>PF14870 PSII_BNR: Photosynthesis system II assembly factor YCF48; PDB: 2XBG_A Back     alignment and domain information
>PF05096 Glu_cyclase_2: Glutamine cyclotransferase; InterPro: IPR007788 This family of enzymes 2 Back     alignment and domain information
>PF11715 Nup160: Nucleoporin Nup120/160; InterPro: IPR021717 Nup120 is conserved from fungi to plants to humans, and is homologous with the Nup160 of vertebrates Back     alignment and domain information
>COG3204 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF11715 Nup160: Nucleoporin Nup120/160; InterPro: IPR021717 Nup120 is conserved from fungi to plants to humans, and is homologous with the Nup160 of vertebrates Back     alignment and domain information
>KOG2395 consensus Protein involved in vacuole import and degradation [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF14781 BBS2_N: Ciliary BBSome complex subunit 2, N-terminal Back     alignment and domain information
>PF14870 PSII_BNR: Photosynthesis system II assembly factor YCF48; PDB: 2XBG_A Back     alignment and domain information
>PHA02713 hypothetical protein; Provisional Back     alignment and domain information
>PF05694 SBP56: 56kDa selenium binding protein (SBP56); InterPro: IPR008826 This family consists of several eukaryotic selenium binding proteins as well as three sequences from archaea Back     alignment and domain information
>PF14781 BBS2_N: Ciliary BBSome complex subunit 2, N-terminal Back     alignment and domain information
>PRK13684 Ycf48-like protein; Provisional Back     alignment and domain information
>PF02897 Peptidase_S9_N: Prolyl oligopeptidase, N-terminal beta-propeller domain; InterPro: IPR004106 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>PF08728 CRT10: CRT10; InterPro: IPR014839 CRT10 is a transcriptional regulator of ribonucleotide reductase (RNR) genes [] Back     alignment and domain information
>PF05096 Glu_cyclase_2: Glutamine cyclotransferase; InterPro: IPR007788 This family of enzymes 2 Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query1155
2oaj_A902 Crystal Structure Of Sro7 From S. Cerevisiae Length 1e-05
>pdb|2OAJ|A Chain A, Crystal Structure Of Sro7 From S. Cerevisiae Length = 902 Back     alignment and structure 
Iteration: 1

 Score = 49.3 bits (116), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 36/133 (27%), Positives = 66/133 (49%), Gaps = 3/133 (2%)
Query: 28  SKDFDPRVTLHYGIPSTASILAFDHVQSLLAIGTQDGRIKVIGGDNIEGLLVSPKQLAFK 87
           +K F    T  YG+ S     AFD  Q+LLAI T  G + + G   +E ++    + A K
Sbjct: 3   NKIFSLAETNKYGMSSKPIAAAFDFTQNLLAIATVTGEVHIYGQQQVEVVIKLEDRSAIK 62
Query: 88  HLEFLQNQGFLVSISSGNEIQLWDLEARRITSTLPWESNITAFSVIFGTSYMYIGDEYGM 147
            + F++   +LV I++ + + +  L ++++ +T+     IT+        +M IG + G 
Sbjct: 63  EMRFVKGI-YLVVINAKDTVYVLSLYSQKVLTTVFVPGKITSIDTDASLDWMLIGLQNGS 121
Query: 148 VYVLKYDTEEGKL 160
           + V  YD +  +L
Sbjct: 122 MIV--YDIDRDQL 132

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query1155
2oaj_A902 Protein SNI1; WD40 repeat, beta propeller, endocyt 2e-79
1vt4_I1221 APAF-1 related killer DARK; drosophila apoptosome, 7e-14
1vt4_I1221 APAF-1 related killer DARK; drosophila apoptosome, 8e-10
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 5e-08
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 9e-08
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-04
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 5e-04
1urq_A63 M-tomosyn isoform; transport protein, tomosyn-snar 1e-11
1sfc_A96 VAMP 2, protein (synaptobrevin 2); membrane fusion 2e-08
2nps_A74 VAMP-4, vesicle-associated membrane protein 4; ves 3e-08
1l4a_A80 Synaptobrevin; snare, snare complex, membrane fusi 5e-08
3b5n_A61 Synaptobrevin homolog 1; snare complex, syntaxin, 6e-08
1n7s_A63 Vesicle-associated membrane protein 2; neuronal sn 7e-08
3hd7_A91 Vesicle-associated membrane protein 2; membrane pr 1e-06
2kog_A119 Vesicle-associated membrane protein 2; synaptobrev 2e-06
2nut_C196 Vesicle-trafficking protein SEC22B; human copii SE 5e-06
1gl2_A65 Endobrevin; membrane protein, membrane fusion prot 5e-06
3vu4_A355 KMHSV2; beta-propeller fold, protein transport; 2. 1e-04
>2oaj_A Protein SNI1; WD40 repeat, beta propeller, endocytosis/exocytosis complex; 2.40A {Saccharomyces cerevisiae} Length = 902 Back     alignment and structure
 Score =  279 bits (713), Expect = 2e-79
 Identities = 131/943 (13%), Positives = 283/943 (30%), Gaps = 151/943 (16%)

Query: 28  SKDFDPRVTLHYGIPSTASILAFDHVQSLLAIGTQDGRIKVIGGDNIEGLLVSPKQLAFK 87
           +K F    T  YG+ S     AFD  Q+LLAI T  G + + G   +E ++    + A K
Sbjct: 3   NKIFSLAETNKYGMSSKPIAAAFDFTQNLLAIATVTGEVHIYGQQQVEVVIKLEDRSAIK 62

Query: 88  HLEFLQNQGFLVSISSGNEIQLWDLEARRITSTLPWESNITAFSVIFGTSYMYIGDEYGM 147
            + F++   +LV I++ + + +  L ++++ +T+     IT+        +M IG + G 
Sbjct: 63  EMRFVKG-IYLVVINAKDTVYVLSLYSQKVLTTVFVPGKITSIDTDASLDWMLIGLQNGS 121

Query: 148 VYVLKYDTEEGKLIHSPYYVPKDVIEVFNHLLLEFCPNHIQREKGKAAFNASLLFYCMPP 207
           + V   D ++     S + +                 N  +     AA  + ++     P
Sbjct: 122 MIVYDIDRDQ----LSSFKLD----------------NLQKSSFFPAARLSPIVSIQWNP 161

Query: 208 DESGFIDFIIRSKLRFFVEIRLLQFQKHVNSTLGFSQLLLVYANGLIILWDVSEDKVVLV 267
            + G                                  +L+    + + + + E+++   
Sbjct: 162 RDIG---------------------------------TVLISYEYVTLTYSLVENEIK-- 186

Query: 268 RGSKDLQLKTEIVDDPSKNAGHNLSETVSDNEQVEKEISSLCWASNDGSVLAVGYVDGDI 327
                   ++ I + P    G + SE  ++  +   ++    +   +   +   + D  +
Sbjct: 187 --------QSFIYELPPFAPGGDFSEKTNE--KRTPKVIQSLY-HPNSLHIITIHEDNSL 235

Query: 328 LLWNLRAAASTKDWKSE--NSSTDFGKLQLSSGNRRLPVITLHWSAERSRNDCRGQLFVF 385
           + W+  +              +         S      +  ++W  E +  +    L   
Sbjct: 236 VFWDANSGHMIMARTVFETEINVPQPDYIRDSSTNAAKISKVYWMCENN-PEYTSLLISH 294

Query: 386 GGDEIGSEEVLTMLYLNWSSRIESLKCIGRVDLERKGSFVDMVLLPNGMNESHGTLPCVL 445
                G  + LTM+ L ++ R       G  +       + +  LP         +  +L
Sbjct: 295 KSISRGDNQSLTMIDLGYTPRYSITSYEGMKNYYANPKQMKIFPLPTN-----VPIVNIL 349

Query: 446 TNPGKLQVYDRPRFSPKKSQEKKKISSSSLQYPMLIPTIEPHMTVGKLCMVCRDGKLSVE 505
             P +   +                   ++ YP  I T +  +    L  +         
Sbjct: 350 PIPRQSPYFAGCHNPGLILLILGNGEIETMLYPSGIFTDKASLFPQNLSWLRPLAT---- 405

Query: 506 LSKTLSAAKVRASHTPSTQLTGSTTKWPLTGGIPCQLHDAEDYLVERLYIAGYRDGSTRI 565
              T  AA V                + L GG+  +            +I G+ +GS RI
Sbjct: 406 ---TSMAASVPNKLWLGALSAAQNKDYLLKGGVRTKRQKLPAE-YGTAFITGHSNGSVRI 461

Query: 566 WDATYPTLSLIHVFGSELPGIRTATESESVSALEFCSVTLNLAIGSSSGLVWLYNLIKSS 625
           +DA++  +     F   L       +  +V  + F + TL LA+   +G V L+    + 
Sbjct: 462 YDASHGDIQDNASFEVNLSRTLNKAKELAVDKISFAAETLELAVSIETGDVVLFKYEVNQ 521

Query: 626 NEETLNLVTETGKEVHILPGG--------------------DGPQCKALFSVLNSPICNL 665
                N       E++                          G                +
Sbjct: 522 FYSVENRPESGDLEMNFRRFSLNNTNGVLVDVRDRAPTGVRQGFMPSTAVHANKGKTSAI 581

Query: 666 KFSNFGARLAVGFECSQVAMLDISTFSVLFITDSLSNSNSPVLYLAVKSLSDTSNLTISP 725
             SN G  + + +    + ++D    ++++        N   +  A  +        I  
Sbjct: 582 NNSNIG-FVGIAYAAGSLMLIDRRGPAIIY------MENIREISGAQSACVTCIEFVIME 634

Query: 726 KDSDINSSNDTKKETLFFMTKDAHIVVCDSTTGHILFSRSIHHQESNAIYMCIIEGGNFF 785
              D  SS                ++VC +  G ++  + +    S   +   +      
Sbjct: 635 YGDDGYSSI---------------LMVCGTDMGEVITYKILP--ASGGKFDVQLMDITNV 677

Query: 786 SETSSEKQSLNTPQNSKATSEPDQTNANTGSDPVVAELETSTEATYLERIFEHLFVLLCY 845
           +      +              D  +  T S   +A +      +    I     VL+  
Sbjct: 678 TSKGPIHKI-------------DAFSKETKS-SCLATIPKMQNLSKGLCI--PGIVLITG 721

Query: 846 EDALWLYPLKSLIQGHTDSIHKVNLLKPCCWTTSFKKNEKE---CGLVVLYQTGDIEIRV 902
            D + L  L      H              + ++ +KN        ++ L   G + +  
Sbjct: 722 FDDIRLITLGKSKSTHK-GFKYPLAATGLSYISTVEKNNDRKNLTVIITLEINGHLRVFT 780

Query: 903 LPYLEVGGQTSLMSLLRWNYKTNMEETLCSSDSGEIVLVDFSS 945
           +P  +   +     +        + E+     +G+I +     
Sbjct: 781 IPDFK---EQMSEHIPFPIAAKYITESSVLR-NGDIAIRVSEF 819
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1urq_A M-tomosyn isoform; transport protein, tomosyn-snare complex, exocytosis, four helical bundle, coiled coil; 2.0A {Rattus norvegicus} SCOP: h.1.15.1 Length = 63 Back     alignment and structure
>1sfc_A VAMP 2, protein (synaptobrevin 2); membrane fusion protein complex, transport protein; 2.40A {Rattus norvegicus} SCOP: h.1.15.1 Length = 96 Back     alignment and structure
>2nps_A VAMP-4, vesicle-associated membrane protein 4; vesicle fusion, snare complex, early endosomal snare complex, VTI1A, VAMP4, transport protein; 2.50A {Mus musculus} Length = 74 Back     alignment and structure
>1l4a_A Synaptobrevin; snare, snare complex, membrane fusion, neurotransmission, endocytosis/exocytosis complex; 2.95A {Loligo pealei} SCOP: h.1.15.1 Length = 80 Back     alignment and structure
>3b5n_A Synaptobrevin homolog 1; snare complex, syntaxin, synaptobrevin, SNAP-25, SSO1P, SNC1P, SEC9P, SSO1, SNC1, coiled coil; 1.60A {Saccharomyces cerevisiae} SCOP: h.1.15.1 Length = 61 Back     alignment and structure
>1n7s_A Vesicle-associated membrane protein 2; neuronal snare protein complex, four helix bundle, transport protein; 1.45A {Rattus norvegicus} SCOP: h.1.15.1 PDB: 1kil_A 3rk2_A 3rk3_A 3rl0_A 3fii_B 3g94_B Length = 63 Back     alignment and structure
>3hd7_A Vesicle-associated membrane protein 2; membrane protein, coiled-coil, 4-helical bundle, cell juncti cytoplasmic vesicle, membrane, phosphoprotein; HET: GGG; 3.40A {Rattus norvegicus} PDB: 3hd9_A 3ipd_A Length = 91 Back     alignment and structure
>2kog_A Vesicle-associated membrane protein 2; synaptobrevin, VAMP2, DPC micelle, snare, coiled coil, membrane fusion, transmembrane; NMR {Rattus norvegicus} Length = 119 Back     alignment and structure
>2nut_C Vesicle-trafficking protein SEC22B; human copii SEC23/24 complexed with SEC22, protein transport; 2.30A {Homo sapiens} PDB: 2nup_C 3egd_C 3egx_C 1ifq_A Length = 196 Back     alignment and structure
>1gl2_A Endobrevin; membrane protein, membrane fusion protein complex, coiled coil, transmembrane; 1.9A {Rattus norvegicus} SCOP: h.1.15.1 Length = 65 Back     alignment and structure
>3vu4_A KMHSV2; beta-propeller fold, protein transport; 2.60A {Kluyveromyces marxianus} PDB: 4av9_A 4av8_A 4exv_A Length = 355 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query1155
2oaj_A902 Protein SNI1; WD40 repeat, beta propeller, endocyt 100.0
2ymu_A577 WD-40 repeat protein; unknown function, two domain 100.0
1nr0_A611 Actin interacting protein 1; beta propeller, WD40 100.0
2ymu_A577 WD-40 repeat protein; unknown function, two domain 100.0
3sfz_A1249 APAF-1, apoptotic peptidase activating factor 1; a 100.0
1pgu_A615 Actin interacting protein 1; WD repeat, seven-blad 100.0
1nr0_A611 Actin interacting protein 1; beta propeller, WD40 100.0
3sfz_A1249 APAF-1, apoptotic peptidase activating factor 1; a 100.0
2oaj_A902 Protein SNI1; WD40 repeat, beta propeller, endocyt 100.0
3mkq_A814 Coatomer beta'-subunit; beta-propeller, alpha-sole 100.0
1pgu_A615 Actin interacting protein 1; WD repeat, seven-blad 100.0
1vyh_C410 Platelet-activating factor acetylhydrolase IB alph 100.0
1vyh_C410 Platelet-activating factor acetylhydrolase IB alph 100.0
1got_B340 GT-beta; complex (GTP-binding/transducer), G prote 100.0
2ynn_A304 Coatomer subunit beta'; protein transport, peptide 100.0
3mkq_A814 Coatomer beta'-subunit; beta-propeller, alpha-sole 100.0
4gqb_B344 Methylosome protein 50; TIM barrel, beta-propeller 100.0
1r5m_A425 SIR4-interacting protein SIF2; transcription corep 100.0
3ow8_A321 WD repeat-containing protein 61; structural genomi 100.0
3iz6_a380 40S ribosomal protein RACK1 (RACK1); eukaryotic ri 100.0
4g56_B357 MGC81050 protein; protein arginine methyltransfera 100.0
4gqb_B344 Methylosome protein 50; TIM barrel, beta-propeller 100.0
2pm9_A416 Protein WEB1, protein transport protein SEC31; bet 100.0
3ow8_A321 WD repeat-containing protein 61; structural genomi 100.0
3fm0_A345 Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD r 100.0
3fm0_A345 Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD r 100.0
2pbi_B354 Guanine nucleotide-binding protein subunit beta 5; 100.0
3vl1_A420 26S proteasome regulatory subunit RPN14; beta-prop 100.0
1r5m_A425 SIR4-interacting protein SIF2; transcription corep 100.0
1gxr_A337 ESG1, transducin-like enhancer protein 1; transcri 100.0
2ynn_A304 Coatomer subunit beta'; protein transport, peptide 100.0
4g56_B357 MGC81050 protein; protein arginine methyltransfera 100.0
1erj_A393 Transcriptional repressor TUP1; beta-propeller, tr 100.0
3frx_A319 Guanine nucleotide-binding protein subunit beta- l 100.0
2hes_X330 YDR267CP; beta-propeller, WD40 repeat, biosyntheti 100.0
1got_B340 GT-beta; complex (GTP-binding/transducer), G prote 100.0
2pm9_A416 Protein WEB1, protein transport protein SEC31; bet 100.0
1gxr_A337 ESG1, transducin-like enhancer protein 1; transcri 100.0
2xzm_R343 RACK1; ribosome, translation; 3.93A {Tetrahymena t 100.0
1erj_A393 Transcriptional repressor TUP1; beta-propeller, tr 100.0
3iz6_a380 40S ribosomal protein RACK1 (RACK1); eukaryotic ri 100.0
3frx_A319 Guanine nucleotide-binding protein subunit beta- l 100.0
2pbi_B354 Guanine nucleotide-binding protein subunit beta 5; 100.0
2xzm_R343 RACK1; ribosome, translation; 3.93A {Tetrahymena t 100.0
3gre_A437 Serine/threonine-protein kinase VPS15; seven-blade 100.0
4ery_A312 WD repeat-containing protein 5; WD40, WIN motif, b 100.0
4aow_A340 Guanine nucleotide-binding protein subunit beta-2; 99.98
4aow_A340 Guanine nucleotide-binding protein subunit beta-2; 99.98
2j04_B524 YDR362CP, TAU91; beta propeller, type 2 promoters, 99.98
2hes_X330 YDR267CP; beta-propeller, WD40 repeat, biosyntheti 99.98
4ery_A312 WD repeat-containing protein 5; WD40, WIN motif, b 99.97
3zwl_B369 Eukaryotic translation initiation factor 3 subuni; 99.97
3v7d_B464 Cell division control protein 4; WD 40 domain, pho 99.97
2ovr_B445 FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 99.97
4h5i_A365 Guanine nucleotide-exchange factor SEC12; copii ve 99.97
3k26_A366 Polycomb protein EED; WD40, structural genomics, N 99.97
3zwl_B369 Eukaryotic translation initiation factor 3 subuni; 99.97
1sq9_A397 Antiviral protein SKI8; WD repeat, beta-transducin 99.97
4a11_B408 DNA excision repair protein ERCC-8; DNA binding pr 99.97
3ei3_B383 DNA damage-binding protein 2; UV-damage, DDB, nucl 99.97
3i2n_A357 WD repeat-containing protein 92; WD40 repeats, str 99.97
1k8k_C372 P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta- 99.97
3i2n_A357 WD repeat-containing protein 92; WD40 repeats, str 99.97
3dm0_A694 Maltose-binding periplasmic protein fused with RAC 99.97
3ei3_B383 DNA damage-binding protein 2; UV-damage, DDB, nucl 99.97
2j04_B524 YDR362CP, TAU91; beta propeller, type 2 promoters, 99.97
4h5i_A365 Guanine nucleotide-exchange factor SEC12; copii ve 99.96
3dm0_A694 Maltose-binding periplasmic protein fused with RAC 99.96
4e54_B435 DNA damage-binding protein 2; beta barrel, double 99.96
4e54_B435 DNA damage-binding protein 2; beta barrel, double 99.96
2j04_A588 TAU60, YPL007P, hypothetical protein YPL007C; beta 99.96
1k8k_C372 P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta- 99.96
1sq9_A397 Antiviral protein SKI8; WD repeat, beta-transducin 99.96
3k26_A366 Polycomb protein EED; WD40, structural genomics, N 99.96
3odt_A313 Protein DOA1; ubiquitin, nuclear protein; HET: MSE 99.96
3vl1_A420 26S proteasome regulatory subunit RPN14; beta-prop 99.96
3odt_A313 Protein DOA1; ubiquitin, nuclear protein; HET: MSE 99.96
4aez_A401 CDC20, WD repeat-containing protein SLP1; cell cyc 99.96
4aez_A401 CDC20, WD repeat-containing protein SLP1; cell cyc 99.96
3dwl_C377 Actin-related protein 2/3 complex subunit 1; prope 99.96
2pm7_B297 Protein transport protein SEC13, protein transport 99.96
4ggc_A318 P55CDC, cell division cycle protein 20 homolog; ce 99.96
4gga_A420 P55CDC, cell division cycle protein 20 homolog; ce 99.96
4ggc_A318 P55CDC, cell division cycle protein 20 homolog; ce 99.96
4gga_A420 P55CDC, cell division cycle protein 20 homolog; ce 99.96
3v7d_B464 Cell division control protein 4; WD 40 domain, pho 99.96
4a11_B408 DNA excision repair protein ERCC-8; DNA binding pr 99.95
3dw8_B447 Serine/threonine-protein phosphatase 2A 55 kDa RE 99.95
3dwl_C377 Actin-related protein 2/3 complex subunit 1; prope 99.95
3bg1_A316 Protein SEC13 homolog; NPC, transport, WD repeat, 99.95
1p22_A435 F-BOX/WD-repeat protein 1A; ubiquitination, degrad 99.95
2pm7_B297 Protein transport protein SEC13, protein transport 99.95
3mmy_A368 MRNA export factor; mRNA export, nuclear protein; 99.95
3f3f_A351 Nucleoporin SEH1; structural protein, protein comp 99.94
3f3f_A351 Nucleoporin SEH1; structural protein, protein comp 99.94
1yfq_A342 Cell cycle arrest protein BUB3; WD repeat WD40 rep 99.94
3dw8_B447 Serine/threonine-protein phosphatase 2A 55 kDa RE 99.94
3jrp_A379 Fusion protein of protein transport protein SEC13 99.94
2ovr_B445 FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 99.94
1k32_A1045 Tricorn protease; protein degradation, substrate g 99.94
3mmy_A368 MRNA export factor; mRNA export, nuclear protein; 99.94
1p22_A435 F-BOX/WD-repeat protein 1A; ubiquitination, degrad 99.94
1yfq_A342 Cell cycle arrest protein BUB3; WD repeat WD40 rep 99.94
2j04_A588 TAU60, YPL007P, hypothetical protein YPL007C; beta 99.94
3gre_A437 Serine/threonine-protein kinase VPS15; seven-blade 99.94
1k32_A 1045 Tricorn protease; protein degradation, substrate g 99.93
3bg1_A316 Protein SEC13 homolog; NPC, transport, WD repeat, 99.93
3vu4_A355 KMHSV2; beta-propeller fold, protein transport; 2. 99.93
3lrv_A343 PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiqu 99.93
3jrp_A379 Fusion protein of protein transport protein SEC13 99.92
3vu4_A355 KMHSV2; beta-propeller fold, protein transport; 2. 99.92
2xyi_A430 Probable histone-binding protein CAF1; transcripti 99.92
2aq5_A402 Coronin-1A; WD40 repeat, 7-bladed beta-propeller, 99.92
1l0q_A391 Surface layer protein; SLP, S-layer, 7-bladed beta 99.92
2aq5_A402 Coronin-1A; WD40 repeat, 7-bladed beta-propeller, 99.91
4gq1_A393 NUP37; propeller, transport protein; 2.40A {Schizo 99.91
2vdu_B450 TRNA (guanine-N(7)-)-methyltransferase- associated 99.91
3lrv_A343 PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiqu 99.91
3jro_A753 Fusion protein of protein transport protein SEC13 99.91
4gq1_A393 NUP37; propeller, transport protein; 2.40A {Schizo 99.91
3bws_A433 Protein LP49; two-domain, immunoglobulin-like, 7-b 99.91
3bws_A433 Protein LP49; two-domain, immunoglobulin-like, 7-b 99.91
1nir_A543 Nitrite reductase; hemoprotein, denitrification, d 99.91
1nir_A543 Nitrite reductase; hemoprotein, denitrification, d 99.9
2vdu_B450 TRNA (guanine-N(7)-)-methyltransferase- associated 99.9
2xyi_A430 Probable histone-binding protein CAF1; transcripti 99.9
2w18_A356 PALB2, fancn, partner and localizer of BRCA2; fanc 99.9
2w18_A356 PALB2, fancn, partner and localizer of BRCA2; fanc 99.89
3jro_A753 Fusion protein of protein transport protein SEC13 99.89
1l0q_A391 Surface layer protein; SLP, S-layer, 7-bladed beta 99.89
2ecf_A741 Dipeptidyl peptidase IV; prolyl oligopeptidase fam 99.82
2ecf_A741 Dipeptidyl peptidase IV; prolyl oligopeptidase fam 99.82
2hqs_A415 Protein TOLB; TOLB, PAL, TOL, transport protein-li 99.82
1xfd_A723 DIP, dipeptidyl aminopeptidase-like protein 6, dip 99.81
2z3z_A706 Dipeptidyl aminopeptidase IV; peptidase family S9, 99.8
2z3z_A706 Dipeptidyl aminopeptidase IV; peptidase family S9, 99.78
1xfd_A723 DIP, dipeptidyl aminopeptidase-like protein 6, dip 99.77
1ri6_A343 Putative isomerase YBHE; 7-bladed propeller, enzym 99.77
1pby_B337 Quinohemoprotein amine dehydrogenase 40 kDa subuni 99.75
2hqs_A415 Protein TOLB; TOLB, PAL, TOL, transport protein-li 99.75
3hfq_A347 Uncharacterized protein LP_2219; Q88V64_lacpl, NES 99.74
1ri6_A343 Putative isomerase YBHE; 7-bladed propeller, enzym 99.73
2ojh_A297 Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 99.72
3o4h_A582 Acylamino-acid-releasing enzyme; alpha/beta hydrol 99.71
2ojh_A297 Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 99.71
1z68_A719 Fibroblast activation protein, alpha subunit; sepr 99.71
1pby_B337 Quinohemoprotein amine dehydrogenase 40 kDa subuni 99.7
1z68_A719 Fibroblast activation protein, alpha subunit; sepr 99.68
3u4y_A331 Uncharacterized protein; structural genomics, PSI- 99.67
1jmx_B349 Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 99.66
3vgz_A353 Uncharacterized protein YNCE; beta-propeller, prot 99.66
2oit_A434 Nucleoporin 214KDA; NH2 terminal domain of NUP214/ 99.66
3o4h_A582 Acylamino-acid-releasing enzyme; alpha/beta hydrol 99.65
3scy_A361 Hypothetical bacterial 6-phosphogluconolactonase; 99.64
3u4y_A331 Uncharacterized protein; structural genomics, PSI- 99.63
1urq_A63 M-tomosyn isoform; transport protein, tomosyn-snar 99.63
1jof_A365 Carboxy-CIS,CIS-muconate cyclase; beta-propeller, 99.62
3vgz_A353 Uncharacterized protein YNCE; beta-propeller, prot 99.61
2nps_A74 VAMP-4, vesicle-associated membrane protein 4; ves 99.6
2oit_A434 Nucleoporin 214KDA; NH2 terminal domain of NUP214/ 99.59
4a5s_A740 Dipeptidyl peptidase 4 soluble form; hydrolase, ty 99.59
3hfq_A347 Uncharacterized protein LP_2219; Q88V64_lacpl, NES 99.58
1jmx_B349 Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 99.58
1sfc_A96 VAMP 2, protein (synaptobrevin 2); membrane fusion 99.57
3hd7_A91 Vesicle-associated membrane protein 2; membrane pr 99.56
1l4a_A80 Synaptobrevin; snare, snare complex, membrane fusi 99.55
1n7s_A63 Vesicle-associated membrane protein 2; neuronal sn 99.55
3b5n_A61 Synaptobrevin homolog 1; snare complex, syntaxin, 99.52
3scy_A361 Hypothetical bacterial 6-phosphogluconolactonase; 99.52
3c5m_A396 Oligogalacturonate lyase; blade-shaped beta-propel 99.49
2oiz_A361 Aromatic amine dehydrogenase, large subunit; oxido 99.49
3pe7_A388 Oligogalacturonate lyase; seven-bladed beta-propel 99.48
3pe7_A388 Oligogalacturonate lyase; seven-bladed beta-propel 99.45
2oiz_A361 Aromatic amine dehydrogenase, large subunit; oxido 99.44
1gl2_A65 Endobrevin; membrane protein, membrane fusion prot 99.42
2kog_A119 Vesicle-associated membrane protein 2; synaptobrev 99.39
1jof_A365 Carboxy-CIS,CIS-muconate cyclase; beta-propeller, 99.38
1qks_A567 Cytochrome CD1 nitrite reductase; enzyme, oxidored 99.38
3azo_A662 Aminopeptidase; POP family, hydrolase; 2.00A {Stre 99.33
4a5s_A740 Dipeptidyl peptidase 4 soluble form; hydrolase, ty 99.32
1qks_A567 Cytochrome CD1 nitrite reductase; enzyme, oxidored 99.31
3azo_A662 Aminopeptidase; POP family, hydrolase; 2.00A {Stre 99.29
3fvz_A329 Peptidyl-glycine alpha-amidating monooxygenase; be 99.22
1q7f_A286 NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL 99.21
2gop_A347 Trilobed protease; beta propeller, open velcro, hy 99.16
2nut_C196 Vesicle-trafficking protein SEC22B; human copii SE 99.11
3e5z_A296 Putative gluconolactonase; X-RAY NESG Q9RXN3 gluco 99.07
2xdw_A710 Prolyl endopeptidase; alpha/beta-hydrolase, amnesi 99.07
2xdw_A710 Prolyl endopeptidase; alpha/beta-hydrolase, amnesi 99.06
1q7f_A286 NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL 99.06
2dg1_A333 DRP35, lactonase; beta propeller, hydrolase; 1.72A 99.05
3fvz_A329 Peptidyl-glycine alpha-amidating monooxygenase; be 99.05
4b93_A189 Vesicle-associated membrane protein 7; endocytosis 99.03
3c5m_A396 Oligogalacturonate lyase; blade-shaped beta-propel 99.02
2gop_A347 Trilobed protease; beta propeller, open velcro, hy 99.02
2bkl_A695 Prolyl endopeptidase; mechanistic study, celiac sp 98.95
3dsm_A328 Uncharacterized protein bacuni_02894; seven_blated 98.94
3no2_A276 Uncharacterized protein; six-bladed beta-propeller 98.94
1rwi_B270 Serine/threonine-protein kinase PKND; beta propell 98.94
2bkl_A695 Prolyl endopeptidase; mechanistic study, celiac sp 98.93
1pjx_A314 Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotries 98.92
3e5z_A296 Putative gluconolactonase; X-RAY NESG Q9RXN3 gluco 98.89
2z2n_A299 Virginiamycin B lyase; seven-bladed beta-propeller 98.88
1xip_A388 Nucleoporin NUP159; beta-propeller, transport prot 98.83
1rwi_B270 Serine/threonine-protein kinase PKND; beta propell 98.8
3no2_A276 Uncharacterized protein; six-bladed beta-propeller 98.8
2dg1_A333 DRP35, lactonase; beta propeller, hydrolase; 1.72A 98.79
2mad_H373 Methylamine dehydrogenase (heavy subunit); oxidore 98.76
2z2n_A299 Virginiamycin B lyase; seven-bladed beta-propeller 98.75
1yr2_A741 Prolyl oligopeptidase; prolyl endopeptidase, mecha 98.74
1xip_A388 Nucleoporin NUP159; beta-propeller, transport prot 98.74
3sjl_D386 Methylamine dehydrogenase heavy chain; MAUG, C-hem 98.73
2mad_H373 Methylamine dehydrogenase (heavy subunit); oxidore 98.72
3g4e_A297 Regucalcin; six bladed beta-propeller, gluconolcat 98.72
3sjl_D386 Methylamine dehydrogenase heavy chain; MAUG, C-hem 98.7
4a2l_A795 BT_4663, two-component system sensor histidine kin 98.67
3hrp_A409 Uncharacterized protein; NP_812590.1, structural g 98.66
3dsm_A328 Uncharacterized protein bacuni_02894; seven_blated 98.66
3c75_H426 MADH, methylamine dehydrogenase heavy chain; coppe 98.65
3kyq_A199 YKT6, synaptobrevin homolog YKT6; V-snare homolog, 98.64
1yr2_A741 Prolyl oligopeptidase; prolyl endopeptidase, mecha 98.63
3g4e_A297 Regucalcin; six bladed beta-propeller, gluconolcat 98.61
4a2l_A795 BT_4663, two-component system sensor histidine kin 98.57
1pjx_A314 Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotries 98.57
2qc5_A300 Streptogramin B lactonase; beta propeller, lyase; 98.56
3c75_H426 MADH, methylamine dehydrogenase heavy chain; coppe 98.54
3iuj_A693 Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas 98.51
2ghs_A326 AGR_C_1268P; regucalcin, structural genomics, join 98.51
1kb0_A677 Quinohemoprotein alcohol dehydrogenase; beta-prope 98.42
1yiq_A689 Quinohemoprotein alcohol dehydrogenase; electron t 98.42
2qe8_A343 Uncharacterized protein; structural genomics, join 98.4
3dr2_A305 Exported gluconolactonase; gluconolactonase SMP-30 98.38
2qc5_A300 Streptogramin B lactonase; beta propeller, lyase; 98.37
1kb0_A677 Quinohemoprotein alcohol dehydrogenase; beta-prope 98.36
3hrp_A409 Uncharacterized protein; NP_812590.1, structural g 98.34
2hz6_A369 Endoplasmic reticulum to nucleus signalling 1 isof 98.31
3dr2_A305 Exported gluconolactonase; gluconolactonase SMP-30 98.31
2ghs_A326 AGR_C_1268P; regucalcin, structural genomics, join 98.29
1mda_H368 Methylamine dehydrogenase (heavy subunit); electro 98.27
3q7m_A376 Lipoprotein YFGL, BAMB; beta-propeller, BAM comple 98.24
3v9f_A781 Two-component system sensor histidine kinase/RESP 98.2
3q7m_A376 Lipoprotein YFGL, BAMB; beta-propeller, BAM comple 98.19
3iuj_A693 Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas 98.19
2qe8_A343 Uncharacterized protein; structural genomics, join 98.16
1yiq_A689 Quinohemoprotein alcohol dehydrogenase; electron t 98.15
1mda_H368 Methylamine dehydrogenase (heavy subunit); electro 98.09
2hz6_A369 Endoplasmic reticulum to nucleus signalling 1 isof 98.08
2iwa_A266 Glutamine cyclotransferase; pyroglutamate, acyltra 98.07
2ece_A462 462AA long hypothetical selenium-binding protein; 97.97
3nol_A262 Glutamine cyclotransferase; beta-propeller, glutam 97.9
3mbr_X243 Glutamine cyclotransferase; beta-propeller; 1.44A 97.82
1npe_A267 Nidogen, entactin; glycoprotein, basement membrane 97.81
3nol_A262 Glutamine cyclotransferase; beta-propeller, glutam 97.77
1fwx_A595 Nitrous oxide reductase; beta-propeller domain, cu 97.72
3nok_A268 Glutaminyl cyclase; beta-propeller, cyclotransfera 97.71
3v9f_A781 Two-component system sensor histidine kinase/RESP 97.7
3mbr_X243 Glutamine cyclotransferase; beta-propeller; 1.44A 97.65
2iwa_A266 Glutamine cyclotransferase; pyroglutamate, acyltra 97.52
3nok_A268 Glutaminyl cyclase; beta-propeller, cyclotransfera 97.52
2fp8_A322 Strictosidine synthase; six bladed beta propeller 97.5
2ece_A462 462AA long hypothetical selenium-binding protein; 97.41
1fwx_A595 Nitrous oxide reductase; beta-propeller domain, cu 97.4
1kv9_A668 Type II quinohemoprotein alcohol dehydrogenase; el 97.15
3qqz_A255 Putative uncharacterized protein YJIK; MCSG, PSI-2 97.14
2p4o_A306 Hypothetical protein; putative lactonase, structur 97.13
2xe4_A751 Oligopeptidase B; hydrolase-inhibitor complex, hyd 97.06
1npe_A267 Nidogen, entactin; glycoprotein, basement membrane 97.05
1flg_A582 Protein (quinoprotein ethanol dehydrogenase); supe 96.84
3hxj_A330 Pyrrolo-quinoline quinone; all beta protein. incom 96.83
2ad6_A571 Methanol dehydrogenase subunit 1; PQQ configuratio 96.81
3hxj_A330 Pyrrolo-quinoline quinone; all beta protein. incom 96.78
2fp8_A322 Strictosidine synthase; six bladed beta propeller 96.76
2ad6_A571 Methanol dehydrogenase subunit 1; PQQ configuratio 96.7
1kv9_A668 Type II quinohemoprotein alcohol dehydrogenase; el 96.7
1w6s_A599 Methanol dehydrogenase subunit 1; anisotropic, ele 96.6
2xe4_A751 Oligopeptidase B; hydrolase-inhibitor complex, hyd 96.57
3ei3_A1158 DNA damage-binding protein 1; UV-damage, DDB, nucl 96.52
3fie_C38 Fragment of vesicle-associated membrane protein 2; 96.4
3ei3_A 1158 DNA damage-binding protein 1; UV-damage, DDB, nucl 96.36
1ijq_A316 LDL receptor, low-density lipoprotein receptor; be 96.3
1flg_A582 Protein (quinoprotein ethanol dehydrogenase); supe 96.27
2p9w_A334 MAL S 1 allergenic protein; beta propeller; 1.35A 96.21
2p4o_A306 Hypothetical protein; putative lactonase, structur 96.11
3a9g_A354 Putative uncharacterized protein; PQQ dependent de 96.1
2ism_A352 Putative oxidoreductase; BL41XU spring-8, bladed b 96.06
3v65_B386 Low-density lipoprotein receptor-related protein; 96.02
3v64_C349 Agrin; beta propeller, laminin-G, signaling, prote 95.84
3p5b_L400 Low density lipoprotein receptor variant; B-propel 95.83
4hw6_A433 Hypothetical protein, IPT/TIG domain protein; puta 95.79
3sov_A318 LRP-6, low-density lipoprotein receptor-related pr 95.77
3zym_A310 Phosphatidylinositol-binding clathrin assembly PR 95.76
3v64_C349 Agrin; beta propeller, laminin-G, signaling, prote 95.7
3tc9_A430 Hypothetical hydrolase; 6-bladed beta-propeller, i 95.69
1w6s_A599 Methanol dehydrogenase subunit 1; anisotropic, ele 95.59
3tc9_A430 Hypothetical hydrolase; 6-bladed beta-propeller, i 95.55
2g8s_A353 Glucose/sorbosone dehydrogenases; bladed beta-prop 95.48
3s94_A619 LRP-6, low-density lipoprotein receptor-related pr 95.26
3v65_B386 Low-density lipoprotein receptor-related protein; 95.18
3pbp_A452 Nucleoporin NUP82; beta-propeller, mRNA export, mR 95.12
2p9w_A334 MAL S 1 allergenic protein; beta propeller; 1.35A 95.06
2xbg_A327 YCF48-like protein; photosynthesis, photosystem II 94.81
3m0c_C791 LDL receptor, low-density lipoprotein receptor; pr 94.67
3amr_A355 3-phytase; beta-propeller, phytate, MYO-inositol h 94.61
2xbg_A327 YCF48-like protein; photosynthesis, photosystem II 94.42
4a0p_A628 LRP6, LRP-6, low-density lipoprotein receptor-rela 94.38
3sre_A355 PON1, serum paraoxonase; directed evolution, 6-bla 94.09
3pbp_A452 Nucleoporin NUP82; beta-propeller, mRNA export, mR 94.03
3qqz_A255 Putative uncharacterized protein YJIK; MCSG, PSI-2 93.99
1ijq_A316 LDL receptor, low-density lipoprotein receptor; be 93.97
3p5b_L400 Low density lipoprotein receptor variant; B-propel 93.94
3kya_A496 Putative phosphatase; structural genomics, joint c 93.88
3amr_A355 3-phytase; beta-propeller, phytate, MYO-inositol h 93.77
4hw6_A433 Hypothetical protein, IPT/TIG domain protein; puta 93.64
3sov_A318 LRP-6, low-density lipoprotein receptor-related pr 93.6
1k3i_A656 Galactose oxidase precursor; blade beta propeller, 93.49
3s94_A619 LRP-6, low-density lipoprotein receptor-related pr 93.04
1n7d_A699 LDL receptor, low-density lipoprotein receptor; fa 92.95
3m0c_C791 LDL receptor, low-density lipoprotein receptor; pr 91.72
1k3i_A656 Galactose oxidase precursor; blade beta propeller, 91.62
3kya_A496 Putative phosphatase; structural genomics, joint c 91.56
4a0p_A628 LRP6, LRP-6, low-density lipoprotein receptor-rela 90.92
1n7d_A699 LDL receptor, low-density lipoprotein receptor; fa 90.75
3sre_A355 PON1, serum paraoxonase; directed evolution, 6-bla 90.44
1tl2_A236 L10, protein (tachylectin-2); animal lectin, horse 89.01
2xn4_A302 Kelch-like protein 2; structural protein, cytoskel 85.19
2be1_A339 Serine/threonine-protein kinase/endoribonuclease; 85.19
3das_A347 Putative oxidoreductase; aldose sugar dehydrogenas 84.29
2vpj_A301 Kelch-like protein 12; adaptor protein, WNT signal 83.23
1cru_A454 Protein (soluble quinoprotein glucose dehydrogena; 81.97
2vpj_A301 Kelch-like protein 12; adaptor protein, WNT signal 81.42
2ism_A352 Putative oxidoreductase; BL41XU spring-8, bladed b 80.4
>2oaj_A Protein SNI1; WD40 repeat, beta propeller, endocytosis/exocytosis complex; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
Probab=100.00  E-value=2.1e-67  Score=683.33  Aligned_cols=758  Identities=16%  Similarity=0.176  Sum_probs=519.6

Q ss_pred             cCCCCcceeeccCCCCCceEEEEcCCCCEEEEEEcCCeEEEEccCCceEEEEcCCCCCEEEEEEEcCCcEEEEEecCCeE
Q 001109           28 SKDFDPRVTLHYGIPSTASILAFDHVQSLLAIGTQDGRIKVIGGDNIEGLLVSPKQLAFKHLEFLQNQGFLVSISSGNEI  107 (1155)
Q Consensus        28 ~~~~~~~~~~~~G~~~~vs~lafsp~g~lLAsgs~DG~I~vw~~~~~~~~~~~~~~~~V~~l~Fs~dg~~LvS~s~Dg~I  107 (1155)
                      ++.|+++..+++||++.|+++||+|+|++||+|+.||+|+||+..+.+.+..+.+..+|.+|+|+| +.+|++++.|++|
T Consensus         3 ~~~~~~~~~~~~gh~~~V~~lafspdg~~lAsgs~Dg~I~lw~~~~~~~~~~~~~~~~V~~l~fsp-g~~L~S~s~D~~v   81 (902)
T 2oaj_A            3 NKIFSLAETNKYGMSSKPIAAAFDFTQNLLAIATVTGEVHIYGQQQVEVVIKLEDRSAIKEMRFVK-GIYLVVINAKDTV   81 (902)
T ss_dssp             CTTEEEEEEEEEECSSCEEEEEEETTTTEEEEEETTSEEEEECSTTCEEEEECSSCCCEEEEEEET-TTEEEEEETTCEE
T ss_pred             hheeeeccccccCCCCCcEEEEECCCCCEEEEEeCCCEEEEEeCCCcEEEEEcCCCCCEEEEEEcC-CCEEEEEECcCeE
Confidence            568899999999999999999999999999999999999999999988888877888999999999 6799999999999


Q ss_pred             EEEECCCCceeeeecCCCceeEEEEecCCCEEEEEeCCCcEEEEEecCCCceeeccceeccCCceeeeceeEeeEecccc
Q 001109          108 QLWDLEARRITSTLPWESNITAFSVIFGTSYMYIGDEYGMVYVLKYDTEEGKLIHSPYYVPKDVIEVFNHLLLEFCPNHI  187 (1155)
Q Consensus       108 ~vWDl~t~~~~~~l~~~~~Vtsva~spd~~~l~~G~~dG~V~vw~~d~~~~~l~~~~~~i~~~~~~~~~~~~l~~~p~~~  187 (1155)
                      +|||+++++++.++..++.|++++|+|++++|++|+.||+|++|+++.  +++.  +|.++....           .  .
T Consensus        82 ~lWd~~~~~~~~~~~~~~~V~~v~~sp~g~~l~sgs~dg~V~lwd~~~--~~~~--~~~i~~~~~-----------~--~  144 (902)
T 2oaj_A           82 YVLSLYSQKVLTTVFVPGKITSIDTDASLDWMLIGLQNGSMIVYDIDR--DQLS--SFKLDNLQK-----------S--S  144 (902)
T ss_dssp             EEEETTTCSEEEEEECSSCEEEEECCTTCSEEEEEETTSCEEEEETTT--TEEE--EEEECCHHH-----------H--H
T ss_pred             EEEECCCCcEEEEEcCCCCEEEEEECCCCCEEEEEcCCCcEEEEECCC--Cccc--cceeccccc-----------c--c
Confidence            999999999999988778999999999999999999999999997654  3322  233221000           0  0


Q ss_pred             cccccccccccceeeecCCCCCCCcccccccccccceeeEEEEeecccccccccccEEEEEEcCCeEEEEEccCCeEEEE
Q 001109          188 QREKGKAAFNASLLFYCMPPDESGFIDFIIRSKLRFFVEIRLLQFQKHVNSTLGFSQLLLVYANGLIILWDVSEDKVVLV  267 (1155)
Q Consensus       188 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~v~~~~v~~v~~~p~~~~~~~~~~~~llsg~~dG~I~lWd~~~~~~~~~  267 (1155)
                      .   .                .    ..+..+|.+     ++|+|++.       ..|++|+.||.| |||+.+++.+..
T Consensus       145 ~---~----------------~----~~h~~~V~s-----l~~sp~~~-------~~l~~g~~dg~v-lWd~~~~~~~~~  188 (902)
T 2oaj_A          145 F---F----------------P----AARLSPIVS-----IQWNPRDI-------GTVLISYEYVTL-TYSLVENEIKQS  188 (902)
T ss_dssp             T---C----------------S----SSCCCCCCE-----EEEETTEE-------EEEEEECSSCEE-EEETTTTEEEEE
T ss_pred             c---c----------------c----ccCCCCeEE-----EEEccCCC-------CEEEEEeCCCcE-EEECCCCceEEE
Confidence            0   0                0    002345555     99999753       579999999999 999999988765


Q ss_pred             ecccccccccccccCCCCCCCCCCcccccccccccCCccEEEEEecCCCeEEEEEcCCcEEEEEcCCCCCccc-ccc-CC
Q 001109          268 RGSKDLQLKTEIVDDPSKNAGHNLSETVSDNEQVEKEISSLCWASNDGSVLAVGYVDGDILLWNLRAAASTKD-WKS-EN  345 (1155)
Q Consensus       268 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~V~sl~~s~pdG~~lasg~~DG~I~lWd~~s~~~~~~-~~~-~~  345 (1155)
                      ...       ..+.++......   .  ....+|...|++++|+ |||.+||+|+.||+|++||+.++..... ... ..
T Consensus       189 ~~~-------~~~~g~~~~~~~---~--~~~~~h~~~V~~v~fs-pdg~~lasgs~Dg~i~lWd~~~g~~~~~r~l~~~~  255 (902)
T 2oaj_A          189 FIY-------ELPPFAPGGDFS---E--KTNEKRTPKVIQSLYH-PNSLHIITIHEDNSLVFWDANSGHMIMARTVFETE  255 (902)
T ss_dssp             ECC-------CBCTTCCCSTTC---C--CTTSCBCCCEEEEEEC-TTSSEEEEEETTCCEEEEETTTCCEEEEECSSCSC
T ss_pred             Eec-------ccCCcCCCcccc---c--ccccccCCCeEEEEEc-CCCCEEEEEECCCeEEEEECCCCcEEEEEeecccc
Confidence            321       111111110000   0  0001246789999999 9999999999999999999988654210 000 00


Q ss_pred             CCCCcccccccCCCCCccEEEEEecccCCCCCCCceEEEecCCCCCC-cceEEEEEccCCcc------------ccccee
Q 001109          346 SSTDFGKLQLSSGNRRLPVITLHWSAERSRNDCRGQLFVFGGDEIGS-EEVLTMLYLNWSSR------------IESLKC  412 (1155)
Q Consensus       346 ~~~~i~kl~l~~~~~~~pI~~l~w~~~~~~~~~~~~llv~gg~d~~~-~~~ltvl~l~~~~~------------~~~~~~  412 (1155)
                      ...+..........+..+|..++|++..  +++++.++++|+.+.+. .+.+.+|.++....            ....++
T Consensus       256 ~~~~~~~~~~~~~~~~~~V~~v~w~~~~--~pd~~~ll~sg~~~~~~~~~~v~~~~~~~~~~~~~~s~~~~~~~~~~~~~  333 (902)
T 2oaj_A          256 INVPQPDYIRDSSTNAAKISKVYWMCEN--NPEYTSLLISHKSISRGDNQSLTMIDLGYTPRYSITSYEGMKNYYANPKQ  333 (902)
T ss_dssp             TTSCCTTCCCCCSSCCCEEEEEEEEECS--STTEEEEEEEEECSTTSSCCCEEEEEEEECCCGGGCCHHHHHHHHHSCSE
T ss_pred             cCCCCCcCCCCCccccCCeeEEEEEecC--CCCCCEEEEeCCCCCCCCCceEEEEecCCCCCccccchhhhhhhhcCccc
Confidence            0000000000000245689999997621  12345778888665322 24676766432100            001112


Q ss_pred             ceeeeecCCCceeEEEEecCCC----CCCCceeEEEEcCCCeeEEecCCCCCCcccccccccCCCcccCCcccccCCCcc
Q 001109          413 IGRVDLERKGSFVDMVLLPNGM----NESHGTLPCVLTNPGKLQVYDRPRFSPKKSQEKKKISSSSLQYPMLIPTIEPHM  488 (1155)
Q Consensus       413 ~~~~~l~~~~~v~d~~~~~~~~----~~~~~~~l~v~~~~G~l~~~d~~~~~~~l~~~~~~~~~~~~~~~~~~~~h~~~I  488 (1155)
                      ...+.+.+.+.+.++.++++..    +.+++..+++++.+|+|++||.....         ...+....+..+..|.+.|
T Consensus       334 ~~~~~~~~~~~v~~~~~~~~~sp~~~g~~d~~~l~~~s~dg~l~~~~~~~g~---------~~~~~~~~~~~l~~~~~~v  404 (902)
T 2oaj_A          334 MKIFPLPTNVPIVNILPIPRQSPYFAGCHNPGLILLILGNGEIETMLYPSGI---------FTDKASLFPQNLSWLRPLA  404 (902)
T ss_dssp             EEEECCSSSSCEEEEEECCSSCSHHHHTBSCSEEEEEETTSCEEEEETTTCC---------EECCGGGSCGGGTTBTTBE
T ss_pred             eEEEecCCCCceEEEEECCCCCCCcCCCCCceeEEEEcCCCcEEEEECCCCC---------cccccccCCCcccccCCCe
Confidence            2233345578889999887422    34566688888999999999964211         1111223345677888999


Q ss_pred             eEEEEeeecCCCchhHHHHHHHHhhccccCCCCCccccCCCccCcccCCCCCcccccccCCcCcEEEEEECCCcEEEEeC
Q 001109          489 TVGKLCMVCRDGKLSVELSKTLSAAKVRASHTPSTQLTGSTTKWPLTGGIPCQLHDAEDYLVERLYIAGYRDGSTRIWDA  568 (1155)
Q Consensus       489 t~~~~~~~~~~~~~s~~~~~~~~~~~~~~~~~~s~~~~~~~~~w~l~gg~~~~~~l~~~s~~~~lLaTgs~DgtVrlWD~  568 (1155)
                      +++++++....     .|.......              ....|++.||...+..+ +|+|++++|+||+.||+||+||+
T Consensus       405 ~~~~~s~~~~~-----~w~~~~~~~--------------~~~~~~l~G~~~~v~sv-~~spdg~~laSgs~DgtVrlWd~  464 (902)
T 2oaj_A          405 TTSMAASVPNK-----LWLGALSAA--------------QNKDYLLKGGVRTKRQK-LPAEYGTAFITGHSNGSVRIYDA  464 (902)
T ss_dssp             EEEEEEEEEHH-----HHHHHHHTT--------------BCCCCSCCCSBCCCCCC-CCCSEEEEEEEEETTSEEEEEES
T ss_pred             eEEEEEEcCHH-----HHHHHHhcc--------------cCCCCcccCCcCCCCcc-cccccCcEEEEecCCCcEEEEEC
Confidence            99998765432     344322211              12246788887766666 89999999999999999999999


Q ss_pred             CCCCeeeeeeeCCCcCccccCCCCCCeEEEEEecCCCeEEEEeCCCeEEEEEeccCcccc----------ceee----ec
Q 001109          569 TYPTLSLIHVFGSELPGIRTATESESVSALEFCSVTLNLAIGSSSGLVWLYNLIKSSNEE----------TLNL----VT  634 (1155)
Q Consensus       569 ~~~~l~~l~~l~~~~~~i~~~gh~~~V~~lafspdg~~Lasgs~dG~V~lwd~~~~~~~~----------~~~~----v~  634 (1155)
                      .++.+.....+...+......+|..+|++|+|+|||++||+|+.||+|+||++.++...+          .+.+    +.
T Consensus       465 ~~g~~~~~~~~~~~l~~~~~~~h~~~V~svafspdg~~LAsgs~DgtV~lwd~~~~~~~~~~~~~~~~~~~~~~~~~~~~  544 (902)
T 2oaj_A          465 SHGDIQDNASFEVNLSRTLNKAKELAVDKISFAAETLELAVSIETGDVVLFKYEVNQFYSVENRPESGDLEMNFRRFSLN  544 (902)
T ss_dssp             SCCTTTTTBCEEEEHHHHTTCSSSCCEEEEEEETTTTEEEEEETTSCEEEEEEEECCC---------------CCSCCGG
T ss_pred             CCccccCCceEEeechhhcCCCCCCceeEEEecCCCCeEEEEecCcEEEEEEecCccccCccccCCCcccceeeeecccc
Confidence            887532100010000000012788899999999999999999999999999998763210          0111    11


Q ss_pred             cCCceEEEecC------CCCCceeEEeecCCCCeEEEEEcCCCCEEEEEeCCCcEEEEecCCccEEEEec--cCC-CCCC
Q 001109          635 ETGKEVHILPG------GDGPQCKALFSVLNSPICNLKFSNFGARLAVGFECSQVAMLDISTFSVLFITD--SLS-NSNS  705 (1155)
Q Consensus       635 ~~~~~~~~~~~------~~g~~~~~~l~~h~~~VtslafSpdg~~LAsGs~Dg~V~lWDi~~~~~l~~~~--~~~-~h~~  705 (1155)
                      .++.....+..      ..|++|+.++.+|.++|++|+||||| +||+|+.||+|+|||++++.+++...  .+. +|.+
T Consensus       545 ~~~~~~~~~~~~~~~~~~~g~~~~~~l~~h~~~V~svafSpdG-~lAsgs~D~tv~lwd~~~~~~~~~~~~~~~~~gh~~  623 (902)
T 2oaj_A          545 NTNGVLVDVRDRAPTGVRQGFMPSTAVHANKGKTSAINNSNIG-FVGIAYAAGSLMLIDRRGPAIIYMENIREISGAQSA  623 (902)
T ss_dssp             GSSCSEEECGGGCCTTCSEEEEEEEEECCCSCSEEEEEECBTS-EEEEEETTSEEEEEETTTTEEEEEEEGGGTCSSCCC
T ss_pred             CCccccccccccCCCCCCCccceeEEEEcCCCcEEEEEecCCc-EEEEEeCCCcEEEEECCCCeEEEEeehhHhcccccc
Confidence            11111111111      22467788899999999999999999 99999999999999999988876422  344 8999


Q ss_pred             CeeEEEEeecCCCCccccCCCCCCCCCCCCCCCcEEEEEeCCceEEEEEC---CCCceeeeeecccC---CCceEEEEEE
Q 001109          706 PVLYLAVKSLSDTSNLTISPKDSDINSSNDTKKETLFFMTKDAHIVVCDS---TTGHILFSRSIHHQ---ESNAIYMCII  779 (1155)
Q Consensus       706 ~V~slafs~~~~~~~~~~~~~~~~~~~~~~pd~~~L~s~s~Dg~I~vwd~---~tG~~l~~~~~~~~---~~~al~~~~l  779 (1155)
                      .|++|+|+.....              ++++++++|++|+.|++|++||+   .+|+++..+.-|..   ...++.+..+
T Consensus       624 ~V~sv~Fs~~~~~--------------~Dg~~~~~l~sgs~D~tv~~wd~~p~~~g~~~~~~~~~~~~~~~~~v~~i~~~  689 (902)
T 2oaj_A          624 CVTCIEFVIMEYG--------------DDGYSSILMVCGTDMGEVITYKILPASGGKFDVQLMDITNVTSKGPIHKIDAF  689 (902)
T ss_dssp             CEEEEEEEEEECT--------------TSSSEEEEEEEEETTSEEEEEEEEECGGGCEEEEEEEEEECCSSCCCCEEEEE
T ss_pred             ceEEEEEEEEecC--------------CCCCcceEEEEEecCCcEEEEEEecCCCCcEEEEecCceecCCCCceEEEEeE
Confidence            9999999821110              11144699999999999999998   88998877754432   3344455544


Q ss_pred             eCCCCCC-cccccccccCCCCCCCCCCCCCcCCCCCCCCCcccccccccccchhhhhccceEEEEEeccceeeecccccc
Q 001109          780 EGGNFFS-ETSSEKQSLNTPQNSKATSEPDQTNANTGSDPVVAELETSTEATYLERIFEHLFVLLCYEDALWLYPLKSLI  858 (1155)
Q Consensus       780 d~~~~~~-~~~~e~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~llc~e~~~~~ysl~~~~  858 (1155)
                      +...... ....+.+                                   ....++...+.++|+|+|+.|+||++++  
T Consensus       690 ~~~~~~~~~a~~~~~-----------------------------------~~l~~~~~~~~~~l~~~~~~ir~~~~~~--  732 (902)
T 2oaj_A          690 SKETKSSCLATIPKM-----------------------------------QNLSKGLCIPGIVLITGFDDIRLITLGK--  732 (902)
T ss_dssp             ETTTCCBCBCBHHHH-----------------------------------HGGGGTCCCCEEEEEECSSEEEEECTTC--
T ss_pred             ecCCCCcccCCHHHH-----------------------------------hccCCCCCCCeEEEEEeccceEEEeCcc--
Confidence            4221100 0000000                                   0111223358899999999999999998  


Q ss_pred             ccccceeEEeeccCCccceee--ee------eCCceeEEEEEeecCcEEEeecCCcccccccccccccccccccCcceee
Q 001109          859 QGHTDSIHKVNLLKPCCWTTS--FK------KNEKECGLVVLYQTGDIEIRVLPYLEVGGQTSLMSLLRWNYKTNMEETL  930 (1155)
Q Consensus       859 qg~~~~~~k~k~~~~~~~~~~--~~------~~~~~~~l~~~~~~G~ieirslp~l~~~~~~s~~~~~~~~~~~~~~~~~  930 (1155)
                         .|+++|. +..+||++++  |.      .+.++++|++++++|.|+|+|||+|+.+++.++..++..+    +.+..
T Consensus       733 ---~k~~~k~-~~~~~~~~~v~~~~~~~~~~~~~~~~~l~~~~~~g~i~~~s~p~l~~~~~~~~~~~~~~~----~~~~~  804 (902)
T 2oaj_A          733 ---SKSTHKG-FKYPLAATGLSYISTVEKNNDRKNLTVIITLEINGHLRVFTIPDFKEQMSEHIPFPIAAK----YITES  804 (902)
T ss_dssp             ---CCEEEEE-CSSCEEEEEEEEEEEECSSSCEEEEEEEEEEETTSEEEEEETTTCCEEEEEECSSCCCHH----HHTTC
T ss_pred             ---ccceeeE-cccceeeeEEEEEEeccccccccCceEEEEEeCCCcEEEEECcchHHHhhccCCcccccc----cccce
Confidence               3777766 7888999998  55      4578999999999999999999999999988776544443    34566


Q ss_pred             eecCCCcEEEEcC
Q 001109          931 CSSDSGEIVLVDF  943 (1155)
Q Consensus       931 ~~s~~g~~~lvng  943 (1155)
                      |++.+|+++...+
T Consensus       805 ~~~~~G~~~~~~~  817 (902)
T 2oaj_A          805 SVLRNGDIAIRVS  817 (902)
T ss_dssp             EECTTSCEEEECS
T ss_pred             EEcCCCCEEEEeC
Confidence            9999999955444
>2ymu_A WD-40 repeat protein; unknown function, two domains; 1.79A {Nostoc punctiforme} Back     alignment and structure
>1nr0_A Actin interacting protein 1; beta propeller, WD40 repeat, ADF, cofilin, structural genomics, PSI, protein structure initiative; 1.70A {Caenorhabditis elegans} SCOP: b.69.4.1 b.69.4.1 PDB: 1pev_A Back     alignment and structure
>2ymu_A WD-40 repeat protein; unknown function, two domains; 1.79A {Nostoc punctiforme} Back     alignment and structure
>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* Back     alignment and structure
>1pgu_A Actin interacting protein 1; WD repeat, seven-bladed beta-propeller, protein binding; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 b.69.4.1 PDB: 1pi6_A Back     alignment and structure
>1nr0_A Actin interacting protein 1; beta propeller, WD40 repeat, ADF, cofilin, structural genomics, PSI, protein structure initiative; 1.70A {Caenorhabditis elegans} SCOP: b.69.4.1 b.69.4.1 PDB: 1pev_A Back     alignment and structure
>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* Back     alignment and structure
>2oaj_A Protein SNI1; WD40 repeat, beta propeller, endocytosis/exocytosis complex; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>1pgu_A Actin interacting protein 1; WD repeat, seven-bladed beta-propeller, protein binding; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 b.69.4.1 PDB: 1pi6_A Back     alignment and structure
>1vyh_C Platelet-activating factor acetylhydrolase IB alpha subunit; lissencephaly, platelet activacting factor, regulator of cytoplasmic dynein; 3.4A {Mus musculus} SCOP: b.69.4.1 Back     alignment and structure
>1vyh_C Platelet-activating factor acetylhydrolase IB alpha subunit; lissencephaly, platelet activacting factor, regulator of cytoplasmic dynein; 3.4A {Mus musculus} SCOP: b.69.4.1 Back     alignment and structure
>1got_B GT-beta; complex (GTP-binding/transducer), G protein, heterotrimer signal transduction; HET: GDP; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1b9y_A 1b9x_A* 2trc_B 1tbg_A 1gg2_B* 1omw_B 1gp2_B 1xhm_A 2qns_A 3ah8_B* 3cik_B 3kj5_A 3krw_B* 3krx_B* 3psc_B 3pvu_B* 3pvw_B* 1a0r_B* 2bcj_B* 3sn6_B* Back     alignment and structure
>2ynn_A Coatomer subunit beta'; protein transport, peptide binding protein, membrane traffic COPI-mediated trafficking, dilysine motifs; 1.78A {Saccharomyces cerevisiae} PDB: 2yno_A Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>4gqb_B Methylosome protein 50; TIM barrel, beta-propeller, methyltransferase, methylation, transferase-protein binding complex; HET: 0XU; 2.06A {Homo sapiens} Back     alignment and structure
>1r5m_A SIR4-interacting protein SIF2; transcription corepressor, WD40 repeat, beta propeller; 1.55A {Saccharomyces cerevisiae} Back     alignment and structure
>3ow8_A WD repeat-containing protein 61; structural genomics consortium, SGC, transcriptio; 2.30A {Homo sapiens} Back     alignment and structure
>3iz6_a 40S ribosomal protein RACK1 (RACK1); eukaryotic ribosome,homology modeling,de novo modeling,ribos proteins,novel ribosomal proteins, ribosome; 5.50A {Triticum aestivum} Back     alignment and structure
>4g56_B MGC81050 protein; protein arginine methyltransferase, protein complexes, histo methylation, transferase; HET: SAH; 2.95A {Xenopus laevis} Back     alignment and structure
>4gqb_B Methylosome protein 50; TIM barrel, beta-propeller, methyltransferase, methylation, transferase-protein binding complex; HET: 0XU; 2.06A {Homo sapiens} Back     alignment and structure
>2pm9_A Protein WEB1, protein transport protein SEC31; beta propeller; 3.30A {Saccharomyces cerevisiae} Back     alignment and structure
>3ow8_A WD repeat-containing protein 61; structural genomics consortium, SGC, transcriptio; 2.30A {Homo sapiens} Back     alignment and structure
>3fm0_A Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD repeat, biosynthetic prote structural genomics, structural genomics consortium; 1.70A {Homo sapiens} Back     alignment and structure
>3fm0_A Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD repeat, biosynthetic prote structural genomics, structural genomics consortium; 1.70A {Homo sapiens} Back     alignment and structure
>2pbi_B Guanine nucleotide-binding protein subunit beta 5; helix WRAP, RGS domain, DEP domain, DHEX domain, GGL domain, propeller, signaling protein; 1.95A {Mus musculus} Back     alignment and structure
>3vl1_A 26S proteasome regulatory subunit RPN14; beta-propeller, chaperone, RPT6; 1.60A {Saccharomyces cerevisiae} PDB: 3acp_A Back     alignment and structure
>1r5m_A SIR4-interacting protein SIF2; transcription corepressor, WD40 repeat, beta propeller; 1.55A {Saccharomyces cerevisiae} Back     alignment and structure
>1gxr_A ESG1, transducin-like enhancer protein 1; transcriptional CO-repressor, WD40, transcription repressor, WD repeat; 1.65A {Homo sapiens} SCOP: b.69.4.1 PDB: 2ce8_A 2ce9_A Back     alignment and structure
>2ynn_A Coatomer subunit beta'; protein transport, peptide binding protein, membrane traffic COPI-mediated trafficking, dilysine motifs; 1.78A {Saccharomyces cerevisiae} PDB: 2yno_A Back     alignment and structure
>4g56_B MGC81050 protein; protein arginine methyltransferase, protein complexes, histo methylation, transferase; HET: SAH; 2.95A {Xenopus laevis} Back     alignment and structure
>1erj_A Transcriptional repressor TUP1; beta-propeller, transcription inhibitor; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 Back     alignment and structure
>3frx_A Guanine nucleotide-binding protein subunit beta- like protein; RACK1, WD40, beta propeller, ribosome, translation, acetylation; 2.13A {Saccharomyces cerevisiae} PDB: 3izb_a 3o2z_T 3o30_T 3u5c_g 3u5g_g 3rfg_A 3rfh_A 1trj_A 3jyv_R* Back     alignment and structure
>2hes_X YDR267CP; beta-propeller, WD40 repeat, biosynthetic protein; 1.70A {Saccharomyces cerevisiae} Back     alignment and structure
>1got_B GT-beta; complex (GTP-binding/transducer), G protein, heterotrimer signal transduction; HET: GDP; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1b9y_A 1b9x_A* 2trc_B 1tbg_A 1gg2_B* 1omw_B 1gp2_B 1xhm_A 2qns_A 3ah8_B* 3cik_B 3kj5_A 3krw_B* 3krx_B* 3psc_B 3pvu_B* 3pvw_B* 1a0r_B* 2bcj_B* 3sn6_B* Back     alignment and structure
>2pm9_A Protein WEB1, protein transport protein SEC31; beta propeller; 3.30A {Saccharomyces cerevisiae} Back     alignment and structure
>1gxr_A ESG1, transducin-like enhancer protein 1; transcriptional CO-repressor, WD40, transcription repressor, WD repeat; 1.65A {Homo sapiens} SCOP: b.69.4.1 PDB: 2ce8_A 2ce9_A Back     alignment and structure
>2xzm_R RACK1; ribosome, translation; 3.93A {Tetrahymena thermophila} PDB: 2xzn_R Back     alignment and structure
>1erj_A Transcriptional repressor TUP1; beta-propeller, transcription inhibitor; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 Back     alignment and structure
>3iz6_a 40S ribosomal protein RACK1 (RACK1); eukaryotic ribosome,homology modeling,de novo modeling,ribos proteins,novel ribosomal proteins, ribosome; 5.50A {Triticum aestivum} Back     alignment and structure
>3frx_A Guanine nucleotide-binding protein subunit beta- like protein; RACK1, WD40, beta propeller, ribosome, translation, acetylation; 2.13A {Saccharomyces cerevisiae} PDB: 3izb_a 3o2z_T 3o30_T 3u5c_g 3u5g_g 3rfg_A 3rfh_A 1trj_A 3jyv_R* Back     alignment and structure
>2pbi_B Guanine nucleotide-binding protein subunit beta 5; helix WRAP, RGS domain, DEP domain, DHEX domain, GGL domain, propeller, signaling protein; 1.95A {Mus musculus} Back     alignment and structure
>2xzm_R RACK1; ribosome, translation; 3.93A {Tetrahymena thermophila} PDB: 2xzn_R Back     alignment and structure
>3gre_A Serine/threonine-protein kinase VPS15; seven-bladed propeller, WD repeat, scaffold protein, ATP- binding, endosome, golgi apparatus; 1.80A {Saccharomyces cerevisiae} Back     alignment and structure
>4ery_A WD repeat-containing protein 5; WD40, WIN motif, beta propeller, 3-10 helix, lysine methyltransferase, RBBP5, ASH2L, core complex; 1.30A {Homo sapiens} PDB: 2h6k_A* 2h68_A* 2h6q_A* 3eg6_A 4erq_A 2h6n_A 4erz_A 4es0_A 4esg_A 4ewr_A 2gnq_A 2xl2_A 2xl3_A 3uvk_A* 3psl_A* 3uvl_A 3uvm_A 3uvn_A 3uvo_A 2h14_A ... Back     alignment and structure
>4aow_A Guanine nucleotide-binding protein subunit beta-2; receptor, WD-repeat, beta-propeller; 2.45A {Homo sapiens} PDB: 2zkq_a Back     alignment and structure
>4aow_A Guanine nucleotide-binding protein subunit beta-2; receptor, WD-repeat, beta-propeller; 2.45A {Homo sapiens} PDB: 2zkq_a Back     alignment and structure
>2j04_B YDR362CP, TAU91; beta propeller, type 2 promoters, transcription, hypothetica protein, preinitiation complex, yeast RNA polymerase III; 3.2A {Saccharomyces cerevisiae} Back     alignment and structure
>2hes_X YDR267CP; beta-propeller, WD40 repeat, biosynthetic protein; 1.70A {Saccharomyces cerevisiae} Back     alignment and structure
>4ery_A WD repeat-containing protein 5; WD40, WIN motif, beta propeller, 3-10 helix, lysine methyltransferase, RBBP5, ASH2L, core complex; 1.30A {Homo sapiens} PDB: 2h6k_A* 2h68_A* 2h6q_A* 3eg6_A 4erq_A 2h6n_A 4erz_A 4es0_A 4esg_A 4ewr_A 2gnq_A 2xl2_A 2xl3_A 3uvk_A* 3psl_A* 3uvl_A 3uvm_A 3uvn_A 3uvo_A 2h14_A ... Back     alignment and structure
>3zwl_B Eukaryotic translation initiation factor 3 subuni; 2.20A {Saccharomyces cerevisiae} Back     alignment and structure
>3v7d_B Cell division control protein 4; WD 40 domain, phospho-peptide complex, E3 ubiquitin ligase, cell cycle, phospho binding protein, phosphorylation; HET: SEP; 2.31A {Saccharomyces cerevisiae} PDB: 1nex_B* 3mks_B* Back     alignment and structure
>2ovr_B FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 domains, double phosphorylation, transcription-C complex; HET: TPO; 2.50A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 PDB: 2ovp_B* 2ovq_B* Back     alignment and structure
>4h5i_A Guanine nucleotide-exchange factor SEC12; copii vesicle budding, potassium binding site, beta propelle protein transport; 1.36A {Saccharomyces cerevisiae} PDB: 4h5j_A Back     alignment and structure
>3k26_A Polycomb protein EED; WD40, structural genomics, NPPSFA, national project on prote structural and functional analysis, structural genomics CON SGC; HET: M3L; 1.58A {Homo sapiens} PDB: 3jzn_A* 3k27_A* 3jpx_A* 3jzg_A* 3jzh_A* 3iiw_A* 3ijc_A* 3iiy_A* 3ij0_A* 3ij1_A* 2qxv_A Back     alignment and structure
>3zwl_B Eukaryotic translation initiation factor 3 subuni; 2.20A {Saccharomyces cerevisiae} Back     alignment and structure
>1sq9_A Antiviral protein SKI8; WD repeat, beta-transducin repeat, WD40 repeat, beta propeller, recombination; 1.90A {Saccharomyces cerevisiae} SCOP: b.69.4.1 PDB: 1s4u_X Back     alignment and structure
>4a11_B DNA excision repair protein ERCC-8; DNA binding protein, DNA damage repair; HET: DNA; 3.31A {Homo sapiens} Back     alignment and structure
>3ei3_B DNA damage-binding protein 2; UV-damage, DDB, nucleotide excision repair, xeroderma pigmentosum, cytoplasm, DNA repair; HET: DNA PG4; 2.30A {Danio rerio} PDB: 3ei1_B* 3ei2_B* 4a08_B* 4a09_B* 4a0a_B* 4a0b_B* 4a0k_D* 4a0l_B* Back     alignment and structure
>3i2n_A WD repeat-containing protein 92; WD40 repeats, structural genomics, structural genomic consortium, SGC, apoptosis, transcription; 1.95A {Homo sapiens} Back     alignment and structure
>1k8k_C P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta-propeller, structural protein; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1tyq_C* 1u2v_C* 2p9i_C* 2p9k_C* 2p9l_C 2p9n_C* 2p9p_C* 2p9s_C* 2p9u_C* 3rse_C 3dxm_C* 3dxk_C Back     alignment and structure
>3i2n_A WD repeat-containing protein 92; WD40 repeats, structural genomics, structural genomic consortium, SGC, apoptosis, transcription; 1.95A {Homo sapiens} Back     alignment and structure
>3dm0_A Maltose-binding periplasmic protein fused with RACK1; MBP RACK1A, receptor for activiated protein C-kinase 1, beta-propeller WD40 repeat; HET: GLC; 2.40A {Escherichia coli} Back     alignment and structure
>3ei3_B DNA damage-binding protein 2; UV-damage, DDB, nucleotide excision repair, xeroderma pigmentosum, cytoplasm, DNA repair; HET: DNA PG4; 2.30A {Danio rerio} PDB: 3ei1_B* 3ei2_B* 4a08_B* 4a09_B* 4a0a_B* 4a0b_B* 4a0k_D* 4a0l_B* Back     alignment and structure
>2j04_B YDR362CP, TAU91; beta propeller, type 2 promoters, transcription, hypothetica protein, preinitiation complex, yeast RNA polymerase III; 3.2A {Saccharomyces cerevisiae} Back     alignment and structure
>4h5i_A Guanine nucleotide-exchange factor SEC12; copii vesicle budding, potassium binding site, beta propelle protein transport; 1.36A {Saccharomyces cerevisiae} PDB: 4h5j_A Back     alignment and structure
>3dm0_A Maltose-binding periplasmic protein fused with RACK1; MBP RACK1A, receptor for activiated protein C-kinase 1, beta-propeller WD40 repeat; HET: GLC; 2.40A {Escherichia coli} Back     alignment and structure
>4e54_B DNA damage-binding protein 2; beta barrel, double helix, DDB1:WD40 beta-barrel fold, DNA D DNA repair, HOST-virus interactions; HET: DNA 3DR; 2.85A {Homo sapiens} PDB: 3ei4_B* Back     alignment and structure
>4e54_B DNA damage-binding protein 2; beta barrel, double helix, DDB1:WD40 beta-barrel fold, DNA D DNA repair, HOST-virus interactions; HET: DNA 3DR; 2.85A {Homo sapiens} PDB: 3ei4_B* Back     alignment and structure
>2j04_A TAU60, YPL007P, hypothetical protein YPL007C; beta propeller, type 2 promoters, transcription, hypothetica protein, preinitiation complex, yeast RNA polymerase III; 3.2A {Saccharomyces cerevisiae} Back     alignment and structure
>1k8k_C P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta-propeller, structural protein; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1tyq_C* 1u2v_C* 2p9i_C* 2p9k_C* 2p9l_C 2p9n_C* 2p9p_C* 2p9s_C* 2p9u_C* 3rse_C 3dxm_C* 3dxk_C Back     alignment and structure
>1sq9_A Antiviral protein SKI8; WD repeat, beta-transducin repeat, WD40 repeat, beta propeller, recombination; 1.90A {Saccharomyces cerevisiae} SCOP: b.69.4.1 PDB: 1s4u_X Back     alignment and structure
>3k26_A Polycomb protein EED; WD40, structural genomics, NPPSFA, national project on prote structural and functional analysis, structural genomics CON SGC; HET: M3L; 1.58A {Homo sapiens} PDB: 3jzn_A* 3k27_A* 3jpx_A* 3jzg_A* 3jzh_A* 3iiw_A* 3ijc_A* 3iiy_A* 3ij0_A* 3ij1_A* 2qxv_A Back     alignment and structure
>3odt_A Protein DOA1; ubiquitin, nuclear protein; HET: MSE MES; 1.35A {Saccharomyces cerevisiae} Back     alignment and structure
>3vl1_A 26S proteasome regulatory subunit RPN14; beta-propeller, chaperone, RPT6; 1.60A {Saccharomyces cerevisiae} PDB: 3acp_A Back     alignment and structure
>3odt_A Protein DOA1; ubiquitin, nuclear protein; HET: MSE MES; 1.35A {Saccharomyces cerevisiae} Back     alignment and structure
>4aez_A CDC20, WD repeat-containing protein SLP1; cell cycle, KEN-BOX, D-BOX, APC/C; 2.30A {Schizosaccharomyces pombe} Back     alignment and structure
>4aez_A CDC20, WD repeat-containing protein SLP1; cell cycle, KEN-BOX, D-BOX, APC/C; 2.30A {Schizosaccharomyces pombe} Back     alignment and structure
>3dwl_C Actin-related protein 2/3 complex subunit 1; propellor, actin-binding, ATP-binding, cytoskeleton, nucleot binding, WD repeat; HET: ATP; 3.78A {Schizosaccharomyces pombe} Back     alignment and structure
>2pm7_B Protein transport protein SEC13, protein transport protein SEC31; beta propeller, alpha solenoid; 2.35A {Saccharomyces cerevisiae} PDB: 2pm9_B 2pm6_B 3iko_A 3mzk_A 3mzl_A Back     alignment and structure
>4ggc_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; HET: MRD; 1.35A {Homo sapiens} Back     alignment and structure
>4gga_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; 2.04A {Homo sapiens} PDB: 4ggd_A Back     alignment and structure
>4ggc_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; HET: MRD; 1.35A {Homo sapiens} Back     alignment and structure
>4gga_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; 2.04A {Homo sapiens} PDB: 4ggd_A Back     alignment and structure
>3v7d_B Cell division control protein 4; WD 40 domain, phospho-peptide complex, E3 ubiquitin ligase, cell cycle, phospho binding protein, phosphorylation; HET: SEP; 2.31A {Saccharomyces cerevisiae} PDB: 1nex_B* 3mks_B* Back     alignment and structure
>4a11_B DNA excision repair protein ERCC-8; DNA binding protein, DNA damage repair; HET: DNA; 3.31A {Homo sapiens} Back     alignment and structure
>3dw8_B Serine/threonine-protein phosphatase 2A 55 kDa RE subunit B alpha isoform; holoenzyme, PR55, WD repeat, hydrolase, iron, manganese binding, methylation, phosphoprotein, protein phosphatase; HET: 1ZN; 2.85A {Homo sapiens} Back     alignment and structure
>3dwl_C Actin-related protein 2/3 complex subunit 1; propellor, actin-binding, ATP-binding, cytoskeleton, nucleot binding, WD repeat; HET: ATP; 3.78A {Schizosaccharomyces pombe} Back     alignment and structure
>3bg1_A Protein SEC13 homolog; NPC, transport, WD repeat, autocatalytic cleavage, mRNA transport, nuclear pore complex, nucleus, phosphoprotein; 3.00A {Homo sapiens} PDB: 3bg0_A Back     alignment and structure
>1p22_A F-BOX/WD-repeat protein 1A; ubiquitination, degradation, signaling protein; HET: SEP; 2.95A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 Back     alignment and structure
>2pm7_B Protein transport protein SEC13, protein transport protein SEC31; beta propeller, alpha solenoid; 2.35A {Saccharomyces cerevisiae} PDB: 2pm9_B 2pm6_B 3iko_A 3mzk_A 3mzl_A Back     alignment and structure
>3mmy_A MRNA export factor; mRNA export, nuclear protein; HET: MES; 1.65A {Homo sapiens} Back     alignment and structure
>3f3f_A Nucleoporin SEH1; structural protein, protein complex, nucleopori complex, nuclear pore complex, macromolecular assembly, MEM coat; 2.90A {Saccharomyces cerevisiae} PDB: 3f3g_A 3f3p_A 3ewe_A Back     alignment and structure
>3f3f_A Nucleoporin SEH1; structural protein, protein complex, nucleopori complex, nuclear pore complex, macromolecular assembly, MEM coat; 2.90A {Saccharomyces cerevisiae} PDB: 3f3g_A 3f3p_A 3ewe_A Back     alignment and structure
>1yfq_A Cell cycle arrest protein BUB3; WD repeat WD40 repeat beta transducin repeat all beta, signaling protein; 1.10A {Saccharomyces cerevisiae} SCOP: b.69.4.2 PDB: 1u4c_A 2i3s_A 2i3t_A Back     alignment and structure
>3dw8_B Serine/threonine-protein phosphatase 2A 55 kDa RE subunit B alpha isoform; holoenzyme, PR55, WD repeat, hydrolase, iron, manganese binding, methylation, phosphoprotein, protein phosphatase; HET: 1ZN; 2.85A {Homo sapiens} Back     alignment and structure
>3jrp_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>2ovr_B FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 domains, double phosphorylation, transcription-C complex; HET: TPO; 2.50A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 PDB: 2ovp_B* 2ovq_B* Back     alignment and structure
>1k32_A Tricorn protease; protein degradation, substrate gating, serine protease, beta propeller, proteasome, hydrolase; 2.00A {Thermoplasma acidophilum} SCOP: b.36.1.3 b.68.7.1 b.69.9.1 c.14.1.2 PDB: 1n6e_A 1n6d_A 1n6f_A* Back     alignment and structure
>3mmy_A MRNA export factor; mRNA export, nuclear protein; HET: MES; 1.65A {Homo sapiens} Back     alignment and structure
>1p22_A F-BOX/WD-repeat protein 1A; ubiquitination, degradation, signaling protein; HET: SEP; 2.95A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 Back     alignment and structure
>1yfq_A Cell cycle arrest protein BUB3; WD repeat WD40 repeat beta transducin repeat all beta, signaling protein; 1.10A {Saccharomyces cerevisiae} SCOP: b.69.4.2 PDB: 1u4c_A 2i3s_A 2i3t_A Back     alignment and structure
>2j04_A TAU60, YPL007P, hypothetical protein YPL007C; beta propeller, type 2 promoters, transcription, hypothetica protein, preinitiation complex, yeast RNA polymerase III; 3.2A {Saccharomyces cerevisiae} Back     alignment and structure
>3gre_A Serine/threonine-protein kinase VPS15; seven-bladed propeller, WD repeat, scaffold protein, ATP- binding, endosome, golgi apparatus; 1.80A {Saccharomyces cerevisiae} Back     alignment and structure
>1k32_A Tricorn protease; protein degradation, substrate gating, serine protease, beta propeller, proteasome, hydrolase; 2.00A {Thermoplasma acidophilum} SCOP: b.36.1.3 b.68.7.1 b.69.9.1 c.14.1.2 PDB: 1n6e_A 1n6d_A 1n6f_A* Back     alignment and structure
>3bg1_A Protein SEC13 homolog; NPC, transport, WD repeat, autocatalytic cleavage, mRNA transport, nuclear pore complex, nucleus, phosphoprotein; 3.00A {Homo sapiens} PDB: 3bg0_A Back     alignment and structure
>3vu4_A KMHSV2; beta-propeller fold, protein transport; 2.60A {Kluyveromyces marxianus} PDB: 4av9_A 4av8_A 4exv_A Back     alignment and structure
>3lrv_A PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiquitin ligase, spliceosome, DNA damage, D repair, mRNA processing, nucleus; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3jrp_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3vu4_A KMHSV2; beta-propeller fold, protein transport; 2.60A {Kluyveromyces marxianus} PDB: 4av9_A 4av8_A 4exv_A Back     alignment and structure
>2xyi_A Probable histone-binding protein CAF1; transcription, repressor, phosphoprotein, WD-repeat; HET: PG4; 1.75A {Drosophila melanogaster} PDB: 3c99_A 3c9c_A 2yb8_B 2yba_A 2xu7_A* 3gfc_A 3cfs_B 3cfv_B Back     alignment and structure
>2aq5_A Coronin-1A; WD40 repeat, 7-bladed beta-propeller, structural protein; HET: CME; 1.75A {Mus musculus} PDB: 2b4e_A Back     alignment and structure
>1l0q_A Surface layer protein; SLP, S-layer, 7-bladed beta-propeller superfamily, protein binding; HET: YCM; 2.40A {Methanosarcina mazei} SCOP: b.1.3.1 b.69.2.3 Back     alignment and structure
>2aq5_A Coronin-1A; WD40 repeat, 7-bladed beta-propeller, structural protein; HET: CME; 1.75A {Mus musculus} PDB: 2b4e_A Back     alignment and structure
>4gq1_A NUP37; propeller, transport protein; 2.40A {Schizosaccharomyces pombe} PDB: 4gq2_P 4fhl_A 4fhm_A 4fhn_A Back     alignment and structure
>2vdu_B TRNA (guanine-N(7)-)-methyltransferase- associated WD repeat protein TRM82; S-adenosyl-L-methionine, tRNA processing, phosphorylation, M7G, spout MT, WD repeat; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3lrv_A PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiquitin ligase, spliceosome, DNA damage, D repair, mRNA processing, nucleus; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3jro_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum, transport, membrane, mRNA transport; 4.00A {Saccharomyces cerevisiae} Back     alignment and structure
>4gq1_A NUP37; propeller, transport protein; 2.40A {Schizosaccharomyces pombe} PDB: 4gq2_P 4fhl_A 4fhm_A 4fhn_A Back     alignment and structure
>3bws_A Protein LP49; two-domain, immunoglobulin-like, 7-bladed beta propeller, unknown function; 1.99A {Leptospira interrogans} Back     alignment and structure
>3bws_A Protein LP49; two-domain, immunoglobulin-like, 7-bladed beta propeller, unknown function; 1.99A {Leptospira interrogans} Back     alignment and structure
>1nir_A Nitrite reductase; hemoprotein, denitrification, domain swapping; HET: HEC DHE; 2.15A {Pseudomonas aeruginosa} SCOP: a.3.1.2 b.70.2.1 PDB: 1bl9_A* 1n15_A* 1n50_A* 1n90_A* 1gjq_A* 1nno_A* 1hzv_A* 1hzu_A* Back     alignment and structure
>1nir_A Nitrite reductase; hemoprotein, denitrification, domain swapping; HET: HEC DHE; 2.15A {Pseudomonas aeruginosa} SCOP: a.3.1.2 b.70.2.1 PDB: 1bl9_A* 1n15_A* 1n50_A* 1n90_A* 1gjq_A* 1nno_A* 1hzv_A* 1hzu_A* Back     alignment and structure
>2vdu_B TRNA (guanine-N(7)-)-methyltransferase- associated WD repeat protein TRM82; S-adenosyl-L-methionine, tRNA processing, phosphorylation, M7G, spout MT, WD repeat; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2xyi_A Probable histone-binding protein CAF1; transcription, repressor, phosphoprotein, WD-repeat; HET: PG4; 1.75A {Drosophila melanogaster} PDB: 3c99_A 3c9c_A 2yb8_B 2yba_A 2xu7_A* 3gfc_A 3cfs_B 3cfv_B Back     alignment and structure
>2w18_A PALB2, fancn, partner and localizer of BRCA2; fanconi anemia, homologous recomination, polymorphism, phosphoprotein, beta-propeller, WD40, nucleus; 1.90A {Homo sapiens} PDB: 3eu7_A Back     alignment and structure
>2w18_A PALB2, fancn, partner and localizer of BRCA2; fanconi anemia, homologous recomination, polymorphism, phosphoprotein, beta-propeller, WD40, nucleus; 1.90A {Homo sapiens} PDB: 3eu7_A Back     alignment and structure
>3jro_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum, transport, membrane, mRNA transport; 4.00A {Saccharomyces cerevisiae} Back     alignment and structure
>1l0q_A Surface layer protein; SLP, S-layer, 7-bladed beta-propeller superfamily, protein binding; HET: YCM; 2.40A {Methanosarcina mazei} SCOP: b.1.3.1 b.69.2.3 Back     alignment and structure
>2ecf_A Dipeptidyl peptidase IV; prolyl oligopeptidase family, peptidase family S9, hydrolase; 2.80A {Stenotrophomonas maltophilia} Back     alignment and structure
>2ecf_A Dipeptidyl peptidase IV; prolyl oligopeptidase family, peptidase family S9, hydrolase; 2.80A {Stenotrophomonas maltophilia} Back     alignment and structure
>2hqs_A Protein TOLB; TOLB, PAL, TOL, transport protein-lipoprotein complex; 1.50A {Escherichia coli} SCOP: b.68.4.1 c.51.2.1 PDB: 3iax_A 1c5k_A 2ivz_A 2w8b_B 2w8b_A 1crz_A Back     alignment and structure
>1xfd_A DIP, dipeptidyl aminopeptidase-like protein 6, dipeptidylpeptidase 6; DPPX, DPP6, KV4, KV, KAF, membrane protein; HET: NDG NAG BMA MAN; 3.00A {Homo sapiens} SCOP: b.70.3.1 c.69.1.24 Back     alignment and structure
>2z3z_A Dipeptidyl aminopeptidase IV; peptidase family S9, prolyl oligopeptidase family, serine PR proline-specific peptidase, hydrolase; HET: AIO; 1.95A {Porphyromonas gingivalis} PDB: 2z3w_A* 2d5l_A 2eep_A* 2dcm_A* Back     alignment and structure
>2z3z_A Dipeptidyl aminopeptidase IV; peptidase family S9, prolyl oligopeptidase family, serine PR proline-specific peptidase, hydrolase; HET: AIO; 1.95A {Porphyromonas gingivalis} PDB: 2z3w_A* 2d5l_A 2eep_A* 2dcm_A* Back     alignment and structure
>1xfd_A DIP, dipeptidyl aminopeptidase-like protein 6, dipeptidylpeptidase 6; DPPX, DPP6, KV4, KV, KAF, membrane protein; HET: NDG NAG BMA MAN; 3.00A {Homo sapiens} SCOP: b.70.3.1 c.69.1.24 Back     alignment and structure
>1ri6_A Putative isomerase YBHE; 7-bladed propeller, enzyme, PSI, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.00A {Escherichia coli} SCOP: b.69.11.1 Back     alignment and structure
>1pby_B Quinohemoprotein amine dehydrogenase 40 kDa subunit; oxidoreductase; HET: TRW HEM; 1.70A {Paracoccus denitrificans} SCOP: b.69.2.2 PDB: 1jju_B* Back     alignment and structure
>2hqs_A Protein TOLB; TOLB, PAL, TOL, transport protein-lipoprotein complex; 1.50A {Escherichia coli} SCOP: b.68.4.1 c.51.2.1 PDB: 3iax_A 1c5k_A 2ivz_A 2w8b_B 2w8b_A 1crz_A Back     alignment and structure
>3hfq_A Uncharacterized protein LP_2219; Q88V64_lacpl, NESG, LPR118, structural genomics, PSI-2, protein structure initiative; 1.96A {Lactobacillus plantarum} Back     alignment and structure
>1ri6_A Putative isomerase YBHE; 7-bladed propeller, enzyme, PSI, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.00A {Escherichia coli} SCOP: b.69.11.1 Back     alignment and structure
>2ojh_A Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 6-stranded beta-propeller, structural genomics, PSI-2; 1.85A {Agrobacterium tumefaciens str} Back     alignment and structure
>3o4h_A Acylamino-acid-releasing enzyme; alpha/beta hydrolase fold, beta propeller, hydrolase, oligop SIZE selectivity; HET: GOL; 1.82A {Aeropyrum pernix} PDB: 3o4i_A 3o4j_A 2hu5_A* 1ve7_A* 1ve6_A* 2hu7_A* 3o4g_A 2hu8_A* 2qr5_A 2qzp_A Back     alignment and structure
>2ojh_A Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 6-stranded beta-propeller, structural genomics, PSI-2; 1.85A {Agrobacterium tumefaciens str} Back     alignment and structure
>1z68_A Fibroblast activation protein, alpha subunit; seprase, fibroblast activation protein alpha,fapalpha, dipeptidylpeptidase,S9B; HET: NAG NDG; 2.60A {Homo sapiens} Back     alignment and structure
>1pby_B Quinohemoprotein amine dehydrogenase 40 kDa subunit; oxidoreductase; HET: TRW HEM; 1.70A {Paracoccus denitrificans} SCOP: b.69.2.2 PDB: 1jju_B* Back     alignment and structure
>1z68_A Fibroblast activation protein, alpha subunit; seprase, fibroblast activation protein alpha,fapalpha, dipeptidylpeptidase,S9B; HET: NAG NDG; 2.60A {Homo sapiens} Back     alignment and structure
>3u4y_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomi CS, MCSG; 2.99A {Desulfotomaculum acetoxidans} Back     alignment and structure
>1jmx_B Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 1.90A {Pseudomonas putida} SCOP: b.69.2.2 PDB: 1jmz_B* Back     alignment and structure
>3vgz_A Uncharacterized protein YNCE; beta-propeller, protein binding; 1.70A {Escherichia coli} PDB: 3vh0_A* Back     alignment and structure
>2oit_A Nucleoporin 214KDA; NH2 terminal domain of NUP214/CAN, X-RAY crystallography, beta-propeller, structure, mRNA export, NPC assembly, leukemia; HET: MES; 1.65A {Homo sapiens} PDB: 3fmo_A* 3fmp_A* 3fhc_A Back     alignment and structure
>3o4h_A Acylamino-acid-releasing enzyme; alpha/beta hydrolase fold, beta propeller, hydrolase, oligop SIZE selectivity; HET: GOL; 1.82A {Aeropyrum pernix} PDB: 3o4i_A 3o4j_A 2hu5_A* 1ve7_A* 1ve6_A* 2hu7_A* 3o4g_A 2hu8_A* 2qr5_A 2qzp_A Back     alignment and structure
>3scy_A Hypothetical bacterial 6-phosphogluconolactonase; 7-bladed beta-propeller, structural genomics, joint center F structural genomics, JCSG; HET: MSE; 1.50A {Bacteroides fragilis} PDB: 3fgb_A Back     alignment and structure
>3u4y_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomi CS, MCSG; 2.99A {Desulfotomaculum acetoxidans} Back     alignment and structure
>1urq_A M-tomosyn isoform; transport protein, tomosyn-snare complex, exocytosis, four helical bundle, coiled coil; 2.0A {Rattus norvegicus} SCOP: h.1.15.1 Back     alignment and structure
>1jof_A Carboxy-CIS,CIS-muconate cyclase; beta-propeller, homotetramer, seMet-protein, isomerase; HET: PIN; 2.50A {Neurospora crassa} SCOP: b.69.10.1 Back     alignment and structure
>3vgz_A Uncharacterized protein YNCE; beta-propeller, protein binding; 1.70A {Escherichia coli} PDB: 3vh0_A* Back     alignment and structure
>2nps_A VAMP-4, vesicle-associated membrane protein 4; vesicle fusion, snare complex, early endosomal snare complex, VTI1A, VAMP4, transport protein; 2.50A {Mus musculus} Back     alignment and structure
>2oit_A Nucleoporin 214KDA; NH2 terminal domain of NUP214/CAN, X-RAY crystallography, beta-propeller, structure, mRNA export, NPC assembly, leukemia; HET: MES; 1.65A {Homo sapiens} PDB: 3fmo_A* 3fmp_A* 3fhc_A Back     alignment and structure
>4a5s_A Dipeptidyl peptidase 4 soluble form; hydrolase, type 2 diabetes, novartis compound NVP-BIV988; HET: N7F NAG MAN; 1.62A {Homo sapiens} PDB: 2qjr_A* 3f8s_A* 2qt9_A* 2qtb_A* 2rip_A* 1tk3_A* 1n1m_A* 1nu8_A* 1rwq_A* 1nu6_A* 1tkr_A* 1w1i_A* 2ajl_I* 2bgn_A* 2bub_A* 2ogz_A* 2ole_A* 2oqi_A* 3bjm_A* 3eio_A* ... Back     alignment and structure
>3hfq_A Uncharacterized protein LP_2219; Q88V64_lacpl, NESG, LPR118, structural genomics, PSI-2, protein structure initiative; 1.96A {Lactobacillus plantarum} Back     alignment and structure
>1jmx_B Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 1.90A {Pseudomonas putida} SCOP: b.69.2.2 PDB: 1jmz_B* Back     alignment and structure
>1sfc_A VAMP 2, protein (synaptobrevin 2); membrane fusion protein complex, transport protein; 2.40A {Rattus norvegicus} SCOP: h.1.15.1 Back     alignment and structure
>3hd7_A Vesicle-associated membrane protein 2; membrane protein, coiled-coil, 4-helical bundle, cell juncti cytoplasmic vesicle, membrane, phosphoprotein; HET: GGG; 3.40A {Rattus norvegicus} PDB: 3hd9_A 3ipd_A Back     alignment and structure
>1l4a_A Synaptobrevin; snare, snare complex, membrane fusion, neurotransmission, endocytosis/exocytosis complex; 2.95A {Loligo pealei} SCOP: h.1.15.1 Back     alignment and structure
>1n7s_A Vesicle-associated membrane protein 2; neuronal snare protein complex, four helix bundle, transport protein; 1.45A {Rattus norvegicus} SCOP: h.1.15.1 PDB: 1kil_A 3rk2_A 3rk3_A 3rl0_A 3fii_B 3g94_B Back     alignment and structure
>3b5n_A Synaptobrevin homolog 1; snare complex, syntaxin, synaptobrevin, SNAP-25, SSO1P, SNC1P, SEC9P, SSO1, SNC1, coiled coil; 1.60A {Saccharomyces cerevisiae} SCOP: h.1.15.1 Back     alignment and structure
>3scy_A Hypothetical bacterial 6-phosphogluconolactonase; 7-bladed beta-propeller, structural genomics, joint center F structural genomics, JCSG; HET: MSE; 1.50A {Bacteroides fragilis} PDB: 3fgb_A Back     alignment and structure
>3c5m_A Oligogalacturonate lyase; blade-shaped beta-propeller, structural genomics, PSI-2, protein structure initiative; 2.60A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>2oiz_A Aromatic amine dehydrogenase, large subunit; oxidoreductase, tryptophan tryptophyl quinone, H-tunneling; HET: TRQ TSR PG4; 1.05A {Alcaligenes faecalis} PDB: 2agw_A* 2agx_A* 2agl_A* 2agz_A* 2ah0_A* 2ah1_A* 2hj4_A* 2hjb_A* 2i0t_A* 2iup_A* 2iuq_A* 2iur_A* 2iuv_A* 2agy_A* 2ok4_A* 2ok6_A* 2iaa_A* 2h47_A* 2h3x_A* 2hkr_A* ... Back     alignment and structure
>3pe7_A Oligogalacturonate lyase; seven-bladed beta-propeller; 1.65A {Yersinia enterocolitica subsp} Back     alignment and structure
>3pe7_A Oligogalacturonate lyase; seven-bladed beta-propeller; 1.65A {Yersinia enterocolitica subsp} Back     alignment and structure
>2oiz_A Aromatic amine dehydrogenase, large subunit; oxidoreductase, tryptophan tryptophyl quinone, H-tunneling; HET: TRQ TSR PG4; 1.05A {Alcaligenes faecalis} PDB: 2agw_A* 2agx_A* 2agl_A* 2agz_A* 2ah0_A* 2ah1_A* 2hj4_A* 2hjb_A* 2i0t_A* 2iup_A* 2iuq_A* 2iur_A* 2iuv_A* 2agy_A* 2ok4_A* 2ok6_A* 2iaa_A* 2h47_A* 2h3x_A* 2hkr_A* ... Back     alignment and structure
>1gl2_A Endobrevin; membrane protein, membrane fusion protein complex, coiled coil, transmembrane; 1.9A {Rattus norvegicus} SCOP: h.1.15.1 Back     alignment and structure
>2kog_A Vesicle-associated membrane protein 2; synaptobrevin, VAMP2, DPC micelle, snare, coiled coil, membrane fusion, transmembrane; NMR {Rattus norvegicus} Back     alignment and structure
>1jof_A Carboxy-CIS,CIS-muconate cyclase; beta-propeller, homotetramer, seMet-protein, isomerase; HET: PIN; 2.50A {Neurospora crassa} SCOP: b.69.10.1 Back     alignment and structure
>1qks_A Cytochrome CD1 nitrite reductase; enzyme, oxidoreductase, denitrification, electron transport, periplasmic; HET: HEC DHE; 1.28A {Paracoccus pantotrophus} SCOP: a.3.1.2 b.70.2.1 PDB: 1aof_A* 1aoq_A* 1aom_A* 1e2r_A* 1hj5_A* 1h9x_A* 1h9y_A* 1hcm_A* 1hj3_A* 1hj4_A* 1dy7_A* 1gq1_A* Back     alignment and structure
>3azo_A Aminopeptidase; POP family, hydrolase; 2.00A {Streptomyces morookaensis} PDB: 3azp_A 3azq_A Back     alignment and structure
>4a5s_A Dipeptidyl peptidase 4 soluble form; hydrolase, type 2 diabetes, novartis compound NVP-BIV988; HET: N7F NAG MAN; 1.62A {Homo sapiens} PDB: 2qjr_A* 3f8s_A* 2qt9_A* 2qtb_A* 2rip_A* 1tk3_A* 1n1m_A* 1nu8_A* 1rwq_A* 1nu6_A* 1tkr_A* 1w1i_A* 2ajl_I* 2bgn_A* 2bub_A* 2ogz_A* 2ole_A* 2oqi_A* 3bjm_A* 3eio_A* ... Back     alignment and structure
>1qks_A Cytochrome CD1 nitrite reductase; enzyme, oxidoreductase, denitrification, electron transport, periplasmic; HET: HEC DHE; 1.28A {Paracoccus pantotrophus} SCOP: a.3.1.2 b.70.2.1 PDB: 1aof_A* 1aoq_A* 1aom_A* 1e2r_A* 1hj5_A* 1h9x_A* 1h9y_A* 1hcm_A* 1hj3_A* 1hj4_A* 1dy7_A* 1gq1_A* Back     alignment and structure
>3azo_A Aminopeptidase; POP family, hydrolase; 2.00A {Streptomyces morookaensis} PDB: 3azp_A 3azq_A Back     alignment and structure
>3fvz_A Peptidyl-glycine alpha-amidating monooxygenase; beta propeller, lyase, peptide amidation, HG-MAD, Zn-MAD, CL PAIR of basic residues; 2.35A {Rattus norvegicus} PDB: 3fw0_A* Back     alignment and structure
>1q7f_A NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL repeat, beta-propeller, translation; 1.95A {Drosophila melanogaster} SCOP: b.68.9.1 Back     alignment and structure
>2gop_A Trilobed protease; beta propeller, open velcro, hydrolase; 2.00A {Pyrococcus furiosus} Back     alignment and structure
>2nut_C Vesicle-trafficking protein SEC22B; human copii SEC23/24 complexed with SEC22, protein transport; 2.30A {Homo sapiens} PDB: 2nup_C 3egd_C 3egx_C 1ifq_A Back     alignment and structure
>3e5z_A Putative gluconolactonase; X-RAY NESG Q9RXN3 gluconolactonase, structural genomics, PSI protein structure initiative; 2.01A {Deinococcus radiodurans} Back     alignment and structure
>2xdw_A Prolyl endopeptidase; alpha/beta-hydrolase, amnesia, beta-propeller, hydrolase, in; HET: PHQ TAM; 1.35A {Sus scrofa} PDB: 1qfm_A 1qfs_A* 1h2w_A* 3eq7_A* 3eq8_A* 3eq9_A* 1e8m_A* 1e8n_A 1h2z_A 1uoo_A 1uop_A 1uoq_A 1o6f_A 1h2x_A 1h2y_A* 1o6g_A 1vz3_A 1e5t_A 1vz2_A 3ddu_A* Back     alignment and structure
>2xdw_A Prolyl endopeptidase; alpha/beta-hydrolase, amnesia, beta-propeller, hydrolase, in; HET: PHQ TAM; 1.35A {Sus scrofa} PDB: 1qfm_A 1qfs_A* 1h2w_A* 3eq7_A* 3eq8_A* 3eq9_A* 1e8m_A* 1e8n_A 1h2z_A 1uoo_A 1uop_A 1uoq_A 1o6f_A 1h2x_A 1h2y_A* 1o6g_A 1vz3_A 1e5t_A 1vz2_A 3ddu_A* Back     alignment and structure
>1q7f_A NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL repeat, beta-propeller, translation; 1.95A {Drosophila melanogaster} SCOP: b.68.9.1 Back     alignment and structure
>2dg1_A DRP35, lactonase; beta propeller, hydrolase; 1.72A {Staphylococcus aureus} SCOP: b.68.6.1 PDB: 2dg0_A 2dso_A Back     alignment and structure
>3fvz_A Peptidyl-glycine alpha-amidating monooxygenase; beta propeller, lyase, peptide amidation, HG-MAD, Zn-MAD, CL PAIR of basic residues; 2.35A {Rattus norvegicus} PDB: 3fw0_A* Back     alignment and structure
>4b93_A Vesicle-associated membrane protein 7; endocytosis, exocytosis, snare; 2.00A {Mus musculus} PDB: 2dmw_A Back     alignment and structure
>3c5m_A Oligogalacturonate lyase; blade-shaped beta-propeller, structural genomics, PSI-2, protein structure initiative; 2.60A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>2gop_A Trilobed protease; beta propeller, open velcro, hydrolase; 2.00A {Pyrococcus furiosus} Back     alignment and structure
>2bkl_A Prolyl endopeptidase; mechanistic study, celiac sprue, hydrolase, protease; HET: ZAH MES; 1.5A {Myxococcus xanthus} Back     alignment and structure
>3dsm_A Uncharacterized protein bacuni_02894; seven_blated beta propeller, structural genomics, PSI-2, Pro structure initiative; 1.90A {Bacteroides uniformis} Back     alignment and structure
>3no2_A Uncharacterized protein; six-bladed beta-propeller, structural genomics, joint center structural genomics, JCSG, protein structure initiative; HET: MSE CIT PEG; 1.35A {Bacteroides caccae} Back     alignment and structure
>1rwi_B Serine/threonine-protein kinase PKND; beta propeller, structural genomics, PSI, protein structure initiative; 1.80A {Mycobacterium tuberculosis} SCOP: b.68.9.1 PDB: 1rwl_A Back     alignment and structure
>2bkl_A Prolyl endopeptidase; mechanistic study, celiac sprue, hydrolase, protease; HET: ZAH MES; 1.5A {Myxococcus xanthus} Back     alignment and structure
>1pjx_A Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotriesterase (PTE), nitrogen-calcium coordination, BET propeller; HET: ME2 MES PGE; 0.85A {Loligo vulgaris} SCOP: b.68.6.1 PDB: 1e1a_A* 2gvv_A* 2gvw_A 3byc_A 3kgg_A 3o4p_A* 3li3_A 2gvx_A 2gvu_A 3li4_A 2iaq_A 3li5_A* 2iao_A 2iap_A 2iau_A 2iax_A 2iaw_A 2ias_A 2iat_A 2iar_A ... Back     alignment and structure
>3e5z_A Putative gluconolactonase; X-RAY NESG Q9RXN3 gluconolactonase, structural genomics, PSI protein structure initiative; 2.01A {Deinococcus radiodurans} Back     alignment and structure
>2z2n_A Virginiamycin B lyase; seven-bladed beta-propeller, antibiotic resistance, E mechanism, virginiamycin B hydrolase streptogramin; HET: MSE; 1.65A {Staphylococcus aureus} PDB: 2z2o_A 2z2p_A* Back     alignment and structure
>1xip_A Nucleoporin NUP159; beta-propeller, transport protein; 2.50A {Saccharomyces cerevisiae} SCOP: b.69.14.1 PDB: 3pez_C* 3rrm_C* Back     alignment and structure
>1rwi_B Serine/threonine-protein kinase PKND; beta propeller, structural genomics, PSI, protein structure initiative; 1.80A {Mycobacterium tuberculosis} SCOP: b.68.9.1 PDB: 1rwl_A Back     alignment and structure
>3no2_A Uncharacterized protein; six-bladed beta-propeller, structural genomics, joint center structural genomics, JCSG, protein structure initiative; HET: MSE CIT PEG; 1.35A {Bacteroides caccae} Back     alignment and structure
>2dg1_A DRP35, lactonase; beta propeller, hydrolase; 1.72A {Staphylococcus aureus} SCOP: b.68.6.1 PDB: 2dg0_A 2dso_A Back     alignment and structure
>2mad_H Methylamine dehydrogenase (heavy subunit); oxidoreductase(CHNH2(D)-deaminating); HET: TRQ; 2.25A {Paracoccus versutus} SCOP: b.69.2.1 PDB: 1mae_H* 1maf_H* Back     alignment and structure
>2z2n_A Virginiamycin B lyase; seven-bladed beta-propeller, antibiotic resistance, E mechanism, virginiamycin B hydrolase streptogramin; HET: MSE; 1.65A {Staphylococcus aureus} PDB: 2z2o_A 2z2p_A* Back     alignment and structure
>1yr2_A Prolyl oligopeptidase; prolyl endopeptidase, mechanistic study, celiac sprue, hydro; 1.80A {Novosphingobium capsulatum} Back     alignment and structure
>1xip_A Nucleoporin NUP159; beta-propeller, transport protein; 2.50A {Saccharomyces cerevisiae} SCOP: b.69.14.1 PDB: 3pez_C* 3rrm_C* Back     alignment and structure
>3sjl_D Methylamine dehydrogenase heavy chain; MAUG, C-heme, quinone cofactor, oxidoreductase-electron transport complex; HET: 0AF HEC MES; 1.63A {Paracoccus denitrificans} PDB: 2gc7_A* 2j55_H* 2j56_H* 2j57_G* 3l4m_D* 3l4o_D* 3orv_D* 3pxs_D* 3pxt_D* 3rlm_D* 2gc4_A* 3rn0_D* 3rn1_D* 3rmz_D* 3svw_D* 3sws_D* 3sxt_D* 3pxw_D* 3sle_D* 1mg2_A* ... Back     alignment and structure
>2mad_H Methylamine dehydrogenase (heavy subunit); oxidoreductase(CHNH2(D)-deaminating); HET: TRQ; 2.25A {Paracoccus versutus} SCOP: b.69.2.1 PDB: 1mae_H* 1maf_H* Back     alignment and structure
>3g4e_A Regucalcin; six bladed beta-propeller, gluconolcatonase, organophosphate hydrolase, calcium bound, alternative splicing, cytoplasm, phosphoprotein; 1.42A {Homo sapiens} PDB: 3g4h_B Back     alignment and structure
>3sjl_D Methylamine dehydrogenase heavy chain; MAUG, C-heme, quinone cofactor, oxidoreductase-electron transport complex; HET: 0AF HEC MES; 1.63A {Paracoccus denitrificans} PDB: 2gc7_A* 2j55_H* 2j56_H* 2j57_G* 3l4m_D* 3l4o_D* 3orv_D* 3pxs_D* 3pxt_D* 3rlm_D* 2gc4_A* 3rn0_D* 3rn1_D* 3rmz_D* 3svw_D* 3sws_D* 3sxt_D* 3pxw_D* 3sle_D* 1mg2_A* ... Back     alignment and structure
>4a2l_A BT_4663, two-component system sensor histidine kinase/RESP; transcription, beta-propeller; HET: PGE PG4 MES 2PE; 2.60A {Bacteroides thetaiotaomicron} PDB: 4a2m_A* Back     alignment and structure
>3hrp_A Uncharacterized protein; NP_812590.1, structural genomics protein of unknown function structural genomics; HET: MSE; 1.70A {Bacteroides thetaiotaomicron vpi-5482} Back     alignment and structure
>3dsm_A Uncharacterized protein bacuni_02894; seven_blated beta propeller, structural genomics, PSI-2, Pro structure initiative; 1.90A {Bacteroides uniformis} Back     alignment and structure
>3c75_H MADH, methylamine dehydrogenase heavy chain; copper proteins, electron transfer complex, TTQ, electron transport, oxidoreductase, periplasm, transport, metal- binding; HET: TRQ; 2.50A {Paracoccus versutus} Back     alignment and structure
>3kyq_A YKT6, synaptobrevin homolog YKT6; V-snare homolog, lipid binding, cytoplasmic vesicle, ER-GOLG transport, golgi apparatus, lipoprotein; HET: DPV; 2.44A {Rattus norvegicus} Back     alignment and structure
>1yr2_A Prolyl oligopeptidase; prolyl endopeptidase, mechanistic study, celiac sprue, hydro; 1.80A {Novosphingobium capsulatum} Back     alignment and structure
>3g4e_A Regucalcin; six bladed beta-propeller, gluconolcatonase, organophosphate hydrolase, calcium bound, alternative splicing, cytoplasm, phosphoprotein; 1.42A {Homo sapiens} PDB: 3g4h_B Back     alignment and structure
>4a2l_A BT_4663, two-component system sensor histidine kinase/RESP; transcription, beta-propeller; HET: PGE PG4 MES 2PE; 2.60A {Bacteroides thetaiotaomicron} PDB: 4a2m_A* Back     alignment and structure
>1pjx_A Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotriesterase (PTE), nitrogen-calcium coordination, BET propeller; HET: ME2 MES PGE; 0.85A {Loligo vulgaris} SCOP: b.68.6.1 PDB: 1e1a_A* 2gvv_A* 2gvw_A 3byc_A 3kgg_A 3o4p_A* 3li3_A 2gvx_A 2gvu_A 3li4_A 2iaq_A 3li5_A* 2iao_A 2iap_A 2iau_A 2iax_A 2iaw_A 2ias_A 2iat_A 2iar_A ... Back     alignment and structure
>2qc5_A Streptogramin B lactonase; beta propeller, lyase; 1.80A {Staphylococcus cohnii} Back     alignment and structure
>3c75_H MADH, methylamine dehydrogenase heavy chain; copper proteins, electron transfer complex, TTQ, electron transport, oxidoreductase, periplasm, transport, metal- binding; HET: TRQ; 2.50A {Paracoccus versutus} Back     alignment and structure
>3iuj_A Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas punctata} PDB: 3iul_A 3ium_A 3ivm_A* 3iur_A* 3iun_A* 3iuq_A* 3muo_A* 3mun_A* Back     alignment and structure
>2ghs_A AGR_C_1268P; regucalcin, structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PSI-2; 1.55A {Agrobacterium tumefaciens str} SCOP: b.68.6.1 Back     alignment and structure
>1kb0_A Quinohemoprotein alcohol dehydrogenase; beta-propeller fold, cytochrome C, oxidoreductase; HET: TRO HEC PQQ; 1.44A {Comamonas testosteroni} SCOP: a.3.1.6 b.70.1.1 Back     alignment and structure
>1yiq_A Quinohemoprotein alcohol dehydrogenase; electron transfer, oxidoreductase; HET: PQQ HEM; 2.20A {Pseudomonas putida} Back     alignment and structure
>2qe8_A Uncharacterized protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE UNL PG4; 1.35A {Anabaena variabilis atcc 29413} Back     alignment and structure
>3dr2_A Exported gluconolactonase; gluconolactonase SMP-30, six-bladed-propeller dimer, vitamin C, hydrolase; 1.67A {Xanthomonas campestris PV} Back     alignment and structure
>2qc5_A Streptogramin B lactonase; beta propeller, lyase; 1.80A {Staphylococcus cohnii} Back     alignment and structure
>1kb0_A Quinohemoprotein alcohol dehydrogenase; beta-propeller fold, cytochrome C, oxidoreductase; HET: TRO HEC PQQ; 1.44A {Comamonas testosteroni} SCOP: a.3.1.6 b.70.1.1 Back     alignment and structure
>3hrp_A Uncharacterized protein; NP_812590.1, structural genomics protein of unknown function structural genomics; HET: MSE; 1.70A {Bacteroides thetaiotaomicron vpi-5482} Back     alignment and structure
>2hz6_A Endoplasmic reticulum to nucleus signalling 1 isoform 1 variant; triangular beta-sheet cluster, signaling protein; 3.10A {Homo sapiens} Back     alignment and structure
>3dr2_A Exported gluconolactonase; gluconolactonase SMP-30, six-bladed-propeller dimer, vitamin C, hydrolase; 1.67A {Xanthomonas campestris PV} Back     alignment and structure
>2ghs_A AGR_C_1268P; regucalcin, structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PSI-2; 1.55A {Agrobacterium tumefaciens str} SCOP: b.68.6.1 Back     alignment and structure
>1mda_H Methylamine dehydrogenase (heavy subunit); electron transport; HET: TRQ; 2.50A {Paracoccus denitrificans} SCOP: b.69.2.1 Back     alignment and structure
>3q7m_A Lipoprotein YFGL, BAMB; beta-propeller, BAM complex, outer membrane protein folding, negative, BAMA, protein binding; 1.65A {Escherichia coli} PDB: 3q7n_A 3q7o_A 3p1l_A 3prw_A 2yh3_A 3q54_A Back     alignment and structure
>3v9f_A Two-component system sensor histidine kinase/RESP regulator, hybrid (ONE-component...; beta-propeller, beta-sandwich; 3.30A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3q7m_A Lipoprotein YFGL, BAMB; beta-propeller, BAM complex, outer membrane protein folding, negative, BAMA, protein binding; 1.65A {Escherichia coli} PDB: 3q7n_A 3q7o_A 3p1l_A 3prw_A 2yh3_A 3q54_A Back     alignment and structure
>3iuj_A Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas punctata} PDB: 3iul_A 3ium_A 3ivm_A* 3iur_A* 3iun_A* 3iuq_A* 3muo_A* 3mun_A* Back     alignment and structure
>2qe8_A Uncharacterized protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE UNL PG4; 1.35A {Anabaena variabilis atcc 29413} Back     alignment and structure
>1yiq_A Quinohemoprotein alcohol dehydrogenase; electron transfer, oxidoreductase; HET: PQQ HEM; 2.20A {Pseudomonas putida} Back     alignment and structure
>1mda_H Methylamine dehydrogenase (heavy subunit); electron transport; HET: TRQ; 2.50A {Paracoccus denitrificans} SCOP: b.69.2.1 Back     alignment and structure
>2hz6_A Endoplasmic reticulum to nucleus signalling 1 isoform 1 variant; triangular beta-sheet cluster, signaling protein; 3.10A {Homo sapiens} Back     alignment and structure
>2iwa_A Glutamine cyclotransferase; pyroglutamate, acyltransferase, glutaminyl CYCL N-terminal cyclisation; HET: NAG; 1.6A {Carica papaya} PDB: 2faw_A* Back     alignment and structure
>2ece_A 462AA long hypothetical selenium-binding protein; beta propeller, structural genomics, unknown function; 2.00A {Sulfolobus tokodaii} Back     alignment and structure
>3nol_A Glutamine cyclotransferase; beta-propeller, glutaminyl cyclase, pyrogl transferase; 1.70A {Zymomonas mobilis} PDB: 3nom_A Back     alignment and structure
>3mbr_X Glutamine cyclotransferase; beta-propeller; 1.44A {Xanthomonas campestris} Back     alignment and structure
>1npe_A Nidogen, entactin; glycoprotein, basement membrane, beta-propeller, EGF-like, structural protein; 2.30A {Mus musculus} SCOP: b.68.5.1 Back     alignment and structure
>3nol_A Glutamine cyclotransferase; beta-propeller, glutaminyl cyclase, pyrogl transferase; 1.70A {Zymomonas mobilis} PDB: 3nom_A Back     alignment and structure
>1fwx_A Nitrous oxide reductase; beta-propeller domain, cupredoxin domain, CUZ site, CUA site oxidoreductase; 1.60A {Paracoccus denitrificans} SCOP: b.6.1.4 b.69.3.1 PDB: 2iwk_A 2iwf_A Back     alignment and structure
>3nok_A Glutaminyl cyclase; beta-propeller, cyclotransferase, pyrogl transferase; HET: MES DDQ; 1.65A {Myxococcus xanthus} Back     alignment and structure
>3v9f_A Two-component system sensor histidine kinase/RESP regulator, hybrid (ONE-component...; beta-propeller, beta-sandwich; 3.30A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3mbr_X Glutamine cyclotransferase; beta-propeller; 1.44A {Xanthomonas campestris} Back     alignment and structure
>2iwa_A Glutamine cyclotransferase; pyroglutamate, acyltransferase, glutaminyl CYCL N-terminal cyclisation; HET: NAG; 1.6A {Carica papaya} PDB: 2faw_A* Back     alignment and structure
>3nok_A Glutaminyl cyclase; beta-propeller, cyclotransferase, pyrogl transferase; HET: MES DDQ; 1.65A {Myxococcus xanthus} Back     alignment and structure
>2fp8_A Strictosidine synthase; six bladed beta propeller fold, lyase; 2.30A {Rauvolfia serpentina} PDB: 2fp9_A* 2fpc_A* 2vaq_A* 3v1s_A* 2fpb_A* 2v91_A* Back     alignment and structure
>2ece_A 462AA long hypothetical selenium-binding protein; beta propeller, structural genomics, unknown function; 2.00A {Sulfolobus tokodaii} Back     alignment and structure
>1fwx_A Nitrous oxide reductase; beta-propeller domain, cupredoxin domain, CUZ site, CUA site oxidoreductase; 1.60A {Paracoccus denitrificans} SCOP: b.6.1.4 b.69.3.1 PDB: 2iwk_A 2iwf_A Back     alignment and structure
>1kv9_A Type II quinohemoprotein alcohol dehydrogenase; electron transfer, oxidoreductase; HET: PQQ HEM EPE; 1.90A {Pseudomonas putida} SCOP: a.3.1.6 b.70.1.1 Back     alignment and structure
>3qqz_A Putative uncharacterized protein YJIK; MCSG, PSI-2, structural genomics, midwest center for structu genomics, TOLB-like, Ca binding; 2.55A {Escherichia coli} Back     alignment and structure
>2p4o_A Hypothetical protein; putative lactonase, structural genomics, joint center for ST genomics, JCSG, protein structure initiative, PSI-2; HET: MSE; 1.90A {Nostoc punctiforme} SCOP: b.68.6.3 Back     alignment and structure
>2xe4_A Oligopeptidase B; hydrolase-inhibitor complex, hydrolase, protease inhibitor trypanosomes, CLAN SC; HET: FC0 RGL; 1.65A {Leishmania major} Back     alignment and structure
>1npe_A Nidogen, entactin; glycoprotein, basement membrane, beta-propeller, EGF-like, structural protein; 2.30A {Mus musculus} SCOP: b.68.5.1 Back     alignment and structure
>1flg_A Protein (quinoprotein ethanol dehydrogenase); superbarrel, oxidoreductase; HET: PQQ; 2.60A {Pseudomonas aeruginosa} SCOP: b.70.1.1 Back     alignment and structure
>3hxj_A Pyrrolo-quinoline quinone; all beta protein. incomplete 8-blade beta-propeller., struct genomics, PSI-2, protein structure initiative; 2.00A {Methanococcus maripaludis} Back     alignment and structure
>2ad6_A Methanol dehydrogenase subunit 1; PQQ configuration, native, oxidoredu; HET: PQQ; 1.50A {Methylophilus methylotrophus} SCOP: b.70.1.1 PDB: 2ad7_A* 2ad8_A* 4aah_A* 1g72_A* Back     alignment and structure
>3hxj_A Pyrrolo-quinoline quinone; all beta protein. incomplete 8-blade beta-propeller., struct genomics, PSI-2, protein structure initiative; 2.00A {Methanococcus maripaludis} Back     alignment and structure
>2fp8_A Strictosidine synthase; six bladed beta propeller fold, lyase; 2.30A {Rauvolfia serpentina} PDB: 2fp9_A* 2fpc_A* 2vaq_A* 3v1s_A* 2fpb_A* 2v91_A* Back     alignment and structure
>2ad6_A Methanol dehydrogenase subunit 1; PQQ configuration, native, oxidoredu; HET: PQQ; 1.50A {Methylophilus methylotrophus} SCOP: b.70.1.1 PDB: 2ad7_A* 2ad8_A* 4aah_A* 1g72_A* Back     alignment and structure
>1kv9_A Type II quinohemoprotein alcohol dehydrogenase; electron transfer, oxidoreductase; HET: PQQ HEM EPE; 1.90A {Pseudomonas putida} SCOP: a.3.1.6 b.70.1.1 Back     alignment and structure
>1w6s_A Methanol dehydrogenase subunit 1; anisotropic, electron transfer, oxidoreductase, calcium- binding, methanol utilization, PQQ; HET: PQQ; 1.2A {Methylobacterium extorquens} SCOP: b.70.1.1 PDB: 1h4i_A* 1h4j_A* 2d0v_A* 1lrw_A* Back     alignment and structure
>2xe4_A Oligopeptidase B; hydrolase-inhibitor complex, hydrolase, protease inhibitor trypanosomes, CLAN SC; HET: FC0 RGL; 1.65A {Leishmania major} Back     alignment and structure
>3ei3_A DNA damage-binding protein 1; UV-damage, DDB, nucleotide excision repair, xeroderma pigmentosum, cytoplasm, DNA repair; HET: DNA PG4; 2.30A {Homo sapiens} PDB: 3ei1_A* 3ei2_A* 3ei4_A* 4a0l_A* 3e0c_A* 3i7k_A* 3i7h_A* 3i7l_A* 3i7n_A* 3i7o_A* 3i7p_A* 3i89_A* 3i8c_A* 3i8e_A* 2b5l_A 2b5m_A 2hye_A* 4a11_A* 4a0k_C* 4a0a_A* ... Back     alignment and structure
>3fie_C Fragment of vesicle-associated membrane protein 2; BONT F, VAMP, inhibitor, complex structure, acetylation, cell junction, hydrolase; 2.10A {Clostridium botulinum} Back     alignment and structure
>3ei3_A DNA damage-binding protein 1; UV-damage, DDB, nucleotide excision repair, xeroderma pigmentosum, cytoplasm, DNA repair; HET: DNA PG4; 2.30A {Homo sapiens} PDB: 3ei1_A* 3ei2_A* 3ei4_A* 4a0l_A* 3e0c_A* 3i7k_A* 3i7h_A* 3i7l_A* 3i7n_A* 3i7o_A* 3i7p_A* 3i89_A* 3i8c_A* 3i8e_A* 2b5l_A 2b5m_A 2hye_A* 4a11_A* 4a0k_C* 4a0a_A* ... Back     alignment and structure
>1ijq_A LDL receptor, low-density lipoprotein receptor; beta-propeller, lipid transport; 1.50A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 Back     alignment and structure
>1flg_A Protein (quinoprotein ethanol dehydrogenase); superbarrel, oxidoreductase; HET: PQQ; 2.60A {Pseudomonas aeruginosa} SCOP: b.70.1.1 Back     alignment and structure
>2p9w_A MAL S 1 allergenic protein; beta propeller; 1.35A {Malassezia sympodialis} Back     alignment and structure
>2p4o_A Hypothetical protein; putative lactonase, structural genomics, joint center for ST genomics, JCSG, protein structure initiative, PSI-2; HET: MSE; 1.90A {Nostoc punctiforme} SCOP: b.68.6.3 Back     alignment and structure
>3a9g_A Putative uncharacterized protein; PQQ dependent dehydrogenase, aldose sugar dehydrogenase, BET propeller fold, oxidoreductase; HET: TRE; 2.39A {Pyrobaculum aerophilum} PDB: 3a9h_A* Back     alignment and structure
>2ism_A Putative oxidoreductase; BL41XU spring-8, bladed beta-propellor, glucose dehydrogenas structural genomics, NPPSFA; 1.90A {Thermus thermophilus} Back     alignment and structure
>3v65_B Low-density lipoprotein receptor-related protein; laminin-G, beta-propeller, protein binding; 3.30A {Rattus norvegicus} Back     alignment and structure
>3v64_C Agrin; beta propeller, laminin-G, signaling, protein binding; HET: NAG; 2.85A {Rattus norvegicus} Back     alignment and structure
>3p5b_L Low density lipoprotein receptor variant; B-propellor, convertase, hydrolase-lipid binding P complex; 3.30A {Homo sapiens} PDB: 3p5c_L Back     alignment and structure
>4hw6_A Hypothetical protein, IPT/TIG domain protein; putative carbohydrate bindning two domains protein, IPT/TIG (PF01833), 6-beta-propeller; HET: MSE; 1.70A {Bacteroides ovatus} Back     alignment and structure
>3sov_A LRP-6, low-density lipoprotein receptor-related protein; beta propeller, protein binding-antagonist complex; HET: NAG FUC; 1.27A {Homo sapiens} PDB: 3soq_A* 3sob_B Back     alignment and structure
>3zym_A Phosphatidylinositol-binding clathrin assembly PR vesicle-associated membrane protein...; endocytosis, synaptobrevin, VAMP2, VAMP3, AP180; HET: PO4; 2.03A {Rattus norvegicus} Back     alignment and structure
>3v64_C Agrin; beta propeller, laminin-G, signaling, protein binding; HET: NAG; 2.85A {Rattus norvegicus} Back     alignment and structure
>3tc9_A Hypothetical hydrolase; 6-bladed beta-propeller, immunoglobulin-like, structural GEN joint center for structural genomics, JCSG; 2.23A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1w6s_A Methanol dehydrogenase subunit 1; anisotropic, electron transfer, oxidoreductase, calcium- binding, methanol utilization, PQQ; HET: PQQ; 1.2A {Methylobacterium extorquens} SCOP: b.70.1.1 PDB: 1h4i_A* 1h4j_A* 2d0v_A* 1lrw_A* Back     alignment and structure
>3tc9_A Hypothetical hydrolase; 6-bladed beta-propeller, immunoglobulin-like, structural GEN joint center for structural genomics, JCSG; 2.23A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2g8s_A Glucose/sorbosone dehydrogenases; bladed beta-propellor, pyrolloquinoline quinone (PQQ), quinoprotein, sugar binding protein; HET: MSE; 1.50A {Escherichia coli K12} Back     alignment and structure
>3s94_A LRP-6, low-density lipoprotein receptor-related protein; WNT, LDL receptor-like protein, dickko YWTD B-propeller, signaling protein; HET: NAG; 2.80A {Homo sapiens} PDB: 4dg6_A* Back     alignment and structure
>3v65_B Low-density lipoprotein receptor-related protein; laminin-G, beta-propeller, protein binding; 3.30A {Rattus norvegicus} Back     alignment and structure
>3pbp_A Nucleoporin NUP82; beta-propeller, mRNA export, mRNP remodelling, nucleocytoplasmic transport, protein transport; HET: PGE; 2.60A {Saccharomyces cerevisiae} PDB: 3tkn_A Back     alignment and structure
>2p9w_A MAL S 1 allergenic protein; beta propeller; 1.35A {Malassezia sympodialis} Back     alignment and structure
>2xbg_A YCF48-like protein; photosynthesis, photosystem II, beta-propeller, assembly FAC; 1.50A {Thermosynechococcus elongatus} Back     alignment and structure
>3m0c_C LDL receptor, low-density lipoprotein receptor; protein complex, beta propeller, cholesterol clearance, PCSK autocatalytic cleavage; 7.01A {Homo sapiens} Back     alignment and structure
>3amr_A 3-phytase; beta-propeller, phytate, MYO-inositol hexasulfate, hydrolase-hydrolase inhibitor complex; HET: IHS; 1.25A {Bacillus subtilis} PDB: 3ams_A* 2poo_A 1poo_A 1qlg_A 1h6l_A 1cvm_A Back     alignment and structure
>2xbg_A YCF48-like protein; photosynthesis, photosystem II, beta-propeller, assembly FAC; 1.50A {Thermosynechococcus elongatus} Back     alignment and structure
>4a0p_A LRP6, LRP-6, low-density lipoprotein receptor-related protein; signaling, WNT signalling, WNT3A, DKK1, MESD; HET: NAG; 1.90A {Homo sapiens} PDB: 3s2k_A* 3s8z_A* 3s8v_A* Back     alignment and structure
>3sre_A PON1, serum paraoxonase; directed evolution, 6-blades-propeller fold, hydrolase; HET: LMT; 1.99A {Artificial gene} PDB: 1v04_A* 3srg_A* Back     alignment and structure
>3pbp_A Nucleoporin NUP82; beta-propeller, mRNA export, mRNP remodelling, nucleocytoplasmic transport, protein transport; HET: PGE; 2.60A {Saccharomyces cerevisiae} PDB: 3tkn_A Back     alignment and structure
>3qqz_A Putative uncharacterized protein YJIK; MCSG, PSI-2, structural genomics, midwest center for structu genomics, TOLB-like, Ca binding; 2.55A {Escherichia coli} Back     alignment and structure
>1ijq_A LDL receptor, low-density lipoprotein receptor; beta-propeller, lipid transport; 1.50A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 Back     alignment and structure
>3p5b_L Low density lipoprotein receptor variant; B-propellor, convertase, hydrolase-lipid binding P complex; 3.30A {Homo sapiens} PDB: 3p5c_L Back     alignment and structure
>3kya_A Putative phosphatase; structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PS hydrolase; HET: MSE; 1.77A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3amr_A 3-phytase; beta-propeller, phytate, MYO-inositol hexasulfate, hydrolase-hydrolase inhibitor complex; HET: IHS; 1.25A {Bacillus subtilis} PDB: 3ams_A* 2poo_A 1poo_A 1qlg_A 1h6l_A 1cvm_A Back     alignment and structure
>4hw6_A Hypothetical protein, IPT/TIG domain protein; putative carbohydrate bindning two domains protein, IPT/TIG (PF01833), 6-beta-propeller; HET: MSE; 1.70A {Bacteroides ovatus} Back     alignment and structure
>3sov_A LRP-6, low-density lipoprotein receptor-related protein; beta propeller, protein binding-antagonist complex; HET: NAG FUC; 1.27A {Homo sapiens} PDB: 3soq_A* 3sob_B Back     alignment and structure
>1k3i_A Galactose oxidase precursor; blade beta propeller, prosequence form, precursor of copper enzyme., oxidoreductase; 1.40A {Fusarium SP} SCOP: b.1.18.2 b.18.1.1 b.69.1.1 PDB: 1gof_A 1gog_A 1goh_A 2eie_A 2jkx_A 2vz1_A 2vz3_A 2eic_A 2eib_A 1t2x_A 2eid_A 2wq8_A Back     alignment and structure
>3s94_A LRP-6, low-density lipoprotein receptor-related protein; WNT, LDL receptor-like protein, dickko YWTD B-propeller, signaling protein; HET: NAG; 2.80A {Homo sapiens} PDB: 4dg6_A* Back     alignment and structure
>1n7d_A LDL receptor, low-density lipoprotein receptor; familial hypercholesterolemia, cholestero metabolism, lipid transport; HET: NAG BMA MAN KEG; 3.70A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 g.3.11.1 g.3.11.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 PDB: 2lgp_A 1xfe_A 1f5y_A 1ldl_A 1ldr_A 1d2j_A 1f8z_A Back     alignment and structure
>3m0c_C LDL receptor, low-density lipoprotein receptor; protein complex, beta propeller, cholesterol clearance, PCSK autocatalytic cleavage; 7.01A {Homo sapiens} Back     alignment and structure
>1k3i_A Galactose oxidase precursor; blade beta propeller, prosequence form, precursor of copper enzyme., oxidoreductase; 1.40A {Fusarium SP} SCOP: b.1.18.2 b.18.1.1 b.69.1.1 PDB: 1gof_A 1gog_A 1goh_A 2eie_A 2jkx_A 2vz1_A 2vz3_A 2eic_A 2eib_A 1t2x_A 2eid_A 2wq8_A Back     alignment and structure
>3kya_A Putative phosphatase; structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PS hydrolase; HET: MSE; 1.77A {Bacteroides thetaiotaomicron} Back     alignment and structure
>4a0p_A LRP6, LRP-6, low-density lipoprotein receptor-related protein; signaling, WNT signalling, WNT3A, DKK1, MESD; HET: NAG; 1.90A {Homo sapiens} PDB: 3s2k_A* 3s8z_A* 3s8v_A* Back     alignment and structure
>1n7d_A LDL receptor, low-density lipoprotein receptor; familial hypercholesterolemia, cholestero metabolism, lipid transport; HET: NAG BMA MAN KEG; 3.70A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 g.3.11.1 g.3.11.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 PDB: 2lgp_A 1xfe_A 1f5y_A 1ldl_A 1ldr_A 1d2j_A 1f8z_A Back     alignment and structure
>3sre_A PON1, serum paraoxonase; directed evolution, 6-blades-propeller fold, hydrolase; HET: LMT; 1.99A {Artificial gene} PDB: 1v04_A* 3srg_A* Back     alignment and structure
>1tl2_A L10, protein (tachylectin-2); animal lectin, horseshoe CRAB, N-acetylglucosamine, beta- propeller, sugar binding protein; HET: NDG; 2.00A {Tachypleus tridentatus} SCOP: b.67.1.1 PDB: 3kif_A* 3kih_A* Back     alignment and structure
>2xn4_A Kelch-like protein 2; structural protein, cytoskeleton; 1.99A {Homo sapiens} Back     alignment and structure
>2be1_A Serine/threonine-protein kinase/endoribonuclease; transcription; 2.98A {Saccharomyces cerevisiae} Back     alignment and structure
>3das_A Putative oxidoreductase; aldose sugar dehydrogenase, beta propellor, PQQ, SGDH; HET: MSE ARA PQQ; 1.60A {Streptomyces coelicolor} Back     alignment and structure
>2vpj_A Kelch-like protein 12; adaptor protein, WNT signaling pathway, protein-binding, UBI degradation, UBL conjugation pathway, CUL3, kelch repeat; 1.85A {Homo sapiens} Back     alignment and structure
>1cru_A Protein (soluble quinoprotein glucose dehydrogena; beta-propeller, superbarrel; HET: PQQ; 1.50A {Acinetobacter calcoaceticus} SCOP: b.68.2.1 PDB: 1c9u_A* 1cq1_A* 1qbi_A Back     alignment and structure
>2vpj_A Kelch-like protein 12; adaptor protein, WNT signaling pathway, protein-binding, UBI degradation, UBL conjugation pathway, CUL3, kelch repeat; 1.85A {Homo sapiens} Back     alignment and structure
>2ism_A Putative oxidoreductase; BL41XU spring-8, bladed beta-propellor, glucose dehydrogenas structural genomics, NPPSFA; 1.90A {Thermus thermophilus} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 1155
d1jmxb_346 b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase 5e-06
d1jmxb_346 b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase 6e-04
d1vyhc1317 b.69.4.1 (C:92-408) Platelet-activating factor ace 1e-04
d1nr0a2299 b.69.4.1 (A:313-611) Actin interacting protein 1 { 3e-04
d1tbga_340 b.69.4.1 (A:) beta1-subunit of the signal-transduc 7e-04
d1qksa2432 b.70.2.1 (A:136-567) C-terminal (heme d1) domain o 9e-04
d1gxra_337 b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Hum 9e-04
d1k8kc_371 b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 0.001
d1hzua2426 b.70.2.1 (A:118-543) C-terminal (heme d1) domain o 0.003
>d1jmxb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Pseudomonas putida [TaxId: 303]} Length = 346 Back     information, alignment and structure

class: All beta proteins
fold: 7-bladed beta-propeller
superfamily: YVTN repeat-like/Quinoprotein amine dehydrogenase
family: Quinohemoprotein amine dehydrogenase B chain
domain: Quinohemoprotein amine dehydrogenase B chain
species: Pseudomonas putida [TaxId: 303]

 Score = 47.4 bits (111), Expect = 5e-06
 Identities = 26/240 (10%), Positives = 62/240 (25%), Gaps = 14/240 (5%)

Query: 97  FLVSISSGNEIQLWDLEARRITSTLPWESNITAFSVIFGT--SYMYIGDEY-GMVYVLKY 153
           +++  +  N + + D+ +  +  +          + +        Y+ + + G +Y    
Sbjct: 10  YMIVTNYPNNLHVVDVASDTVYKSCVMPDKFGPGTAMMAPDNRTAYVLNNHYGDIYG--I 67

Query: 154 DTEEGKLIHSPYYVPKDVIEVFNHLLLEFCPNHIQREKGKAAFNASLLFYCMPPDESGFI 213
           D +  K                +       P+    ++  A  N +         +   +
Sbjct: 68  DLDTCKNTFHANLSSVPGEVGRSMYSFAISPDG---KEVYATVNPTQRLNDHYVVKPPRL 124

Query: 214 DFIIRSKLRFFVEIRLLQFQKHVNSTLGFSQLLLVYANGLIILWDVSEDKVVLVRGSKDL 273
           +    +       +R     + V          L  A   I   DV   K         L
Sbjct: 125 EVFSTADGLEAKPVRTFPMPRQVYLMRAADDGSLYVAGPDIYKMDVKTGKYT-----VAL 179

Query: 274 QLKTEIVDDPSKNAGHNLSETVSDNEQVEKEISSLCWASNDGSVLAVGYVDGDILLWNLR 333
            L+       S           S        + ++    +D    A   +    L  +L+
Sbjct: 180 PLRNWNRKGYSAPDVLYFWPHQSP-RHEFSMLYTIARFKDDKQDPATADLLYGYLSVDLK 238
>d1jmxb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Pseudomonas putida [TaxId: 303]} Length = 346 Back     information, alignment and structure
>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Length = 317 Back     information, alignment and structure
>d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 299 Back     information, alignment and structure
>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Length = 340 Back     information, alignment and structure
>d1qksa2 b.70.2.1 (A:136-567) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Paracoccus denitrificans [TaxId: 266]} Length = 432 Back     information, alignment and structure
>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 337 Back     information, alignment and structure
>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} Length = 371 Back     information, alignment and structure
>d1hzua2 b.70.2.1 (A:118-543) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Pseudomonas aeruginosa [TaxId: 287]} Length = 426 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query1155
d1erja_388 Tup1, C-terminal domain {Baker's yeast (Saccharomy 100.0
d1vyhc1317 Platelet-activating factor acetylhydrolase IB subu 100.0
d1gxra_337 Groucho/tle1, C-terminal domain {Human (Homo sapie 100.0
d1gxra_337 Groucho/tle1, C-terminal domain {Human (Homo sapie 99.98
d1erja_388 Tup1, C-terminal domain {Baker's yeast (Saccharomy 99.98
d1nexb2355 Cdc4 propeller domain {Baker's yeast (Saccharomyce 99.97
d1k8kc_371 Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taur 99.97
d1nr0a1311 Actin interacting protein 1 {Nematode (Caenorhabdi 99.97
d1tbga_340 beta1-subunit of the signal-transducing G protein 99.97
d1vyhc1317 Platelet-activating factor acetylhydrolase IB subu 99.97
d1nr0a1311 Actin interacting protein 1 {Nematode (Caenorhabdi 99.97
d1nexb2355 Cdc4 propeller domain {Baker's yeast (Saccharomyce 99.96
d1tbga_340 beta1-subunit of the signal-transducing G protein 99.96
d1nr0a2299 Actin interacting protein 1 {Nematode (Caenorhabdi 99.96
d1nr0a2299 Actin interacting protein 1 {Nematode (Caenorhabdi 99.96
d2ovrb2342 F-box/WD repeat-containing protein 7, FBXW7 {Human 99.96
d2ovrb2342 F-box/WD repeat-containing protein 7, FBXW7 {Human 99.96
d1k8kc_371 Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taur 99.96
d1pgua1325 Actin interacting protein 1 {Baker's yeast (Saccha 99.93
d1pgua1325 Actin interacting protein 1 {Baker's yeast (Saccha 99.93
d1k32a3360 Tricorn protease domain 2 {Archaeon Thermoplasma a 99.93
d1pgua2287 Actin interacting protein 1 {Baker's yeast (Saccha 99.92
d1sq9a_393 Antiviral protein Ski8 (Ski8p) {Baker's yeast (Sac 99.92
d1yfqa_342 Cell cycle arrest protein BUB3 {Baker's yeast (Sac 99.92
d1p22a2293 F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Hom 99.91
d1p22a2293 F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Hom 99.91
d1sq9a_393 Antiviral protein Ski8 (Ski8p) {Baker's yeast (Sac 99.91
d1yfqa_342 Cell cycle arrest protein BUB3 {Baker's yeast (Sac 99.9
d1pgua2287 Actin interacting protein 1 {Baker's yeast (Saccha 99.9
d1qksa2432 C-terminal (heme d1) domain of cytochrome cd1-nitr 99.89
d1hzua2426 C-terminal (heme d1) domain of cytochrome cd1-nitr 99.88
d1qksa2432 C-terminal (heme d1) domain of cytochrome cd1-nitr 99.88
d1k32a3360 Tricorn protease domain 2 {Archaeon Thermoplasma a 99.88
d1hzua2426 C-terminal (heme d1) domain of cytochrome cd1-nitr 99.83
d1jmxb_346 Quinohemoprotein amine dehydrogenase B chain {Pseu 99.79
d1pbyb_337 Quinohemoprotein amine dehydrogenase B chain {Para 99.77
d1l0qa2301 Surface layer protein {Archaeon Methanosarcina maz 99.74
d1l0qa2301 Surface layer protein {Archaeon Methanosarcina maz 99.74
d2madh_373 Methylamine dehydrogenase, H-chain {Gram negative 99.71
d1jmxb_346 Quinohemoprotein amine dehydrogenase B chain {Pseu 99.7
d1pbyb_337 Quinohemoprotein amine dehydrogenase B chain {Para 99.7
d2bbkh_355 Methylamine dehydrogenase, H-chain {Paracoccus den 99.54
d1ri6a_333 Putative isomerase YbhE {Escherichia coli [TaxId: 99.53
d2bbkh_355 Methylamine dehydrogenase, H-chain {Paracoccus den 99.5
d1ri6a_333 Putative isomerase YbhE {Escherichia coli [TaxId: 99.47
d2madh_373 Methylamine dehydrogenase, H-chain {Gram negative 99.25
d2bgra1470 Dipeptidyl peptidase IV/CD26, N-terminal domain {P 99.19
d1mdah_368 Methylamine dehydrogenase, H-chain {Paracoccus den 99.11
d2bgra1470 Dipeptidyl peptidase IV/CD26, N-terminal domain {P 99.05
d1mdah_368 Methylamine dehydrogenase, H-chain {Paracoccus den 98.95
d1qnia2441 Nitrous oxide reductase, N-terminal domain {Pseudo 98.82
d2p4oa1302 Hypothetical protein All0351 homologue {Nostoc pun 98.29
d1qnia2441 Nitrous oxide reductase, N-terminal domain {Pseudo 98.25
d2hqsa1269 TolB, C-terminal domain {Escherichia coli [TaxId: 98.23
d1jofa_365 3-carboxy-cis,cis-mucoante lactonizing enzyme {Neu 97.9
d1pjxa_314 Diisopropylfluorophosphatase (phosphotriesterase, 97.87
d1rwia_260 Serine/threonine-protein kinase PknD {Mycobacteriu 97.78
d2dg1a1319 Lactonase Drp35 {Staphylococcus aureus [TaxId: 128 97.74
d1rwia_260 Serine/threonine-protein kinase PknD {Mycobacteriu 97.7
d1k32a2281 Tricorn protease N-terminal domain {Archaeon Therm 97.69
d2hqsa1269 TolB, C-terminal domain {Escherichia coli [TaxId: 97.69
d1jofa_365 3-carboxy-cis,cis-mucoante lactonizing enzyme {Neu 97.67
d1pjxa_314 Diisopropylfluorophosphatase (phosphotriesterase, 97.6
d2p4oa1302 Hypothetical protein All0351 homologue {Nostoc pun 97.54
d1q7fa_279 Brain tumor cg10719-pa {Fruit fly (Drosophila mela 97.43
d2ghsa1295 Regucalcin {Agrobacterium tumefaciens [TaxId: 358] 97.36
d1q7fa_279 Brain tumor cg10719-pa {Fruit fly (Drosophila mela 97.01
d1xfda1465 Dipeptidyl aminopeptidase-like protein 6, DPP6, N- 96.89
d2dg1a1319 Lactonase Drp35 {Staphylococcus aureus [TaxId: 128 96.73
d2ghsa1295 Regucalcin {Agrobacterium tumefaciens [TaxId: 358] 96.5
d1xfda1465 Dipeptidyl aminopeptidase-like protein 6, DPP6, N- 96.1
d1k32a2281 Tricorn protease N-terminal domain {Archaeon Therm 94.79
d1qfma1430 Prolyl oligopeptidase, N-terminal domain {Pig (Sus 91.97
d1fwxa2459 Nitrous oxide reductase, N-terminal domain {Paraco 91.9
d1k3ia3387 Galactose oxidase, central domain {Fungi (Fusarium 91.4
d1kv9a2560 Quinoprotein alcohol dehydrogenase, N-terminal dom 90.5
d2ad6a1571 Methanol dehydrogenase, heavy chain {Methylophilus 89.38
d1kb0a2573 Quinoprotein alcohol dehydrogenase, N-terminal dom 89.3
d1flga_582 Ethanol dehydrogenase {Pseudomonas aeruginosa [Tax 87.35
d1npea_263 Nidogen {Mouse (Mus musculus) [TaxId: 10090]} 86.41
d1w6sa_596 Methanol dehydrogenase, heavy chain {Methylobacter 86.1
d1k3ia3387 Galactose oxidase, central domain {Fungi (Fusarium 85.75
d1kb0a2573 Quinoprotein alcohol dehydrogenase, N-terminal dom 85.65
d1fwxa2459 Nitrous oxide reductase, N-terminal domain {Paraco 84.3
d1flga_582 Ethanol dehydrogenase {Pseudomonas aeruginosa [Tax 84.05
d2ad6a1571 Methanol dehydrogenase, heavy chain {Methylophilus 82.65
d1npea_263 Nidogen {Mouse (Mus musculus) [TaxId: 10090]} 80.97
d1kv9a2560 Quinoprotein alcohol dehydrogenase, N-terminal dom 80.35
>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
class: All beta proteins
fold: 7-bladed beta-propeller
superfamily: WD40 repeat-like
family: WD40-repeat
domain: Tup1, C-terminal domain
species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]

Probab=100.00  E-value=1.4e-30  Score=299.54  Aligned_cols=172  Identities=17%  Similarity=0.160  Sum_probs=129.6

Q ss_pred             CcCcEEEEEECCCcEEEEeCCCCCeeeeeeeCCCcCccccCCCCCCeEEEEEecCCCeEEEEeCCCeEEEEEeccCcccc
Q 001109          549 LVERLYIAGYRDGSTRIWDATYPTLSLIHVFGSELPGIRTATESESVSALEFCSVTLNLAIGSSSGLVWLYNLIKSSNEE  628 (1155)
Q Consensus       549 ~~~~lLaTgs~DgtVrlWD~~~~~l~~l~~l~~~~~~i~~~gh~~~V~~lafspdg~~Lasgs~dG~V~lwd~~~~~~~~  628 (1155)
                      +++++|++|+.||.|++||...+...  ..+....  ....+|..+|++++|+|++++|++|+.||.|++|++.......
T Consensus       215 ~~~~~l~~~~~d~~i~i~~~~~~~~~--~~~~~~~--~~~~~h~~~v~~l~~s~~~~~l~s~~~d~~i~iwd~~~~~~~~  290 (388)
T d1erja_         215 GDGKYIAAGSLDRAVRVWDSETGFLV--ERLDSEN--ESGTGHKDSVYSVVFTRDGQSVVSGSLDRSVKLWNLQNANNKS  290 (388)
T ss_dssp             TTCCEEEEEETTSCEEEEETTTCCEE--EEEC--------CCCSSCEEEEEECTTSSEEEEEETTSEEEEEEC-------
T ss_pred             CCCCeEEEEcCCCeEEEeecccCccc--eeecccc--ccccCCCCCEEEEEECCCCCEEEEEECCCcEEEEeccCCcccc
Confidence            34568999999999999999887632  2332211  1234788899999999999999999999999999998754321


Q ss_pred             ceeeeccCCceEEEecCCCCCceeEEeecCCCCeEEEEEcCCCCEEEEEeCCCcEEEEecCCccEEEEeccCCCCCCCee
Q 001109          629 TLNLVTETGKEVHILPGGDGPQCKALFSVLNSPICNLKFSNFGARLAVGFECSQVAMLDISTFSVLFITDSLSNSNSPVL  708 (1155)
Q Consensus       629 ~~~~v~~~~~~~~~~~~~~g~~~~~~l~~h~~~VtslafSpdg~~LAsGs~Dg~V~lWDi~~~~~l~~~~~~~~h~~~V~  708 (1155)
                      ..             .......+......|...|++++|+|+|++||+|+.||+|+|||+.+++++...   .+|.++|.
T Consensus       291 ~~-------------~~~~~~~~~~~~~~~~~~v~~~~~s~~~~~l~sg~~dg~i~vwd~~~~~~~~~l---~~H~~~V~  354 (388)
T d1erja_         291 DS-------------KTPNSGTCEVTYIGHKDFVLSVATTQNDEYILSGSKDRGVLFWDKKSGNPLLML---QGHRNSVI  354 (388)
T ss_dssp             ---------------------CEEEEEECCSSCEEEEEECGGGCEEEEEETTSEEEEEETTTCCEEEEE---ECCSSCEE
T ss_pred             cc-------------ccccccceeeecccccceEEEEEECCCCCEEEEEeCCCEEEEEECCCCcEEEEE---eCCCCCEE
Confidence            10             001111234456789999999999999999999999999999999999988765   46999999


Q ss_pred             EEEEeecCCCCccccCCCCCCCCCCCCCCCcEEEEEeCCceEEEEECC
Q 001109          709 YLAVKSLSDTSNLTISPKDSDINSSNDTKKETLFFMTKDAHIVVCDST  756 (1155)
Q Consensus       709 slafs~~~~~~~~~~~~~~~~~~~~~~pd~~~L~s~s~Dg~I~vwd~~  756 (1155)
                      ++++.....                ..||+++|++|+.||+|+|||++
T Consensus       355 ~~~~~~~~~----------------~spd~~~l~s~s~Dg~I~iW~~~  386 (388)
T d1erja_         355 SVAVANGSS----------------LGPEYNVFATGSGDCKARIWKYK  386 (388)
T ss_dssp             EEEECSSCT----------------TCTTCEEEEEEETTSEEEEEEEE
T ss_pred             EEEEecCcc----------------cCCCCCEEEEEeCCCEEEEEeee
Confidence            999974332                24899999999999999999964
>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d2ovrb2 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ovrb2 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1pgua1 b.69.4.1 (A:2-326) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1pgua1 b.69.4.1 (A:2-326) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1k32a3 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1pgua2 b.69.4.1 (A:327-613) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1sq9a_ b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1yfqa_ b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1p22a2 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p22a2 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sq9a_ b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1yfqa_ b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1pgua2 b.69.4.1 (A:327-613) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1qksa2 b.70.2.1 (A:136-567) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1hzua2 b.70.2.1 (A:118-543) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1qksa2 b.70.2.1 (A:136-567) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1k32a3 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1hzua2 b.70.2.1 (A:118-543) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1jmxb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1pbyb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1l0qa2 b.69.2.3 (A:1-301) Surface layer protein {Archaeon Methanosarcina mazei [TaxId: 2209]} Back     information, alignment and structure
>d1l0qa2 b.69.2.3 (A:1-301) Surface layer protein {Archaeon Methanosarcina mazei [TaxId: 2209]} Back     information, alignment and structure
>d2madh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Gram negative methylotrophic bacteria (Thiobacillus versutus) [TaxId: 34007]} Back     information, alignment and structure
>d1jmxb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1pbyb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d2bbkh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1ri6a_ b.69.11.1 (A:) Putative isomerase YbhE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2bbkh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1ri6a_ b.69.11.1 (A:) Putative isomerase YbhE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2madh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Gram negative methylotrophic bacteria (Thiobacillus versutus) [TaxId: 34007]} Back     information, alignment and structure
>d2bgra1 b.70.3.1 (A:39-508) Dipeptidyl peptidase IV/CD26, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1mdah_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d2bgra1 b.70.3.1 (A:39-508) Dipeptidyl peptidase IV/CD26, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1mdah_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1qnia2 b.69.3.1 (A:10-450) Nitrous oxide reductase, N-terminal domain {Pseudomonas nautica [TaxId: 2743]} Back     information, alignment and structure
>d2p4oa1 b.68.6.3 (A:4-305) Hypothetical protein All0351 homologue {Nostoc punctiforme [TaxId: 272131]} Back     information, alignment and structure
>d1qnia2 b.69.3.1 (A:10-450) Nitrous oxide reductase, N-terminal domain {Pseudomonas nautica [TaxId: 2743]} Back     information, alignment and structure
>d2hqsa1 b.68.4.1 (A:163-431) TolB, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1jofa_ b.69.10.1 (A:) 3-carboxy-cis,cis-mucoante lactonizing enzyme {Neurospora crassa [TaxId: 5141]} Back     information, alignment and structure
>d1pjxa_ b.68.6.1 (A:) Diisopropylfluorophosphatase (phosphotriesterase, DFP) {Squid (Loligo vulgaris) [TaxId: 6622]} Back     information, alignment and structure
>d1rwia_ b.68.9.1 (A:) Serine/threonine-protein kinase PknD {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2dg1a1 b.68.6.1 (A:6-324) Lactonase Drp35 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1rwia_ b.68.9.1 (A:) Serine/threonine-protein kinase PknD {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1k32a2 b.68.7.1 (A:39-319) Tricorn protease N-terminal domain {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d2hqsa1 b.68.4.1 (A:163-431) TolB, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1jofa_ b.69.10.1 (A:) 3-carboxy-cis,cis-mucoante lactonizing enzyme {Neurospora crassa [TaxId: 5141]} Back     information, alignment and structure
>d1pjxa_ b.68.6.1 (A:) Diisopropylfluorophosphatase (phosphotriesterase, DFP) {Squid (Loligo vulgaris) [TaxId: 6622]} Back     information, alignment and structure
>d2p4oa1 b.68.6.3 (A:4-305) Hypothetical protein All0351 homologue {Nostoc punctiforme [TaxId: 272131]} Back     information, alignment and structure
>d1q7fa_ b.68.9.1 (A:) Brain tumor cg10719-pa {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2ghsa1 b.68.6.1 (A:20-314) Regucalcin {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1q7fa_ b.68.9.1 (A:) Brain tumor cg10719-pa {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1xfda1 b.70.3.1 (A:127-591) Dipeptidyl aminopeptidase-like protein 6, DPP6, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dg1a1 b.68.6.1 (A:6-324) Lactonase Drp35 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d2ghsa1 b.68.6.1 (A:20-314) Regucalcin {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1xfda1 b.70.3.1 (A:127-591) Dipeptidyl aminopeptidase-like protein 6, DPP6, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k32a2 b.68.7.1 (A:39-319) Tricorn protease N-terminal domain {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1qfma1 b.69.7.1 (A:1-430) Prolyl oligopeptidase, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1fwxa2 b.69.3.1 (A:8-451) Nitrous oxide reductase, N-terminal domain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1k3ia3 b.69.1.1 (A:151-537) Galactose oxidase, central domain {Fungi (Fusarium sp.) [TaxId: 29916]} Back     information, alignment and structure
>d1kv9a2 b.70.1.1 (A:1-560) Quinoprotein alcohol dehydrogenase, N-terminal domain {Pseudomonas putida, hk5 [TaxId: 303]} Back     information, alignment and structure
>d2ad6a1 b.70.1.1 (A:1-571) Methanol dehydrogenase, heavy chain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} Back     information, alignment and structure
>d1kb0a2 b.70.1.1 (A:1-573) Quinoprotein alcohol dehydrogenase, N-terminal domain {Comamonas testosteroni [TaxId: 285]} Back     information, alignment and structure
>d1flga_ b.70.1.1 (A:) Ethanol dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1npea_ b.68.5.1 (A:) Nidogen {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1w6sa_ b.70.1.1 (A:) Methanol dehydrogenase, heavy chain {Methylobacterium extorquens [TaxId: 408]} Back     information, alignment and structure
>d1k3ia3 b.69.1.1 (A:151-537) Galactose oxidase, central domain {Fungi (Fusarium sp.) [TaxId: 29916]} Back     information, alignment and structure
>d1kb0a2 b.70.1.1 (A:1-573) Quinoprotein alcohol dehydrogenase, N-terminal domain {Comamonas testosteroni [TaxId: 285]} Back     information, alignment and structure
>d1fwxa2 b.69.3.1 (A:8-451) Nitrous oxide reductase, N-terminal domain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1flga_ b.70.1.1 (A:) Ethanol dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d2ad6a1 b.70.1.1 (A:1-571) Methanol dehydrogenase, heavy chain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} Back     information, alignment and structure
>d1npea_ b.68.5.1 (A:) Nidogen {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1kv9a2 b.70.1.1 (A:1-560) Quinoprotein alcohol dehydrogenase, N-terminal domain {Pseudomonas putida, hk5 [TaxId: 303]} Back     information, alignment and structure