Citrus Sinensis ID: 001123

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820-------830-------840-------850-------860-------870-------880-------890-------900-------910-------920-------930-------940-------950-------960-------970-------980-------990------1000------1010------1020------1030------1040------1050------1060------1070------1080------1090------1100------1110------1120------1130------1140------115
MDPPPLIDFSDDVVSSATSHSYTDHQGTRIFDRYSSSLSPSSSEDDETESHPSNSTIKRLDYMMEFLERKLSSSATTTNEKKRFASSSSLPEYIGKGGDIPMFKPPVRAALHPARPPSLEVKPHPLRETQIGCFLRTIVCTEEQLWAGGENGLRVWNLKELYDESESDSVSVSKSKGEDGTAPFKESVKGVSSVMCMVGDEASGVVWSGHRDGRIMCWKMNARLLDSDDGFGEVLSWQAHRGPVLSLCISSYGDLWSGSEGGGIKIWPWEAIEKALSLKPEERHTAALIVERSYIDLRSHLSVNGFSSILTSDIKNLLSDHSRAKVWSAGFLSFALWDARTRELLKVFNIDGQIENRVDMSLLPDFAMEDEFKTKIVTSSKKDKAQSSFGFFQRSRNAIMGAADAVRRVAAKGGFGDDNRRTEALTTSIDGMIWTGGANGLLLQWDPNGNRLQDFQYLPFAVQCLCTFGSQIWVGYMNGIVQVLDLEGNLLGGWVAHSSPVIKMAVGAGYIFTLANHGGIRGWNVTSPGPLDSILCKELAGKEFLYTRMENLKILAGTWNVGQGRASQDALISWLGSAASDVGIVVVGLQEVEMGAGFLAMSAAKETVGLEGSAVGHWWLDMIGKILDDGSTFERVGSRQLAGLLIAVWVRKNLKDYVGDVDVAAVPCGFGRAIGNKGAVGLRVRVYDRIMCFVNCHFAAHLEAVNRRNADFDHVYRTMTFCRPSNLCSAAAGTMPFLLLSCVLACSMYLLWLVYRSGLPLVLYIAAGASSVVQMLRSTNPLSGLTVEGVPELSEADMVIFLGDFNYRLDGITYDEARDFISQRCFDWLRERDQLRAEMEAGNVFQGMREADIKFPPTYKFEKHLAGLAGYDSGEKKRVPAWCDRILYRDSRSDLASECSLECPVASSILRYEACMDVTDSDHKPVRCIFSVDIARVDESVRRQEFGDIMTSNEKVKIILEDLCRIPETIVSTNNIIIQNQDTSILRVTNKCGKKDAFYQINCEGQSTVKDDGQASDRHPRGSFGFPRWLEVTPATGMIKPDRTAEMSVHHEDFQTLEEFVDGVPQNWWCEDTRDQEVVLVLKVRGRYSTETRNHRIRVRHCFSAKTKREDHKPNESAQIPGNVLPRSDYQRLSSSFDVVDQLRNLHSP
ccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHcccccccEEccccccEEEEccHHHccccccccccccccccccccccccccccccccEEEEEEEccccEEEccccccEEEEEEccccccccccccccccccccccccEEEEEEccccccEEccccccEEEEcHHHHHHHHcccccccccEEEEcccccccccccccccccccccccccccccccccccEEEEcccHHHHHHHHHcccccEEcccccccccccccccccccccccccEEEEEcccccccccccccHHHHHHHHcccHHHHHHHHHHcccccccccEEEEEEEccccEEEEEccccEEEEEcccccEEEEEEEccccEEEEccccccEEEEccccEEEEEEcccccccccccccccEEEEEEcccEEEEEcccccccccccccccccHHHHHHHHHcHHccccccEEEEEEEEEEEccccccccccHHHHHccccccccEEEEEEEEEEccccccccccccccccccccHHHHHHHHHHcccccccccEEEEcccccccEEEEEEEcccccccccccccccccccccccccccccEEEEEEEEcEEEEEEEccccHHHHHHHHHcccHHHHHHcccccccccccccccccccccccccccccEEEHHHHHccccccHHHHHHcccHHHHHHHHccccccccccccccccccccEEEEccccccccccccHHHHHHHHHHccHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccEEEEEcccccccccccccccccccccEEcccccccccccccEEEEEEEEEEEEcHHHHHHHHHHHHHHHHHHHHHHHccccccccEEccccEEEccccEEEEEEEEccccccEEEEEEccccccccccccccccccccccccccccccccccEEEcccccEEEEEEEcccccEEEEEcccccccccccccccEEEEEEEEEccccccccccEEEEcccccccccccccccccccccccccccccccccccccccHHccccccccc
ccccccccccccEEEccccccccccccccEEEcccccccccccccccccccccccccHHHHHHHHHHHHccccccccccccccccccccccHHEcccccccEEccccccccccccccccEEccccccccHHHHHHHHHcccccEEEEcccccEEEEcHHHHHccccccccccccccccHccccccccccccccEEEEEEccccEEEEEccccccEEEEEccccccccccccHHHHEHHHccccEEEEEEEccccccccccccEEEEccHHHHHHHHcccHHHHHHHHHHHHHHHHcHHHcccccccccccHHHHHHHEHcccccEEEEccHHHEHHHHHHHHHHHHHccccccEccccccccccccccHHHEEEEEccccccccccccccHHHHHHHHHHHHHHHHHHHHHccccccccccEEEEEEccccEEEEEccccEEEEEcccccEEEEEEEEcEEEEEEEEcccEEEEEEcccEEEEEEccccEccccccccccEEEEEEccEEEEEEcccccEEEcccccccccHHHHHHHHHHHHHHHccccEEEEEEEEEEccccccccccHHHHHccccccccEEEEEEEEEEcccccEEHcccHHHcccccccHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHcHHHHHHHHHccHHHcccccccccccccEEEEEEEEcccEEEEEHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHccccccccccEEEEEEcccccccccccHHHHHHHHHHHHHHHHcccHcccccccccccHHcccEEEEEccccEEcccccHHHHHHHHHHccHHHHHHHHHHHHHHHccccEEccccccEEccccEEEcccccccccccccccccccccccEEEEccccccccccccccccEEEEEEEEcccccEEccccccEEEEEEEEEEEEcHHHHHHHHHHHHHHHHHccHHHHHHcccccEEEcccEEEEccccEEEEEEEEEcccccEEEEEEcccEEEEcccccccccccccccccccEEEEccccccEccccEEEEEEEEcccccHHHHccccccccccccccccEEEEEEEEEcccEEEEEEEEEEEEEcccccccccccccccccccccccccccccccccccHHHHHHHHHcccc
mdppplidfsddvvssatshsytdhqgtrifdryssslspssseddeteshpsnstIKRLDYMMEFLERKlsssatttnekkrfasssslpeyigkggdipmfkppvraalhparppslevkphplretqigcflrTIVCTEeqlwaggenglRVWNLKElydesesdsvsvskskgedgtapfkeSVKGVSSVMCMVGDeasgvvwsghrdgrIMCWKMNArlldsddgfgEVLSWQAHRGPVLSLCISSygdlwsgsegggikiwPWEAIEKALSLKPEERHTAALIVERSYIDLRshlsvngfsSILTSDIKNLLSDHSRAKVWSAGFLSFALWDARTRELLKVFNIdgqienrvdmsllpdfamedeFKTKIVTsskkdkaqssfgffQRSRNAIMGAADAVRRVAakggfgddnrrteALTTSidgmiwtgganglllqwdpngnrlqdfqylpFAVQCLCTFGSQIWVGYMNGIVQVLDLEGnllggwvahssPVIKMAVGAGYIFTLANhggirgwnvtspgpldsilCKELAGKEFLYTRMENLKILAGtwnvgqgraSQDALISWLGSAASDVGIVVVGLQEVEMGAGFLAMSAAKETVglegsavgHWWLDMIGKIlddgstfervGSRQLAGLLIAVWVRKNLKdyvgdvdvaavpcgfgraignkgavglRVRVYDRIMCFVNCHFAAHLEAVNRRNADFDHVYRtmtfcrpsnlcsaaagtMPFLLLSCVLACSMYLLWLVYRSGLPLVLYIAAGASSVVQMLRstnplsgltvegvpelseADMVIFLGDfnyrldgitydeARDFISQRCFDWLRERDQLRAEMEAGNvfqgmreadikfpptykfekhlaglagydsgekkrvpawcdrilyrdsrsdlasecslecpvassilRYEAcmdvtdsdhkpvrciFSVDiarvdesvrrqefgdimtsNEKVKIILEDlcripetivstnniiiqnqdtsILRVTnkcgkkdafyqincegqstvkddgqasdrhprgsfgfprwlevtpatgmikpdrtaemsvhhedfQTLEEFvdgvpqnwwcedtrdQEVVLVLKVRGrystetrnhrirvrhcfsaktkredhkpnesaqipgnvlprsdyqrlsssfDVVDQLRNLHSP
mdppplidFSDDVVSSATshsytdhqgtrifDRYSSSLSpssseddeteshpsnstiKRLDYMMEFLERKLsssatttnekkrfasssslpeyiGKGGDIPMFKPPVRAALHPArppslevkphplrETQIGCFLRTIVCTEEQLWAGGENGLRVWNLKELYdesesdsvsvskskgedgtapfkesVKGVSSVMCMVGDEASGVVWSGHRDGRIMCWKMNARLLDSDDGFGEVLSWQAHRGPVLSLCISSYGDLWSGSEGGGIKIWPWEAIEKALSLKPEERHTAALIVERSYIDLRSHLSVNGFSSILTSDIKNLLSDHSRAKVWSAGFLSFALWDARTRELLKVFnidgqienrvDMSLLPDFAMEDEFKTKIvtsskkdkaqssfgffqrsrNAIMGAADAVRRVaakggfgddnrrteALTTSIDGMIWTGGANGLLLQWDPNGNRLQDFQYLPFAVQCLCTFGSQIWVGYMNGIVQVLDLEGNLLGGWVAHSSPVIKMAVGAGYIFTLANHGGIRGWNVTSPGPLDSILCKELAGKEFLYTRMENLKILAGTWNVGQGRASQDALISWLGSAASDVGIVVVGLQEVEMGAGFLAMSAAKETVGLEGSAVGHWWLDMIGKILDDGSTFERVGSRQLAGLLIAVWVRKNLKDYVGDVDVAAVPcgfgraignkgaVGLRVRVYDRIMCFVNCHFAAHLEAVNRRNADFDHVYRTMTFCRPSNLCSAAAGTMPFLLLSCVLACSMYLLWLVYRSGLPLVLYIAAGASSVVQMLRSTNPLSGLTVEGVPELSEADMVIFLGDFNYRLDGITYDEARDFISQRCFDWLRERDQLRAEMEAGNVFQGMREADIKFPPTYKFEKHLAGlagydsgekkrvPAWCDRILYRdsrsdlasecSLECPVASSILRYEACMDVTDSDHKPVRCIFSvdiarvdesvrrqefgdimtsnekvKIILEDLCRIPETivstnniiiqnqdtsiLRVTNKCGKKDAFYQINCEGQSTVKDDGQASDrhprgsfgfprwlevtpATGMIKPDRTAEMSVHHEDFQTLEEFVDGVPQNWWCEDTRDQEVVLVLKVrgrystetrnhrirvrhcfsaktkredhkpnesaqipgnvlprSDYQRLSSSFDVVDQLRNLHSP
MDPPPLIDFSDDVVSSATSHSYTDHQGTRIFDRYssslspssseddeteshpsNSTIKRLDYMMEFLERKLSSSATTTNEKKRFASSSSLPEYIGKGGDIPMFKPPVRAALHPARPPSLEVKPHPLRETQIGCFLRTIVCTEEQLWAGGENGLRVWNLKELYdesesdsvsvskskgedgTAPFKESVKGVSSVMCMVGDEASGVVWSGHRDGRIMCWKMNARLLDSDDGFGEVLSWQAHRGPVLSLCISSYGDLWSGSEGGGIKIWPWEAIEKALSLKPEERHTAALIVERSYIDLRSHLSVNGFSSILTSDIKNLLSDHSRAKVWSAGFLSFALWDARTRELLKVFNIDGQIENRVDMSLLPDFAMEDEFKTKIVTSSKKDKAQSSFGFFQRSRNAIMGAADAVRRVAAKGGFGDDNRRTEALTTSIDGMIWTGGANGLLLQWDPNGNRLQDFQYLPFAVQCLCTFGSQIWVGYMNGIVQVLDLEGNLLGGWVAHSSPVIKMAVGAGYIFTLANHGGIRGWNVTSPGPLDSILCKELAGKEFLYTRMENLKILAGTWNVGQGRASQDALISWLGSAASDVGIVVVGLQEVEMGAGFLAMSAAKETVGLEGSAVGHWWLDMIGKILDDGSTFERVGSRQLAGLLIAVWVRKNLKDYVGDVDVAAVPCGFGRAIGNKGAVGLRVRVYDRIMCFVNCHFAAHLEAVNRRNADFDHVYRTMTFCRPSNLCSAAAGTMPFLLLSCVLACSMYLLWLVYRSGLPLVLYIAAGASSVVQMLRSTNPLSGLTVEGVPELSEADMVIFLGDFNYRLDGITYDEARDFISQRCFDWLRERDQLRAEMEAGNVFQGMREADIKFPPTYKFEKHLAGLAGYDSGEKKRVPAWCDRILYRDSRSDLASECSLECPVASSILRYEACMDVTDSDHKPVRCIFSVDIARVDESVRRQEFGDIMTSNEKVKIILEDLCRIPETIVSTNNIIIQNQDTSILRVTNKCGKKDAFYQINCEGQSTVKDDGQASDRHPRGSFGFPRWLEVTPATGMIKPDRTAEMSVHHEDFQTLEEFVDGVPQNWWCEDTRDQEVVLVLKVRGRYSTETRNHRIRVRHCFSAKTKREDHKPNESAQIPGNVLPRSDYQRLSSSFDVVDQLRNLHSP
******************************************************************************************************************************RETQIGCFLRTIVCTEEQLWAGGENGLRVWNLKELY****************************VSSVMCMVGDEASGVVWSGHRDGRIMCWKMNARLLDSDDGFGEVLSWQAHRGPVLSLCISSYGDLWSGSEGGGIKIWPWEAIEKALSLKPEERHTAALIVERSYIDLRSHLSVNGFSSILTSDIKNLLSDHSRAKVWSAGFLSFALWDARTRELLKVFNIDGQIENRVDMSLLPDFAMEDEFKTKI*************GFFQRSRNAIMGAADAVRRVAAKGGFGDDNRRTEALTTSIDGMIWTGGANGLLLQWDPNGNRLQDFQYLPFAVQCLCTFGSQIWVGYMNGIVQVLDLEGNLLGGWVAHSSPVIKMAVGAGYIFTLANHGGIRGWNVTSPGPLDSILCKELAGKEFLYTRMENLKILAGTWNVGQGRASQDALISWLGSAASDVGIVVVGLQEVEMGAGFLAMSAAKETVGLEGSAVGHWWLDMIGKILDDGSTFERVGSRQLAGLLIAVWVRKNLKDYVGDVDVAAVPCGFGRAIGNKGAVGLRVRVYDRIMCFVNCHFAAHLEAVNRRNADFDHVYRTMTFCRPSNLCSAAAGTMPFLLLSCVLACSMYLLWLVYRSGLPLVLYIAAGASSVVQMLRSTNPLSGLTVEGVPELSEADMVIFLGDFNYRLDGITYDEARDFISQRCFDWLRERDQLRAEMEAGNVFQGMREADIKFPPTYKFEKHLAGLAGYDSGEKKRVPAWCDRILYRDSRSDLASECSLECPVASSILRYEACMDVTDSDHKPVRCIFSVDIARVDESVRRQEFGDIMTSNEKVKIILEDLCRIPETIVSTNNIIIQNQDTSILRVTNKCGKKDAFYQINCE*******************FGFPRWLEVTPATGMIK******MSVHHEDFQTLEEFVDGVPQNWWCEDTRDQEVVLVLKVRGRYSTETRNHRIRVRHCF**********************************************
************************************************************DYMMEFLER*************************GKGGDIPMFKPPVRAALHPARPPSLEVKPHPLRETQIGCFLRTIVCTEEQLWAGGENGLRVWNLKELY****************DGTAPFKESVKGVSSVMCMVGDEASGVVWSGHRDGRIMCWKMNA************LSWQAHRGPVLSLCISSYGDLWSGSEGGGIKIWPWEAIEKALS**********LIVERSYIDL***L*****SSILTSDIKNLLSDHSRAKVWSAGFLSFALWDARTRELLKVFN*******************************************QRSRNAIMGAADAVRRVAAKGGFGDDNRRTEALTTSIDGMIWTGGANGLLLQWDPNGNRLQDFQYLPFAVQCLCTFGSQIWVGYMNGIVQVLDLEGNLLGGWVAHSSPVIKMAVGAGYIFTLANHGGIRGWNVTSPGPLDSILCKELAGKEFLYTRMENLKILAGTWNVGQGRASQDALISWLGSAASDVGIVVVGLQEVEMGAGF************EGSAVGHWWLDMIGKILDDGSTFERVGSRQLAGLLIAVWVRKNLKDYVGDVDVAAVPCGFGRAIGNKGAVGLRVRVYDRIMCFVNCHFAAHLEAVNRRNADFDHVYRTMTFCRPSNLCSAAAGTMPFLLLSCVLACSMYLLWLVYRSGLPLVLYIAAGASSVVQMLRSTNPLSGLTVEGVPELSEADMVIFLGDFNYRLDGITYDEARDFISQRCFDWLRERDQLRAEMEAGNVFQGMREADIKFPPTYKFEKHLAGLAGYDSGEKKRVPAWCDRILYRDSRSD*****S***PVASSILRYEACMDVTDSDHKPVRCIFSVDIARVDESVRRQEFGDIMTSNEKVKII*****RIPETIVSTNNIIIQNQDTSILRVTNKCGKKDAFYQINCEG*S****************FGFPRWLEVTPATG********EMSVHHEDFQTLEEFVDGVPQNWWCEDTRDQEVVLVLKVRGRYSTETRNHRIRVRH************************************************
MDPPPLIDFSDD***********DHQGTRIFDRY********************STIKRLDYMMEFLERKL*****************SLPEYIGKGGDIPMFKPPVRAALHPARPPSLEVKPHPLRETQIGCFLRTIVCTEEQLWAGGENGLRVWNLKELY********************PFKESVKGVSSVMCMVGDEASGVVWSGHRDGRIMCWKMNARLLDSDDGFGEVLSWQAHRGPVLSLCISSYGDLWSGSEGGGIKIWPWEAIEKALSLKPEERHTAALIVERSYIDLRSHLSVNGFSSILTSDIKNLLSDHSRAKVWSAGFLSFALWDARTRELLKVFNIDGQIENRVDMSLLPDFAMEDEFKTKIV*********SSFGFFQRSRNAIMGAADAVRRVAAKGGFGDDNRRTEALTTSIDGMIWTGGANGLLLQWDPNGNRLQDFQYLPFAVQCLCTFGSQIWVGYMNGIVQVLDLEGNLLGGWVAHSSPVIKMAVGAGYIFTLANHGGIRGWNVTSPGPLDSILCKELAGKEFLYTRMENLKILAGTWNVGQGRASQDALISWLGSAASDVGIVVVGLQEVEMGAGFLAMSAAKETVGLEGSAVGHWWLDMIGKILDDGSTFERVGSRQLAGLLIAVWVRKNLKDYVGDVDVAAVPCGFGRAIGNKGAVGLRVRVYDRIMCFVNCHFAAHLEAVNRRNADFDHVYRTMTFCRPSNLCSAAAGTMPFLLLSCVLACSMYLLWLVYRSGLPLVLYIAAGASSVVQMLRSTNPLSGLTVEGVPELSEADMVIFLGDFNYRLDGITYDEARDFISQRCFDWLRERDQLRAEMEAGNVFQGMREADIKFPPTYKFEKHLAGLAGYDSGEKKRVPAWCDRILYRDSRSDLASECSLECPVASSILRYEACMDVTDSDHKPVRCIFSVDIARVDESVRRQEFGDIMTSNEKVKIILEDLCRIPETIVSTNNIIIQNQDTSILRVTNKCGKKDAFYQINCEGQSTV**********PRGSFGFPRWLEVTPATGMIKPDRTAEMSVHHEDFQTLEEFVDGVPQNWWCEDTRDQEVVLVLKVRGRYSTETRNHRIRVRHCFSA***********SAQIPGNVLPRSDYQRLSSSFDVVDQLRNLHSP
**PPPLIDFSDDVVSSATSHSYTDHQGTRIFD************************IKRLDYMMEFLERKLSS*************SSSLPEYIGKGGDIPMFKPPVRAALHPARPPSLEVKPHPLRETQIGCFLRTIVCTEEQLWAGGENGLRVWNLKELYDESESDSVS********GTAPFKESVKGVSSVMCMVGDEASGVVWSGHRDGRIMCWKMNARLLDSDDGFGEVLSWQAHRGPVLSLCISSYGDLWSGSEGGGIKIWPWEAIEKALSLKPEERHTAALIVERSYIDLRSHLSVNGFSSILTSDIKNLLSDHSRAKVWSAGFLSFALWDARTRELLKVFNIDGQIENRVDMSLLPDFAMEDEFKTKIVTS********SFGFFQRSRNAIMGAADAVRRVAAKGGFGDDNRRTEALTTSIDGMIWTGGANGLLLQWDPNGNRLQDFQYLPFAVQCLCTFGSQIWVGYMNGIVQVLDLEGNLLGGWVAHSSPVIKMAVGAGYIFTLANHGGIRGWNVTSPGPLDSILCKELAGKEFLYTRMENLKILAGTWNVGQGRASQDALISWLGSAASDVGIVVVGLQEVEMGAGFLAMSAAKETVGLEGSAVGHWWLDMIGKILDDGSTFERVGSRQLAGLLIAVWVRKNLKDYVGDVDVAAVPCGFGRAIGNKGAVGLRVRVYDRIMCFVNCHFAAHLEAVNRRNADFDHVYRTMTFCRPSNLCSAAAGTMPFLLLSCVLACSMYLLWLVYRSGLPLVLYIAAGASSVVQMLRSTNPLSGLTVEGVPELSEADMVIFLGDFNYRLDGITYDEARDFISQRCFDWLRERDQLRAEMEAGNVFQGMREADIKFPPTYKFEKHLAGLAGYDSGEKKRVPAWCDRILYRDSRSDLASECSLECPVASSILRYEACMDVTDSDHKPVRCIFSVDIARVDESVRRQEFGDIMTSNEKVKIILEDLCRIPETIVSTNNIIIQNQDTSILRVTNKCGKKDAFYQINCEGQSTVKDDGQASDRHPRGSFGFPRWLEVTPATGMIKPDRTAEMSVHHEDFQTLEEFVDGVPQNWWCEDTRDQEVVLVLKVRGRYSTETRNHRIRVRHCFSAK*****************************SFDVVDQ*******
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MDPPPLIDFSDDVVSSATSHSYTDHQGTRIFDRYSSSLSPSSSEDDETESHPSNSTIKRLDYMMEFLERKLSSSATTTNEKKRFASSSSLPEYIGKGGDIPMFKPPVRAALHPARPPSLEVKPHPLRETQIGCFLRTIVCTEEQLWAGGENGLRVWNLKELYDESESDSVSVSKSKGEDGTAPFKESVKGVSSVMCMVGDEASGVVWSGHRDGRIMCWKMNARLLDSDDGFGEVLSWQAHRGPVLSLCISSYGDLWSGSEGGGIKIWPWEAIEKALSLKPEERHTAALIVERSYIDLRSHLSVNGFSSILTSDIKNLLSDHSRAKVWSAGFLSFALWDARTRELLKVFNIDGQIENRVDMSLLPDFAMEDEFKTKIVTSSKKDKAQSSFGFFQRSRNAIMGAADAVRRVAAKGGFGDDNRRTEALTTSIDGMIWTGGANGLLLQWDPNGNRLQDFQYLPFAVQCLCTFGSQIWVGYMNGIVQVLDLEGNLLGGWVAHSSPVIKMAVGAGYIFTLANHGGIRGWNVTSPGPLDSILCKELAGKEFLYTRMENLKILAGTWNVGQGRASQDALISWLGSAASDVGIVVVGLQEVEMGAGFLAMSAAKETVGLEGSAVGHWWLDMIGKILDDGSTFERVGSRQLAGLLIAVWVRKNLKDYVGDVDVAAVPCGFGRAIGNKGAVGLRVRVYDRIMCFVNCHFAAHLEAVNRRNADFDHVYRTMTFCRPSNLCSAAAGTMPFLLLSCVLACSMYLLWLVYRSGLPLVLYIAAGASSVVQMLRSTNPLSGLTVEGVPELSEADMVIFLGDFNYRLDGITYDEARDFISQRCFDWLRERDQLRAEMEAGNVFQGMREADIKFPPTYKFEKHLAGLAGYDSGEKKRVPAWCDRILYRDSRSDLASECSLECPVASSILRYEACMDVTDSDHKPVRCIFSVDIARVDESVRRQEFGDIMTSNEKVKIILEDLCRIPETIVSTNNIIIQNQDTSILRVTNKCGKKDAFYQINCEGQSTVKDDGQASDRHPRGSFGFPRWLEVTPATGMIKPDRTAEMSVHHEDFQTLEEFVDGVPQNWWCEDTRDQEVVLVLKVRGRYSTETRNHRIRVRHCFSAKTKREDHKPNESAQIPGNVLPRSDYQRLSSSFDVVDQLRNLHSP
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query1149 2.2.26 [Sep-21-2011]
Q84W551101 Type II inositol 1,4,5-tr yes no 0.929 0.970 0.660 0.0
O80560 1305 Type I inositol 1,4,5-tri no no 0.859 0.757 0.619 0.0
Q9SYK41136 Type I inositol 1,4,5-tri no no 0.857 0.867 0.605 0.0
Q9SKB71144 Type II inositol 1,4,5-tr no no 0.858 0.861 0.577 0.0
P32019 993 Type II inositol 1,4,5-tr no no 0.362 0.419 0.247 1e-44
Q8K337 993 Type II inositol 1,4,5-tr yes no 0.362 0.419 0.243 2e-44
D3ZGS3 902 Inositol polyphosphate 5- no no 0.354 0.451 0.253 3e-38
Q6NVF0 900 Inositol polyphosphate 5- no no 0.364 0.465 0.250 5e-31
Q9FUR2646 Type I inositol 1,4,5-tri no no 0.205 0.365 0.310 5e-30
O143061191 Probable inositol polypho yes no 0.391 0.377 0.229 4e-23
>sp|Q84W55|IP5P4_ARATH Type II inositol 1,4,5-trisphosphate 5-phosphatase FRA3 OS=Arabidopsis thaliana GN=FRA3 PE=1 SV=2 Back     alignment and function desciption
 Score = 1498 bits (3878), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 744/1126 (66%), Positives = 881/1126 (78%), Gaps = 58/1126 (5%)

Query: 30   IFDRYSSSLSPSSSEDDETESHPS-NSTIKRLDYMMEFLERKLSSSATTTNEKKRFASSS 88
            +F+R + S S SS +D   ES PS + + KR+DYM++FL+R+LS              S 
Sbjct: 28   LFNRSAYSSSSSSGDD---ESQPSVDDSNKRIDYMIQFLDRRLSEDGNHDGIGDG-NGSD 83

Query: 89   SLPEYIGKGGDIPMFKPPVRAALHPARPPSLEVKPHPLRETQIGCFLRTIVCTEEQLWAG 148
            SLPE++GK G+  +FK P+R+A+HP RPPSL+V+PHPLRETQIG FLRT+  TE QLW G
Sbjct: 84   SLPEFVGKCGESGIFKVPIRSAVHPNRPPSLDVRPHPLRETQIGRFLRTMTSTERQLWTG 143

Query: 149  GENG-LRVWNLKELYDESESDSVSVSKSKGEDGTAPFKESVK---GVSSVMCMVGDEASG 204
            GE+G LRVW   ELY       V       ED TAP+KES+    G ++V+CM+GDE S 
Sbjct: 144  GEDGALRVWEFSELYGSGRGLEV-------ED-TAPYKESLGNEFGSAAVVCMIGDEGSR 195

Query: 205  VVWSGHRDGRIMCWKMNARLLDSDDGFGEVLSWQAHRGPVLSLCISSYGDLWSGSEGGGI 264
            VVWSGHRDGRI CW+     L  D G  E LSWQAHRGPVLS+ IS+YGD+WSGSEGG +
Sbjct: 196  VVWSGHRDGRIRCWR-----LRGDHGIEEALSWQAHRGPVLSIAISAYGDIWSGSEGGAL 250

Query: 265  KIWPWE-AIEKALSLKPEERHTAALIVERSYIDLRSHLSVNGFSSILTSDIKNLLSDHSR 323
            K+WPW+ A+ K+LSLK EERH AAL VERSYID R+ +S NGF++ LTSD+  L+SDH+R
Sbjct: 251  KVWPWDGALGKSLSLKMEERHMAALAVERSYIDPRNMVSANGFANTLTSDVTFLVSDHTR 310

Query: 324  AKVWSAGFLSFALWDARTRELLKVFNIDGQIENRVDMSLLPDFAMEDEFKTKIVTSSKKD 383
            A+VWSA  L+FA+WDARTR+L+KVFNIDGQ+ENR + S+ PDF  E+E K K VT+SKK+
Sbjct: 311  ARVWSASPLTFAIWDARTRDLIKVFNIDGQLENRPENSVYPDFGSEEEGKMK-VTASKKE 369

Query: 384  KAQSSFGFFQRSRNAIMGAADAVRRVAAKGGFGDDNRRTEALTTSIDGMIWTGGANGLLL 443
            KAQSS GFFQRSRNAIMGAADAVRR A KGGF DD+R+TEA+  S+DGMIWTG +NG+L+
Sbjct: 370  KAQSSLGFFQRSRNAIMGAADAVRRAATKGGFCDDSRKTEAIVISVDGMIWTGSSNGILM 429

Query: 444  QWDPNGNRLQDFQYLPFAVQCLCTFGSQIWVGYMNGIVQVLDLEGNLLGGWVAHSSPVIK 503
            +WD NGN LQ+F Y    + C+ TF S++WVGY NG VQV DLEG LLGGWVAHS PVIK
Sbjct: 430  RWDGNGNCLQEFAYESSGILCMFTFCSRLWVGYSNGTVQVWDLEGKLLGGWVAHSGPVIK 489

Query: 504  MAVGAGYIFTLANHGGIRGWNVTSPGPLDSILCKELAGKEFLYTRMENLKILAGTWNVGQ 563
            MA+GAGY+FTLANHGGIRGWNVTSPGPLD++L  ELAGKEFLY+R+ENLKILAGTWNVG+
Sbjct: 490  MAIGAGYLFTLANHGGIRGWNVTSPGPLDNVLRAELAGKEFLYSRIENLKILAGTWNVGE 549

Query: 564  GRASQDALISWLGSAASDVGIVVVGLQEVEMGAGFLAMSAAKETVGLEGSAVGHWWLDMI 623
            GRAS D+L+SWLG AA+ V IVVVGLQEVEMGAG LAMSAAKETVGLEGS +G WWLDMI
Sbjct: 550  GRASTDSLVSWLGCAATGVEIVVVGLQEVEMGAGVLAMSAAKETVGLEGSPLGQWWLDMI 609

Query: 624  GKILDDGSTFERVGSRQLAGLLIAVWVRKNLKDYVGDVDVAAVPCGFGRAIGNKGAVGLR 683
            GK LD+GS+F RVGSRQLAGLLI VWVR +LK +VGDVD AAVPCGFGRAIGNKGAVG+R
Sbjct: 610  GKTLDEGSSFVRVGSRQLAGLLICVWVRHDLKPHVGDVDAAAVPCGFGRAIGNKGAVGVR 669

Query: 684  VRVYDRIMCFVNCHFAAHLEAVNRRNADFDHVYRTMTFCRPSNLCSAAAGTMPFLLLSCV 743
            +R+YDR++CFVNCHFAAHLEAVNRRNADFDHVYRTMTF R S+  +A             
Sbjct: 670  LRMYDRVLCFVNCHFAAHLEAVNRRNADFDHVYRTMTFSRQSSSLNAG------------ 717

Query: 744  LACSMYLLWLVYRSGLPLVLYIAAGASSVVQMLRSTNPLSGLTVEGVPELSEADMVIFLG 803
                                   AGAS  V M R  N L   T+E  PELSEADMVIFLG
Sbjct: 718  ----------------------VAGASFGVTMPRGGNALGVNTIEARPELSEADMVIFLG 755

Query: 804  DFNYRLDGITYDEARDFISQRCFDWLRERDQLRAEMEAGNVFQGMREADIKFPPTYKFEK 863
            DFNYRLD ITYDE RDFISQRCFDWLRE+DQL  EMEAGNVFQGMREA I+FPPTYKFE+
Sbjct: 756  DFNYRLDDITYDETRDFISQRCFDWLREKDQLHTEMEAGNVFQGMREAIIRFPPTYKFER 815

Query: 864  HLAGLAGYDSGEKKRVPAWCDRILYRDSRSDLASECSLECPVASSILRYEACMDVTDSDH 923
            H AGLAGYDSGEKKR+PAWCDRILYRD++  L +ECSL+CPV SSI +Y+ACM+VTDSDH
Sbjct: 816  HQAGLAGYDSGEKKRIPAWCDRILYRDNKKHLGAECSLDCPVVSSISQYDACMEVTDSDH 875

Query: 924  KPVRCIFSVDIARVDESVRRQEFGDIMTSNEKVKIILEDLCRIPETIVSTNNIIIQNQDT 983
            KPVRC+FSV IARVDESVRRQE+G+I+ SN+K+K++L +L ++PETIVSTNNII+QNQD+
Sbjct: 876  KPVRCVFSVKIARVDESVRRQEYGNIINSNKKIKVLLGELSKVPETIVSTNNIILQNQDS 935

Query: 984  SILRVTNKCGKKDAFYQINCEGQSTVKDDGQASDRHPRGSFGFPRWLEVTPATGMIKPDR 1043
            +ILR+TNK  K  AF++I CEGQS +++DGQA D   RGSFGFP+WLEV+P TG IKP++
Sbjct: 936  TILRITNKSEKNIAFFKIICEGQSKIEEDGQAHDHRARGSFGFPQWLEVSPGTGTIKPNQ 995

Query: 1044 TAEMSVHHEDFQTLEEFVDGVPQNWWCEDTRDQEVVLVLKVRGRYSTETRNHRIRVRHCF 1103
             AE+SVH EDF T+EEFVDGV QN WCEDTRD+EV+LVL V GR+STETR HRIRVRHC 
Sbjct: 996  IAEVSVHLEDFPTVEEFVDGVAQNSWCEDTRDKEVILVLVVHGRFSTETRKHRIRVRHCP 1055

Query: 1104 SAKTKREDHKPNESAQIPGNVLPRSDYQRLSSSFDVVDQLRNLHSP 1149
                 +             N L RSDY +LS++ DVV+QL+NLHSP
Sbjct: 1056 RGGPAKNHFNDGTKTSGQINALHRSDYHQLSNTLDVVEQLKNLHSP 1101
Required for secondary wall synthesis and actin organization in fiber cells. Has phosphatase activity toward PtdIns(4,5)P2, PtdIns(3,4,5)P3 and Ins(1,4,5)P3. Has a higher substrate affinity toward PtdIns(4,5)P2.
Arabidopsis thaliana (taxid: 3702)
EC: 3EC: .EC: 1EC: .EC: 3EC: .EC: 3EC: 6
>sp|O80560|IP5PC_ARATH Type I inositol 1,4,5-trisphosphate 5-phosphatase 12 OS=Arabidopsis thaliana GN=5PTASE12 PE=1 SV=1 Back     alignment and function description
>sp|Q9SYK4|IP5PD_ARATH Type I inositol 1,4,5-trisphosphate 5-phosphatase 13 OS=Arabidopsis thaliana GN=5PTASE13 PE=1 SV=1 Back     alignment and function description
>sp|Q9SKB7|IP5PE_ARATH Type II inositol 1,4,5-trisphosphate 5-phosphatase 14 OS=Arabidopsis thaliana GN=5PTASE14 PE=1 SV=1 Back     alignment and function description
>sp|P32019|I5P2_HUMAN Type II inositol 1,4,5-trisphosphate 5-phosphatase OS=Homo sapiens GN=INPP5B PE=1 SV=4 Back     alignment and function description
>sp|Q8K337|I5P2_MOUSE Type II inositol 1,4,5-trisphosphate 5-phosphatase OS=Mus musculus GN=Inpp5b PE=1 SV=1 Back     alignment and function description
>sp|D3ZGS3|OCRL_RAT Inositol polyphosphate 5-phosphatase OCRL-1 OS=Rattus norvegicus GN=Ocrl PE=1 SV=1 Back     alignment and function description
>sp|Q6NVF0|OCRL_MOUSE Inositol polyphosphate 5-phosphatase OCRL-1 OS=Mus musculus GN=Ocrl PE=2 SV=1 Back     alignment and function description
>sp|Q9FUR2|IP5P2_ARATH Type I inositol 1,4,5-trisphosphate 5-phosphatase 2 OS=Arabidopsis thaliana GN=IP5P2 PE=1 SV=2 Back     alignment and function description
>sp|O14306|YE8A_SCHPO Probable inositol polyphosphate 5-phosphatase C9G1.10c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC9G1.10c PE=1 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query1149
2960834031105 unnamed protein product [Vitis vinifera] 0.946 0.983 0.694 0.0
2555474261102 type II inositol 5-phosphatase, putative 0.916 0.955 0.684 0.0
3565748381138 PREDICTED: type II inositol-1,4,5-trisph 0.926 0.934 0.669 0.0
3565352581100 PREDICTED: type II inositol-1,4,5-trisph 0.910 0.950 0.676 0.0
2978410891103 hypothetical protein ARALYDRAFT_475657 [ 0.946 0.986 0.649 0.0
425629791101 Type II inositol-1,4,5-trisphosphate 5-p 0.929 0.970 0.660 0.0
46885961101 inositol 1,4,5-trisphosphate 5-phosphata 0.929 0.970 0.659 0.0
283936191101 unknown protein [Arabidopsis thaliana] 0.929 0.970 0.659 0.0
1477836171165 hypothetical protein VITISV_035655 [Viti 0.912 0.899 0.674 0.0
4494427811130 PREDICTED: type II inositol 1,4,5-trisph 0.959 0.976 0.640 0.0
>gi|296083403|emb|CBI23358.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
 Score = 1603 bits (4151), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 798/1149 (69%), Positives = 927/1149 (80%), Gaps = 62/1149 (5%)

Query: 11   DDVVSSATSH-SYTDHQGTRIFDRYSSSLSPSSSEDD---------ETESHPSNSTIKRL 60
            DDV  S   H SY+   G+    ++      SSS+DD          + S    +  +RL
Sbjct: 9    DDVFPSLNLHPSYSSDDGSNRTPKFFDRFYDSSSDDDFCPSSSAAAPSISEGVENAGRRL 68

Query: 61   DYMMEFLERKLSSSATTTNEKKRFASSSSLPEYIGKGGDIPMFKPPVRAALHPARPPSLE 120
            DYM++FLERKLSS     +++ R     +LPE++GKGG   MFK PV  ++HP RPPSLE
Sbjct: 69   DYMIQFLERKLSSP---DHDRTR-----ALPEFVGKGGGTGMFKVPVHVSVHPGRPPSLE 120

Query: 121  VKPHPLRETQIGCFLRTIVCTEEQLWAGGENGLRVWNLKELYDESESDSVSVSKSKGEDG 180
            V+PHPLRETQIGCFLR++VCTE QLWAG E G+RVWN  +LY  S   +  V++S G++ 
Sbjct: 121  VRPHPLRETQIGCFLRSVVCTESQLWAGQECGVRVWNFSDLYG-SACGAGGVTRS-GDEE 178

Query: 181  TAPFKESVKGVSSVMCMVGDEASGVVWSGHRDGRIMCWKMNARLLDSDDGFGEVLSWQAH 240
            TAPF ESV+   + +C+V DEA+ +VWSGH+DG++  WKM+ RL D+   F E L+W AH
Sbjct: 179  TAPFCESVQ-TPAAICLVVDEANRLVWSGHKDGKVRAWKMDQRLGDAP--FTECLAWLAH 235

Query: 241  RGPVLSLCISSYGDLWSGSEGGGIKIWPWEAIEKALSLKPEERHTAALIVERSYIDLRSH 300
            R PVLSL ++SYGDLWSGSEGG IKIWPWE+IEK  SL  EERH AAL+VERS+IDLRS 
Sbjct: 236  RTPVLSLVMTSYGDLWSGSEGGVIKIWPWESIEKVFSLTMEERHMAALLVERSFIDLRSQ 295

Query: 301  LSVNGFSSILTSDIKNLLSDHSRAKVWSAGFLSFALWDARTRELLKVFNIDGQIENRVDM 360
            ++VNG  +IL SD+K ++SD+ RAKVWSAG+ SFALWDARTRELLKVFN+DGQ+ENRVD+
Sbjct: 296  VTVNGVCNILASDVKYMISDNCRAKVWSAGYQSFALWDARTRELLKVFNVDGQMENRVDI 355

Query: 361  SLLPDFAMEDEFKTKIVTSSKKDKAQSSFGFFQRSRNAIMGAADAVRRVAAKGGFGDDNR 420
            S + D A ++E+K K V+S KKDK Q+SF F QRSRNAIMGAADAVRRVAAKG FGDD+R
Sbjct: 356  SPVQDPAFDEEWKMKSVSSLKKDKLQASFSFLQRSRNAIMGAADAVRRVAAKGAFGDDSR 415

Query: 421  RTEALTTSIDGMIWTGGANGLLLQWDPNGNRLQDFQYLPFAVQCLCTFGSQIWVGYMNGI 480
            RTEAL  +IDGMIWTG  +GLL+QWD NGNRLQDF Y  FAVQC CTFGS+IWVGY++G 
Sbjct: 416  RTEALVMTIDGMIWTGCTSGLLVQWDGNGNRLQDFHYHSFAVQCFCTFGSRIWVGYVSGT 475

Query: 481  VQVLDLEGNLLGGWVAHSSPVIKMAVGAGYIFTLANHGGIRGWNVTSPGPLDSILCKELA 540
            VQVLDLEGNLLGGW+AH SPVI M  GAGY+FTLAN GGIRGWN TSPGPLDSIL  ELA
Sbjct: 476  VQVLDLEGNLLGGWIAHDSPVINMTSGAGYVFTLANDGGIRGWNTTSPGPLDSILSSELA 535

Query: 541  GKEFLYTRMENLKILAGTWNVGQGRASQDALISWLGSAASDVGIVVVGLQEVEMGAGFLA 600
            GKEFLYTR+ENLKILAGTWNVGQGRAS D+LISWLGSA+SDVGI+VVGLQEVEMGAGFLA
Sbjct: 536  GKEFLYTRLENLKILAGTWNVGQGRASHDSLISWLGSASSDVGIIVVGLQEVEMGAGFLA 595

Query: 601  MSAAKETVGLEGSAVGHWWLDMIGKILDDGSTFERVGSRQLAGLLIAVWVRKNLKDYVGD 660
            MSAAKETVGLEGS+VG WWLDMIG+ LD+GS FERVGSRQLAGLLIAVWVR N++ +VGD
Sbjct: 596  MSAAKETVGLEGSSVGQWWLDMIGRTLDEGSIFERVGSRQLAGLLIAVWVRNNIRAHVGD 655

Query: 661  VDVAAVPCGFGRAIGNKGAVGLRVRVYDRIMCFVNCHFAAHLEAVNRRNADFDHVYRTMT 720
            VD AAVPCGFGRAIGNKGAVGLR+RVY+RIMCFVNCHFAAHLEAVNRRNADFDHVYRTM 
Sbjct: 656  VDAAAVPCGFGRAIGNKGAVGLRMRVYNRIMCFVNCHFAAHLEAVNRRNADFDHVYRTMI 715

Query: 721  FCRPSNLCSAAAGTMPFLLLSCVLACSMYLLWLVYRSGLPLVLYIAAGASSVVQMLRSTN 780
            F RPSNL +A                                    AG SS VQMLRS N
Sbjct: 716  FSRPSNLFNAT----------------------------------TAGVSSAVQMLRSAN 741

Query: 781  PLSGLTVEGVPELSEADMVIFLGDFNYRLDGITYDEARDFISQRCFDWLRERDQLRAEME 840
                 +VEG PELSEADMV+FLGDFNYRLDGI+YDEARDF+SQRCFDWL+ERDQLRAEME
Sbjct: 742  -----SVEGTPELSEADMVVFLGDFNYRLDGISYDEARDFVSQRCFDWLKERDQLRAEME 796

Query: 841  AGNVFQGMREADIKFPPTYKFEKHLAGLAGYDSGEKKRVPAWCDRILYRDSRSDLASECS 900
            AGNVFQGMREA ++FPPTYKFE+H AGLAGYDSGEKKR+PAWCDRILYRDSRS   +EC+
Sbjct: 797  AGNVFQGMREAVVRFPPTYKFERHQAGLAGYDSGEKKRIPAWCDRILYRDSRSAAVAECN 856

Query: 901  LECPVASSILRYEACMDVTDSDHKPVRCIFSVDIARVDESVRRQEFGDIMTSNEKVKIIL 960
            LECPV SSIL+YEACMDVTDSDHKPVRC+FSVDIARVDESVRRQEFG+I+ SN+++  +L
Sbjct: 857  LECPVVSSILQYEACMDVTDSDHKPVRCMFSVDIARVDESVRRQEFGEIIGSNKRIWHML 916

Query: 961  EDLCRIPETIVSTNNIIIQNQDTSILRVTNKCGKKDAFYQINCEGQSTVKDDGQASDRHP 1020
            E+LC+IP+TIVSTNNII+QNQDTSILR+TNK GK +A ++I CEGQST+K+ G ASD  P
Sbjct: 917  EELCKIPDTIVSTNNIILQNQDTSILRITNKSGKYEALFEIICEGQSTIKEGGLASDHQP 976

Query: 1021 RGSFGFPRWLEVTPATGMIKPDRTAEMSVHHEDFQTLEEFVDGVPQNWWCEDTRDQEVVL 1080
            RGSFGFPRWLEV PA+ +IKPD  AE++VHHE+FQTLEEFVDG+PQNWWCED+RD+EV+L
Sbjct: 977  RGSFGFPRWLEVNPASAIIKPDHVAEVAVHHEEFQTLEEFVDGIPQNWWCEDSRDKEVIL 1036

Query: 1081 VLKVRGRYSTETRNHRIRVRHCFSAKTKREDHKPNESAQIPGNVLPRSDYQRLSSSFDVV 1140
            V+K+RG++STETRNHRIRVR+CF+AK    D K N S Q  G VL RSD QRLS S DVV
Sbjct: 1037 VVKIRGKFSTETRNHRIRVRYCFAAKKLPIDSKSNSSRQAQGTVLHRSDMQRLSGSSDVV 1096

Query: 1141 DQLRNLHSP 1149
              LRN+HSP
Sbjct: 1097 AHLRNMHSP 1105

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|255547426|ref|XP_002514770.1| type II inositol 5-phosphatase, putative [Ricinus communis] gi|223545821|gb|EEF47324.1| type II inositol 5-phosphatase, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|356574838|ref|XP_003555551.1| PREDICTED: type II inositol-1,4,5-trisphosphate 5-phosphatase FRA3-like [Glycine max] Back     alignment and taxonomy information
>gi|356535258|ref|XP_003536165.1| PREDICTED: type II inositol-1,4,5-trisphosphate 5-phosphatase FRA3-like [Glycine max] Back     alignment and taxonomy information
>gi|297841089|ref|XP_002888426.1| hypothetical protein ARALYDRAFT_475657 [Arabidopsis lyrata subsp. lyrata] gi|297334267|gb|EFH64685.1| hypothetical protein ARALYDRAFT_475657 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|42562979|ref|NP_176736.2| Type II inositol-1,4,5-trisphosphate 5-phosphatase FRA3 [Arabidopsis thaliana] gi|59799523|sp|Q84W55.2|IP5P4_ARATH RecName: Full=Type II inositol 1,4,5-trisphosphate 5-phosphatase FRA3; AltName: Full=Protein FRAGILE FIBER 3 gi|56405846|gb|AAV87313.1| type II inositol polyphosphate 5-phosphatase [Arabidopsis thaliana] gi|56405854|gb|AAV87317.1| type II inositol polyphosphate 5-phosphatase [Arabidopsis thaliana] gi|332196277|gb|AEE34398.1| Type II inositol-1,4,5-trisphosphate 5-phosphatase FRA3 [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|4688596|emb|CAB41466.1| inositol 1,4,5-trisphosphate 5-phosphatase [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|28393619|gb|AAO42229.1| unknown protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|147783617|emb|CAN68138.1| hypothetical protein VITISV_035655 [Vitis vinifera] Back     alignment and taxonomy information
>gi|449442781|ref|XP_004139159.1| PREDICTED: type II inositol 1,4,5-trisphosphate 5-phosphatase FRA3-like [Cucumis sativus] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query1149
TAIR|locus:20319331170 5PTASE13 "inositol-polyphospha 0.905 0.888 0.615 0.0
TAIR|locus:20341411101 FRA3 "FRAGILE FIBER3" [Arabido 0.619 0.646 0.643 0.0
UNIPROTKB|J9NXN5743 OCRL "Uncharacterized protein" 0.164 0.254 0.273 2.4e-37
UNIPROTKB|F1P2F3895 Gga.53675 "Uncharacterized pro 0.163 0.210 0.285 5.6e-37
UNIPROTKB|F1NY08899 Gga.53675 "Uncharacterized pro 0.163 0.209 0.285 5.7e-37
UNIPROTKB|E2QUW6898 OCRL "Uncharacterized protein" 0.164 0.210 0.273 6e-37
UNIPROTKB|Q01968901 OCRL "Inositol polyphosphate 5 0.164 0.209 0.268 8.9e-36
UNIPROTKB|K7GR29892 OCRL "Uncharacterized protein" 0.164 0.211 0.283 1.1e-35
UNIPROTKB|F1RTI8900 OCRL "Uncharacterized protein" 0.164 0.21 0.283 1.1e-35
UNIPROTKB|K7GRA1900 OCRL "Uncharacterized protein" 0.164 0.21 0.283 1.1e-35
TAIR|locus:2031933 5PTASE13 "inositol-polyphosphate 5-phosphatase 13" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 3448 (1218.8 bits), Expect = 0., P = 0.
 Identities = 649/1055 (61%), Positives = 806/1055 (76%)

Query:    90 LPEYIGKGGDIPMFKPPVRAALHPARPPSLEVKPHPLRETQIGCFLRTIVCTEEQLWAGG 149
             LPE+IG GG   +FK PVRAA+HP RPP LE++PHPLRETQ G FLR I CTE QLWAG 
Sbjct:   109 LPEFIGAGGGSGIFKVPVRAAVHPGRPPCLELRPHPLRETQTGRFLRNIACTETQLWAGQ 168

Query:   150 ENGLRVWNLKELYXXXXXXXXXXXXXXXXXXTAPFKESVKGVSSVMCMVGDEASGVVWSG 209
             ENG+R WNL++ Y                  TAPF ESV   S  MC+V D+++ ++WSG
Sbjct:   169 ENGIRFWNLEDAYEAGCGIGGQVPRGDED--TAPFHESVT-TSPTMCLVADQSNKLLWSG 225

Query:   210 HRDGRIMCWKMNARLL--DSDDG--FGEVLSWQAHRGPVLSLCISSYGDLWSGSEGGGIK 265
             H+DG+I  WKM+   +  D DD   F E +SW AHRGPV S+ ISSYGD+WS SEGG IK
Sbjct:   226 HKDGKIRAWKMDQSSVSHDDDDSDPFKERVSWLAHRGPVNSIVISSYGDMWSCSEGGVIK 285

Query:   266 IWPWEAIEKALSLKPEERHTAALIVERSYIDLRSHLSVNGFSSILTSDIKNLLSDHSRAK 325
             IWPW+ +EK+L LKPEE+H AAL+VERS IDLRS ++VNG  SI +S++K LL+D  RAK
Sbjct:   286 IWPWDTLEKSLLLKPEEKHMAALLVERSAIDLRSQVTVNGTCSISSSEVKFLLADSVRAK 345

Query:   326 VWSAGFLSFALWDARTRELLKVFNIDGQIENRVDMSLLPDFAMEDEFKTKIVTSSKKDKA 385
             VW+   LSF++WDAR+++LLKV N+DGQ+ENR D+  + D  ++DE K K  ++SK++K 
Sbjct:   346 VWAVQSLSFSIWDARSKDLLKVLNVDGQVENRGDLPPIQDQQVDDEMKLKFFSASKREKP 405

Query:   386 QSSFGFFQRSRNAIMGAADAVRRVAAK--GGFGDDNRRTEALTTSIDGMIWTGGANGLLL 443
             Q   GF QRSRNAIMGAA AVRRVA +  G F +D R+TEA+  ++DG IWTG  +GL++
Sbjct:   406 Q---GFLQRSRNAIMGAAGAVRRVATRSAGAFSEDTRKTEAIVLAVDGTIWTGSISGLIV 462

Query:   444 QWDPNGNRLQDFQYLPFAVQCLCTFGSQIWVGYMNGIVQVLDLEGNLLGGWVAHSSPVIK 503
             QWD NGNRL+D  +    V C CTFG +I+VGY +G +QVLDL+G L+  WV+H+ PVIK
Sbjct:   463 QWDGNGNRLRDVNHHHRPVLCFCTFGDRIYVGYASGYIQVLDLDGKLISSWVSHNEPVIK 522

Query:   504 MAVGAGYIFTLANHGGIRGWNVTSPGPLDSILCKELAGKEFLYTRMENLKILAGTWNVGQ 563
             +A G G+IF+LA HGG+RGW VTSPGPLD+I+  EL+ KE LY R +N++IL GTWNVGQ
Sbjct:   523 LAAGGGFIFSLATHGGVRGWYVTSPGPLDNIIRTELSQKETLYARQDNVRILIGTWNVGQ 582

Query:   564 GRASQDALISWLGSAASDVGIVVVGLQEVEMGAGFLAMSAAKETVGLEGSAVGHWWLDMI 623
             GRAS DAL+SWLGS  SDVGIV VGLQEVEMGAGFLAMSAAKETVGLEGSAVG WW+D I
Sbjct:   583 GRASHDALMSWLGSVTSDVGIVAVGLQEVEMGAGFLAMSAAKETVGLEGSAVGQWWIDAI 642

Query:   624 GKILDDGSTFERVGSRQLAGLLIAVWVRKNLKDYVGDVDVAAVPCGFGRAIGNKGAVGLR 683
             GK LD+ +TFER+GSRQLAGLLI++W RK+++ +VGD+DVAAVPCGFGRAIGNKG VGLR
Sbjct:   643 GKALDEKNTFERMGSRQLAGLLISLWARKDIRTHVGDLDVAAVPCGFGRAIGNKGGVGLR 702

Query:   684 VRVYDRIMCFVNCHFAAHLEAVNRRNADFDHVYRTMTFCRPSNLCSAAAGTMPFLLLSCV 743
             +RVYDRIMCFVNCH AAHLEAVNRRNADF+H++R M F R  NL +AAAG +P+L LSC 
Sbjct:   703 IRVYDRIMCFVNCHLAAHLEAVNRRNADFNHIFRLMVFSRGQNLSNAAAGMVPYLFLSCS 762

Query:   744 LACSMYLLWLVYRSGLPLVLYIAAGASSVVQMLRS-TNPLSGLTVEGVPELSEADMVIFL 802
             L  S YL WL+Y SGLP  L +AAG S+     +S T P +G   E   +L+ ADMV F 
Sbjct:   763 LGFSTYLFWLLYSSGLPWALSLAAGVSTSAYTTKSNTIPSTGAE-EIKSDLAAADMVAFF 821

Query:   803 GDFNYRLDGITYDEARDFISQRCFDWLRERDQLRAEMEAGNVFQGMREADIKFPPTYKFE 862
             GDFNYRL GITYDEARDFISQR FDWLRERDQLRAEM+ G VFQGMREA I FPPTYKFE
Sbjct:   822 GDFNYRLFGITYDEARDFISQRSFDWLRERDQLRAEMKVGKVFQGMREALITFPPTYKFE 881

Query:   863 KHLAGLAGYDSGEKKRVPAWCDRILYRDSRSDLASECSLECPVASSILRYEACMDVTDSD 922
             ++ +GL GYDSGEKKR+PAWCDR++YRD++S   SE +L+CPV SS++ YEACMDVT+SD
Sbjct:   882 RNRSGLGGYDSGEKKRIPAWCDRVIYRDTQSSPFSESNLQCPVVSSVIMYEACMDVTESD 941

Query:   923 HKPVRCIFSVDIARVDESVRRQEFGDIMTSNEKVKIILEDLCRIPETIVSTNNIIIQNQD 982
             HKPVRC F   IA VD+SVRRQE G I+ SNEK+  I EDL  +PET VSTNNI++Q+QD
Sbjct:   942 HKPVRCKFHATIAHVDKSVRRQELGKIIRSNEKILSIFEDLRFVPETSVSTNNIVLQSQD 1001

Query:   983 TSILRVTNKCGKKDAFYQINCEGQSTVKDDGQASDRHPRGSFGFPRWLEVTPATGMIKPD 1042
             T IL +TN      A + I C GQ+ VKDDG+ +D +PRGSFG PRWLEV+PA G+I P+
Sbjct:  1002 TVILTITNNSPTSQAIFNILCGGQAVVKDDGEDADYNPRGSFGLPRWLEVSPAAGIINPE 1061

Query:  1043 RTAEMSVHHEDFQTLEEFVDGVPQNWWCEDTRDQEVVLVLKVRGRYSTETRNHRIRVRHC 1102
              + ++ VHHEDF ++EE+VDG+PQNWWCEDTRD+E +L++ +RG  ST  R+H ++VRHC
Sbjct:  1062 GSVDVKVHHEDFYSMEEYVDGIPQNWWCEDTRDKEAILMVNIRGSCSTTLRSHSVKVRHC 1121

Query:  1103 FSAKTKREDHKP-NESAQIPGNVLPRSDYQRLSSS 1136
             FSA+    +++P N +  + G+    +D  R  S+
Sbjct:  1122 FSARVCLLENRPTNLTKNLGGSRRYPTDITRNGST 1156
GO:0005737 "cytoplasm" evidence=ISM
GO:0046854 "phosphatidylinositol phosphorylation" evidence=IEA
GO:0009611 "response to wounding" evidence=IEP
GO:0009737 "response to abscisic acid stimulus" evidence=IEP;IMP
GO:0046855 "inositol phosphate dephosphorylation" evidence=IDA
GO:0052658 "inositol-1,4,5-trisphosphate 5-phosphatase activity" evidence=IDA
GO:0010087 "phloem or xylem histogenesis" evidence=IMP
GO:0010252 "auxin homeostasis" evidence=IMP
GO:0009637 "response to blue light" evidence=IEP;IMP
GO:0005634 "nucleus" evidence=IDA
GO:0007584 "response to nutrient" evidence=IMP
GO:0009743 "response to carbohydrate stimulus" evidence=IMP
GO:0010182 "sugar mediated signaling pathway" evidence=IMP
GO:0048364 "root development" evidence=IMP
GO:0009827 "plant-type cell wall modification" evidence=RCA
GO:0009860 "pollen tube growth" evidence=RCA
TAIR|locus:2034141 FRA3 "FRAGILE FIBER3" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|J9NXN5 OCRL "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|F1P2F3 Gga.53675 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|F1NY08 Gga.53675 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|E2QUW6 OCRL "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|Q01968 OCRL "Inositol polyphosphate 5-phosphatase OCRL-1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|K7GR29 OCRL "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|F1RTI8 OCRL "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|K7GRA1 OCRL "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q84W55IP5P4_ARATH3, ., 1, ., 3, ., 3, 60.66070.92950.9700yesno

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer3.1.30.976
3rd Layer3.1.3.560.946

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query1149
smart00128306 smart00128, IPPc, Inositol polyphosphate phosphata 3e-56
cd09074299 cd09074, INPP5c, Catalytic domain of inositol poly 8e-48
cd09074299 cd09074, INPP5c, Catalytic domain of inositol poly 1e-47
cd09093292 cd09093, INPP5c_INPP5B, Catalytic inositol polypho 3e-34
cd09090291 cd09090, INPP5c_ScInp51p-like, Catalytic inositol 1e-33
COG5411460 COG5411, COG5411, Phosphatidylinositol 5-phosphate 4e-32
cd09093292 cd09093, INPP5c_INPP5B, Catalytic inositol polypho 6e-32
smart00128306 smart00128, IPPc, Inositol polyphosphate phosphata 9e-30
cd09094300 cd09094, INPP5c_INPP5J-like, Catalytic inositol po 2e-29
cd09095298 cd09095, INPP5c_INPP5E-like, Catalytic inositol po 4e-25
cd09089328 cd09089, INPP5c_Synj, Catalytic inositol polyphosp 8e-25
cd09090291 cd09090, INPP5c_ScInp51p-like, Catalytic inositol 1e-22
cd09094300 cd09094, INPP5c_INPP5J-like, Catalytic inositol po 3e-21
PLN03191621 PLN03191, PLN03191, Type I inositol-1,4,5-trisphos 5e-21
cd09099336 cd09099, INPP5c_Synj2, Catalytic inositol polyphos 3e-19
cd09089328 cd09089, INPP5c_Synj, Catalytic inositol polyphosp 1e-17
cd09098336 cd09098, INPP5c_Synj1, Catalytic inositol polyphos 1e-16
cd09101304 cd09101, INPP5c_SHIP2-INPPL1, Catalytic inositol p 6e-16
cd09098336 cd09098, INPP5c_Synj1, Catalytic inositol polyphos 1e-15
COG5411460 COG5411, COG5411, Phosphatidylinositol 5-phosphate 6e-15
cd09100307 cd09100, INPP5c_SHIP1-INPP5D, Catalytic inositol p 1e-14
cd09091307 cd09091, INPP5c_SHIP, Catalytic inositol polyphosp 4e-14
cd09099336 cd09099, INPP5c_Synj2, Catalytic inositol polyphos 5e-13
PLN03191621 PLN03191, PLN03191, Type I inositol-1,4,5-trisphos 6e-10
cd09092383 cd09092, INPP5A, Type I inositol polyphosphate 5-p 3e-09
cd09101304 cd09101, INPP5c_SHIP2-INPPL1, Catalytic inositol p 9e-08
cd09091307 cd09091, INPP5c_SHIP, Catalytic inositol polyphosp 2e-06
>gnl|CDD|214525 smart00128, IPPc, Inositol polyphosphate phosphatase, catalytic domain homologues Back     alignment and domain information 
 Score =  197 bits (502), Expect = 3e-56
 Identities = 67/156 (42%), Positives = 90/156 (57%), Gaps = 15/156 (9%)

Query: 782 LSGLTVEGVPELSE--ADMVIFLGDFNYRLDGITYDEARDFISQRCFDWLRERDQLRAEM 839
           L  L+      LS+   D+V + GD N+RLD  +Y+E R  IS++ FD L E+DQL  + 
Sbjct: 164 LRALSFPERALLSQFDHDVVFWFGDLNFRLDSPSYEEVRRKISKKEFDDLLEKDQLNRQR 223

Query: 840 EAGNVFQGMREADIKFPPTYKFEKHLAGLAGYDSGEKKRVPAWCDRILYRDSRSDLASEC 899
           EAG VF+G +E  I FPPTYK++    G   YD+ EKKRVPAWCDRILYR +  +L    
Sbjct: 224 EAGKVFKGFQEGPITFPPTYKYD--SVGTETYDTSEKKRVPAWCDRILYRSNGPELIQLS 281

Query: 900 SLECPVASSILRYEACMDVTDSDHKPVRCIFSVDIA 935
                       Y + M++T SDHKPV   F + + 
Sbjct: 282 E-----------YHSGMEITTSDHKPVFATFRLKVT 306

Mg(2+)-dependent/Li(+)-sensitive enzymes. Length = 306
>gnl|CDD|197308 cd09074, INPP5c, Catalytic domain of inositol polyphosphate 5-phosphatases Back     alignment and domain information
>gnl|CDD|197308 cd09074, INPP5c, Catalytic domain of inositol polyphosphate 5-phosphatases Back     alignment and domain information
>gnl|CDD|197327 cd09093, INPP5c_INPP5B, Catalytic inositol polyphosphate 5-phosphatase (INPP5c) domain of Type II inositol polyphosphate 5-phosphatase I, Oculocerebrorenal syndrome of Lowe 1, and related proteins Back     alignment and domain information
>gnl|CDD|197324 cd09090, INPP5c_ScInp51p-like, Catalytic inositol polyphosphate 5-phosphatase (INPP5c) domain of Saccharomyces cerevisiae Inp51p, Inp52p, and Inp53p, and related proteins Back     alignment and domain information
>gnl|CDD|227698 COG5411, COG5411, Phosphatidylinositol 5-phosphate phosphatase [Signal transduction mechanisms] Back     alignment and domain information
>gnl|CDD|197327 cd09093, INPP5c_INPP5B, Catalytic inositol polyphosphate 5-phosphatase (INPP5c) domain of Type II inositol polyphosphate 5-phosphatase I, Oculocerebrorenal syndrome of Lowe 1, and related proteins Back     alignment and domain information
>gnl|CDD|214525 smart00128, IPPc, Inositol polyphosphate phosphatase, catalytic domain homologues Back     alignment and domain information
>gnl|CDD|197328 cd09094, INPP5c_INPP5J-like, Catalytic inositol polyphosphate 5-phosphatase (INPP5c) domain of inositol polyphosphate 5-phosphatase J and related proteins Back     alignment and domain information
>gnl|CDD|197329 cd09095, INPP5c_INPP5E-like, Catalytic inositol polyphosphate 5-phosphatase (INPP5c) domain of Inositol polyphosphate-5-phosphatase E and related proteins Back     alignment and domain information
>gnl|CDD|197323 cd09089, INPP5c_Synj, Catalytic inositol polyphosphate 5-phosphatase (INPP5c) domain of synaptojanins Back     alignment and domain information
>gnl|CDD|197324 cd09090, INPP5c_ScInp51p-like, Catalytic inositol polyphosphate 5-phosphatase (INPP5c) domain of Saccharomyces cerevisiae Inp51p, Inp52p, and Inp53p, and related proteins Back     alignment and domain information
>gnl|CDD|197328 cd09094, INPP5c_INPP5J-like, Catalytic inositol polyphosphate 5-phosphatase (INPP5c) domain of inositol polyphosphate 5-phosphatase J and related proteins Back     alignment and domain information
>gnl|CDD|215624 PLN03191, PLN03191, Type I inositol-1,4,5-trisphosphate 5-phosphatase 2; Provisional Back     alignment and domain information
>gnl|CDD|197333 cd09099, INPP5c_Synj2, Catalytic inositol polyphosphate 5-phosphatase (INPP5c) domain of synaptojanin 2 Back     alignment and domain information
>gnl|CDD|197323 cd09089, INPP5c_Synj, Catalytic inositol polyphosphate 5-phosphatase (INPP5c) domain of synaptojanins Back     alignment and domain information
>gnl|CDD|197332 cd09098, INPP5c_Synj1, Catalytic inositol polyphosphate 5-phosphatase (INPP5c) domain of synaptojanin 1 Back     alignment and domain information
>gnl|CDD|197335 cd09101, INPP5c_SHIP2-INPPL1, Catalytic inositol polyphosphate 5-phosphatase (INPP5c) domain of SH2 domain containing inositol 5-phosphatase-2 and related proteins Back     alignment and domain information
>gnl|CDD|197332 cd09098, INPP5c_Synj1, Catalytic inositol polyphosphate 5-phosphatase (INPP5c) domain of synaptojanin 1 Back     alignment and domain information
>gnl|CDD|227698 COG5411, COG5411, Phosphatidylinositol 5-phosphate phosphatase [Signal transduction mechanisms] Back     alignment and domain information
>gnl|CDD|197334 cd09100, INPP5c_SHIP1-INPP5D, Catalytic inositol polyphosphate 5-phosphatase (INPP5c) domain of SH2 domain containing inositol polyphosphate 5-phosphatase-1 and related proteins Back     alignment and domain information
>gnl|CDD|197325 cd09091, INPP5c_SHIP, Catalytic inositol polyphosphate 5-phosphatase (INPP5c) domain of SH2 domain containing inositol polyphosphate 5-phosphatase-1 and -2, and related proteins Back     alignment and domain information
>gnl|CDD|197333 cd09099, INPP5c_Synj2, Catalytic inositol polyphosphate 5-phosphatase (INPP5c) domain of synaptojanin 2 Back     alignment and domain information
>gnl|CDD|215624 PLN03191, PLN03191, Type I inositol-1,4,5-trisphosphate 5-phosphatase 2; Provisional Back     alignment and domain information
>gnl|CDD|197326 cd09092, INPP5A, Type I inositol polyphosphate 5-phosphatase I Back     alignment and domain information
>gnl|CDD|197335 cd09101, INPP5c_SHIP2-INPPL1, Catalytic inositol polyphosphate 5-phosphatase (INPP5c) domain of SH2 domain containing inositol 5-phosphatase-2 and related proteins Back     alignment and domain information
>gnl|CDD|197325 cd09091, INPP5c_SHIP, Catalytic inositol polyphosphate 5-phosphatase (INPP5c) domain of SH2 domain containing inositol polyphosphate 5-phosphatase-1 and -2, and related proteins Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 1149
KOG05661080 consensus Inositol-1,4,5-triphosphate 5-phosphatas 100.0
PLN03191621 Type I inositol-1,4,5-trisphosphate 5-phosphatase 100.0
smart00128310 IPPc Inositol polyphosphate phosphatase, catalytic 100.0
COG5411460 Phosphatidylinositol 5-phosphate phosphatase [Sign 100.0
KOG0271480 consensus Notchless-like WD40 repeat-containing pr 100.0
KOG0271480 consensus Notchless-like WD40 repeat-containing pr 100.0
KOG0272459 consensus U4/U6 small nuclear ribonucleoprotein Pr 100.0
KOG0263707 consensus Transcription initiation factor TFIID, s 100.0
KOG0281499 consensus Beta-TrCP (transducin repeats containing 100.0
KOG0319775 consensus WD40-repeat-containing subunit of the 18 99.97
KOG0295406 consensus WD40 repeat-containing protein [Function 99.97
KOG0286343 consensus G-protein beta subunit [General function 99.97
KOG0281499 consensus Beta-TrCP (transducin repeats containing 99.97
KOG0272459 consensus U4/U6 small nuclear ribonucleoprotein Pr 99.97
KOG0319775 consensus WD40-repeat-containing subunit of the 18 99.97
KOG0315311 consensus G-protein beta subunit-like protein (con 99.96
KOG0279315 consensus G protein beta subunit-like protein [Sig 99.96
KOG0263707 consensus Transcription initiation factor TFIID, s 99.96
KOG0295406 consensus WD40 repeat-containing protein [Function 99.96
KOG0273524 consensus Beta-transducin family (WD-40 repeat) pr 99.95
KOG0266456 consensus WD40 repeat-containing protein [General 99.95
KOG0306888 consensus WD40-repeat-containing subunit of the 18 99.95
KOG0265338 consensus U5 snRNP-specific protein-like factor an 99.95
KOG0274537 consensus Cdc4 and related F-box and WD-40 protein 99.95
KOG0318603 consensus WD40 repeat stress protein/actin interac 99.95
PTZ00312356 inositol-1,4,5-triphosphate 5-phosphatase; Provisi 99.94
KOG0315311 consensus G-protein beta subunit-like protein (con 99.94
KOG0313423 consensus Microtubule binding protein YTM1 (contai 99.94
KOG0291893 consensus WD40-repeat-containing subunit of the 18 99.94
KOG0266456 consensus WD40 repeat-containing protein [General 99.94
KOG0313423 consensus Microtubule binding protein YTM1 (contai 99.94
KOG0285460 consensus Pleiotropic regulator 1 [RNA processing 99.94
cd00200289 WD40 WD40 domain, found in a number of eukaryotic 99.94
KOG0291893 consensus WD40-repeat-containing subunit of the 18 99.93
KOG0274537 consensus Cdc4 and related F-box and WD-40 protein 99.93
KOG0318603 consensus WD40 repeat stress protein/actin interac 99.93
KOG0284464 consensus Polyadenylation factor I complex, subuni 99.93
PLN00181793 protein SPA1-RELATED; Provisional 99.93
KOG0279315 consensus G protein beta subunit-like protein [Sig 99.93
KOG0296399 consensus Angio-associated migratory cell protein 99.93
KOG0308735 consensus Conserved WD40 repeat-containing protein 99.93
KOG0286343 consensus G-protein beta subunit [General function 99.93
KOG0293519 consensus WD40 repeat-containing protein [Function 99.92
KOG0285460 consensus Pleiotropic regulator 1 [RNA processing 99.92
KOG0645312 consensus WD40 repeat protein [General function pr 99.92
KOG0282503 consensus mRNA splicing factor [Function unknown] 99.91
KOG0292 1202 consensus Vesicle coat complex COPI, alpha subunit 99.91
KOG0565145 consensus Inositol polyphosphate 5-phosphatase and 99.91
KOG0284464 consensus Polyadenylation factor I complex, subuni 99.91
KOG0276794 consensus Vesicle coat complex COPI, beta' subunit 99.9
KOG0316307 consensus Conserved WD40 repeat-containing protein 99.9
KOG0301745 consensus Phospholipase A2-activating protein (con 99.9
KOG0275508 consensus Conserved WD40 repeat-containing protein 99.9
KOG0645312 consensus WD40 repeat protein [General function pr 99.9
KOG0276794 consensus Vesicle coat complex COPI, beta' subunit 99.9
KOG0306888 consensus WD40-repeat-containing subunit of the 18 99.9
KOG0273524 consensus Beta-transducin family (WD-40 repeat) pr 99.89
cd00200289 WD40 WD40 domain, found in a number of eukaryotic 99.89
PLN00181793 protein SPA1-RELATED; Provisional 99.89
KOG0265338 consensus U5 snRNP-specific protein-like factor an 99.88
KOG0300481 consensus WD40 repeat-containing protein [Function 99.88
PTZ00420568 coronin; Provisional 99.87
PTZ00421493 coronin; Provisional 99.87
KOG0288459 consensus WD40 repeat protein TipD [General functi 99.87
KOG0296399 consensus Angio-associated migratory cell protein 99.87
PTZ00421493 coronin; Provisional 99.87
KOG0301745 consensus Phospholipase A2-activating protein (con 99.87
KOG0292 1202 consensus Vesicle coat complex COPI, alpha subunit 99.86
KOG0278334 consensus Serine/threonine kinase receptor-associa 99.86
KOG0640430 consensus mRNA cleavage stimulating factor complex 99.86
KOG0316307 consensus Conserved WD40 repeat-containing protein 99.86
PTZ00420568 coronin; Provisional 99.85
KOG0308735 consensus Conserved WD40 repeat-containing protein 99.85
KOG0283712 consensus WD40 repeat-containing protein [Function 99.85
KOG0294362 consensus WD40 repeat-containing protein [Function 99.84
KOG0278334 consensus Serine/threonine kinase receptor-associa 99.84
KOG0268433 consensus Sof1-like rRNA processing protein (conta 99.84
KOG0299479 consensus U3 snoRNP-associated protein (contains W 99.84
KOG0277311 consensus Peroxisomal targeting signal type 2 rece 99.83
KOG0299479 consensus U3 snoRNP-associated protein (contains W 99.83
KOG0275508 consensus Conserved WD40 repeat-containing protein 99.83
KOG0641350 consensus WD40 repeat protein [General function pr 99.83
KOG0294362 consensus WD40 repeat-containing protein [Function 99.82
KOG0310487 consensus Conserved WD40 repeat-containing protein 99.82
KOG0282503 consensus mRNA splicing factor [Function unknown] 99.82
KOG0643327 consensus Translation initiation factor 3, subunit 99.81
KOG1446311 consensus Histone H3 (Lys4) methyltransferase comp 99.8
KOG0305484 consensus Anaphase promoting complex, Cdc20, Cdh1, 99.8
KOG0293519 consensus WD40 repeat-containing protein [Function 99.8
KOG14081080 consensus WD40 repeat protein [Function unknown] 99.8
KOG0973942 consensus Histone transcription regulator HIRA, WD 99.79
KOG0289506 consensus mRNA splicing factor [General function p 99.79
KOG0288459 consensus WD40 repeat protein TipD [General functi 99.78
KOG0277311 consensus Peroxisomal targeting signal type 2 rece 99.78
KOG0973942 consensus Histone transcription regulator HIRA, WD 99.78
TIGR03866300 PQQ_ABC_repeats PQQ-dependent catabolism-associate 99.78
KOG0300481 consensus WD40 repeat-containing protein [Function 99.78
KOG1407313 consensus WD40 repeat protein [Function unknown] 99.77
KOG0647347 consensus mRNA export protein (contains WD40 repea 99.77
KOG0310487 consensus Conserved WD40 repeat-containing protein 99.77
KOG0641350 consensus WD40 repeat protein [General function pr 99.76
KOG0646476 consensus WD40 repeat protein [General function pr 99.75
KOG0305484 consensus Anaphase promoting complex, Cdc20, Cdh1, 99.74
KOG0321720 consensus WD40 repeat-containing protein L2DTL [Fu 99.74
KOG0647347 consensus mRNA export protein (contains WD40 repea 99.74
KOG1539910 consensus WD repeat protein [General function pred 99.73
KOG1036323 consensus Mitotic spindle checkpoint protein BUB3, 99.73
KOG0772641 consensus Uncharacterized conserved protein, conta 99.73
KOG0283712 consensus WD40 repeat-containing protein [Function 99.73
KOG2445361 consensus Nuclear pore complex component (sc Seh1) 99.73
KOG1407313 consensus WD40 repeat protein [Function unknown] 99.73
KOG1446311 consensus Histone H3 (Lys4) methyltransferase comp 99.73
KOG1063764 consensus RNA polymerase II elongator complex, sub 99.72
KOG2096420 consensus WD40 repeat protein [General function pr 99.72
KOG2048691 consensus WD40 repeat protein [General function pr 99.72
KOG0264422 consensus Nucleosome remodeling factor, subunit CA 99.71
KOG0640430 consensus mRNA cleavage stimulating factor complex 99.71
KOG0639705 consensus Transducin-like enhancer of split protei 99.7
KOG0267825 consensus Microtubule severing protein katanin p80 99.69
KOG0646476 consensus WD40 repeat protein [General function pr 99.68
KOG1976391 consensus Inositol polyphosphate 5-phosphatase, ty 99.68
KOG2096420 consensus WD40 repeat protein [General function pr 99.68
KOG0772641 consensus Uncharacterized conserved protein, conta 99.68
KOG1036323 consensus Mitotic spindle checkpoint protein BUB3, 99.67
KOG1539910 consensus WD repeat protein [General function pred 99.67
KOG0642577 consensus Cell-cycle nuclear protein, contains WD- 99.67
KOG0643327 consensus Translation initiation factor 3, subunit 99.66
KOG0639705 consensus Transducin-like enhancer of split protei 99.66
KOG1332299 consensus Vesicle coat complex COPII, subunit SEC1 99.66
KOG1332299 consensus Vesicle coat complex COPII, subunit SEC1 99.66
TIGR03866300 PQQ_ABC_repeats PQQ-dependent catabolism-associate 99.65
KOG0302440 consensus Ribosome Assembly protein [General funct 99.64
KOG4283397 consensus Transcription-coupled repair protein CSA 99.63
KOG0267825 consensus Microtubule severing protein katanin p80 99.62
KOG2106626 consensus Uncharacterized conserved protein, conta 99.62
KOG14081080 consensus WD40 repeat protein [Function unknown] 99.61
KOG2048691 consensus WD40 repeat protein [General function pr 99.61
KOG0268433 consensus Sof1-like rRNA processing protein (conta 99.61
KOG0270463 consensus WD40 repeat-containing protein [Function 99.6
KOG0264422 consensus Nucleosome remodeling factor, subunit CA 99.59
KOG0649325 consensus WD40 repeat protein [General function pr 99.58
KOG0269839 consensus WD40 repeat-containing protein [Function 99.58
KOG4283397 consensus Transcription-coupled repair protein CSA 99.57
KOG1273405 consensus WD40 repeat protein [General function pr 99.56
KOG0650733 consensus WD40 repeat nucleolar protein Bop1, invo 99.56
KOG1274933 consensus WD40 repeat protein [General function pr 99.56
KOG2445361 consensus Nuclear pore complex component (sc Seh1) 99.55
KOG0642577 consensus Cell-cycle nuclear protein, contains WD- 99.54
KOG0289506 consensus mRNA splicing factor [General function p 99.54
KOG0321720 consensus WD40 repeat-containing protein L2DTL [Fu 99.52
KOG06441113 consensus Uncharacterized conserved protein, conta 99.5
KOG03071049 consensus Vesicle coat complex COPII, subunit SEC3 99.49
KOG1274933 consensus WD40 repeat protein [General function pr 99.49
COG2319466 FOG: WD40 repeat [General function prediction only 99.49
KOG1538 1081 consensus Uncharacterized conserved protein WDR10, 99.48
COG2319466 FOG: WD40 repeat [General function prediction only 99.48
KOG0269839 consensus WD40 repeat-containing protein [Function 99.46
KOG14451012 consensus Tumor-specific antigen (contains WD repe 99.46
KOG4328498 consensus WD40 protein [Function unknown] 99.45
KOG0270463 consensus WD40 repeat-containing protein [Function 99.44
KOG2106626 consensus Uncharacterized conserved protein, conta 99.44
KOG0649325 consensus WD40 repeat protein [General function pr 99.44
KOG0302440 consensus Ribosome Assembly protein [General funct 99.44
KOG0650733 consensus WD40 repeat nucleolar protein Bop1, invo 99.42
KOG0303472 consensus Actin-binding protein Coronin, contains 99.42
KOG1063764 consensus RNA polymerase II elongator complex, sub 99.41
KOG0303472 consensus Actin-binding protein Coronin, contains 99.4
KOG2055514 consensus WD40 repeat protein [General function pr 99.39
KOG4378673 consensus Nuclear protein COP1 [Signal transductio 99.39
PRK11028330 6-phosphogluconolactonase; Provisional 99.35
KOG1034385 consensus Transcriptional repressor EED/ESC/FIE, r 99.35
KOG2055514 consensus WD40 repeat protein [General function pr 99.35
KOG2919406 consensus Guanine nucleotide-binding protein [Gene 99.35
KOG1188376 consensus WD40 repeat protein [General function pr 99.33
KOG0322323 consensus G-protein beta subunit-like protein GNB1 99.32
KOG1034385 consensus Transcriptional repressor EED/ESC/FIE, r 99.31
KOG1007370 consensus WD repeat protein TSSC1, WD repeat super 99.3
KOG15171387 consensus Guanine nucleotide binding protein MIP1 99.3
KOG1009434 consensus Chromatin assembly complex 1 subunit B/C 99.3
KOG1009434 consensus Chromatin assembly complex 1 subunit B/C 99.29
KOG03071049 consensus Vesicle coat complex COPII, subunit SEC3 99.23
PRK01742429 tolB translocation protein TolB; Provisional 99.22
KOG4328498 consensus WD40 protein [Function unknown] 99.22
KOG0771398 consensus Prolactin regulatory element-binding pro 99.22
KOG1538 1081 consensus Uncharacterized conserved protein WDR10, 99.21
KOG1587555 consensus Cytoplasmic dynein intermediate chain [C 99.19
KOG2919406 consensus Guanine nucleotide-binding protein [Gene 99.19
KOG4227609 consensus WD40 repeat protein [General function pr 99.19
KOG4378673 consensus Nuclear protein COP1 [Signal transductio 99.18
KOG06441113 consensus Uncharacterized conserved protein, conta 99.18
KOG12401431 consensus Protein kinase containing WD40 repeats [ 99.16
PRK01742429 tolB translocation protein TolB; Provisional 99.15
KOG1007370 consensus WD repeat protein TSSC1, WD repeat super 99.14
KOG14451012 consensus Tumor-specific antigen (contains WD repe 99.11
KOG1963792 consensus WD40 repeat protein [General function pr 99.09
KOG1334559 consensus WD40 repeat protein [General function pr 99.08
PRK03629429 tolB translocation protein TolB; Provisional 99.07
KOG1273405 consensus WD40 repeat protein [General function pr 99.05
PRK11028330 6-phosphogluconolactonase; Provisional 98.99
KOG0974967 consensus WD-repeat protein WDR6, WD repeat superf 98.97
KOG0322323 consensus G-protein beta subunit-like protein GNB1 98.95
PRK04922433 tolB translocation protein TolB; Provisional 98.94
KOG1963792 consensus WD40 repeat protein [General function pr 98.89
KOG12401431 consensus Protein kinase containing WD40 repeats [ 98.88
KOG0290364 consensus Conserved WD40 repeat-containing protein 98.85
KOG4227609 consensus WD40 repeat protein [General function pr 98.82
KOG1310758 consensus WD40 repeat protein [General function pr 98.82
KOG0974967 consensus WD-repeat protein WDR6, WD repeat superf 98.81
PRK05137435 tolB translocation protein TolB; Provisional 98.79
KOG1310758 consensus WD40 repeat protein [General function pr 98.79
PF03372249 Exo_endo_phos: Endonuclease/Exonuclease/phosphatas 98.78
KOG15171387 consensus Guanine nucleotide binding protein MIP1 98.77
TIGR03300377 assembly_YfgL outer membrane assembly lipoprotein 98.76
KOG1188376 consensus WD40 repeat protein [General function pr 98.75
PRK03629429 tolB translocation protein TolB; Provisional 98.73
PRK02889427 tolB translocation protein TolB; Provisional 98.73
KOG0290364 consensus Conserved WD40 repeat-containing protein 98.72
PRK05421263 hypothetical protein; Provisional 98.71
TIGR02800417 propeller_TolB tol-pal system beta propeller repea 98.7
KOG1524737 consensus WD40 repeat-containing protein CHE-2 [Ge 98.69
PRK11756268 exonuclease III; Provisional 98.68
TIGR03395283 sphingomy sphingomyelin phosphodiesterase. Members 98.66
PRK05137435 tolB translocation protein TolB; Provisional 98.63
KOG2110391 consensus Uncharacterized conserved protein, conta 98.63
TIGR00633255 xth exodeoxyribonuclease III (xth). This family is 98.58
PRK04922433 tolB translocation protein TolB; Provisional 98.57
KOG2110391 consensus Uncharacterized conserved protein, conta 98.55
KOG4547541 consensus WD40 repeat-containing protein [General 98.54
KOG1272545 consensus WD40-repeat-containing subunit of the 18 98.51
KOG2394636 consensus WD40 protein DMR-N9 [General function pr 98.5
TIGR03300377 assembly_YfgL outer membrane assembly lipoprotein 98.5
KOG1587555 consensus Cytoplasmic dynein intermediate chain [C 98.49
PRK00178430 tolB translocation protein TolB; Provisional 98.48
PF02239369 Cytochrom_D1: Cytochrome D1 heme domain; PDB: 1NNO 98.46
KOG2394636 consensus WD40 protein DMR-N9 [General function pr 98.45
KOG4497447 consensus Uncharacterized conserved protein WDR8, 98.45
PF08662194 eIF2A: Eukaryotic translation initiation factor eI 98.44
PRK04792448 tolB translocation protein TolB; Provisional 98.43
TIGR02800417 propeller_TolB tol-pal system beta propeller repea 98.43
KOG41901034 consensus Uncharacterized conserved protein [Funct 98.43
KOG1354433 consensus Serine/threonine protein phosphatase 2A, 98.42
KOG3881412 consensus Uncharacterized conserved protein [Funct 98.4
PRK02889427 tolB translocation protein TolB; Provisional 98.39
KOG0771398 consensus Prolactin regulatory element-binding pro 98.39
PF02239369 Cytochrom_D1: Cytochrome D1 heme domain; PDB: 1NNO 98.39
KOG2111346 consensus Uncharacterized conserved protein, conta 98.38
PF08662194 eIF2A: Eukaryotic translation initiation factor eI 98.38
KOG2139445 consensus WD40 repeat protein [General function pr 98.37
KOG2111346 consensus Uncharacterized conserved protein, conta 98.35
KOG1524737 consensus WD40 repeat-containing protein CHE-2 [Ge 98.31
KOG41901034 consensus Uncharacterized conserved protein [Funct 98.3
KOG1272545 consensus WD40-repeat-containing subunit of the 18 98.27
PF0040039 WD40: WD domain, G-beta repeat; InterPro: IPR01978 98.25
KOG1334559 consensus WD40 repeat protein [General function pr 98.25
KOG2321703 consensus WD40 repeat protein [General function pr 98.2
PRK11138394 outer membrane biogenesis protein BamB; Provisiona 98.17
TIGR00195254 exoDNase_III exodeoxyribonuclease III. The model b 98.16
PLN029191057 haloacid dehalogenase-like hydrolase family protei 98.16
KOG10642439 consensus RAVE (regulator of V-ATPase assembly) co 98.15
PLN029191057 haloacid dehalogenase-like hydrolase family protei 98.13
KOG1523361 consensus Actin-related protein Arp2/3 complex, su 98.13
KOG2139445 consensus WD40 repeat protein [General function pr 98.09
COG3568259 ElsH Metal-dependent hydrolase [General function p 98.08
PRK00178430 tolB translocation protein TolB; Provisional 98.07
KOG3881412 consensus Uncharacterized conserved protein [Funct 98.02
KOG3914390 consensus WD repeat protein WDR4 [Function unknown 98.01
KOG2315566 consensus Predicted translation initiation factor 98.01
KOG1409404 consensus Uncharacterized conserved protein, conta 98.01
PRK13911250 exodeoxyribonuclease III; Provisional 97.96
KOG10642439 consensus RAVE (regulator of V-ATPase assembly) co 97.95
PF13360238 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 97.94
KOG0309 1081 consensus Conserved WD40 repeat-containing protein 97.92
PF13360238 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 97.9
TIGR02658352 TTQ_MADH_Hv methylamine dehydrogenase heavy chain. 97.9
KOG4547541 consensus WD40 repeat-containing protein [General 97.89
PRK04792448 tolB translocation protein TolB; Provisional 97.88
PF0040039 WD40: WD domain, G-beta repeat; InterPro: IPR01978 97.83
KOG2695425 consensus WD40 repeat protein [General function pr 97.74
PRK01029428 tolB translocation protein TolB; Provisional 97.74
KOG0280339 consensus Uncharacterized conserved protein [Amino 97.7
KOG2321703 consensus WD40 repeat protein [General function pr 97.68
smart00476276 DNaseIc deoxyribonuclease I. Deoxyribonuclease I c 97.67
TIGR02658352 TTQ_MADH_Hv methylamine dehydrogenase heavy chain. 97.67
COG2706346 3-carboxymuconate cyclase [Carbohydrate transport 97.66
PF10282345 Lactonase: Lactonase, 7-bladed beta-propeller; Int 97.66
KOG3914390 consensus WD repeat protein WDR4 [Function unknown 97.62
PF14874102 PapD-like: Flagellar-associated PapD-like 97.62
COG5170460 CDC55 Serine/threonine protein phosphatase 2A, reg 97.58
PLN03144606 Carbon catabolite repressor protein 4 homolog; Pro 97.54
KOG2041 1189 consensus WD40 repeat protein [General function pr 97.4
KOG2695425 consensus WD40 repeat protein [General function pr 97.39
PRK01029428 tolB translocation protein TolB; Provisional 97.39
COG5354561 Uncharacterized protein, contains Trp-Asp (WD) rep 97.38
KOG2315566 consensus Predicted translation initiation factor 97.37
KOG1409404 consensus Uncharacterized conserved protein, conta 97.36
PF08450246 SGL: SMP-30/Gluconolaconase/LRE-like region; Inter 97.28
PRK04043419 tolB translocation protein TolB; Provisional 97.24
COG0708261 XthA Exonuclease III [DNA replication, recombinati 97.23
PRK11138394 outer membrane biogenesis protein BamB; Provisiona 97.16
KOG1354433 consensus Serine/threonine protein phosphatase 2A, 97.13
COG4946668 Uncharacterized protein related to the periplasmic 97.12
KOG1523361 consensus Actin-related protein Arp2/3 complex, su 97.12
PTZ00297 1452 pantothenate kinase; Provisional 97.12
COG2706346 3-carboxymuconate cyclase [Carbohydrate transport 97.07
PF10282345 Lactonase: Lactonase, 7-bladed beta-propeller; Int 96.99
KOG0309 1081 consensus Conserved WD40 repeat-containing protein 96.96
KOG0280339 consensus Uncharacterized conserved protein [Amino 96.94
smart0032040 WD40 WD40 repeats. Note that these repeats are per 96.7
PF04762928 IKI3: IKI3 family; InterPro: IPR006849 Members of 96.68
PF07433305 DUF1513: Protein of unknown function (DUF1513); In 96.57
KOG19121062 consensus WD40 repeat protein [General function pr 96.56
KOG2314698 consensus Translation initiation factor 3, subunit 96.51
KOG4714319 consensus Nucleoporin [Nuclear structure] 96.43
COG4946668 Uncharacterized protein related to the periplasmic 96.37
KOG1645463 consensus RING-finger-containing E3 ubiquitin liga 96.2
PRK04043419 tolB translocation protein TolB; Provisional 96.15
PF11768545 DUF3312: Protein of unknown function (DUF3312); In 96.09
KOG2756349 consensus Predicted Mg2+-dependent phosphodiestera 96.08
PRK15251271 cytolethal distending toxin subunit CdtB; Provisio 96.01
PF00635109 Motile_Sperm: MSP (Major sperm protein) domain; In 95.88
COG5354561 Uncharacterized protein, contains Trp-Asp (WD) rep 95.85
KOG4714319 consensus Nucleoporin [Nuclear structure] 95.8
KOG3873422 consensus Sphingomyelinase family protein [Signal 95.8
KOG4497447 consensus Uncharacterized conserved protein WDR8, 95.79
smart0032040 WD40 WD40 repeats. Note that these repeats are per 95.53
PF15492282 Nbas_N: Neuroblastoma-amplified sequence, N termin 95.53
KOG4532344 consensus WD40-like repeat containing protein [Gen 95.46
KOG2444238 consensus WD40 repeat protein [General function pr 95.33
KOG2114933 consensus Vacuolar assembly/sorting protein PEP5/V 95.29
KOG3621726 consensus WD40 repeat-containing protein [General 95.09
PF15492282 Nbas_N: Neuroblastoma-amplified sequence, N termin 94.96
PF08450246 SGL: SMP-30/Gluconolaconase/LRE-like region; Inter 94.93
KOG0882558 consensus Cyclophilin-related peptidyl-prolyl cis- 94.78
KOG1275 1118 consensus PAB-dependent poly(A) ribonuclease, subu 94.64
cd00216488 PQQ_DH Dehydrogenases with pyrrolo-quinoline quino 94.53
PF07433305 DUF1513: Protein of unknown function (DUF1513); In 94.25
COG3386307 Gluconolactonase [Carbohydrate transport and metab 93.76
PF14783111 BBS2_Mid: Ciliary BBSome complex subunit 2, middle 93.72
KOG2066846 consensus Vacuolar assembly/sorting protein VPS41 93.51
COG5170460 CDC55 Serine/threonine protein phosphatase 2A, reg 93.49
KOG2338495 consensus Transcriptional effector CCR4-related pr 93.28
COG3292671 Predicted periplasmic ligand-binding sensor domain 93.1
KOG4649354 consensus PQQ (pyrrolo-quinoline quinone) repeat p 92.83
KOG0882558 consensus Cyclophilin-related peptidyl-prolyl cis- 92.57
cd00216488 PQQ_DH Dehydrogenases with pyrrolo-quinoline quino 92.5
KOG18321516 consensus HIV-1 Vpr-binding protein [Cell cycle co 92.36
KOG2066846 consensus Vacuolar assembly/sorting protein VPS41 92.29
PF11768545 DUF3312: Protein of unknown function (DUF3312); In 92.23
PF08553794 VID27: VID27 cytoplasmic protein; InterPro: IPR013 90.94
KOG2444238 consensus WD40 repeat protein [General function pr 90.92
KOG12751118 consensus PAB-dependent poly(A) ribonuclease, subu 90.86
KOG2079 1206 consensus Vacuolar assembly/sorting protein VPS8 [ 90.84
PF04762928 IKI3: IKI3 family; InterPro: IPR006849 Members of 90.53
KOG2041 1189 consensus WD40 repeat protein [General function pr 89.73
KOG2079 1206 consensus Vacuolar assembly/sorting protein VPS8 [ 89.44
KOG1645463 consensus RING-finger-containing E3 ubiquitin liga 88.85
KOG1920 1265 consensus IkappaB kinase complex, IKAP component [ 88.74
KOG3621726 consensus WD40 repeat-containing protein [General 88.63
KOG1912 1062 consensus WD40 repeat protein [General function pr 88.63
KOG2114933 consensus Vacuolar assembly/sorting protein PEP5/V 88.37
KOG18321516 consensus HIV-1 Vpr-binding protein [Cell cycle co 88.31
PF14783111 BBS2_Mid: Ciliary BBSome complex subunit 2, middle 87.87
PF14583386 Pectate_lyase22: Oligogalacturonate lyase; PDB: 3C 87.42
PF04841410 Vps16_N: Vps16, N-terminal region; InterPro: IPR00 86.68
PRK13616591 lipoprotein LpqB; Provisional 86.57
KOG4640665 consensus Anaphase-promoting complex (APC), subuni 86.44
KOG4532344 consensus WD40-like repeat containing protein [Gen 86.22
PF08553794 VID27: VID27 cytoplasmic protein; InterPro: IPR013 86.04
PF04053443 Coatomer_WDAD: Coatomer WD associated region ; Int 85.87
KOG2395644 consensus Protein involved in vacuole import and d 84.99
PF00780275 CNH: CNH domain; InterPro: IPR001180 Based on sequ 84.3
KOG4649354 consensus PQQ (pyrrolo-quinoline quinone) repeat p 83.96
KOG4640665 consensus Anaphase-promoting complex (APC), subuni 83.58
COG3292671 Predicted periplasmic ligand-binding sensor domain 82.26
PRK02888635 nitrous-oxide reductase; Validated 80.4
KOG2395644 consensus Protein involved in vacuole import and d 80.31
>KOG0566 consensus Inositol-1,4,5-triphosphate 5-phosphatase (synaptojanin), INP51/INP52/INP53 family [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information 
Probab=100.00  E-value=3.5e-87  Score=789.96  Aligned_cols=340  Identities=35%  Similarity=0.617  Sum_probs=309.6

Q ss_pred             CCCceeeeeccCCCCCchhhhhhccccccceeeeeceEEEEEEEEeCCCCCCc-hhhcccccCC-----CCCcceEEEEe
Q 001123          516 NHGGIRGWNVTSPGPLDSILCKELAGKEFLYTRMENLKILAGTWNVGQGRASQ-DALISWLGSA-----ASDVGIVVVGL  589 (1149)
Q Consensus       516 ~DgtIRlWdl~sp~pld~~i~~~l~~re~~yt~~~~~~i~v~TWNv~~~~~~~-~~l~~wl~~~-----~~~~Di~viGl  589 (1149)
                      .|..+.+.|     |+...+.++|++++.+|+..++++||+|||||||+.+.. ++|.+||...     ...+|||||||
T Consensus       506 ~q~~v~L~d-----pv~~yv~~~L~er~~eyt~~k~i~IfvgTfNvNG~s~~~k~~L~~WLfp~s~~~~~~~aDIyviG~  580 (1080)
T KOG0566|consen  506 AQSAVILYD-----PVHEYVLKELRERRSEYTEPKDISIFVGTFNVNGRSAAFKDDLSDWLFPISRGKEFSPADIYVIGF  580 (1080)
T ss_pred             ccchhhhcC-----chhHHHHHHHHHhhhhhccccceEEEEEeeeccCccccchhhHHhhccccccCCcCCcCcEEEEee
Confidence            466666665     578899999999999999999999999999999855443 5899999854     23589999999


Q ss_pred             ecc-ccccchhhhhhhhhhccCCCCcchhhHHHHHhcccCC-CCcEEEEeeeccceeeeeeeeeccccCccceeEeeeEe
Q 001123          590 QEV-EMGAGFLAMSAAKETVGLEGSAVGHWWLDMIGKILDD-GSTFERVGSRQLAGLLIAVWVRKNLKDYVGDVDVAAVP  667 (1149)
Q Consensus       590 QEi-~~~~~~~~~~~~ke~~~~~~~~~~~~W~~~i~~~L~~-~~~y~~v~s~qL~Gl~l~vfvr~~l~~~i~~v~~~~v~  667 (1149)
                      ||| +|+++++..+         +.++.+.|++.|+++|+. +.+|+++.|.||+|++|++|+|+++.++|++|..++++
T Consensus       581 eEvVeLnag~iv~A---------s~tk~~~Wee~i~~~Ln~~~~kYvlL~s~QlvGv~L~iF~r~~~~p~Ik~V~~~tkK  651 (1080)
T KOG0566|consen  581 EEVVELNAGNIVSA---------STTKRRFWEEKILKTLNRYKNKYVLLRSEQLVGVCLLLFIRPDHAPYIKDVAGDTKK  651 (1080)
T ss_pred             hhhhhcCccceecc---------ChHHHHHHHHHHHHHhcCCCCceEEEehhhhheeeEEEEEcccccchhhhcccceee
Confidence            997 8999876421         345578899999999987 88999999999999999999999999999999999999


Q ss_pred             ecccccccCcceeEEEEEEeceEEEEeeecccccchhHHHHHHHHHHHHHhcccCCCCCccccccCCCchhhhhhhhhhh
Q 001123          668 CGFGRAIGNKGAVGLRVRVYDRIMCFVNCHFAAHLEAVNRRNADFDHVYRTMTFCRPSNLCSAAAGTMPFLLLSCVLACS  747 (1149)
Q Consensus       668 tG~~g~~gNKGaV~ir~~~~~t~lcFVn~HLaA~~~~~~~Rn~d~~~I~~~l~F~~~~~~~~~~~~~~~~~~~s~~~~~~  747 (1149)
                      |||||+.||||||||||.+++|+|||||+||||+++|+++||.||.+|.++|+|+++.                      
T Consensus       652 TGfGG~tgNKGAVAIrf~~~~TsfCFv~SHlAAG~snv~ERn~DY~tI~r~l~Fp~Gr----------------------  709 (1080)
T KOG0566|consen  652 TGFGGATGNKGAVAIRFVYHATSFCFVCSHLAAGQSNVEERNEDYKTIARKLRFPRGR----------------------  709 (1080)
T ss_pred             cccccccCCCceEEEEEEeccccEEEEecccccccchHhhhhhhHHHHHHhccccCCc----------------------
Confidence            9999999999999999999999999999999999999999999999999999998642                      


Q ss_pred             hhhhhhhhccCCchhhhhhccccchhhhcccCCCCCCCcccCCCcccCccEEEEECccCCCCCCCChHHHHHHHhhcChH
Q 001123          748 MYLLWLVYRSGLPLVLYIAAGASSVVQMLRSTNPLSGLTVEGVPELSEADMVIFLGDFNYRLDGITYDEARDFISQRCFD  827 (1149)
Q Consensus       748 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~i~~~D~vfw~GDlNyRi~~~~~~~v~~~i~~~~~~  827 (1149)
                                                                  .|.+||+|||||||||||++ ++|||+++|.+++++
T Consensus       710 --------------------------------------------~I~~HD~ifW~GDFNYRI~l-~nEEVr~~v~~~d~~  744 (1080)
T KOG0566|consen  710 --------------------------------------------MIFSHDYIFWLGDFNYRIDL-SNEEVRRLVRNQDLD  744 (1080)
T ss_pred             --------------------------------------------cccCCceEEEecccceeecC-CHHHHHHHHHhccHH
Confidence                                                        25789999999999999996 999999999999999


Q ss_pred             HHHHhhHHHHHhHcCCcCCCCccCCcccCCCccccccccCCccccCCCCccccccccceeeecCCCccccccccCCCccc
Q 001123          828 WLRERDQLRAEMEAGNVFQGMREADIKFPPTYKFEKHLAGLAGYDSGEKKRVPAWCDRILYRDSRSDLASECSLECPVAS  907 (1149)
Q Consensus       828 ~Ll~~DQL~~~~~~g~~f~gf~E~~I~F~PTYKyd~~~~g~~~yDts~k~R~PsWcDRIL~~~~~~~~~~~~~~~~p~~~  907 (1149)
                      .|+++|||++||.+|++|.||.|++|+|+||||||.   ||+.||||||+|+||||||||||+...              
T Consensus       745 kL~e~DQL~~q~~~G~vF~gF~E~~ltF~PTYKyD~---gTd~YDTSeK~R~PAWTDRIL~r~e~~--------------  807 (1080)
T KOG0566|consen  745 KLLEYDQLTQQMNAGQVFPGFHEGQLTFPPTYKYDP---GTDDYDTSEKCRTPAWTDRILWRGEKL--------------  807 (1080)
T ss_pred             HHhhHHHHHHHHhcCcccccccccccccCCcccccC---CCCccccchhccCccchhhheeccccc--------------
Confidence            999999999999999999999999999999999996   668999999999999999999998753              


Q ss_pred             ceeeeeeecccccCCCCceeeEEEEEccccCHHHHHHHHHHHhhcch
Q 001123          908 SILRYEACMDVTDSDHKPVRCIFSVDIARVDESVRRQEFGDIMTSNE  954 (1149)
Q Consensus       908 ~~~~Y~s~~~~~~SDHkPV~a~f~v~v~~vd~~~~~~~~~~i~~~~~  954 (1149)
                      .++.|.+++ +++||||||+|.|+++|..||+++|.++|+|+++.+.
T Consensus       808 ~~l~Y~~~e-l~~SDHRPV~A~~~a~i~~Vd~~kk~~l~eev~~~~~  853 (1080)
T KOG0566|consen  808 ELLSYKRAE-LKTSDHRPVYAIFRAEIFEVDEQKKLRLFEEVKERLG  853 (1080)
T ss_pred             ccccccccc-ccccCCCceEEEEEEEEEEEcHHHHHHHHHHHHHHcC
Confidence            247898875 9999999999999999999999999999999998643

>PLN03191 Type I inositol-1,4,5-trisphosphate 5-phosphatase 2; Provisional Back     alignment and domain information
>smart00128 IPPc Inositol polyphosphate phosphatase, catalytic domain homologues Back     alignment and domain information
>COG5411 Phosphatidylinositol 5-phosphate phosphatase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0271 consensus Notchless-like WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0271 consensus Notchless-like WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0272 consensus U4/U6 small nuclear ribonucleoprotein Prp4 (contains WD40 repeats) [RNA processing and modification] Back     alignment and domain information
>KOG0263 consensus Transcription initiation factor TFIID, subunit TAF5 (also component of histone acetyltransferase SAGA) [Transcription] Back     alignment and domain information
>KOG0281 consensus Beta-TrCP (transducin repeats containing)/Slimb proteins [Function unknown] Back     alignment and domain information
>KOG0319 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification] Back     alignment and domain information
>KOG0295 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0286 consensus G-protein beta subunit [General function prediction only] Back     alignment and domain information
>KOG0281 consensus Beta-TrCP (transducin repeats containing)/Slimb proteins [Function unknown] Back     alignment and domain information
>KOG0272 consensus U4/U6 small nuclear ribonucleoprotein Prp4 (contains WD40 repeats) [RNA processing and modification] Back     alignment and domain information
>KOG0319 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification] Back     alignment and domain information
>KOG0315 consensus G-protein beta subunit-like protein (contains WD40 repeats) [General function prediction only] Back     alignment and domain information
>KOG0279 consensus G protein beta subunit-like protein [Signal transduction mechanisms] Back     alignment and domain information
>KOG0263 consensus Transcription initiation factor TFIID, subunit TAF5 (also component of histone acetyltransferase SAGA) [Transcription] Back     alignment and domain information
>KOG0295 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0273 consensus Beta-transducin family (WD-40 repeat) protein [Chromatin structure and dynamics] Back     alignment and domain information
>KOG0266 consensus WD40 repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG0306 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification] Back     alignment and domain information
>KOG0265 consensus U5 snRNP-specific protein-like factor and related proteins [RNA processing and modification] Back     alignment and domain information
>KOG0274 consensus Cdc4 and related F-box and WD-40 proteins [General function prediction only] Back     alignment and domain information
>KOG0318 consensus WD40 repeat stress protein/actin interacting protein [Cytoskeleton] Back     alignment and domain information
>PTZ00312 inositol-1,4,5-triphosphate 5-phosphatase; Provisional Back     alignment and domain information
>KOG0315 consensus G-protein beta subunit-like protein (contains WD40 repeats) [General function prediction only] Back     alignment and domain information
>KOG0313 consensus Microtubule binding protein YTM1 (contains WD40 repeats) [Cytoskeleton] Back     alignment and domain information
>KOG0291 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification] Back     alignment and domain information
>KOG0266 consensus WD40 repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG0313 consensus Microtubule binding protein YTM1 (contains WD40 repeats) [Cytoskeleton] Back     alignment and domain information
>KOG0285 consensus Pleiotropic regulator 1 [RNA processing and modification] Back     alignment and domain information
>cd00200 WD40 WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and botto Back     alignment and domain information
>KOG0291 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification] Back     alignment and domain information
>KOG0274 consensus Cdc4 and related F-box and WD-40 proteins [General function prediction only] Back     alignment and domain information
>KOG0318 consensus WD40 repeat stress protein/actin interacting protein [Cytoskeleton] Back     alignment and domain information
>KOG0284 consensus Polyadenylation factor I complex, subunit PFS2 [RNA processing and modification] Back     alignment and domain information
>PLN00181 protein SPA1-RELATED; Provisional Back     alignment and domain information
>KOG0279 consensus G protein beta subunit-like protein [Signal transduction mechanisms] Back     alignment and domain information
>KOG0296 consensus Angio-associated migratory cell protein (contains WD40 repeats) [Function unknown] Back     alignment and domain information
>KOG0308 consensus Conserved WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0286 consensus G-protein beta subunit [General function prediction only] Back     alignment and domain information
>KOG0293 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0285 consensus Pleiotropic regulator 1 [RNA processing and modification] Back     alignment and domain information
>KOG0645 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0282 consensus mRNA splicing factor [Function unknown] Back     alignment and domain information
>KOG0292 consensus Vesicle coat complex COPI, alpha subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0565 consensus Inositol polyphosphate 5-phosphatase and related proteins [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0284 consensus Polyadenylation factor I complex, subunit PFS2 [RNA processing and modification] Back     alignment and domain information
>KOG0276 consensus Vesicle coat complex COPI, beta' subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0316 consensus Conserved WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0301 consensus Phospholipase A2-activating protein (contains WD40 repeats) [Lipid transport and metabolism] Back     alignment and domain information
>KOG0275 consensus Conserved WD40 repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG0645 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0276 consensus Vesicle coat complex COPI, beta' subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0306 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification] Back     alignment and domain information
>KOG0273 consensus Beta-transducin family (WD-40 repeat) protein [Chromatin structure and dynamics] Back     alignment and domain information
>cd00200 WD40 WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and botto Back     alignment and domain information
>PLN00181 protein SPA1-RELATED; Provisional Back     alignment and domain information
>KOG0265 consensus U5 snRNP-specific protein-like factor and related proteins [RNA processing and modification] Back     alignment and domain information
>KOG0300 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>PTZ00420 coronin; Provisional Back     alignment and domain information
>PTZ00421 coronin; Provisional Back     alignment and domain information
>KOG0288 consensus WD40 repeat protein TipD [General function prediction only] Back     alignment and domain information
>KOG0296 consensus Angio-associated migratory cell protein (contains WD40 repeats) [Function unknown] Back     alignment and domain information
>PTZ00421 coronin; Provisional Back     alignment and domain information
>KOG0301 consensus Phospholipase A2-activating protein (contains WD40 repeats) [Lipid transport and metabolism] Back     alignment and domain information
>KOG0292 consensus Vesicle coat complex COPI, alpha subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0278 consensus Serine/threonine kinase receptor-associated protein [Lipid transport and metabolism] Back     alignment and domain information
>KOG0640 consensus mRNA cleavage stimulating factor complex; subunit 1 [RNA processing and modification] Back     alignment and domain information
>KOG0316 consensus Conserved WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>PTZ00420 coronin; Provisional Back     alignment and domain information
>KOG0308 consensus Conserved WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0283 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0294 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0278 consensus Serine/threonine kinase receptor-associated protein [Lipid transport and metabolism] Back     alignment and domain information
>KOG0268 consensus Sof1-like rRNA processing protein (contains WD40 repeats) [RNA processing and modification] Back     alignment and domain information
>KOG0299 consensus U3 snoRNP-associated protein (contains WD40 repeats) [RNA processing and modification] Back     alignment and domain information
>KOG0277 consensus Peroxisomal targeting signal type 2 receptor [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0299 consensus U3 snoRNP-associated protein (contains WD40 repeats) [RNA processing and modification] Back     alignment and domain information
>KOG0275 consensus Conserved WD40 repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG0641 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0294 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0310 consensus Conserved WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0282 consensus mRNA splicing factor [Function unknown] Back     alignment and domain information
>KOG0643 consensus Translation initiation factor 3, subunit i (eIF-3i)/TGF-beta receptor-interacting protein (TRIP-1) [Translation, ribosomal structure and biogenesis; Signal transduction mechanisms] Back     alignment and domain information
>KOG1446 consensus Histone H3 (Lys4) methyltransferase complex and RNA cleavage factor II complex, subunit SWD2 [RNA processing and modification; Chromatin structure and dynamics; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0305 consensus Anaphase promoting complex, Cdc20, Cdh1, and Ama1 subunits [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0293 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG1408 consensus WD40 repeat protein [Function unknown] Back     alignment and domain information
>KOG0973 consensus Histone transcription regulator HIRA, WD repeat superfamily [Cell cycle control, cell division, chromosome partitioning; Transcription] Back     alignment and domain information
>KOG0289 consensus mRNA splicing factor [General function prediction only] Back     alignment and domain information
>KOG0288 consensus WD40 repeat protein TipD [General function prediction only] Back     alignment and domain information
>KOG0277 consensus Peroxisomal targeting signal type 2 receptor [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0973 consensus Histone transcription regulator HIRA, WD repeat superfamily [Cell cycle control, cell division, chromosome partitioning; Transcription] Back     alignment and domain information
>TIGR03866 PQQ_ABC_repeats PQQ-dependent catabolism-associated beta-propeller protein Back     alignment and domain information
>KOG0300 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG1407 consensus WD40 repeat protein [Function unknown] Back     alignment and domain information
>KOG0647 consensus mRNA export protein (contains WD40 repeats) [RNA processing and modification] Back     alignment and domain information
>KOG0310 consensus Conserved WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0641 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0646 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0305 consensus Anaphase promoting complex, Cdc20, Cdh1, and Ama1 subunits [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0321 consensus WD40 repeat-containing protein L2DTL [Function unknown] Back     alignment and domain information
>KOG0647 consensus mRNA export protein (contains WD40 repeats) [RNA processing and modification] Back     alignment and domain information
>KOG1539 consensus WD repeat protein [General function prediction only] Back     alignment and domain information
>KOG1036 consensus Mitotic spindle checkpoint protein BUB3, WD repeat superfamily [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0772 consensus Uncharacterized conserved protein, contains WD40 repeat [Function unknown] Back     alignment and domain information
>KOG0283 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG2445 consensus Nuclear pore complex component (sc Seh1) [Nuclear structure; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1407 consensus WD40 repeat protein [Function unknown] Back     alignment and domain information
>KOG1446 consensus Histone H3 (Lys4) methyltransferase complex and RNA cleavage factor II complex, subunit SWD2 [RNA processing and modification; Chromatin structure and dynamics; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1063 consensus RNA polymerase II elongator complex, subunit ELP2, WD repeat superfamily [Chromatin structure and dynamics; Transcription] Back     alignment and domain information
>KOG2096 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG2048 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0264 consensus Nucleosome remodeling factor, subunit CAF1/NURF55/MSI1 [Chromatin structure and dynamics] Back     alignment and domain information
>KOG0640 consensus mRNA cleavage stimulating factor complex; subunit 1 [RNA processing and modification] Back     alignment and domain information
>KOG0639 consensus Transducin-like enhancer of split protein (contains WD40 repeats) [Chromatin structure and dynamics] Back     alignment and domain information
>KOG0267 consensus Microtubule severing protein katanin p80 subunit B (contains WD40 repeats) [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0646 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG1976 consensus Inositol polyphosphate 5-phosphatase, type I [Lipid transport and metabolism] Back     alignment and domain information
>KOG2096 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0772 consensus Uncharacterized conserved protein, contains WD40 repeat [Function unknown] Back     alignment and domain information
>KOG1036 consensus Mitotic spindle checkpoint protein BUB3, WD repeat superfamily [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG1539 consensus WD repeat protein [General function prediction only] Back     alignment and domain information
>KOG0642 consensus Cell-cycle nuclear protein, contains WD-40 repeats [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0643 consensus Translation initiation factor 3, subunit i (eIF-3i)/TGF-beta receptor-interacting protein (TRIP-1) [Translation, ribosomal structure and biogenesis; Signal transduction mechanisms] Back     alignment and domain information
>KOG0639 consensus Transducin-like enhancer of split protein (contains WD40 repeats) [Chromatin structure and dynamics] Back     alignment and domain information
>KOG1332 consensus Vesicle coat complex COPII, subunit SEC13 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1332 consensus Vesicle coat complex COPII, subunit SEC13 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>TIGR03866 PQQ_ABC_repeats PQQ-dependent catabolism-associated beta-propeller protein Back     alignment and domain information
>KOG0302 consensus Ribosome Assembly protein [General function prediction only] Back     alignment and domain information
>KOG4283 consensus Transcription-coupled repair protein CSA, contains WD40 domain [Transcription; Replication, recombination and repair] Back     alignment and domain information
>KOG0267 consensus Microtubule severing protein katanin p80 subunit B (contains WD40 repeats) [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG2106 consensus Uncharacterized conserved protein, contains HELP and WD40 domains [Function unknown] Back     alignment and domain information
>KOG1408 consensus WD40 repeat protein [Function unknown] Back     alignment and domain information
>KOG2048 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0268 consensus Sof1-like rRNA processing protein (contains WD40 repeats) [RNA processing and modification] Back     alignment and domain information
>KOG0270 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0264 consensus Nucleosome remodeling factor, subunit CAF1/NURF55/MSI1 [Chromatin structure and dynamics] Back     alignment and domain information
>KOG0649 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0269 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG4283 consensus Transcription-coupled repair protein CSA, contains WD40 domain [Transcription; Replication, recombination and repair] Back     alignment and domain information
>KOG1273 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0650 consensus WD40 repeat nucleolar protein Bop1, involved in ribosome biogenesis [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG1274 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG2445 consensus Nuclear pore complex component (sc Seh1) [Nuclear structure; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0642 consensus Cell-cycle nuclear protein, contains WD-40 repeats [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0289 consensus mRNA splicing factor [General function prediction only] Back     alignment and domain information
>KOG0321 consensus WD40 repeat-containing protein L2DTL [Function unknown] Back     alignment and domain information
>KOG0644 consensus Uncharacterized conserved protein, contains WD40 repeat and BROMO domains [General function prediction only] Back     alignment and domain information
>KOG0307 consensus Vesicle coat complex COPII, subunit SEC31 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1274 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>COG2319 FOG: WD40 repeat [General function prediction only] Back     alignment and domain information
>KOG1538 consensus Uncharacterized conserved protein WDR10, contains WD40 repeats [General function prediction only] Back     alignment and domain information
>COG2319 FOG: WD40 repeat [General function prediction only] Back     alignment and domain information
>KOG0269 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG1445 consensus Tumor-specific antigen (contains WD repeats) [Cytoskeleton] Back     alignment and domain information
>KOG4328 consensus WD40 protein [Function unknown] Back     alignment and domain information
>KOG0270 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG2106 consensus Uncharacterized conserved protein, contains HELP and WD40 domains [Function unknown] Back     alignment and domain information
>KOG0649 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0302 consensus Ribosome Assembly protein [General function prediction only] Back     alignment and domain information
>KOG0650 consensus WD40 repeat nucleolar protein Bop1, involved in ribosome biogenesis [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG0303 consensus Actin-binding protein Coronin, contains WD40 repeats [Cytoskeleton] Back     alignment and domain information
>KOG1063 consensus RNA polymerase II elongator complex, subunit ELP2, WD repeat superfamily [Chromatin structure and dynamics; Transcription] Back     alignment and domain information
>KOG0303 consensus Actin-binding protein Coronin, contains WD40 repeats [Cytoskeleton] Back     alignment and domain information
>KOG2055 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG4378 consensus Nuclear protein COP1 [Signal transduction mechanisms] Back     alignment and domain information
>PRK11028 6-phosphogluconolactonase; Provisional Back     alignment and domain information
>KOG1034 consensus Transcriptional repressor EED/ESC/FIE, required for transcriptional silencing, WD repeat superfamily [Transcription] Back     alignment and domain information
>KOG2055 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG2919 consensus Guanine nucleotide-binding protein [General function prediction only] Back     alignment and domain information
>KOG1188 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0322 consensus G-protein beta subunit-like protein GNB1L, contains WD repeats [General function prediction only] Back     alignment and domain information
>KOG1034 consensus Transcriptional repressor EED/ESC/FIE, required for transcriptional silencing, WD repeat superfamily [Transcription] Back     alignment and domain information
>KOG1007 consensus WD repeat protein TSSC1, WD repeat superfamily [Function unknown] Back     alignment and domain information
>KOG1517 consensus Guanine nucleotide binding protein MIP1 [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG1009 consensus Chromatin assembly complex 1 subunit B/CAC2 (contains WD40 repeats) [Chromatin structure and dynamics; Replication, recombination and repair] Back     alignment and domain information
>KOG1009 consensus Chromatin assembly complex 1 subunit B/CAC2 (contains WD40 repeats) [Chromatin structure and dynamics; Replication, recombination and repair] Back     alignment and domain information
>KOG0307 consensus Vesicle coat complex COPII, subunit SEC31 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PRK01742 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG4328 consensus WD40 protein [Function unknown] Back     alignment and domain information
>KOG0771 consensus Prolactin regulatory element-binding protein/Protein transport protein SEC12p [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1538 consensus Uncharacterized conserved protein WDR10, contains WD40 repeats [General function prediction only] Back     alignment and domain information
>KOG1587 consensus Cytoplasmic dynein intermediate chain [Cytoskeleton] Back     alignment and domain information
>KOG2919 consensus Guanine nucleotide-binding protein [General function prediction only] Back     alignment and domain information
>KOG4227 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG4378 consensus Nuclear protein COP1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0644 consensus Uncharacterized conserved protein, contains WD40 repeat and BROMO domains [General function prediction only] Back     alignment and domain information
>KOG1240 consensus Protein kinase containing WD40 repeats [Signal transduction mechanisms] Back     alignment and domain information
>PRK01742 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG1007 consensus WD repeat protein TSSC1, WD repeat superfamily [Function unknown] Back     alignment and domain information
>KOG1445 consensus Tumor-specific antigen (contains WD repeats) [Cytoskeleton] Back     alignment and domain information
>KOG1963 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG1334 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PRK03629 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG1273 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PRK11028 6-phosphogluconolactonase; Provisional Back     alignment and domain information
>KOG0974 consensus WD-repeat protein WDR6, WD repeat superfamily [General function prediction only] Back     alignment and domain information
>KOG0322 consensus G-protein beta subunit-like protein GNB1L, contains WD repeats [General function prediction only] Back     alignment and domain information
>PRK04922 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG1963 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG1240 consensus Protein kinase containing WD40 repeats [Signal transduction mechanisms] Back     alignment and domain information
>KOG0290 consensus Conserved WD40 repeat-containing protein AN11 [Function unknown] Back     alignment and domain information
>KOG4227 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG1310 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0974 consensus WD-repeat protein WDR6, WD repeat superfamily [General function prediction only] Back     alignment and domain information
>PRK05137 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG1310 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PF03372 Exo_endo_phos: Endonuclease/Exonuclease/phosphatase family Subset of Pfam family Subset of Pfam family; InterPro: IPR005135 This domain is found in a large number of proteins including magnesium dependent endonucleases and phosphatases involved in intracellular signalling [] Back     alignment and domain information
>KOG1517 consensus Guanine nucleotide binding protein MIP1 [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>TIGR03300 assembly_YfgL outer membrane assembly lipoprotein YfgL Back     alignment and domain information
>KOG1188 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PRK03629 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK02889 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG0290 consensus Conserved WD40 repeat-containing protein AN11 [Function unknown] Back     alignment and domain information
>PRK05421 hypothetical protein; Provisional Back     alignment and domain information
>TIGR02800 propeller_TolB tol-pal system beta propeller repeat protein TolB Back     alignment and domain information
>KOG1524 consensus WD40 repeat-containing protein CHE-2 [General function prediction only] Back     alignment and domain information
>PRK11756 exonuclease III; Provisional Back     alignment and domain information
>TIGR03395 sphingomy sphingomyelin phosphodiesterase Back     alignment and domain information
>PRK05137 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG2110 consensus Uncharacterized conserved protein, contains WD40 repeats [Function unknown] Back     alignment and domain information
>TIGR00633 xth exodeoxyribonuclease III (xth) Back     alignment and domain information
>PRK04922 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG2110 consensus Uncharacterized conserved protein, contains WD40 repeats [Function unknown] Back     alignment and domain information
>KOG4547 consensus WD40 repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG1272 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification] Back     alignment and domain information
>KOG2394 consensus WD40 protein DMR-N9 [General function prediction only] Back     alignment and domain information
>TIGR03300 assembly_YfgL outer membrane assembly lipoprotein YfgL Back     alignment and domain information
>KOG1587 consensus Cytoplasmic dynein intermediate chain [Cytoskeleton] Back     alignment and domain information
>PRK00178 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PF02239 Cytochrom_D1: Cytochrome D1 heme domain; PDB: 1NNO_B 1HZU_A 1N15_B 1N50_A 1GJQ_A 1BL9_B 1NIR_B 1N90_B 1HZV_A 1AOQ_A Back     alignment and domain information
>KOG2394 consensus WD40 protein DMR-N9 [General function prediction only] Back     alignment and domain information
>KOG4497 consensus Uncharacterized conserved protein WDR8, contains WD repeats [General function prediction only] Back     alignment and domain information
>PF08662 eIF2A: Eukaryotic translation initiation factor eIF2A; InterPro: IPR013979 This entry contains beta propellor domains found in eukaryotic translation initiation factors and TolB domain-containing proteins Back     alignment and domain information
>PRK04792 tolB translocation protein TolB; Provisional Back     alignment and domain information
>TIGR02800 propeller_TolB tol-pal system beta propeller repeat protein TolB Back     alignment and domain information
>KOG4190 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1354 consensus Serine/threonine protein phosphatase 2A, regulatory subunit [Signal transduction mechanisms] Back     alignment and domain information
>KOG3881 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK02889 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG0771 consensus Prolactin regulatory element-binding protein/Protein transport protein SEC12p [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF02239 Cytochrom_D1: Cytochrome D1 heme domain; PDB: 1NNO_B 1HZU_A 1N15_B 1N50_A 1GJQ_A 1BL9_B 1NIR_B 1N90_B 1HZV_A 1AOQ_A Back     alignment and domain information
>KOG2111 consensus Uncharacterized conserved protein, contains WD40 repeats [Function unknown] Back     alignment and domain information
>PF08662 eIF2A: Eukaryotic translation initiation factor eIF2A; InterPro: IPR013979 This entry contains beta propellor domains found in eukaryotic translation initiation factors and TolB domain-containing proteins Back     alignment and domain information
>KOG2139 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG2111 consensus Uncharacterized conserved protein, contains WD40 repeats [Function unknown] Back     alignment and domain information
>KOG1524 consensus WD40 repeat-containing protein CHE-2 [General function prediction only] Back     alignment and domain information
>KOG4190 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1272 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification] Back     alignment and domain information
>PF00400 WD40: WD domain, G-beta repeat; InterPro: IPR019781 WD-40 repeats (also known as WD or beta-transducin repeats) are short ~40 amino acid motifs, often terminating in a Trp-Asp (W-D) dipeptide Back     alignment and domain information
>KOG1334 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG2321 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PRK11138 outer membrane biogenesis protein BamB; Provisional Back     alignment and domain information
>TIGR00195 exoDNase_III exodeoxyribonuclease III Back     alignment and domain information
>PLN02919 haloacid dehalogenase-like hydrolase family protein Back     alignment and domain information
>KOG1064 consensus RAVE (regulator of V-ATPase assembly) complex subunit RAV1/DMX protein, WD repeat superfamily [General function prediction only] Back     alignment and domain information
>PLN02919 haloacid dehalogenase-like hydrolase family protein Back     alignment and domain information
>KOG1523 consensus Actin-related protein Arp2/3 complex, subunit ARPC1/p41-ARC [Cytoskeleton] Back     alignment and domain information
>KOG2139 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>COG3568 ElsH Metal-dependent hydrolase [General function prediction only] Back     alignment and domain information
>PRK00178 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG3881 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG3914 consensus WD repeat protein WDR4 [Function unknown] Back     alignment and domain information
>KOG2315 consensus Predicted translation initiation factor related to eIF-3a [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG1409 consensus Uncharacterized conserved protein, contains WD40 repeats and FYVE domains [Function unknown] Back     alignment and domain information
>PRK13911 exodeoxyribonuclease III; Provisional Back     alignment and domain information
>KOG1064 consensus RAVE (regulator of V-ATPase assembly) complex subunit RAV1/DMX protein, WD repeat superfamily [General function prediction only] Back     alignment and domain information
>PF13360 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 3Q54_A 2YH3_A 3PRW_A 3P1L_A 3Q7M_A 3Q7O_A 3Q7N_A Back     alignment and domain information
>KOG0309 consensus Conserved WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>PF13360 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 3Q54_A 2YH3_A 3PRW_A 3P1L_A 3Q7M_A 3Q7O_A 3Q7N_A Back     alignment and domain information
>TIGR02658 TTQ_MADH_Hv methylamine dehydrogenase heavy chain Back     alignment and domain information
>KOG4547 consensus WD40 repeat-containing protein [General function prediction only] Back     alignment and domain information
>PRK04792 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PF00400 WD40: WD domain, G-beta repeat; InterPro: IPR019781 WD-40 repeats (also known as WD or beta-transducin repeats) are short ~40 amino acid motifs, often terminating in a Trp-Asp (W-D) dipeptide Back     alignment and domain information
>KOG2695 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PRK01029 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG0280 consensus Uncharacterized conserved protein [Amino acid transport and metabolism] Back     alignment and domain information
>KOG2321 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>smart00476 DNaseIc deoxyribonuclease I Back     alignment and domain information
>TIGR02658 TTQ_MADH_Hv methylamine dehydrogenase heavy chain Back     alignment and domain information
>COG2706 3-carboxymuconate cyclase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PF10282 Lactonase: Lactonase, 7-bladed beta-propeller; InterPro: IPR019405 6-phosphogluconolactonases (6PGL) 3 Back     alignment and domain information
>KOG3914 consensus WD repeat protein WDR4 [Function unknown] Back     alignment and domain information
>PF14874 PapD-like: Flagellar-associated PapD-like Back     alignment and domain information
>COG5170 CDC55 Serine/threonine protein phosphatase 2A, regulatory subunit [Signal transduction mechanisms] Back     alignment and domain information
>PLN03144 Carbon catabolite repressor protein 4 homolog; Provisional Back     alignment and domain information
>KOG2041 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG2695 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PRK01029 tolB translocation protein TolB; Provisional Back     alignment and domain information
>COG5354 Uncharacterized protein, contains Trp-Asp (WD) repeat [General function prediction only] Back     alignment and domain information
>KOG2315 consensus Predicted translation initiation factor related to eIF-3a [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG1409 consensus Uncharacterized conserved protein, contains WD40 repeats and FYVE domains [Function unknown] Back     alignment and domain information
>PF08450 SGL: SMP-30/Gluconolaconase/LRE-like region; InterPro: IPR013658 This family describes a region that is found in proteins expressed by a variety of eukaryotic and prokaryotic species Back     alignment and domain information
>PRK04043 tolB translocation protein TolB; Provisional Back     alignment and domain information
>COG0708 XthA Exonuclease III [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK11138 outer membrane biogenesis protein BamB; Provisional Back     alignment and domain information
>KOG1354 consensus Serine/threonine protein phosphatase 2A, regulatory subunit [Signal transduction mechanisms] Back     alignment and domain information
>COG4946 Uncharacterized protein related to the periplasmic component of the Tol biopolymer transport system [Function unknown] Back     alignment and domain information
>KOG1523 consensus Actin-related protein Arp2/3 complex, subunit ARPC1/p41-ARC [Cytoskeleton] Back     alignment and domain information
>PTZ00297 pantothenate kinase; Provisional Back     alignment and domain information
>COG2706 3-carboxymuconate cyclase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PF10282 Lactonase: Lactonase, 7-bladed beta-propeller; InterPro: IPR019405 6-phosphogluconolactonases (6PGL) 3 Back     alignment and domain information
>KOG0309 consensus Conserved WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0280 consensus Uncharacterized conserved protein [Amino acid transport and metabolism] Back     alignment and domain information
>smart00320 WD40 WD40 repeats Back     alignment and domain information
>PF04762 IKI3: IKI3 family; InterPro: IPR006849 Members of this family are components of the elongator multi-subunit component of a novel RNA polymerase II holoenzyme for transcriptional elongation [] Back     alignment and domain information
>PF07433 DUF1513: Protein of unknown function (DUF1513); InterPro: IPR008311 There are currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function Back     alignment and domain information
>KOG1912 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG2314 consensus Translation initiation factor 3, subunit b (eIF-3b) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG4714 consensus Nucleoporin [Nuclear structure] Back     alignment and domain information
>COG4946 Uncharacterized protein related to the periplasmic component of the Tol biopolymer transport system [Function unknown] Back     alignment and domain information
>KOG1645 consensus RING-finger-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK04043 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PF11768 DUF3312: Protein of unknown function (DUF3312); InterPro: IPR024511 This is a eukaryotic family of uncharacterised proteins that contain WD40 repeats Back     alignment and domain information
>KOG2756 consensus Predicted Mg2+-dependent phosphodiesterase TTRAP [Signal transduction mechanisms] Back     alignment and domain information
>PRK15251 cytolethal distending toxin subunit CdtB; Provisional Back     alignment and domain information
>PF00635 Motile_Sperm: MSP (Major sperm protein) domain; InterPro: IPR000535 Major sperm proteins (MSP) are central components in molecular interactions underlying sperm motility in Caenorhabditis elegans, whose sperm employ an amoebae-like crawling motion using a MSP-containing lamellipod, rather than the flagellar-based swimming motion associated with other sperm Back     alignment and domain information
>COG5354 Uncharacterized protein, contains Trp-Asp (WD) repeat [General function prediction only] Back     alignment and domain information
>KOG4714 consensus Nucleoporin [Nuclear structure] Back     alignment and domain information
>KOG3873 consensus Sphingomyelinase family protein [Signal transduction mechanisms] Back     alignment and domain information
>KOG4497 consensus Uncharacterized conserved protein WDR8, contains WD repeats [General function prediction only] Back     alignment and domain information
>smart00320 WD40 WD40 repeats Back     alignment and domain information
>PF15492 Nbas_N: Neuroblastoma-amplified sequence, N terminal Back     alignment and domain information
>KOG4532 consensus WD40-like repeat containing protein [General function prediction only] Back     alignment and domain information
>KOG2444 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG2114 consensus Vacuolar assembly/sorting protein PEP5/VPS11 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG3621 consensus WD40 repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF15492 Nbas_N: Neuroblastoma-amplified sequence, N terminal Back     alignment and domain information
>PF08450 SGL: SMP-30/Gluconolaconase/LRE-like region; InterPro: IPR013658 This family describes a region that is found in proteins expressed by a variety of eukaryotic and prokaryotic species Back     alignment and domain information
>KOG0882 consensus Cyclophilin-related peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1275 consensus PAB-dependent poly(A) ribonuclease, subunit PAN2 [Replication, recombination and repair] Back     alignment and domain information
>cd00216 PQQ_DH Dehydrogenases with pyrrolo-quinoline quinone (PQQ) as cofactor, like ethanol, methanol, and membrane bound glucose dehydrogenases Back     alignment and domain information
>PF07433 DUF1513: Protein of unknown function (DUF1513); InterPro: IPR008311 There are currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function Back     alignment and domain information
>COG3386 Gluconolactonase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PF14783 BBS2_Mid: Ciliary BBSome complex subunit 2, middle region Back     alignment and domain information
>KOG2066 consensus Vacuolar assembly/sorting protein VPS41 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>COG5170 CDC55 Serine/threonine protein phosphatase 2A, regulatory subunit [Signal transduction mechanisms] Back     alignment and domain information
>KOG2338 consensus Transcriptional effector CCR4-related protein [Transcription] Back     alignment and domain information
>COG3292 Predicted periplasmic ligand-binding sensor domain [Signal transduction mechanisms] Back     alignment and domain information
>KOG4649 consensus PQQ (pyrrolo-quinoline quinone) repeat protein [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>KOG0882 consensus Cyclophilin-related peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd00216 PQQ_DH Dehydrogenases with pyrrolo-quinoline quinone (PQQ) as cofactor, like ethanol, methanol, and membrane bound glucose dehydrogenases Back     alignment and domain information
>KOG1832 consensus HIV-1 Vpr-binding protein [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG2066 consensus Vacuolar assembly/sorting protein VPS41 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF11768 DUF3312: Protein of unknown function (DUF3312); InterPro: IPR024511 This is a eukaryotic family of uncharacterised proteins that contain WD40 repeats Back     alignment and domain information
>PF08553 VID27: VID27 cytoplasmic protein; InterPro: IPR013863 This entry represents fungal and plant proteins and contains many hypothetical proteins Back     alignment and domain information
>KOG2444 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG1275 consensus PAB-dependent poly(A) ribonuclease, subunit PAN2 [Replication, recombination and repair] Back     alignment and domain information
>KOG2079 consensus Vacuolar assembly/sorting protein VPS8 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF04762 IKI3: IKI3 family; InterPro: IPR006849 Members of this family are components of the elongator multi-subunit component of a novel RNA polymerase II holoenzyme for transcriptional elongation [] Back     alignment and domain information
>KOG2041 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG2079 consensus Vacuolar assembly/sorting protein VPS8 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1645 consensus RING-finger-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1920 consensus IkappaB kinase complex, IKAP component [Transcription] Back     alignment and domain information
>KOG3621 consensus WD40 repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG1912 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG2114 consensus Vacuolar assembly/sorting protein PEP5/VPS11 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1832 consensus HIV-1 Vpr-binding protein [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PF14783 BBS2_Mid: Ciliary BBSome complex subunit 2, middle region Back     alignment and domain information
>PF14583 Pectate_lyase22: Oligogalacturonate lyase; PDB: 3C5M_C 3PE7_A Back     alignment and domain information
>PF04841 Vps16_N: Vps16, N-terminal region; InterPro: IPR006926 This protein forms part of the Class C vacuolar protein sorting (Vps) complex Back     alignment and domain information
>PRK13616 lipoprotein LpqB; Provisional Back     alignment and domain information
>KOG4640 consensus Anaphase-promoting complex (APC), subunit 4 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4532 consensus WD40-like repeat containing protein [General function prediction only] Back     alignment and domain information
>PF08553 VID27: VID27 cytoplasmic protein; InterPro: IPR013863 This entry represents fungal and plant proteins and contains many hypothetical proteins Back     alignment and domain information
>PF04053 Coatomer_WDAD: Coatomer WD associated region ; InterPro: IPR006692 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>KOG2395 consensus Protein involved in vacuole import and degradation [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF00780 CNH: CNH domain; InterPro: IPR001180 Based on sequence similarities a domain of homology has been identified in the following proteins []: Citron and Citron kinase Back     alignment and domain information
>KOG4649 consensus PQQ (pyrrolo-quinoline quinone) repeat protein [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>KOG4640 consensus Anaphase-promoting complex (APC), subunit 4 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG3292 Predicted periplasmic ligand-binding sensor domain [Signal transduction mechanisms] Back     alignment and domain information
>PRK02888 nitrous-oxide reductase; Validated Back     alignment and domain information
>KOG2395 consensus Protein involved in vacuole import and degradation [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query1149
3n9v_A313 Crystal Structure Of Inpp5b Length = 313 9e-38
3mtc_A313 Crystal Structure Of Inpp5b In Complex With Phospha 6e-35
1i9y_A347 Crystal Structure Of Inositol Polyphosphate 5-Phosp 3e-20
2xsw_A357 Crystal Structure Of Human Inpp5e Length = 357 4e-18
3nr8_B316 Crystal Structure Of Human Ship2 Length = 316 5e-14
1ntf_A282 Crystal Structure Of Cimex Nitrophorin Length = 282 2e-07
>pdb|3N9V|A Chain A, Crystal Structure Of Inpp5b Length = 313 Back     alignment and structure 
Iteration: 1

 Score =  155 bits (393), Expect = 9e-38,   Method: Compositional matrix adjust.
 Identities = 99/391 (25%), Positives = 175/391 (44%), Gaps = 87/391 (22%)
Query: 549 MENLKILAGTWNVGQGRASQDALISWLGSAASDVGIVVVGLQEVEMGAGFLAMSAAKETV 608
           ++N +  AGT+NV  G++ ++ L  WL +      +  VG QE+++         +KE  
Sbjct: 2   IQNFRFFAGTYNVN-GQSPKECLRLWLSNGIQAPDVYCVGFQELDL---------SKEAF 51
Query: 609 GLEGSAVGHWWLDMIGKILDDGSTFERVGSRQLAGLLIAVWVRKNLKDYVGDVDVAAVPC 668
               +     W   + + L   + + +V   +L G+++ ++V++    Y+ +V+   V  
Sbjct: 52  FFHDTPKEEEWFKAVSEGLHPDAKYAKVKLIRLVGIMLLLYVKQEHAAYISEVEAETVGT 111
Query: 669 GFGRAIGNKGAVGLRVRVYDRIMCFVNCHFAAHLEAVNRRNADFDHVYRTMTFCRPSNLC 728
           G    +GNKG V +R + ++  +C VN H AAH+E   RRN D+             ++C
Sbjct: 112 GIMGRMGNKGGVAIRFQFHNTSICVVNSHLAAHIEEYERRNQDY------------KDIC 159
Query: 729 SAAAGTMPFLLLSCVLACSMYLLWLVYRSGLPLVLYIAAGASSVVQMLRSTNPLSGLTVE 788
           S      P                      LP                    PL+     
Sbjct: 160 SRMQFCQP-------------------DPSLP--------------------PLT----- 175
Query: 789 GVPELSEADMVIFLGDFNYRLDGITYDEARDFISQRCFDWLRERDQLRAEMEAGNVFQGM 848
               +S  D++++LGD NYR++ +  ++ +  I ++ F  L   DQL+ ++ A  VF+G 
Sbjct: 176 ----ISNHDVILWLGDLNYRIEELDVEKVKKLIEEKDFQMLYAYDQLKIQVAAKTVFEGF 231
Query: 849 READIKFPPTYKFEKHLAGLAGYDSGEKKRVPAWCDRILYRDSRSDLASECSLECPVASS 908
            E ++ F PTYK++    G   +D+ EK R PAWCDRIL++                  +
Sbjct: 232 TEGELTFQPTYKYD---TGSDDWDTSEKCRAPAWCDRILWKGKN--------------IT 274
Query: 909 ILRYEACMDVTDSDHKPVRCIFSVDIARVDE 939
            L Y++ M +  SDHKPV  +F + +  V++
Sbjct: 275 QLSYQSHMALKTSDHKPVSSVFDIGVRVVND 305
>pdb|3MTC|A Chain A, Crystal Structure Of Inpp5b In Complex With Phosphatidylinositol 4- Phosphate Length = 313 Back     alignment and structure
>pdb|1I9Y|A Chain A, Crystal Structure Of Inositol Polyphosphate 5-Phosphatase Domain (Ipp5c) Of Spsynaptojanin Length = 347 Back     alignment and structure
>pdb|2XSW|A Chain A, Crystal Structure Of Human Inpp5e Length = 357 Back     alignment and structure
>pdb|3NR8|B Chain B, Crystal Structure Of Human Ship2 Length = 316 Back     alignment and structure
>pdb|1NTF|A Chain A, Crystal Structure Of Cimex Nitrophorin Length = 282 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query1149
3mtc_A313 Type II inositol-1,4,5-trisphosphate 5-phosphatas; 2e-91
2xsw_A357 72 kDa inositol polyphosphate 5-phosphatase; inosi 1e-87
1i9z_A347 Synaptojanin, phosphatidylinositol phosphate phosp 3e-72
4a9c_A316 Phosphatidylinositol-3,4,5-trisphosphate 5-phosph; 3e-49
4a9c_A316 Phosphatidylinositol-3,4,5-trisphosphate 5-phosph; 2e-40
2imq_X282 Salivary nitrophorin; ferrous heme, beta-sandwich, 4e-45
2imq_X282 Salivary nitrophorin; ferrous heme, beta-sandwich, 3e-32
4a2l_A795 BT_4663, two-component system sensor histidine kin 8e-05
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 9e-05
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-04
2oaj_A902 Protein SNI1; WD40 repeat, beta propeller, endocyt 3e-04
3qbt_B140 Inositol polyphosphate 5-phosphatase OCRL-1; prote 4e-04
2vdu_B450 TRNA (guanine-N(7)-)-methyltransferase- associated 9e-04
>3mtc_A Type II inositol-1,4,5-trisphosphate 5-phosphatas; INPP5BA,phosphoinositide 5-phosphatase, inositol signalling, phosphatase, magnesium; HET: PIF; 2.40A {Homo sapiens} PDB: 3n9v_A Length = 313 Back     alignment and structure
 Score =  295 bits (757), Expect = 2e-91
 Identities = 99/403 (24%), Positives = 167/403 (41%), Gaps = 93/403 (23%)

Query: 545 LYTRMENLKILAGTWNVGQGRASQDALISWLGSAASDVGIVVVGLQEVEMGAGFLAMSAA 604
           +YT ++N +  AGT+NV  G++ ++ L  WL +      +  VG QE+++          
Sbjct: 1   MYTYIQNFRFFAGTYNVN-GQSPKECLRLWLSNGIQAPDVYCVGFQELDLSKE------- 52

Query: 605 KETVGLEGSAVGHWWLDMIGKILDDGSTFERVGSRQLAGLLIAVWVRKNLKDYVGDVDVA 664
                   +     W   + + L   + + +V   +L G+++ ++V++    Y+ +V+  
Sbjct: 53  --AFFFHDTPKEEEWFKAVSEGLHPDAKYAKVKLIRLVGIMLLLYVKQEHAAYISEVEAE 110

Query: 665 AVPCGFGRAIGNKGAVGLRVRVYDRIMCFVNCHFAAHLEAVNRRNADFDHVYRTMTFCRP 724
            V  G    +GNKG V +R + ++  +C VN H AAH+E   RRN D+  +   M FC+P
Sbjct: 111 TVGTGIMGRMGNKGGVAIRFQFHNTSICVVNSHLAAHIEEYERRNQDYKDICSRMQFCQP 170

Query: 725 SNLCSAAAGTMPFLLLSCVLACSMYLLWLV---YRSGLPLVLYIAAGASSVVQMLRSTNP 781
                      P  + +        +LWL    YR                         
Sbjct: 171 DP------SLPPLTISNHD-----VILWLGDLNYR------------------------- 194

Query: 782 LSGLTVEGVPELSEADMVIFLGDFNYRLDGITYDEARDFISQRCFDWLRERDQLRAEMEA 841
           +  L VE V +L                      E +DF     +D      QL+ ++ A
Sbjct: 195 IEELDVEKVKKL---------------------IEEKDFQMLYAYD------QLKIQVAA 227

Query: 842 GNVFQGMREADIKFPPTYKFEKHLAGLAGYDSGEKKRVPAWCDRILYRDSRSDLASECSL 901
             VF+G  E ++ F PTYK++    G   +D+ EK R PAWCDRIL++          ++
Sbjct: 228 KTVFEGFTEGELTFQPTYKYDT---GSDDWDTSEKCRAPAWCDRILWKGK--------NI 276

Query: 902 ECPVASSILRYEACMDVTDSDHKPVRCIFSVDIARVDESVRRQ 944
                   L Y++ M +  SDHKPV  +F + +  V       
Sbjct: 277 TQ------LSYQSHMALKTSDHKPVSSVFDIGVRVVAHHHHHH 313
>2xsw_A 72 kDa inositol polyphosphate 5-phosphatase; inositol signalling, SGC stockholm, structural genomics CONS hydrolase; 1.90A {Homo sapiens} Length = 357 Back     alignment and structure
>1i9z_A Synaptojanin, phosphatidylinositol phosphate phosphatase; spsynaptojanin, IPP5C, IP3, IP2,, hydrolase; HET: 2IP; 1.80A {Schizosaccharomyces pombe} SCOP: d.151.1.2 PDB: 1i9y_A* Length = 347 Back     alignment and structure
>4a9c_A Phosphatidylinositol-3,4,5-trisphosphate 5-phosph; SGC, signalling, structural genomics consortium stockholm, magnesium binding, hydrolase; HET: B5F; 2.10A {Homo sapiens} PDB: 3nr8_B* Length = 316 Back     alignment and structure
>4a9c_A Phosphatidylinositol-3,4,5-trisphosphate 5-phosph; SGC, signalling, structural genomics consortium stockholm, magnesium binding, hydrolase; HET: B5F; 2.10A {Homo sapiens} PDB: 3nr8_B* Length = 316 Back     alignment and structure
>2imq_X Salivary nitrophorin; ferrous heme, beta-sandwich, transport protein; HET: HEM; 1.30A {Cimex lectularius} SCOP: d.151.1.2 PDB: 1ntf_A* 1y21_A* 1yjh_A* 1si6_X* Length = 282 Back     alignment and structure
>2imq_X Salivary nitrophorin; ferrous heme, beta-sandwich, transport protein; HET: HEM; 1.30A {Cimex lectularius} SCOP: d.151.1.2 PDB: 1ntf_A* 1y21_A* 1yjh_A* 1si6_X* Length = 282 Back     alignment and structure
>4a2l_A BT_4663, two-component system sensor histidine kinase/RESP; transcription, beta-propeller; HET: PGE PG4 MES 2PE; 2.60A {Bacteroides thetaiotaomicron} PDB: 4a2m_A* Length = 795 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>2oaj_A Protein SNI1; WD40 repeat, beta propeller, endocytosis/exocytosis complex; 2.40A {Saccharomyces cerevisiae} Length = 902 Back     alignment and structure
>3qbt_B Inositol polyphosphate 5-phosphatase OCRL-1; protein transport, vesicular trafficking, GTPase, LOWE syndr immunoglobulin fold, RAB8A, endocytosis; HET: GNP; 2.00A {Homo sapiens} Length = 140 Back     alignment and structure
>2vdu_B TRNA (guanine-N(7)-)-methyltransferase- associated WD repeat protein TRM82; S-adenosyl-L-methionine, tRNA processing, phosphorylation, M7G, spout MT, WD repeat; 2.40A {Saccharomyces cerevisiae} Length = 450 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query1149
3mtc_A313 Type II inositol-1,4,5-trisphosphate 5-phosphatas; 100.0
4a9c_A316 Phosphatidylinositol-3,4,5-trisphosphate 5-phosph; 100.0
1i9z_A347 Synaptojanin, phosphatidylinositol phosphate phosp 100.0
2xsw_A357 72 kDa inositol polyphosphate 5-phosphatase; inosi 100.0
2imq_X282 Salivary nitrophorin; ferrous heme, beta-sandwich, 100.0
1vyh_C410 Platelet-activating factor acetylhydrolase IB alph 100.0
1nr0_A611 Actin interacting protein 1; beta propeller, WD40 100.0
2ymu_A577 WD-40 repeat protein; unknown function, two domain 100.0
1nr0_A611 Actin interacting protein 1; beta propeller, WD40 100.0
4gqb_B344 Methylosome protein 50; TIM barrel, beta-propeller 100.0
4g56_B357 MGC81050 protein; protein arginine methyltransfera 100.0
3ow8_A321 WD repeat-containing protein 61; structural genomi 100.0
2ymu_A577 WD-40 repeat protein; unknown function, two domain 100.0
1erj_A393 Transcriptional repressor TUP1; beta-propeller, tr 100.0
1got_B340 GT-beta; complex (GTP-binding/transducer), G prote 100.0
2ynn_A304 Coatomer subunit beta'; protein transport, peptide 100.0
3iz6_a380 40S ribosomal protein RACK1 (RACK1); eukaryotic ri 100.0
2pbi_B354 Guanine nucleotide-binding protein subunit beta 5; 100.0
3frx_A319 Guanine nucleotide-binding protein subunit beta- l 100.0
1vyh_C410 Platelet-activating factor acetylhydrolase IB alph 100.0
4ery_A312 WD repeat-containing protein 5; WD40, WIN motif, b 100.0
2hes_X330 YDR267CP; beta-propeller, WD40 repeat, biosyntheti 100.0
3fm0_A345 Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD r 100.0
2oaj_A902 Protein SNI1; WD40 repeat, beta propeller, endocyt 100.0
3sfz_A1249 APAF-1, apoptotic peptidase activating factor 1; a 100.0
2pm9_A416 Protein WEB1, protein transport protein SEC31; bet 100.0
2xzm_R343 RACK1; ribosome, translation; 3.93A {Tetrahymena t 100.0
3vl1_A420 26S proteasome regulatory subunit RPN14; beta-prop 100.0
4aow_A340 Guanine nucleotide-binding protein subunit beta-2; 100.0
1got_B340 GT-beta; complex (GTP-binding/transducer), G prote 100.0
1pgu_A615 Actin interacting protein 1; WD repeat, seven-blad 99.98
3ow8_A321 WD repeat-containing protein 61; structural genomi 99.98
1r5m_A425 SIR4-interacting protein SIF2; transcription corep 99.98
4gqb_B344 Methylosome protein 50; TIM barrel, beta-propeller 99.97
2pm7_B297 Protein transport protein SEC13, protein transport 99.97
1p22_A435 F-BOX/WD-repeat protein 1A; ubiquitination, degrad 99.97
2ovr_B445 FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 99.97
4h5i_A365 Guanine nucleotide-exchange factor SEC12; copii ve 99.97
2pbi_B354 Guanine nucleotide-binding protein subunit beta 5; 99.97
3zwl_B369 Eukaryotic translation initiation factor 3 subuni; 99.97
4ggc_A318 P55CDC, cell division cycle protein 20 homolog; ce 99.97
3bg1_A316 Protein SEC13 homolog; NPC, transport, WD repeat, 99.97
4gga_A420 P55CDC, cell division cycle protein 20 homolog; ce 99.97
3k26_A366 Polycomb protein EED; WD40, structural genomics, N 99.97
2ynn_A304 Coatomer subunit beta'; protein transport, peptide 99.97
3dm0_A694 Maltose-binding periplasmic protein fused with RAC 99.97
2j04_B524 YDR362CP, TAU91; beta propeller, type 2 promoters, 99.97
1gxr_A337 ESG1, transducin-like enhancer protein 1; transcri 99.97
3i2n_A357 WD repeat-containing protein 92; WD40 repeats, str 99.97
4g56_B357 MGC81050 protein; protein arginine methyltransfera 99.97
3sfz_A1249 APAF-1, apoptotic peptidase activating factor 1; a 99.97
3v7d_B464 Cell division control protein 4; WD 40 domain, pho 99.97
1erj_A393 Transcriptional repressor TUP1; beta-propeller, tr 99.97
2hes_X330 YDR267CP; beta-propeller, WD40 repeat, biosyntheti 99.97
2xzm_R343 RACK1; ribosome, translation; 3.93A {Tetrahymena t 99.97
1k8k_C372 P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta- 99.97
1sq9_A397 Antiviral protein SKI8; WD repeat, beta-transducin 99.97
3odt_A313 Protein DOA1; ubiquitin, nuclear protein; HET: MSE 99.97
3v7d_B464 Cell division control protein 4; WD 40 domain, pho 99.97
3iz6_a380 40S ribosomal protein RACK1 (RACK1); eukaryotic ri 99.97
4e54_B435 DNA damage-binding protein 2; beta barrel, double 99.96
3dwl_C377 Actin-related protein 2/3 complex subunit 1; prope 99.96
3fm0_A345 Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD r 99.96
1pgu_A615 Actin interacting protein 1; WD repeat, seven-blad 99.96
2ovr_B445 FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 99.96
3ei3_B383 DNA damage-binding protein 2; UV-damage, DDB, nucl 99.96
4ery_A312 WD repeat-containing protein 5; WD40, WIN motif, b 99.96
3gre_A437 Serine/threonine-protein kinase VPS15; seven-blade 99.96
3f3f_A351 Nucleoporin SEH1; structural protein, protein comp 99.96
4a11_B408 DNA excision repair protein ERCC-8; DNA binding pr 99.96
1r5m_A425 SIR4-interacting protein SIF2; transcription corep 99.96
2oaj_A902 Protein SNI1; WD40 repeat, beta propeller, endocyt 99.96
4aez_A401 CDC20, WD repeat-containing protein SLP1; cell cyc 99.96
3frx_A319 Guanine nucleotide-binding protein subunit beta- l 99.96
3mmy_A368 MRNA export factor; mRNA export, nuclear protein; 99.96
2pm9_A416 Protein WEB1, protein transport protein SEC31; bet 99.96
3vl1_A420 26S proteasome regulatory subunit RPN14; beta-prop 99.95
3jrp_A379 Fusion protein of protein transport protein SEC13 99.95
3dw8_B447 Serine/threonine-protein phosphatase 2A 55 kDa RE 99.95
1yfq_A342 Cell cycle arrest protein BUB3; WD repeat WD40 rep 99.95
4h5i_A365 Guanine nucleotide-exchange factor SEC12; copii ve 99.95
3dm0_A694 Maltose-binding periplasmic protein fused with RAC 99.95
1p22_A435 F-BOX/WD-repeat protein 1A; ubiquitination, degrad 99.95
4aow_A340 Guanine nucleotide-binding protein subunit beta-2; 99.95
3mkq_A814 Coatomer beta'-subunit; beta-propeller, alpha-sole 99.95
4gq1_A393 NUP37; propeller, transport protein; 2.40A {Schizo 99.94
2aq5_A402 Coronin-1A; WD40 repeat, 7-bladed beta-propeller, 99.94
3k26_A366 Polycomb protein EED; WD40, structural genomics, N 99.94
2pm7_B297 Protein transport protein SEC13, protein transport 99.94
1gxr_A337 ESG1, transducin-like enhancer protein 1; transcri 99.94
2j04_B524 YDR362CP, TAU91; beta propeller, type 2 promoters, 99.94
1sq9_A397 Antiviral protein SKI8; WD repeat, beta-transducin 99.94
3bg1_A316 Protein SEC13 homolog; NPC, transport, WD repeat, 99.94
3ei3_B383 DNA damage-binding protein 2; UV-damage, DDB, nucl 99.94
3mkq_A814 Coatomer beta'-subunit; beta-propeller, alpha-sole 99.94
3dw8_B447 Serine/threonine-protein phosphatase 2A 55 kDa RE 99.94
3odt_A313 Protein DOA1; ubiquitin, nuclear protein; HET: MSE 99.94
3zwl_B369 Eukaryotic translation initiation factor 3 subuni; 99.94
3i2n_A357 WD repeat-containing protein 92; WD40 repeats, str 99.94
2w18_A356 PALB2, fancn, partner and localizer of BRCA2; fanc 99.93
1k8k_C372 P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta- 99.93
3gre_A437 Serine/threonine-protein kinase VPS15; seven-blade 99.93
4a11_B408 DNA excision repair protein ERCC-8; DNA binding pr 99.93
3jro_A753 Fusion protein of protein transport protein SEC13 99.93
3f3f_A351 Nucleoporin SEH1; structural protein, protein comp 99.93
2j04_A588 TAU60, YPL007P, hypothetical protein YPL007C; beta 99.93
1yfq_A342 Cell cycle arrest protein BUB3; WD repeat WD40 rep 99.93
4e54_B435 DNA damage-binding protein 2; beta barrel, double 99.93
2vdu_B450 TRNA (guanine-N(7)-)-methyltransferase- associated 99.93
3vu4_A355 KMHSV2; beta-propeller fold, protein transport; 2. 99.93
3dwl_C377 Actin-related protein 2/3 complex subunit 1; prope 99.92
2xyi_A430 Probable histone-binding protein CAF1; transcripti 99.92
1l0q_A391 Surface layer protein; SLP, S-layer, 7-bladed beta 99.92
4gga_A420 P55CDC, cell division cycle protein 20 homolog; ce 99.92
3mmy_A368 MRNA export factor; mRNA export, nuclear protein; 99.92
4gq1_A393 NUP37; propeller, transport protein; 2.40A {Schizo 99.92
2aq5_A402 Coronin-1A; WD40 repeat, 7-bladed beta-propeller, 99.91
4aez_A401 CDC20, WD repeat-containing protein SLP1; cell cyc 99.91
3lrv_A343 PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiqu 99.91
2vdu_B450 TRNA (guanine-N(7)-)-methyltransferase- associated 99.91
4ggc_A318 P55CDC, cell division cycle protein 20 homolog; ce 99.91
3bws_A433 Protein LP49; two-domain, immunoglobulin-like, 7-b 99.91
3jrp_A379 Fusion protein of protein transport protein SEC13 99.91
3lrv_A343 PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiqu 99.9
2j04_A588 TAU60, YPL007P, hypothetical protein YPL007C; beta 99.9
2w18_A356 PALB2, fancn, partner and localizer of BRCA2; fanc 99.89
1l0q_A391 Surface layer protein; SLP, S-layer, 7-bladed beta 99.88
3vu4_A355 KMHSV2; beta-propeller fold, protein transport; 2. 99.88
2xyi_A430 Probable histone-binding protein CAF1; transcripti 99.87
3jro_A753 Fusion protein of protein transport protein SEC13 99.86
3bws_A433 Protein LP49; two-domain, immunoglobulin-like, 7-b 99.84
1nir_A543 Nitrite reductase; hemoprotein, denitrification, d 99.83
1nir_A543 Nitrite reductase; hemoprotein, denitrification, d 99.83
2hqs_A415 Protein TOLB; TOLB, PAL, TOL, transport protein-li 99.82
2hqs_A415 Protein TOLB; TOLB, PAL, TOL, transport protein-li 99.81
3qbt_B140 Inositol polyphosphate 5-phosphatase OCRL-1; prote 99.81
3qis_A 366 Inositol polyphosphate 5-phosphatase OCRL-1; DENT 99.81
1k32_A1045 Tricorn protease; protein degradation, substrate g 99.79
3u4y_A331 Uncharacterized protein; structural genomics, PSI- 99.76
2ecf_A741 Dipeptidyl peptidase IV; prolyl oligopeptidase fam 99.75
2ojh_A297 Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 99.74
1k32_A1045 Tricorn protease; protein degradation, substrate g 99.73
1ri6_A343 Putative isomerase YBHE; 7-bladed propeller, enzym 99.73
1xfd_A723 DIP, dipeptidyl aminopeptidase-like protein 6, dip 99.72
3o4h_A582 Acylamino-acid-releasing enzyme; alpha/beta hydrol 99.72
3vgz_A353 Uncharacterized protein YNCE; beta-propeller, prot 99.71
2z3z_A706 Dipeptidyl aminopeptidase IV; peptidase family S9, 99.7
1pby_B337 Quinohemoprotein amine dehydrogenase 40 kDa subuni 99.7
2ecf_A741 Dipeptidyl peptidase IV; prolyl oligopeptidase fam 99.69
3vgz_A353 Uncharacterized protein YNCE; beta-propeller, prot 99.66
3hfq_A347 Uncharacterized protein LP_2219; Q88V64_lacpl, NES 99.64
2ojh_A297 Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 99.63
1xfd_A723 DIP, dipeptidyl aminopeptidase-like protein 6, dip 99.63
2z3z_A706 Dipeptidyl aminopeptidase IV; peptidase family S9, 99.63
1jmx_B349 Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 99.63
2oit_A434 Nucleoporin 214KDA; NH2 terminal domain of NUP214/ 99.61
1z68_A719 Fibroblast activation protein, alpha subunit; sepr 99.59
1z68_A719 Fibroblast activation protein, alpha subunit; sepr 99.59
1jmx_B349 Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 99.59
3u4y_A331 Uncharacterized protein; structural genomics, PSI- 99.59
3pe7_A388 Oligogalacturonate lyase; seven-bladed beta-propel 99.57
1q7f_A286 NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL 99.55
3scy_A361 Hypothetical bacterial 6-phosphogluconolactonase; 99.55
1pby_B337 Quinohemoprotein amine dehydrogenase 40 kDa subuni 99.55
2oit_A434 Nucleoporin 214KDA; NH2 terminal domain of NUP214/ 99.52
1ri6_A343 Putative isomerase YBHE; 7-bladed propeller, enzym 99.51
1jof_A365 Carboxy-CIS,CIS-muconate cyclase; beta-propeller, 99.49
3hfq_A347 Uncharacterized protein LP_2219; Q88V64_lacpl, NES 99.47
3fvz_A329 Peptidyl-glycine alpha-amidating monooxygenase; be 99.44
4a5s_A740 Dipeptidyl peptidase 4 soluble form; hydrolase, ty 99.42
4a5s_A740 Dipeptidyl peptidase 4 soluble form; hydrolase, ty 99.42
3o4h_A582 Acylamino-acid-releasing enzyme; alpha/beta hydrol 99.41
3scy_A361 Hypothetical bacterial 6-phosphogluconolactonase; 99.38
3azo_A662 Aminopeptidase; POP family, hydrolase; 2.00A {Stre 99.38
4gz1_A256 Tyrosyl-DNA phosphodiesterase 2; protein-DNA compl 99.35
2oiz_A361 Aromatic amine dehydrogenase, large subunit; oxido 99.34
1jof_A365 Carboxy-CIS,CIS-muconate cyclase; beta-propeller, 99.34
3c5m_A396 Oligogalacturonate lyase; blade-shaped beta-propel 99.33
2gop_A347 Trilobed protease; beta propeller, open velcro, hy 99.32
2oiz_A361 Aromatic amine dehydrogenase, large subunit; oxido 99.31
3fvz_A329 Peptidyl-glycine alpha-amidating monooxygenase; be 99.31
3e5z_A296 Putative gluconolactonase; X-RAY NESG Q9RXN3 gluco 99.3
3azo_A662 Aminopeptidase; POP family, hydrolase; 2.00A {Stre 99.25
2dg1_A333 DRP35, lactonase; beta propeller, hydrolase; 1.72A 99.23
1q7f_A286 NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL 99.23
4fva_A256 5'-tyrosyl-DNA phosphodiesterase; 5'-phosphotyrosy 99.22
2gop_A347 Trilobed protease; beta propeller, open velcro, hy 99.19
4f1h_A250 Tyrosyl-DNA phosphodiesterase 2; hydrolase-DNA com 99.18
2bkl_A695 Prolyl endopeptidase; mechanistic study, celiac sp 99.16
2xdw_A710 Prolyl endopeptidase; alpha/beta-hydrolase, amnesi 99.15
1pjx_A314 Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotries 99.12
3pe7_A388 Oligogalacturonate lyase; seven-bladed beta-propel 99.12
3teb_A266 Endonuclease/exonuclease/phosphatase; PSI-biology, 99.11
4gew_A362 5'-tyrosyl-DNA phosphodiesterase; 5'-phosphotyrosy 99.11
2dg1_A333 DRP35, lactonase; beta propeller, hydrolase; 1.72A 99.1
1ako_A268 Exonuclease III; AP-endonuclease, DNA repair; 1.70 99.09
1rwi_B270 Serine/threonine-protein kinase PKND; beta propell 99.07
3no2_A276 Uncharacterized protein; six-bladed beta-propeller 99.06
3dsm_A328 Uncharacterized protein bacuni_02894; seven_blated 99.05
3e5z_A296 Putative gluconolactonase; X-RAY NESG Q9RXN3 gluco 99.04
2z2n_A299 Virginiamycin B lyase; seven-bladed beta-propeller 99.01
3q7m_A376 Lipoprotein YFGL, BAMB; beta-propeller, BAM comple 99.01
3dsm_A328 Uncharacterized protein bacuni_02894; seven_blated 99.01
2bkl_A695 Prolyl endopeptidase; mechanistic study, celiac sp 99.01
3no2_A276 Uncharacterized protein; six-bladed beta-propeller 98.91
1yr2_A741 Prolyl oligopeptidase; prolyl endopeptidase, mecha 98.91
3c5m_A396 Oligogalacturonate lyase; blade-shaped beta-propel 98.89
2xdw_A710 Prolyl endopeptidase; alpha/beta-hydrolase, amnesi 98.88
3hxj_A330 Pyrrolo-quinoline quinone; all beta protein. incom 98.87
1zwx_A301 SMCL, sphingomyelinase-C; dnase1-like fold, beta-h 98.86
3i41_A317 Beta-hemolysin; beta toxin, sphingomyelinase, toxi 98.84
1qks_A567 Cytochrome CD1 nitrite reductase; enzyme, oxidored 98.82
2qc5_A300 Streptogramin B lactonase; beta propeller, lyase; 98.82
1rwi_B270 Serine/threonine-protein kinase PKND; beta propell 98.81
3g6s_A267 Putative endonuclease/exonuclease/phosphatase fami 98.79
1qks_A567 Cytochrome CD1 nitrite reductase; enzyme, oxidored 98.78
2z2n_A299 Virginiamycin B lyase; seven-bladed beta-propeller 98.77
3hrp_A409 Uncharacterized protein; NP_812590.1, structural g 98.77
3dr2_A305 Exported gluconolactonase; gluconolactonase SMP-30 98.77
3l1w_A257 Uncharacterized protein; APC29019.2, conserved pro 98.75
3mpr_A298 Putative endonuclease/exonuclease/phosphatase FAM 98.74
2qe8_A343 Uncharacterized protein; structural genomics, join 98.72
3g4e_A297 Regucalcin; six bladed beta-propeller, gluconolcat 98.71
2hz6_A369 Endoplasmic reticulum to nucleus signalling 1 isof 98.71
3iuj_A693 Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas 98.7
2ghs_A326 AGR_C_1268P; regucalcin, structural genomics, join 98.68
2ddr_A306 Sphingomyelin phosphodiesterase; DNAse I like fold 98.67
1yr2_A741 Prolyl oligopeptidase; prolyl endopeptidase, mecha 98.66
2jc4_A256 Exodeoxyribonuclease III; hydrolase, repair phosph 98.61
1pjx_A314 Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotries 98.59
3sjl_D386 Methylamine dehydrogenase heavy chain; MAUG, C-hem 98.59
1xip_A388 Nucleoporin NUP159; beta-propeller, transport prot 98.56
3q7m_A376 Lipoprotein YFGL, BAMB; beta-propeller, BAM comple 98.54
2mad_H373 Methylamine dehydrogenase (heavy subunit); oxidore 98.48
2qc5_A300 Streptogramin B lactonase; beta propeller, lyase; 98.45
4a2l_A795 BT_4663, two-component system sensor histidine kin 98.45
2jc5_A259 Exodeoxyribonuclease; hydrolase, repair phosphodie 98.45
1yiq_A689 Quinohemoprotein alcohol dehydrogenase; electron t 98.44
4a2l_A795 BT_4663, two-component system sensor histidine kin 98.42
2j63_A467 AP-endonuclease; base excision repair, lyase; 2.48 98.42
3g4e_A297 Regucalcin; six bladed beta-propeller, gluconolcat 98.42
2o3h_A285 DNA-(apurinic or apyrimidinic site) lyase; APE, en 98.39
2mad_H373 Methylamine dehydrogenase (heavy subunit); oxidore 98.39
1vyb_A238 ORF2 contains A reverse transcriptase domain; endo 98.39
3hxj_A330 Pyrrolo-quinoline quinone; all beta protein. incom 98.38
1xip_A388 Nucleoporin NUP159; beta-propeller, transport prot 98.33
2voa_A257 AF_EXO, XTHA, exodeoxyribonuclease III; EXOIII, AP 98.32
1kb0_A677 Quinohemoprotein alcohol dehydrogenase; beta-prope 98.31
1wdu_A245 TRAS1 ORF2P; four-layered alpha/beta sandwich, RNA 98.31
3dr2_A305 Exported gluconolactonase; gluconolactonase SMP-30 98.31
3hrp_A409 Uncharacterized protein; NP_812590.1, structural g 98.29
2hz6_A369 Endoplasmic reticulum to nucleus signalling 1 isof 98.28
2ghs_A326 AGR_C_1268P; regucalcin, structural genomics, join 98.27
3sjl_D386 Methylamine dehydrogenase heavy chain; MAUG, C-hem 98.26
1hd7_A318 DNA-(apurinic or apyrimidinic site) lyase; DNA rep 98.26
3v9f_A781 Two-component system sensor histidine kinase/RESP 98.22
3v9f_A781 Two-component system sensor histidine kinase/RESP 98.18
1yiq_A689 Quinohemoprotein alcohol dehydrogenase; electron t 98.15
3c75_H426 MADH, methylamine dehydrogenase heavy chain; coppe 98.13
3iuj_A693 Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas 98.1
2fp8_A322 Strictosidine synthase; six bladed beta propeller 98.09
3g91_A265 MTH0212, exodeoxyribonuclease; double-strand speci 98.09
3c75_H426 MADH, methylamine dehydrogenase heavy chain; coppe 98.08
1mda_H368 Methylamine dehydrogenase (heavy subunit); electro 98.05
1kb0_A677 Quinohemoprotein alcohol dehydrogenase; beta-prope 97.92
2qe8_A343 Uncharacterized protein; structural genomics, join 97.86
1mda_H368 Methylamine dehydrogenase (heavy subunit); electro 97.8
1kv9_A668 Type II quinohemoprotein alcohol dehydrogenase; el 97.6
2ei9_A240 Non-LTR retrotransposon R1BMKS ORF2 protein; four 97.49
1npe_A267 Nidogen, entactin; glycoprotein, basement membrane 97.46
1kv9_A668 Type II quinohemoprotein alcohol dehydrogenase; el 97.36
1npe_A267 Nidogen, entactin; glycoprotein, basement membrane 97.28
1w6s_A599 Methanol dehydrogenase subunit 1; anisotropic, ele 97.25
3ngq_A398 CCR4-NOT transcription complex subunit 6-like; alp 97.17
4b8c_D727 Glucose-repressible alcohol dehydrogenase transcr 97.11
2iwa_A266 Glutamine cyclotransferase; pyroglutamate, acyltra 97.04
2ad6_A571 Methanol dehydrogenase subunit 1; PQQ configuratio 97.03
2a40_B260 Deoxyribonuclease-1; WAVE, WH2, WAsp, actin, DNAse 97.02
2fp8_A322 Strictosidine synthase; six bladed beta propeller 96.91
3nol_A262 Glutamine cyclotransferase; beta-propeller, glutam 96.91
2e6j_A112 Hydin protein; PAPD, structural genomics, NPPSFA, 96.87
1flg_A582 Protein (quinoprotein ethanol dehydrogenase); supe 96.85
2ys4_A122 Hydrocephalus-inducing protein homolog; hydin, PAP 96.84
3ott_A758 Two-component system sensor histidine kinase; beta 96.82
3nol_A262 Glutamine cyclotransferase; beta-propeller, glutam 96.67
2ece_A462 462AA long hypothetical selenium-binding protein; 96.53
3mbr_X243 Glutamine cyclotransferase; beta-propeller; 1.44A 96.48
1flg_A582 Protein (quinoprotein ethanol dehydrogenase); supe 96.47
3v65_B386 Low-density lipoprotein receptor-related protein; 96.41
2p4o_A306 Hypothetical protein; putative lactonase, structur 96.29
2ad6_A571 Methanol dehydrogenase subunit 1; PQQ configuratio 96.23
3sov_A318 LRP-6, low-density lipoprotein receptor-related pr 96.21
2xe4_A751 Oligopeptidase B; hydrolase-inhibitor complex, hyd 96.11
2iwa_A266 Glutamine cyclotransferase; pyroglutamate, acyltra 95.93
1w6s_A599 Methanol dehydrogenase subunit 1; anisotropic, ele 95.92
1k3i_A656 Galactose oxidase precursor; blade beta propeller, 95.89
1k3i_A656 Galactose oxidase precursor; blade beta propeller, 95.85
3nok_A268 Glutaminyl cyclase; beta-propeller, cyclotransfera 95.81
2xbg_A327 YCF48-like protein; photosynthesis, photosystem II 95.7
1msp_A126 MSP, major sperm protein; cytoskeletal protein, ce 95.62
3ott_A758 Two-component system sensor histidine kinase; beta 95.58
3v64_C349 Agrin; beta propeller, laminin-G, signaling, prote 95.57
1fwx_A595 Nitrous oxide reductase; beta-propeller domain, cu 95.47
1m1s_A116 WR4; structural genomics, major sperm protein, bio 95.26
1row_A109 SSP-19, MSP-domain protein like family member; bet 95.26
3mbr_X243 Glutamine cyclotransferase; beta-propeller; 1.44A 95.06
3m0c_C791 LDL receptor, low-density lipoprotein receptor; pr 94.9
1ijq_A316 LDL receptor, low-density lipoprotein receptor; be 94.8
3nok_A268 Glutaminyl cyclase; beta-propeller, cyclotransfera 94.73
3p5b_L400 Low density lipoprotein receptor variant; B-propel 94.71
2ece_A462 462AA long hypothetical selenium-binding protein; 94.54
1z9l_A128 Vesicle-associated membrane protein-associated pro 94.53
1sr4_B261 CDT B, cytolethal distending toxin protein B; bact 94.5
3tc9_A430 Hypothetical hydrolase; 6-bladed beta-propeller, i 94.38
2cri_A147 Vesicle-associated membrane protein-associated pro 94.3
1wic_A152 Hypothetical protein riken cDNA 6030424E15; beta s 93.9
3v65_B386 Low-density lipoprotein receptor-related protein; 93.35
2p4o_A306 Hypothetical protein; putative lactonase, structur 93.3
2xbg_A327 YCF48-like protein; photosynthesis, photosystem II 93.28
3p5b_L400 Low density lipoprotein receptor variant; B-propel 92.88
4hw6_A433 Hypothetical protein, IPT/TIG domain protein; puta 92.35
2f1n_A262 CDT B, cytolethal distending toxin subunit B; E.co 92.18
3v64_C349 Agrin; beta propeller, laminin-G, signaling, prote 92.01
1ijq_A316 LDL receptor, low-density lipoprotein receptor; be 91.4
4a0p_A628 LRP6, LRP-6, low-density lipoprotein receptor-rela 90.26
3m0c_C791 LDL receptor, low-density lipoprotein receptor; pr 89.37
1fwx_A595 Nitrous oxide reductase; beta-propeller domain, cu 89.17
2qsv_A220 Uncharacterized protein; MCSG, structural genomics 87.97
3sov_A318 LRP-6, low-density lipoprotein receptor-related pr 87.75
1n7d_A699 LDL receptor, low-density lipoprotein receptor; fa 83.65
1n7d_A699 LDL receptor, low-density lipoprotein receptor; fa 82.21
2xe4_A751 Oligopeptidase B; hydrolase-inhibitor complex, hyd 81.16
>3mtc_A Type II inositol-1,4,5-trisphosphate 5-phosphatas; INPP5BA,phosphoinositide 5-phosphatase, inositol signalling, phosphatase, magnesium; HET: PIF; 2.40A {Homo sapiens} PDB: 3n9v_A Back     alignment and structure
Probab=100.00  E-value=4.2e-87  Score=748.46  Aligned_cols=306  Identities=31%  Similarity=0.659  Sum_probs=276.6

Q ss_pred             eeeeeceEEEEEEEEeCCCCCCchhhcccccCCCCCcceEEEEeeccccccchhhhhhhhhhccCCCCcchhhHHHHHhc
Q 001123          546 YTRMENLKILAGTWNVGQGRASQDALISWLGSAASDVGIVVVGLQEVEMGAGFLAMSAAKETVGLEGSAVGHWWLDMIGK  625 (1149)
Q Consensus       546 yt~~~~~~i~v~TWNv~~~~~~~~~l~~wl~~~~~~~Di~viGlQEi~~~~~~~~~~~~ke~~~~~~~~~~~~W~~~i~~  625 (1149)
                      ||..++++|+++|||||+..| .++|.+||.....+||||||||||++++++++..         .+++..+.|.+.|.+
T Consensus         2 yt~~~~~~i~v~TwNvng~~~-~~~l~~wL~~~~~~pDI~viGlQE~~l~~~~~~~---------~~~~~~~~W~~~i~~   71 (313)
T 3mtc_A            2 YTYIQNFRFFAGTYNVNGQSP-KECLRLWLSNGIQAPDVYCVGFQELDLSKEAFFF---------HDTPKEEEWFKAVSE   71 (313)
T ss_dssp             CEEEEEEEEEEEEEECTTCCC-CSCTHHHHSSSCCCCSEEEEEEECSCCSHHHHTT---------CCCHHHHHHHHHHHH
T ss_pred             CceeeccEEEEEEEEcCCccC-chhHHHHhcccCCCCCeEEEEEEecccchhhhcc---------cCcchHHHHHHHHHH
Confidence            899999999999999998876 5789999997667899999999999987654322         234456789999999


Q ss_pred             ccCCCCcEEEEeeeccceeeeeeeeeccccCccceeEeeeEeecccccccCcceeEEEEEEeceEEEEeeecccccchhH
Q 001123          626 ILDDGSTFERVGSRQLAGLLIAVWVRKNLKDYVGDVDVAAVPCGFGRAIGNKGAVGLRVRVYDRIMCFVNCHFAAHLEAV  705 (1149)
Q Consensus       626 ~L~~~~~y~~v~s~qL~Gl~l~vfvr~~l~~~i~~v~~~~v~tG~~g~~gNKGaV~ir~~~~~t~lcFVn~HLaA~~~~~  705 (1149)
                      +|+.+.+|++|++.||+||+|+||||+++.++|++|++++|+||+||+|||||||+|||.+++|+|||||||||||++++
T Consensus        72 ~L~~~~~Y~~v~s~~lvGl~l~Vfvr~~~~~~i~~v~~~~v~tG~~g~~GNKGaV~ir~~~~~ts~cFVnsHLaA~~~~~  151 (313)
T 3mtc_A           72 GLHPDAKYAKVKLIRLVGIMLLLYVKQEHAAYISEVEAETVGTGIMGRMGNKGGVAIRFQFHNTSICVVNSHLAAHIEEY  151 (313)
T ss_dssp             HSCTTSCEEEEEEEEETTEEEEEEEEGGGGGGEEEEEEEEEECSGGGTSTTSEEEEEEEEETTEEEEEEEEECCCSGGGH
T ss_pred             hcCCCCCEEEEEEechhhhhhhhhhhhhhhhhcceeEeeeecccccccccCCceEEEEEEECCcEEEEEeeccCCCchHH
Confidence            99887899999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHHHHHHHhcccCCCCCccccccCCCchhhhhhhhhhhhhhhhhhhccCCchhhhhhccccchhhhcccCCCCCCC
Q 001123          706 NRRNADFDHVYRTMTFCRPSNLCSAAAGTMPFLLLSCVLACSMYLLWLVYRSGLPLVLYIAAGASSVVQMLRSTNPLSGL  785 (1149)
Q Consensus       706 ~~Rn~d~~~I~~~l~F~~~~~~~~~~~~~~~~~~~s~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  785 (1149)
                      ++||+||.+|++++.|.+.....                                                         
T Consensus       152 ~~Rn~d~~~I~~~l~f~~~~~~~---------------------------------------------------------  174 (313)
T 3mtc_A          152 ERRNQDYKDICSRMQFCQPDPSL---------------------------------------------------------  174 (313)
T ss_dssp             HHHHHHHHHHHHHCCBCCSCSSS---------------------------------------------------------
T ss_pred             HHHHHHHHHHHHhcccCCCCCcc---------------------------------------------------------
Confidence            99999999999999997532110                                                         


Q ss_pred             cccCCCcccCccEEEEECccCCCCCCCChHHHHHHHhhcChHHHHHhhHHHHHhHcCCcCCCCccCCcccCCCccccccc
Q 001123          786 TVEGVPELSEADMVIFLGDFNYRLDGITYDEARDFISQRCFDWLRERDQLRAEMEAGNVFQGMREADIKFPPTYKFEKHL  865 (1149)
Q Consensus       786 ~~~~~~~i~~~D~vfw~GDlNyRi~~~~~~~v~~~i~~~~~~~Ll~~DQL~~~~~~g~~f~gf~E~~I~F~PTYKyd~~~  865 (1149)
                         ....|.+||+|||||||||||+++++++++++|++++|+.|+++|||++||++|++|.||+|++|+|||||||++| 
T Consensus       175 ---~~~~i~~~d~vfw~GDLNyRi~~~~~~~v~~~i~~~~~~~Ll~~DQL~~~~~~g~~f~gf~E~~I~F~PTYKyd~~-  250 (313)
T 3mtc_A          175 ---PPLTISNHDVILWLGDLNYRIEELDVEKVKKLIEEKDFQMLYAYDQLKIQVAAKTVFEGFTEGELTFQPTYKYDTG-  250 (313)
T ss_dssp             ---CCBCTTSSSEEEEEEECCCCBCSSCHHHHHHHHHTTCHHHHHTTBHHHHHHHTTSSCTTCBCCCCCSCCCBCBCTT-
T ss_pred             ---CCccccCCceEEEeccccccccCCCHHHHHHHHhcCCHHHHHHhHHHHHHHHcCCccCCcccCCcCcCCCccCcCC-
Confidence               0023578999999999999998779999999999999999999999999999999999999999999999999985 


Q ss_pred             cCCccccCCCCccccccccceeeecCCCccccccccCCCcccceeeeeeecccccCCCCceeeEEEEEccccC
Q 001123          866 AGLAGYDSGEKKRVPAWCDRILYRDSRSDLASECSLECPVASSILRYEACMDVTDSDHKPVRCIFSVDIARVD  938 (1149)
Q Consensus       866 ~g~~~yDts~k~R~PsWcDRIL~~~~~~~~~~~~~~~~p~~~~~~~Y~s~~~~~~SDHkPV~a~f~v~v~~vd  938 (1149)
                        ++.||||+|+|+|||||||||++..              .+++.|.|++++++||||||+|.|.+++++|-
T Consensus       251 --s~~ydts~k~R~PsWcDRIL~~~~~--------------i~~~~Y~s~~~~~~SDHrPV~a~f~~~~~~~~  307 (313)
T 3mtc_A          251 --SDDWDTSEKCRAPAWCDRILWKGKN--------------ITQLSYQSHMALKTSDHKPVSSVFDIGVRVVA  307 (313)
T ss_dssp             --SSSBCCSTTCCCCBCCEEEEEEESS--------------EEEEEEEECTTCCSSSSCCEEEEEEEEEEEEC
T ss_pred             --CcccccccCEecccccceEEEecCC--------------eEEEeeeeccCccCCCccCeEEEEEEEEEEee
Confidence              4689999999999999999999753              14689999999999999999999999998763
>4a9c_A Phosphatidylinositol-3,4,5-trisphosphate 5-phosph; SGC, signalling, structural genomics consortium stockholm, magnesium binding, hydrolase; HET: B5F; 2.10A {Homo sapiens} PDB: 3nr8_B* Back     alignment and structure
>1i9z_A Synaptojanin, phosphatidylinositol phosphate phosphatase; spsynaptojanin, IPP5C, IP3, IP2,, hydrolase; HET: 2IP; 1.80A {Schizosaccharomyces pombe} SCOP: d.151.1.2 PDB: 1i9y_A* Back     alignment and structure
>2xsw_A 72 kDa inositol polyphosphate 5-phosphatase; inositol signalling, SGC stockholm, structural genomics CONS hydrolase; 1.90A {Homo sapiens} Back     alignment and structure
>2imq_X Salivary nitrophorin; ferrous heme, beta-sandwich, transport protein; HET: HEM; 1.30A {Cimex lectularius} SCOP: d.151.1.2 PDB: 1ntf_A* 1y21_A* 1yjh_A* 1si6_X* Back     alignment and structure
>1vyh_C Platelet-activating factor acetylhydrolase IB alpha subunit; lissencephaly, platelet activacting factor, regulator of cytoplasmic dynein; 3.4A {Mus musculus} SCOP: b.69.4.1 Back     alignment and structure
>1nr0_A Actin interacting protein 1; beta propeller, WD40 repeat, ADF, cofilin, structural genomics, PSI, protein structure initiative; 1.70A {Caenorhabditis elegans} SCOP: b.69.4.1 b.69.4.1 PDB: 1pev_A Back     alignment and structure
>2ymu_A WD-40 repeat protein; unknown function, two domains; 1.79A {Nostoc punctiforme} Back     alignment and structure
>1nr0_A Actin interacting protein 1; beta propeller, WD40 repeat, ADF, cofilin, structural genomics, PSI, protein structure initiative; 1.70A {Caenorhabditis elegans} SCOP: b.69.4.1 b.69.4.1 PDB: 1pev_A Back     alignment and structure
>4gqb_B Methylosome protein 50; TIM barrel, beta-propeller, methyltransferase, methylation, transferase-protein binding complex; HET: 0XU; 2.06A {Homo sapiens} Back     alignment and structure
>4g56_B MGC81050 protein; protein arginine methyltransferase, protein complexes, histo methylation, transferase; HET: SAH; 2.95A {Xenopus laevis} Back     alignment and structure
>3ow8_A WD repeat-containing protein 61; structural genomics consortium, SGC, transcriptio; 2.30A {Homo sapiens} Back     alignment and structure
>2ymu_A WD-40 repeat protein; unknown function, two domains; 1.79A {Nostoc punctiforme} Back     alignment and structure
>1erj_A Transcriptional repressor TUP1; beta-propeller, transcription inhibitor; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 Back     alignment and structure
>1got_B GT-beta; complex (GTP-binding/transducer), G protein, heterotrimer signal transduction; HET: GDP; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1b9y_A 1b9x_A* 2trc_B 1tbg_A 1gg2_B* 1omw_B 1gp2_B 1xhm_A 2qns_A 3ah8_B* 3cik_B 3kj5_A 3krw_B* 3krx_B* 3psc_B 3pvu_B* 3pvw_B* 1a0r_B* 2bcj_B* 3sn6_B* Back     alignment and structure
>2ynn_A Coatomer subunit beta'; protein transport, peptide binding protein, membrane traffic COPI-mediated trafficking, dilysine motifs; 1.78A {Saccharomyces cerevisiae} PDB: 2yno_A Back     alignment and structure
>3iz6_a 40S ribosomal protein RACK1 (RACK1); eukaryotic ribosome,homology modeling,de novo modeling,ribos proteins,novel ribosomal proteins, ribosome; 5.50A {Triticum aestivum} Back     alignment and structure
>2pbi_B Guanine nucleotide-binding protein subunit beta 5; helix WRAP, RGS domain, DEP domain, DHEX domain, GGL domain, propeller, signaling protein; 1.95A {Mus musculus} Back     alignment and structure
>3frx_A Guanine nucleotide-binding protein subunit beta- like protein; RACK1, WD40, beta propeller, ribosome, translation, acetylation; 2.13A {Saccharomyces cerevisiae} PDB: 3izb_a 3o2z_T 3o30_T 3u5c_g 3u5g_g 3rfg_A 3rfh_A 1trj_A 3jyv_R* Back     alignment and structure
>1vyh_C Platelet-activating factor acetylhydrolase IB alpha subunit; lissencephaly, platelet activacting factor, regulator of cytoplasmic dynein; 3.4A {Mus musculus} SCOP: b.69.4.1 Back     alignment and structure
>4ery_A WD repeat-containing protein 5; WD40, WIN motif, beta propeller, 3-10 helix, lysine methyltransferase, RBBP5, ASH2L, core complex; 1.30A {Homo sapiens} PDB: 2h6k_A* 2h68_A* 2h6q_A* 3eg6_A 4erq_A 2h6n_A 4erz_A 4es0_A 4esg_A 4ewr_A 2gnq_A 2xl2_A 2xl3_A 3uvk_A* 3psl_A* 3uvl_A 3uvm_A 3uvn_A 3uvo_A 2h14_A ... Back     alignment and structure
>2hes_X YDR267CP; beta-propeller, WD40 repeat, biosynthetic protein; 1.70A {Saccharomyces cerevisiae} Back     alignment and structure
>3fm0_A Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD repeat, biosynthetic prote structural genomics, structural genomics consortium; 1.70A {Homo sapiens} Back     alignment and structure
>2oaj_A Protein SNI1; WD40 repeat, beta propeller, endocytosis/exocytosis complex; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* Back     alignment and structure
>2pm9_A Protein WEB1, protein transport protein SEC31; beta propeller; 3.30A {Saccharomyces cerevisiae} Back     alignment and structure
>2xzm_R RACK1; ribosome, translation; 3.93A {Tetrahymena thermophila} PDB: 2xzn_R Back     alignment and structure
>3vl1_A 26S proteasome regulatory subunit RPN14; beta-propeller, chaperone, RPT6; 1.60A {Saccharomyces cerevisiae} PDB: 3acp_A Back     alignment and structure
>4aow_A Guanine nucleotide-binding protein subunit beta-2; receptor, WD-repeat, beta-propeller; 2.45A {Homo sapiens} PDB: 2zkq_a Back     alignment and structure
>1got_B GT-beta; complex (GTP-binding/transducer), G protein, heterotrimer signal transduction; HET: GDP; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1b9y_A 1b9x_A* 2trc_B 1tbg_A 1gg2_B* 1omw_B 1gp2_B 1xhm_A 2qns_A 3ah8_B* 3cik_B 3kj5_A 3krw_B* 3krx_B* 3psc_B 3pvu_B* 3pvw_B* 1a0r_B* 2bcj_B* 3sn6_B* Back     alignment and structure
>1pgu_A Actin interacting protein 1; WD repeat, seven-bladed beta-propeller, protein binding; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 b.69.4.1 PDB: 1pi6_A Back     alignment and structure
>3ow8_A WD repeat-containing protein 61; structural genomics consortium, SGC, transcriptio; 2.30A {Homo sapiens} Back     alignment and structure
>1r5m_A SIR4-interacting protein SIF2; transcription corepressor, WD40 repeat, beta propeller; 1.55A {Saccharomyces cerevisiae} Back     alignment and structure
>4gqb_B Methylosome protein 50; TIM barrel, beta-propeller, methyltransferase, methylation, transferase-protein binding complex; HET: 0XU; 2.06A {Homo sapiens} Back     alignment and structure
>2pm7_B Protein transport protein SEC13, protein transport protein SEC31; beta propeller, alpha solenoid; 2.35A {Saccharomyces cerevisiae} PDB: 2pm9_B 2pm6_B 3iko_A 3mzk_A 3mzl_A Back     alignment and structure
>1p22_A F-BOX/WD-repeat protein 1A; ubiquitination, degradation, signaling protein; HET: SEP; 2.95A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 Back     alignment and structure
>2ovr_B FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 domains, double phosphorylation, transcription-C complex; HET: TPO; 2.50A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 PDB: 2ovp_B* 2ovq_B* Back     alignment and structure
>4h5i_A Guanine nucleotide-exchange factor SEC12; copii vesicle budding, potassium binding site, beta propelle protein transport; 1.36A {Saccharomyces cerevisiae} PDB: 4h5j_A Back     alignment and structure
>2pbi_B Guanine nucleotide-binding protein subunit beta 5; helix WRAP, RGS domain, DEP domain, DHEX domain, GGL domain, propeller, signaling protein; 1.95A {Mus musculus} Back     alignment and structure
>3zwl_B Eukaryotic translation initiation factor 3 subuni; 2.20A {Saccharomyces cerevisiae} Back     alignment and structure
>4ggc_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; HET: MRD; 1.35A {Homo sapiens} Back     alignment and structure
>3bg1_A Protein SEC13 homolog; NPC, transport, WD repeat, autocatalytic cleavage, mRNA transport, nuclear pore complex, nucleus, phosphoprotein; 3.00A {Homo sapiens} PDB: 3bg0_A Back     alignment and structure
>4gga_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; 2.04A {Homo sapiens} PDB: 4ggd_A Back     alignment and structure
>3k26_A Polycomb protein EED; WD40, structural genomics, NPPSFA, national project on prote structural and functional analysis, structural genomics CON SGC; HET: M3L; 1.58A {Homo sapiens} PDB: 3jzn_A* 3k27_A* 3jpx_A* 3jzg_A* 3jzh_A* 3iiw_A* 3ijc_A* 3iiy_A* 3ij0_A* 3ij1_A* 2qxv_A Back     alignment and structure
>2ynn_A Coatomer subunit beta'; protein transport, peptide binding protein, membrane traffic COPI-mediated trafficking, dilysine motifs; 1.78A {Saccharomyces cerevisiae} PDB: 2yno_A Back     alignment and structure
>3dm0_A Maltose-binding periplasmic protein fused with RACK1; MBP RACK1A, receptor for activiated protein C-kinase 1, beta-propeller WD40 repeat; HET: GLC; 2.40A {Escherichia coli} Back     alignment and structure
>2j04_B YDR362CP, TAU91; beta propeller, type 2 promoters, transcription, hypothetica protein, preinitiation complex, yeast RNA polymerase III; 3.2A {Saccharomyces cerevisiae} Back     alignment and structure
>1gxr_A ESG1, transducin-like enhancer protein 1; transcriptional CO-repressor, WD40, transcription repressor, WD repeat; 1.65A {Homo sapiens} SCOP: b.69.4.1 PDB: 2ce8_A 2ce9_A Back     alignment and structure
>3i2n_A WD repeat-containing protein 92; WD40 repeats, structural genomics, structural genomic consortium, SGC, apoptosis, transcription; 1.95A {Homo sapiens} Back     alignment and structure
>4g56_B MGC81050 protein; protein arginine methyltransferase, protein complexes, histo methylation, transferase; HET: SAH; 2.95A {Xenopus laevis} Back     alignment and structure
>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* Back     alignment and structure
>3v7d_B Cell division control protein 4; WD 40 domain, phospho-peptide complex, E3 ubiquitin ligase, cell cycle, phospho binding protein, phosphorylation; HET: SEP; 2.31A {Saccharomyces cerevisiae} PDB: 1nex_B* 3mks_B* Back     alignment and structure
>1erj_A Transcriptional repressor TUP1; beta-propeller, transcription inhibitor; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 Back     alignment and structure
>2hes_X YDR267CP; beta-propeller, WD40 repeat, biosynthetic protein; 1.70A {Saccharomyces cerevisiae} Back     alignment and structure
>2xzm_R RACK1; ribosome, translation; 3.93A {Tetrahymena thermophila} PDB: 2xzn_R Back     alignment and structure
>1k8k_C P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta-propeller, structural protein; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1tyq_C* 1u2v_C* 2p9i_C* 2p9k_C* 2p9l_C 2p9n_C* 2p9p_C* 2p9s_C* 2p9u_C* 3rse_C 3dxm_C* 3dxk_C Back     alignment and structure
>1sq9_A Antiviral protein SKI8; WD repeat, beta-transducin repeat, WD40 repeat, beta propeller, recombination; 1.90A {Saccharomyces cerevisiae} SCOP: b.69.4.1 PDB: 1s4u_X Back     alignment and structure
>3odt_A Protein DOA1; ubiquitin, nuclear protein; HET: MSE MES; 1.35A {Saccharomyces cerevisiae} Back     alignment and structure
>3v7d_B Cell division control protein 4; WD 40 domain, phospho-peptide complex, E3 ubiquitin ligase, cell cycle, phospho binding protein, phosphorylation; HET: SEP; 2.31A {Saccharomyces cerevisiae} PDB: 1nex_B* 3mks_B* Back     alignment and structure
>3iz6_a 40S ribosomal protein RACK1 (RACK1); eukaryotic ribosome,homology modeling,de novo modeling,ribos proteins,novel ribosomal proteins, ribosome; 5.50A {Triticum aestivum} Back     alignment and structure
>4e54_B DNA damage-binding protein 2; beta barrel, double helix, DDB1:WD40 beta-barrel fold, DNA D DNA repair, HOST-virus interactions; HET: DNA 3DR; 2.85A {Homo sapiens} PDB: 3ei4_B* Back     alignment and structure
>3dwl_C Actin-related protein 2/3 complex subunit 1; propellor, actin-binding, ATP-binding, cytoskeleton, nucleot binding, WD repeat; HET: ATP; 3.78A {Schizosaccharomyces pombe} Back     alignment and structure
>3fm0_A Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD repeat, biosynthetic prote structural genomics, structural genomics consortium; 1.70A {Homo sapiens} Back     alignment and structure
>1pgu_A Actin interacting protein 1; WD repeat, seven-bladed beta-propeller, protein binding; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 b.69.4.1 PDB: 1pi6_A Back     alignment and structure
>2ovr_B FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 domains, double phosphorylation, transcription-C complex; HET: TPO; 2.50A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 PDB: 2ovp_B* 2ovq_B* Back     alignment and structure
>3ei3_B DNA damage-binding protein 2; UV-damage, DDB, nucleotide excision repair, xeroderma pigmentosum, cytoplasm, DNA repair; HET: DNA PG4; 2.30A {Danio rerio} PDB: 3ei1_B* 3ei2_B* 4a08_B* 4a09_B* 4a0a_B* 4a0b_B* 4a0k_D* 4a0l_B* Back     alignment and structure
>4ery_A WD repeat-containing protein 5; WD40, WIN motif, beta propeller, 3-10 helix, lysine methyltransferase, RBBP5, ASH2L, core complex; 1.30A {Homo sapiens} PDB: 2h6k_A* 2h68_A* 2h6q_A* 3eg6_A 4erq_A 2h6n_A 4erz_A 4es0_A 4esg_A 4ewr_A 2gnq_A 2xl2_A 2xl3_A 3uvk_A* 3psl_A* 3uvl_A 3uvm_A 3uvn_A 3uvo_A 2h14_A ... Back     alignment and structure
>3gre_A Serine/threonine-protein kinase VPS15; seven-bladed propeller, WD repeat, scaffold protein, ATP- binding, endosome, golgi apparatus; 1.80A {Saccharomyces cerevisiae} Back     alignment and structure
>3f3f_A Nucleoporin SEH1; structural protein, protein complex, nucleopori complex, nuclear pore complex, macromolecular assembly, MEM coat; 2.90A {Saccharomyces cerevisiae} PDB: 3f3g_A 3f3p_A 3ewe_A Back     alignment and structure
>4a11_B DNA excision repair protein ERCC-8; DNA binding protein, DNA damage repair; HET: DNA; 3.31A {Homo sapiens} Back     alignment and structure
>1r5m_A SIR4-interacting protein SIF2; transcription corepressor, WD40 repeat, beta propeller; 1.55A {Saccharomyces cerevisiae} Back     alignment and structure
>2oaj_A Protein SNI1; WD40 repeat, beta propeller, endocytosis/exocytosis complex; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4aez_A CDC20, WD repeat-containing protein SLP1; cell cycle, KEN-BOX, D-BOX, APC/C; 2.30A {Schizosaccharomyces pombe} Back     alignment and structure
>3frx_A Guanine nucleotide-binding protein subunit beta- like protein; RACK1, WD40, beta propeller, ribosome, translation, acetylation; 2.13A {Saccharomyces cerevisiae} PDB: 3izb_a 3o2z_T 3o30_T 3u5c_g 3u5g_g 3rfg_A 3rfh_A 1trj_A 3jyv_R* Back     alignment and structure
>3mmy_A MRNA export factor; mRNA export, nuclear protein; HET: MES; 1.65A {Homo sapiens} Back     alignment and structure
>2pm9_A Protein WEB1, protein transport protein SEC31; beta propeller; 3.30A {Saccharomyces cerevisiae} Back     alignment and structure
>3vl1_A 26S proteasome regulatory subunit RPN14; beta-propeller, chaperone, RPT6; 1.60A {Saccharomyces cerevisiae} PDB: 3acp_A Back     alignment and structure
>3jrp_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3dw8_B Serine/threonine-protein phosphatase 2A 55 kDa RE subunit B alpha isoform; holoenzyme, PR55, WD repeat, hydrolase, iron, manganese binding, methylation, phosphoprotein, protein phosphatase; HET: 1ZN; 2.85A {Homo sapiens} Back     alignment and structure
>1yfq_A Cell cycle arrest protein BUB3; WD repeat WD40 repeat beta transducin repeat all beta, signaling protein; 1.10A {Saccharomyces cerevisiae} SCOP: b.69.4.2 PDB: 1u4c_A 2i3s_A 2i3t_A Back     alignment and structure
>4h5i_A Guanine nucleotide-exchange factor SEC12; copii vesicle budding, potassium binding site, beta propelle protein transport; 1.36A {Saccharomyces cerevisiae} PDB: 4h5j_A Back     alignment and structure
>3dm0_A Maltose-binding periplasmic protein fused with RACK1; MBP RACK1A, receptor for activiated protein C-kinase 1, beta-propeller WD40 repeat; HET: GLC; 2.40A {Escherichia coli} Back     alignment and structure
>1p22_A F-BOX/WD-repeat protein 1A; ubiquitination, degradation, signaling protein; HET: SEP; 2.95A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 Back     alignment and structure
>4aow_A Guanine nucleotide-binding protein subunit beta-2; receptor, WD-repeat, beta-propeller; 2.45A {Homo sapiens} PDB: 2zkq_a Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>4gq1_A NUP37; propeller, transport protein; 2.40A {Schizosaccharomyces pombe} PDB: 4gq2_P 4fhl_A 4fhm_A 4fhn_A Back     alignment and structure
>2aq5_A Coronin-1A; WD40 repeat, 7-bladed beta-propeller, structural protein; HET: CME; 1.75A {Mus musculus} PDB: 2b4e_A Back     alignment and structure
>3k26_A Polycomb protein EED; WD40, structural genomics, NPPSFA, national project on prote structural and functional analysis, structural genomics CON SGC; HET: M3L; 1.58A {Homo sapiens} PDB: 3jzn_A* 3k27_A* 3jpx_A* 3jzg_A* 3jzh_A* 3iiw_A* 3ijc_A* 3iiy_A* 3ij0_A* 3ij1_A* 2qxv_A Back     alignment and structure
>2pm7_B Protein transport protein SEC13, protein transport protein SEC31; beta propeller, alpha solenoid; 2.35A {Saccharomyces cerevisiae} PDB: 2pm9_B 2pm6_B 3iko_A 3mzk_A 3mzl_A Back     alignment and structure
>1gxr_A ESG1, transducin-like enhancer protein 1; transcriptional CO-repressor, WD40, transcription repressor, WD repeat; 1.65A {Homo sapiens} SCOP: b.69.4.1 PDB: 2ce8_A 2ce9_A Back     alignment and structure
>2j04_B YDR362CP, TAU91; beta propeller, type 2 promoters, transcription, hypothetica protein, preinitiation complex, yeast RNA polymerase III; 3.2A {Saccharomyces cerevisiae} Back     alignment and structure
>1sq9_A Antiviral protein SKI8; WD repeat, beta-transducin repeat, WD40 repeat, beta propeller, recombination; 1.90A {Saccharomyces cerevisiae} SCOP: b.69.4.1 PDB: 1s4u_X Back     alignment and structure
>3bg1_A Protein SEC13 homolog; NPC, transport, WD repeat, autocatalytic cleavage, mRNA transport, nuclear pore complex, nucleus, phosphoprotein; 3.00A {Homo sapiens} PDB: 3bg0_A Back     alignment and structure
>3ei3_B DNA damage-binding protein 2; UV-damage, DDB, nucleotide excision repair, xeroderma pigmentosum, cytoplasm, DNA repair; HET: DNA PG4; 2.30A {Danio rerio} PDB: 3ei1_B* 3ei2_B* 4a08_B* 4a09_B* 4a0a_B* 4a0b_B* 4a0k_D* 4a0l_B* Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>3dw8_B Serine/threonine-protein phosphatase 2A 55 kDa RE subunit B alpha isoform; holoenzyme, PR55, WD repeat, hydrolase, iron, manganese binding, methylation, phosphoprotein, protein phosphatase; HET: 1ZN; 2.85A {Homo sapiens} Back     alignment and structure
>3odt_A Protein DOA1; ubiquitin, nuclear protein; HET: MSE MES; 1.35A {Saccharomyces cerevisiae} Back     alignment and structure
>3zwl_B Eukaryotic translation initiation factor 3 subuni; 2.20A {Saccharomyces cerevisiae} Back     alignment and structure
>3i2n_A WD repeat-containing protein 92; WD40 repeats, structural genomics, structural genomic consortium, SGC, apoptosis, transcription; 1.95A {Homo sapiens} Back     alignment and structure
>2w18_A PALB2, fancn, partner and localizer of BRCA2; fanconi anemia, homologous recomination, polymorphism, phosphoprotein, beta-propeller, WD40, nucleus; 1.90A {Homo sapiens} PDB: 3eu7_A Back     alignment and structure
>1k8k_C P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta-propeller, structural protein; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1tyq_C* 1u2v_C* 2p9i_C* 2p9k_C* 2p9l_C 2p9n_C* 2p9p_C* 2p9s_C* 2p9u_C* 3rse_C 3dxm_C* 3dxk_C Back     alignment and structure
>3gre_A Serine/threonine-protein kinase VPS15; seven-bladed propeller, WD repeat, scaffold protein, ATP- binding, endosome, golgi apparatus; 1.80A {Saccharomyces cerevisiae} Back     alignment and structure
>4a11_B DNA excision repair protein ERCC-8; DNA binding protein, DNA damage repair; HET: DNA; 3.31A {Homo sapiens} Back     alignment and structure
>3jro_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum, transport, membrane, mRNA transport; 4.00A {Saccharomyces cerevisiae} Back     alignment and structure
>3f3f_A Nucleoporin SEH1; structural protein, protein complex, nucleopori complex, nuclear pore complex, macromolecular assembly, MEM coat; 2.90A {Saccharomyces cerevisiae} PDB: 3f3g_A 3f3p_A 3ewe_A Back     alignment and structure
>2j04_A TAU60, YPL007P, hypothetical protein YPL007C; beta propeller, type 2 promoters, transcription, hypothetica protein, preinitiation complex, yeast RNA polymerase III; 3.2A {Saccharomyces cerevisiae} Back     alignment and structure
>1yfq_A Cell cycle arrest protein BUB3; WD repeat WD40 repeat beta transducin repeat all beta, signaling protein; 1.10A {Saccharomyces cerevisiae} SCOP: b.69.4.2 PDB: 1u4c_A 2i3s_A 2i3t_A Back     alignment and structure
>4e54_B DNA damage-binding protein 2; beta barrel, double helix, DDB1:WD40 beta-barrel fold, DNA D DNA repair, HOST-virus interactions; HET: DNA 3DR; 2.85A {Homo sapiens} PDB: 3ei4_B* Back     alignment and structure
>2vdu_B TRNA (guanine-N(7)-)-methyltransferase- associated WD repeat protein TRM82; S-adenosyl-L-methionine, tRNA processing, phosphorylation, M7G, spout MT, WD repeat; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3vu4_A KMHSV2; beta-propeller fold, protein transport; 2.60A {Kluyveromyces marxianus} PDB: 4av9_A 4av8_A 4exv_A Back     alignment and structure
>3dwl_C Actin-related protein 2/3 complex subunit 1; propellor, actin-binding, ATP-binding, cytoskeleton, nucleot binding, WD repeat; HET: ATP; 3.78A {Schizosaccharomyces pombe} Back     alignment and structure
>2xyi_A Probable histone-binding protein CAF1; transcription, repressor, phosphoprotein, WD-repeat; HET: PG4; 1.75A {Drosophila melanogaster} PDB: 3c99_A 3c9c_A 2yb8_B 2yba_A 2xu7_A* 3gfc_A 3cfs_B 3cfv_B Back     alignment and structure
>1l0q_A Surface layer protein; SLP, S-layer, 7-bladed beta-propeller superfamily, protein binding; HET: YCM; 2.40A {Methanosarcina mazei} SCOP: b.1.3.1 b.69.2.3 Back     alignment and structure
>4gga_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; 2.04A {Homo sapiens} PDB: 4ggd_A Back     alignment and structure
>3mmy_A MRNA export factor; mRNA export, nuclear protein; HET: MES; 1.65A {Homo sapiens} Back     alignment and structure
>4gq1_A NUP37; propeller, transport protein; 2.40A {Schizosaccharomyces pombe} PDB: 4gq2_P 4fhl_A 4fhm_A 4fhn_A Back     alignment and structure
>2aq5_A Coronin-1A; WD40 repeat, 7-bladed beta-propeller, structural protein; HET: CME; 1.75A {Mus musculus} PDB: 2b4e_A Back     alignment and structure
>4aez_A CDC20, WD repeat-containing protein SLP1; cell cycle, KEN-BOX, D-BOX, APC/C; 2.30A {Schizosaccharomyces pombe} Back     alignment and structure
>3lrv_A PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiquitin ligase, spliceosome, DNA damage, D repair, mRNA processing, nucleus; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>2vdu_B TRNA (guanine-N(7)-)-methyltransferase- associated WD repeat protein TRM82; S-adenosyl-L-methionine, tRNA processing, phosphorylation, M7G, spout MT, WD repeat; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4ggc_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; HET: MRD; 1.35A {Homo sapiens} Back     alignment and structure
>3bws_A Protein LP49; two-domain, immunoglobulin-like, 7-bladed beta propeller, unknown function; 1.99A {Leptospira interrogans} Back     alignment and structure
>3jrp_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3lrv_A PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiquitin ligase, spliceosome, DNA damage, D repair, mRNA processing, nucleus; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>2j04_A TAU60, YPL007P, hypothetical protein YPL007C; beta propeller, type 2 promoters, transcription, hypothetica protein, preinitiation complex, yeast RNA polymerase III; 3.2A {Saccharomyces cerevisiae} Back     alignment and structure
>2w18_A PALB2, fancn, partner and localizer of BRCA2; fanconi anemia, homologous recomination, polymorphism, phosphoprotein, beta-propeller, WD40, nucleus; 1.90A {Homo sapiens} PDB: 3eu7_A Back     alignment and structure
>1l0q_A Surface layer protein; SLP, S-layer, 7-bladed beta-propeller superfamily, protein binding; HET: YCM; 2.40A {Methanosarcina mazei} SCOP: b.1.3.1 b.69.2.3 Back     alignment and structure
>3vu4_A KMHSV2; beta-propeller fold, protein transport; 2.60A {Kluyveromyces marxianus} PDB: 4av9_A 4av8_A 4exv_A Back     alignment and structure
>2xyi_A Probable histone-binding protein CAF1; transcription, repressor, phosphoprotein, WD-repeat; HET: PG4; 1.75A {Drosophila melanogaster} PDB: 3c99_A 3c9c_A 2yb8_B 2yba_A 2xu7_A* 3gfc_A 3cfs_B 3cfv_B Back     alignment and structure
>3jro_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum, transport, membrane, mRNA transport; 4.00A {Saccharomyces cerevisiae} Back     alignment and structure
>3bws_A Protein LP49; two-domain, immunoglobulin-like, 7-bladed beta propeller, unknown function; 1.99A {Leptospira interrogans} Back     alignment and structure
>1nir_A Nitrite reductase; hemoprotein, denitrification, domain swapping; HET: HEC DHE; 2.15A {Pseudomonas aeruginosa} SCOP: a.3.1.2 b.70.2.1 PDB: 1bl9_A* 1n15_A* 1n50_A* 1n90_A* 1gjq_A* 1nno_A* 1hzv_A* 1hzu_A* Back     alignment and structure
>1nir_A Nitrite reductase; hemoprotein, denitrification, domain swapping; HET: HEC DHE; 2.15A {Pseudomonas aeruginosa} SCOP: a.3.1.2 b.70.2.1 PDB: 1bl9_A* 1n15_A* 1n50_A* 1n90_A* 1gjq_A* 1nno_A* 1hzv_A* 1hzu_A* Back     alignment and structure
>2hqs_A Protein TOLB; TOLB, PAL, TOL, transport protein-lipoprotein complex; 1.50A {Escherichia coli} SCOP: b.68.4.1 c.51.2.1 PDB: 3iax_A 1c5k_A 2ivz_A 2w8b_B 2w8b_A 1crz_A Back     alignment and structure
>2hqs_A Protein TOLB; TOLB, PAL, TOL, transport protein-lipoprotein complex; 1.50A {Escherichia coli} SCOP: b.68.4.1 c.51.2.1 PDB: 3iax_A 1c5k_A 2ivz_A 2w8b_B 2w8b_A 1crz_A Back     alignment and structure
>3qbt_B Inositol polyphosphate 5-phosphatase OCRL-1; protein transport, vesicular trafficking, GTPase, LOWE syndr immunoglobulin fold, RAB8A, endocytosis; HET: GNP; 2.00A {Homo sapiens} Back     alignment and structure
>3qis_A Inositol polyphosphate 5-phosphatase OCRL-1; DENT disease, RAC1, RAB gtpases, APPL1, endocytic PATH golgi complex, hydrolase-protein binding complex; 2.30A {Homo sapiens} PDB: 2qv2_A Back     alignment and structure
>1k32_A Tricorn protease; protein degradation, substrate gating, serine protease, beta propeller, proteasome, hydrolase; 2.00A {Thermoplasma acidophilum} SCOP: b.36.1.3 b.68.7.1 b.69.9.1 c.14.1.2 PDB: 1n6e_A 1n6d_A 1n6f_A* Back     alignment and structure
>3u4y_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomi CS, MCSG; 2.99A {Desulfotomaculum acetoxidans} Back     alignment and structure
>2ecf_A Dipeptidyl peptidase IV; prolyl oligopeptidase family, peptidase family S9, hydrolase; 2.80A {Stenotrophomonas maltophilia} Back     alignment and structure
>2ojh_A Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 6-stranded beta-propeller, structural genomics, PSI-2; 1.85A {Agrobacterium tumefaciens str} Back     alignment and structure
>1k32_A Tricorn protease; protein degradation, substrate gating, serine protease, beta propeller, proteasome, hydrolase; 2.00A {Thermoplasma acidophilum} SCOP: b.36.1.3 b.68.7.1 b.69.9.1 c.14.1.2 PDB: 1n6e_A 1n6d_A 1n6f_A* Back     alignment and structure
>1ri6_A Putative isomerase YBHE; 7-bladed propeller, enzyme, PSI, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.00A {Escherichia coli} SCOP: b.69.11.1 Back     alignment and structure
>1xfd_A DIP, dipeptidyl aminopeptidase-like protein 6, dipeptidylpeptidase 6; DPPX, DPP6, KV4, KV, KAF, membrane protein; HET: NDG NAG BMA MAN; 3.00A {Homo sapiens} SCOP: b.70.3.1 c.69.1.24 Back     alignment and structure
>3o4h_A Acylamino-acid-releasing enzyme; alpha/beta hydrolase fold, beta propeller, hydrolase, oligop SIZE selectivity; HET: GOL; 1.82A {Aeropyrum pernix} PDB: 3o4i_A 3o4j_A 2hu5_A* 1ve7_A* 1ve6_A* 2hu7_A* 3o4g_A 2hu8_A* 2qr5_A 2qzp_A Back     alignment and structure
>3vgz_A Uncharacterized protein YNCE; beta-propeller, protein binding; 1.70A {Escherichia coli} PDB: 3vh0_A* Back     alignment and structure
>2z3z_A Dipeptidyl aminopeptidase IV; peptidase family S9, prolyl oligopeptidase family, serine PR proline-specific peptidase, hydrolase; HET: AIO; 1.95A {Porphyromonas gingivalis} PDB: 2z3w_A* 2d5l_A 2eep_A* 2dcm_A* Back     alignment and structure
>1pby_B Quinohemoprotein amine dehydrogenase 40 kDa subunit; oxidoreductase; HET: TRW HEM; 1.70A {Paracoccus denitrificans} SCOP: b.69.2.2 PDB: 1jju_B* Back     alignment and structure
>2ecf_A Dipeptidyl peptidase IV; prolyl oligopeptidase family, peptidase family S9, hydrolase; 2.80A {Stenotrophomonas maltophilia} Back     alignment and structure
>3vgz_A Uncharacterized protein YNCE; beta-propeller, protein binding; 1.70A {Escherichia coli} PDB: 3vh0_A* Back     alignment and structure
>3hfq_A Uncharacterized protein LP_2219; Q88V64_lacpl, NESG, LPR118, structural genomics, PSI-2, protein structure initiative; 1.96A {Lactobacillus plantarum} Back     alignment and structure
>2ojh_A Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 6-stranded beta-propeller, structural genomics, PSI-2; 1.85A {Agrobacterium tumefaciens str} Back     alignment and structure
>1xfd_A DIP, dipeptidyl aminopeptidase-like protein 6, dipeptidylpeptidase 6; DPPX, DPP6, KV4, KV, KAF, membrane protein; HET: NDG NAG BMA MAN; 3.00A {Homo sapiens} SCOP: b.70.3.1 c.69.1.24 Back     alignment and structure
>2z3z_A Dipeptidyl aminopeptidase IV; peptidase family S9, prolyl oligopeptidase family, serine PR proline-specific peptidase, hydrolase; HET: AIO; 1.95A {Porphyromonas gingivalis} PDB: 2z3w_A* 2d5l_A 2eep_A* 2dcm_A* Back     alignment and structure
>1jmx_B Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 1.90A {Pseudomonas putida} SCOP: b.69.2.2 PDB: 1jmz_B* Back     alignment and structure
>2oit_A Nucleoporin 214KDA; NH2 terminal domain of NUP214/CAN, X-RAY crystallography, beta-propeller, structure, mRNA export, NPC assembly, leukemia; HET: MES; 1.65A {Homo sapiens} PDB: 3fmo_A* 3fmp_A* 3fhc_A Back     alignment and structure
>1z68_A Fibroblast activation protein, alpha subunit; seprase, fibroblast activation protein alpha,fapalpha, dipeptidylpeptidase,S9B; HET: NAG NDG; 2.60A {Homo sapiens} Back     alignment and structure
>1z68_A Fibroblast activation protein, alpha subunit; seprase, fibroblast activation protein alpha,fapalpha, dipeptidylpeptidase,S9B; HET: NAG NDG; 2.60A {Homo sapiens} Back     alignment and structure
>1jmx_B Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 1.90A {Pseudomonas putida} SCOP: b.69.2.2 PDB: 1jmz_B* Back     alignment and structure
>3u4y_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomi CS, MCSG; 2.99A {Desulfotomaculum acetoxidans} Back     alignment and structure
>3pe7_A Oligogalacturonate lyase; seven-bladed beta-propeller; 1.65A {Yersinia enterocolitica subsp} Back     alignment and structure
>1q7f_A NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL repeat, beta-propeller, translation; 1.95A {Drosophila melanogaster} SCOP: b.68.9.1 Back     alignment and structure
>3scy_A Hypothetical bacterial 6-phosphogluconolactonase; 7-bladed beta-propeller, structural genomics, joint center F structural genomics, JCSG; HET: MSE; 1.50A {Bacteroides fragilis} PDB: 3fgb_A Back     alignment and structure
>1pby_B Quinohemoprotein amine dehydrogenase 40 kDa subunit; oxidoreductase; HET: TRW HEM; 1.70A {Paracoccus denitrificans} SCOP: b.69.2.2 PDB: 1jju_B* Back     alignment and structure
>2oit_A Nucleoporin 214KDA; NH2 terminal domain of NUP214/CAN, X-RAY crystallography, beta-propeller, structure, mRNA export, NPC assembly, leukemia; HET: MES; 1.65A {Homo sapiens} PDB: 3fmo_A* 3fmp_A* 3fhc_A Back     alignment and structure
>1ri6_A Putative isomerase YBHE; 7-bladed propeller, enzyme, PSI, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.00A {Escherichia coli} SCOP: b.69.11.1 Back     alignment and structure
>1jof_A Carboxy-CIS,CIS-muconate cyclase; beta-propeller, homotetramer, seMet-protein, isomerase; HET: PIN; 2.50A {Neurospora crassa} SCOP: b.69.10.1 Back     alignment and structure
>3hfq_A Uncharacterized protein LP_2219; Q88V64_lacpl, NESG, LPR118, structural genomics, PSI-2, protein structure initiative; 1.96A {Lactobacillus plantarum} Back     alignment and structure
>3fvz_A Peptidyl-glycine alpha-amidating monooxygenase; beta propeller, lyase, peptide amidation, HG-MAD, Zn-MAD, CL PAIR of basic residues; 2.35A {Rattus norvegicus} PDB: 3fw0_A* Back     alignment and structure
>4a5s_A Dipeptidyl peptidase 4 soluble form; hydrolase, type 2 diabetes, novartis compound NVP-BIV988; HET: N7F NAG MAN; 1.62A {Homo sapiens} PDB: 2qjr_A* 3f8s_A* 2qt9_A* 2qtb_A* 2rip_A* 1tk3_A* 1n1m_A* 1nu8_A* 1rwq_A* 1nu6_A* 1tkr_A* 1w1i_A* 2ajl_I* 2bgn_A* 2bub_A* 2ogz_A* 2ole_A* 2oqi_A* 3bjm_A* 3eio_A* ... Back     alignment and structure
>4a5s_A Dipeptidyl peptidase 4 soluble form; hydrolase, type 2 diabetes, novartis compound NVP-BIV988; HET: N7F NAG MAN; 1.62A {Homo sapiens} PDB: 2qjr_A* 3f8s_A* 2qt9_A* 2qtb_A* 2rip_A* 1tk3_A* 1n1m_A* 1nu8_A* 1rwq_A* 1nu6_A* 1tkr_A* 1w1i_A* 2ajl_I* 2bgn_A* 2bub_A* 2ogz_A* 2ole_A* 2oqi_A* 3bjm_A* 3eio_A* ... Back     alignment and structure
>3o4h_A Acylamino-acid-releasing enzyme; alpha/beta hydrolase fold, beta propeller, hydrolase, oligop SIZE selectivity; HET: GOL; 1.82A {Aeropyrum pernix} PDB: 3o4i_A 3o4j_A 2hu5_A* 1ve7_A* 1ve6_A* 2hu7_A* 3o4g_A 2hu8_A* 2qr5_A 2qzp_A Back     alignment and structure
>3scy_A Hypothetical bacterial 6-phosphogluconolactonase; 7-bladed beta-propeller, structural genomics, joint center F structural genomics, JCSG; HET: MSE; 1.50A {Bacteroides fragilis} PDB: 3fgb_A Back     alignment and structure
>3azo_A Aminopeptidase; POP family, hydrolase; 2.00A {Streptomyces morookaensis} PDB: 3azp_A 3azq_A Back     alignment and structure
>4gz1_A Tyrosyl-DNA phosphodiesterase 2; protein-DNA complex, DNA repair, 5'-DNA END processing, endonuclease/exonuclease/phosphatase domain; HET: DNA EPE; 1.50A {Mus musculus} PDB: 4gyz_A* 4gz0_A* 4gz2_A* Back     alignment and structure
>2oiz_A Aromatic amine dehydrogenase, large subunit; oxidoreductase, tryptophan tryptophyl quinone, H-tunneling; HET: TRQ TSR PG4; 1.05A {Alcaligenes faecalis} PDB: 2agw_A* 2agx_A* 2agl_A* 2agz_A* 2ah0_A* 2ah1_A* 2hj4_A* 2hjb_A* 2i0t_A* 2iup_A* 2iuq_A* 2iur_A* 2iuv_A* 2agy_A* 2ok4_A* 2ok6_A* 2iaa_A* 2h47_A* 2h3x_A* 2hkr_A* ... Back     alignment and structure
>1jof_A Carboxy-CIS,CIS-muconate cyclase; beta-propeller, homotetramer, seMet-protein, isomerase; HET: PIN; 2.50A {Neurospora crassa} SCOP: b.69.10.1 Back     alignment and structure
>3c5m_A Oligogalacturonate lyase; blade-shaped beta-propeller, structural genomics, PSI-2, protein structure initiative; 2.60A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>2gop_A Trilobed protease; beta propeller, open velcro, hydrolase; 2.00A {Pyrococcus furiosus} Back     alignment and structure
>2oiz_A Aromatic amine dehydrogenase, large subunit; oxidoreductase, tryptophan tryptophyl quinone, H-tunneling; HET: TRQ TSR PG4; 1.05A {Alcaligenes faecalis} PDB: 2agw_A* 2agx_A* 2agl_A* 2agz_A* 2ah0_A* 2ah1_A* 2hj4_A* 2hjb_A* 2i0t_A* 2iup_A* 2iuq_A* 2iur_A* 2iuv_A* 2agy_A* 2ok4_A* 2ok6_A* 2iaa_A* 2h47_A* 2h3x_A* 2hkr_A* ... Back     alignment and structure
>3fvz_A Peptidyl-glycine alpha-amidating monooxygenase; beta propeller, lyase, peptide amidation, HG-MAD, Zn-MAD, CL PAIR of basic residues; 2.35A {Rattus norvegicus} PDB: 3fw0_A* Back     alignment and structure
>3e5z_A Putative gluconolactonase; X-RAY NESG Q9RXN3 gluconolactonase, structural genomics, PSI protein structure initiative; 2.01A {Deinococcus radiodurans} Back     alignment and structure
>3azo_A Aminopeptidase; POP family, hydrolase; 2.00A {Streptomyces morookaensis} PDB: 3azp_A 3azq_A Back     alignment and structure
>2dg1_A DRP35, lactonase; beta propeller, hydrolase; 1.72A {Staphylococcus aureus} SCOP: b.68.6.1 PDB: 2dg0_A 2dso_A Back     alignment and structure
>1q7f_A NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL repeat, beta-propeller, translation; 1.95A {Drosophila melanogaster} SCOP: b.68.9.1 Back     alignment and structure
>4fva_A 5'-tyrosyl-DNA phosphodiesterase; 5'-phosphotyrosyl-DNA diesterase, hydrolase; HET: EDO; 2.07A {Caenorhabditis elegans} Back     alignment and structure
>2gop_A Trilobed protease; beta propeller, open velcro, hydrolase; 2.00A {Pyrococcus furiosus} Back     alignment and structure
>4f1h_A Tyrosyl-DNA phosphodiesterase 2; hydrolase-DNA complex; HET: DNA; 1.66A {Danio rerio} PDB: 4fpv_A* 4f1h_B* Back     alignment and structure
>2bkl_A Prolyl endopeptidase; mechanistic study, celiac sprue, hydrolase, protease; HET: ZAH MES; 1.5A {Myxococcus xanthus} Back     alignment and structure
>2xdw_A Prolyl endopeptidase; alpha/beta-hydrolase, amnesia, beta-propeller, hydrolase, in; HET: PHQ TAM; 1.35A {Sus scrofa} PDB: 1qfm_A 1qfs_A* 1h2w_A* 3eq7_A* 3eq8_A* 3eq9_A* 1e8m_A* 1e8n_A 1h2z_A 1uoo_A 1uop_A 1uoq_A 1o6f_A 1h2x_A 1h2y_A* 1o6g_A 1vz3_A 1e5t_A 1vz2_A 3ddu_A* Back     alignment and structure
>1pjx_A Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotriesterase (PTE), nitrogen-calcium coordination, BET propeller; HET: ME2 MES PGE; 0.85A {Loligo vulgaris} SCOP: b.68.6.1 PDB: 1e1a_A* 2gvv_A* 2gvw_A 3byc_A 3kgg_A 3o4p_A* 3li3_A 2gvx_A 2gvu_A 3li4_A 2iaq_A 3li5_A* 2iao_A 2iap_A 2iau_A 2iax_A 2iaw_A 2ias_A 2iat_A 2iar_A ... Back     alignment and structure
>3pe7_A Oligogalacturonate lyase; seven-bladed beta-propeller; 1.65A {Yersinia enterocolitica subsp} Back     alignment and structure
>3teb_A Endonuclease/exonuclease/phosphatase; PSI-biology, MCSG, midwest center for structural genomics; 2.99A {Leptotrichia buccalis c-1013-b} Back     alignment and structure
>4gew_A 5'-tyrosyl-DNA phosphodiesterase; 5'-phosphotyrosyl-DNA diesterase, hydrolase; 2.35A {Caenorhabditis elegans} PDB: 4f1i_A Back     alignment and structure
>2dg1_A DRP35, lactonase; beta propeller, hydrolase; 1.72A {Staphylococcus aureus} SCOP: b.68.6.1 PDB: 2dg0_A 2dso_A Back     alignment and structure
>1ako_A Exonuclease III; AP-endonuclease, DNA repair; 1.70A {Escherichia coli} SCOP: d.151.1.1 Back     alignment and structure
>1rwi_B Serine/threonine-protein kinase PKND; beta propeller, structural genomics, PSI, protein structure initiative; 1.80A {Mycobacterium tuberculosis} SCOP: b.68.9.1 PDB: 1rwl_A Back     alignment and structure
>3no2_A Uncharacterized protein; six-bladed beta-propeller, structural genomics, joint center structural genomics, JCSG, protein structure initiative; HET: MSE CIT PEG; 1.35A {Bacteroides caccae} Back     alignment and structure
>3dsm_A Uncharacterized protein bacuni_02894; seven_blated beta propeller, structural genomics, PSI-2, Pro structure initiative; 1.90A {Bacteroides uniformis} Back     alignment and structure
>3e5z_A Putative gluconolactonase; X-RAY NESG Q9RXN3 gluconolactonase, structural genomics, PSI protein structure initiative; 2.01A {Deinococcus radiodurans} Back     alignment and structure
>2z2n_A Virginiamycin B lyase; seven-bladed beta-propeller, antibiotic resistance, E mechanism, virginiamycin B hydrolase streptogramin; HET: MSE; 1.65A {Staphylococcus aureus} PDB: 2z2o_A 2z2p_A* Back     alignment and structure
>3q7m_A Lipoprotein YFGL, BAMB; beta-propeller, BAM complex, outer membrane protein folding, negative, BAMA, protein binding; 1.65A {Escherichia coli} PDB: 3q7n_A 3q7o_A 3p1l_A 3prw_A 2yh3_A 3q54_A Back     alignment and structure
>3dsm_A Uncharacterized protein bacuni_02894; seven_blated beta propeller, structural genomics, PSI-2, Pro structure initiative; 1.90A {Bacteroides uniformis} Back     alignment and structure
>2bkl_A Prolyl endopeptidase; mechanistic study, celiac sprue, hydrolase, protease; HET: ZAH MES; 1.5A {Myxococcus xanthus} Back     alignment and structure
>3no2_A Uncharacterized protein; six-bladed beta-propeller, structural genomics, joint center structural genomics, JCSG, protein structure initiative; HET: MSE CIT PEG; 1.35A {Bacteroides caccae} Back     alignment and structure
>1yr2_A Prolyl oligopeptidase; prolyl endopeptidase, mechanistic study, celiac sprue, hydro; 1.80A {Novosphingobium capsulatum} Back     alignment and structure
>3c5m_A Oligogalacturonate lyase; blade-shaped beta-propeller, structural genomics, PSI-2, protein structure initiative; 2.60A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>2xdw_A Prolyl endopeptidase; alpha/beta-hydrolase, amnesia, beta-propeller, hydrolase, in; HET: PHQ TAM; 1.35A {Sus scrofa} PDB: 1qfm_A 1qfs_A* 1h2w_A* 3eq7_A* 3eq8_A* 3eq9_A* 1e8m_A* 1e8n_A 1h2z_A 1uoo_A 1uop_A 1uoq_A 1o6f_A 1h2x_A 1h2y_A* 1o6g_A 1vz3_A 1e5t_A 1vz2_A 3ddu_A* Back     alignment and structure
>3hxj_A Pyrrolo-quinoline quinone; all beta protein. incomplete 8-blade beta-propeller., struct genomics, PSI-2, protein structure initiative; 2.00A {Methanococcus maripaludis} Back     alignment and structure
>1zwx_A SMCL, sphingomyelinase-C; dnase1-like fold, beta-hairpin, hydrolase; 1.90A {Listeria ivanovii} SCOP: d.151.1.3 Back     alignment and structure
>3i41_A Beta-hemolysin; beta toxin, sphingomyelinase, toxin; 1.75A {Staphylococcus aureus} PDB: 3i46_A 3i48_A 3i5v_A* 3k55_A Back     alignment and structure
>1qks_A Cytochrome CD1 nitrite reductase; enzyme, oxidoreductase, denitrification, electron transport, periplasmic; HET: HEC DHE; 1.28A {Paracoccus pantotrophus} SCOP: a.3.1.2 b.70.2.1 PDB: 1aof_A* 1aoq_A* 1aom_A* 1e2r_A* 1hj5_A* 1h9x_A* 1h9y_A* 1hcm_A* 1hj3_A* 1hj4_A* 1dy7_A* 1gq1_A* Back     alignment and structure
>2qc5_A Streptogramin B lactonase; beta propeller, lyase; 1.80A {Staphylococcus cohnii} Back     alignment and structure
>1rwi_B Serine/threonine-protein kinase PKND; beta propeller, structural genomics, PSI, protein structure initiative; 1.80A {Mycobacterium tuberculosis} SCOP: b.68.9.1 PDB: 1rwl_A Back     alignment and structure
>3g6s_A Putative endonuclease/exonuclease/phosphatase family protein; alpha-beta protein, structural genomics, PSI-2; 2.50A {Bacteroides vulgatus atcc 8482} Back     alignment and structure
>1qks_A Cytochrome CD1 nitrite reductase; enzyme, oxidoreductase, denitrification, electron transport, periplasmic; HET: HEC DHE; 1.28A {Paracoccus pantotrophus} SCOP: a.3.1.2 b.70.2.1 PDB: 1aof_A* 1aoq_A* 1aom_A* 1e2r_A* 1hj5_A* 1h9x_A* 1h9y_A* 1hcm_A* 1hj3_A* 1hj4_A* 1dy7_A* 1gq1_A* Back     alignment and structure
>2z2n_A Virginiamycin B lyase; seven-bladed beta-propeller, antibiotic resistance, E mechanism, virginiamycin B hydrolase streptogramin; HET: MSE; 1.65A {Staphylococcus aureus} PDB: 2z2o_A 2z2p_A* Back     alignment and structure
>3hrp_A Uncharacterized protein; NP_812590.1, structural genomics protein of unknown function structural genomics; HET: MSE; 1.70A {Bacteroides thetaiotaomicron vpi-5482} Back     alignment and structure
>3dr2_A Exported gluconolactonase; gluconolactonase SMP-30, six-bladed-propeller dimer, vitamin C, hydrolase; 1.67A {Xanthomonas campestris PV} Back     alignment and structure
>3l1w_A Uncharacterized protein; APC29019.2, conserved protein, enterococcus faecalis V583, PSI-2, MCSG, structural genomics; 1.60A {Enterococcus faecalis} Back     alignment and structure
>3mpr_A Putative endonuclease/exonuclease/phosphatase FAM protein; structural genomics, PSI-2, protein structure initiative; HET: MSE PEG; 1.90A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2qe8_A Uncharacterized protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE UNL PG4; 1.35A {Anabaena variabilis atcc 29413} Back     alignment and structure
>3g4e_A Regucalcin; six bladed beta-propeller, gluconolcatonase, organophosphate hydrolase, calcium bound, alternative splicing, cytoplasm, phosphoprotein; 1.42A {Homo sapiens} PDB: 3g4h_B Back     alignment and structure
>2hz6_A Endoplasmic reticulum to nucleus signalling 1 isoform 1 variant; triangular beta-sheet cluster, signaling protein; 3.10A {Homo sapiens} Back     alignment and structure
>3iuj_A Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas punctata} PDB: 3iul_A 3ium_A 3ivm_A* 3iur_A* 3iun_A* 3iuq_A* 3muo_A* 3mun_A* Back     alignment and structure
>2ghs_A AGR_C_1268P; regucalcin, structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PSI-2; 1.55A {Agrobacterium tumefaciens str} SCOP: b.68.6.1 Back     alignment and structure
>2ddr_A Sphingomyelin phosphodiesterase; DNAse I like folding, riken structural genomics/proteomics initiative, RSGI, structural genomics, hydrolase; 1.40A {Bacillus cereus} SCOP: d.151.1.3 PDB: 2dds_A 2ddt_A* 2uyr_X Back     alignment and structure
>1yr2_A Prolyl oligopeptidase; prolyl endopeptidase, mechanistic study, celiac sprue, hydro; 1.80A {Novosphingobium capsulatum} Back     alignment and structure
>2jc4_A Exodeoxyribonuclease III; hydrolase, repair phosphodiesterase, DNA repair, exonuclease, endonuclease; HET: 1PE; 1.90A {Neisseria meningitidis} Back     alignment and structure
>1pjx_A Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotriesterase (PTE), nitrogen-calcium coordination, BET propeller; HET: ME2 MES PGE; 0.85A {Loligo vulgaris} SCOP: b.68.6.1 PDB: 1e1a_A* 2gvv_A* 2gvw_A 3byc_A 3kgg_A 3o4p_A* 3li3_A 2gvx_A 2gvu_A 3li4_A 2iaq_A 3li5_A* 2iao_A 2iap_A 2iau_A 2iax_A 2iaw_A 2ias_A 2iat_A 2iar_A ... Back     alignment and structure
>3sjl_D Methylamine dehydrogenase heavy chain; MAUG, C-heme, quinone cofactor, oxidoreductase-electron transport complex; HET: 0AF HEC MES; 1.63A {Paracoccus denitrificans} PDB: 2gc7_A* 2j55_H* 2j56_H* 2j57_G* 3l4m_D* 3l4o_D* 3orv_D* 3pxs_D* 3pxt_D* 3rlm_D* 2gc4_A* 3rn0_D* 3rn1_D* 3rmz_D* 3svw_D* 3sws_D* 3sxt_D* 3pxw_D* 3sle_D* 1mg2_A* ... Back     alignment and structure
>1xip_A Nucleoporin NUP159; beta-propeller, transport protein; 2.50A {Saccharomyces cerevisiae} SCOP: b.69.14.1 PDB: 3pez_C* 3rrm_C* Back     alignment and structure
>3q7m_A Lipoprotein YFGL, BAMB; beta-propeller, BAM complex, outer membrane protein folding, negative, BAMA, protein binding; 1.65A {Escherichia coli} PDB: 3q7n_A 3q7o_A 3p1l_A 3prw_A 2yh3_A 3q54_A Back     alignment and structure
>2mad_H Methylamine dehydrogenase (heavy subunit); oxidoreductase(CHNH2(D)-deaminating); HET: TRQ; 2.25A {Paracoccus versutus} SCOP: b.69.2.1 PDB: 1mae_H* 1maf_H* Back     alignment and structure
>2qc5_A Streptogramin B lactonase; beta propeller, lyase; 1.80A {Staphylococcus cohnii} Back     alignment and structure
>4a2l_A BT_4663, two-component system sensor histidine kinase/RESP; transcription, beta-propeller; HET: PGE PG4 MES 2PE; 2.60A {Bacteroides thetaiotaomicron} PDB: 4a2m_A* Back     alignment and structure
>2jc5_A Exodeoxyribonuclease; hydrolase, repair phosphodiesterase, DNA repair, exonuclease, endonuclease; HET: BCN DIO GOL; 1.50A {Neisseria meningitidis} Back     alignment and structure
>1yiq_A Quinohemoprotein alcohol dehydrogenase; electron transfer, oxidoreductase; HET: PQQ HEM; 2.20A {Pseudomonas putida} Back     alignment and structure
>4a2l_A BT_4663, two-component system sensor histidine kinase/RESP; transcription, beta-propeller; HET: PGE PG4 MES 2PE; 2.60A {Bacteroides thetaiotaomicron} PDB: 4a2m_A* Back     alignment and structure
>2j63_A AP-endonuclease; base excision repair, lyase; 2.48A {Leishmania major} Back     alignment and structure
>3g4e_A Regucalcin; six bladed beta-propeller, gluconolcatonase, organophosphate hydrolase, calcium bound, alternative splicing, cytoplasm, phosphoprotein; 1.42A {Homo sapiens} PDB: 3g4h_B Back     alignment and structure
>2o3h_A DNA-(apurinic or apyrimidinic site) lyase; APE, endonuclease; 1.90A {Homo sapiens} PDB: 1bix_A 1dew_A* 1de8_B* 1de9_A* 2o3c_A Back     alignment and structure
>2mad_H Methylamine dehydrogenase (heavy subunit); oxidoreductase(CHNH2(D)-deaminating); HET: TRQ; 2.25A {Paracoccus versutus} SCOP: b.69.2.1 PDB: 1mae_H* 1maf_H* Back     alignment and structure
>1vyb_A ORF2 contains A reverse transcriptase domain; endonuclease, APE-1 type, retrotransposition, retrotransposon, transferase; 1.8A {Homo sapiens} SCOP: d.151.1.1 PDB: 2v0s_A 2v0r_A Back     alignment and structure
>3hxj_A Pyrrolo-quinoline quinone; all beta protein. incomplete 8-blade beta-propeller., struct genomics, PSI-2, protein structure initiative; 2.00A {Methanococcus maripaludis} Back     alignment and structure
>1xip_A Nucleoporin NUP159; beta-propeller, transport protein; 2.50A {Saccharomyces cerevisiae} SCOP: b.69.14.1 PDB: 3pez_C* 3rrm_C* Back     alignment and structure
>2voa_A AF_EXO, XTHA, exodeoxyribonuclease III; EXOIII, AP endonuclease, lyase; 1.7A {Archaeoglobus fulgidus} Back     alignment and structure
>1kb0_A Quinohemoprotein alcohol dehydrogenase; beta-propeller fold, cytochrome C, oxidoreductase; HET: TRO HEC PQQ; 1.44A {Comamonas testosteroni} SCOP: a.3.1.6 b.70.1.1 Back     alignment and structure
>1wdu_A TRAS1 ORF2P; four-layered alpha/beta sandwich, RNA binding protein; 2.40A {Bombyx mori} SCOP: d.151.1.1 Back     alignment and structure
>3dr2_A Exported gluconolactonase; gluconolactonase SMP-30, six-bladed-propeller dimer, vitamin C, hydrolase; 1.67A {Xanthomonas campestris PV} Back     alignment and structure
>3hrp_A Uncharacterized protein; NP_812590.1, structural genomics protein of unknown function structural genomics; HET: MSE; 1.70A {Bacteroides thetaiotaomicron vpi-5482} Back     alignment and structure
>2hz6_A Endoplasmic reticulum to nucleus signalling 1 isoform 1 variant; triangular beta-sheet cluster, signaling protein; 3.10A {Homo sapiens} Back     alignment and structure
>2ghs_A AGR_C_1268P; regucalcin, structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PSI-2; 1.55A {Agrobacterium tumefaciens str} SCOP: b.68.6.1 Back     alignment and structure
>3sjl_D Methylamine dehydrogenase heavy chain; MAUG, C-heme, quinone cofactor, oxidoreductase-electron transport complex; HET: 0AF HEC MES; 1.63A {Paracoccus denitrificans} PDB: 2gc7_A* 2j55_H* 2j56_H* 2j57_G* 3l4m_D* 3l4o_D* 3orv_D* 3pxs_D* 3pxt_D* 3rlm_D* 2gc4_A* 3rn0_D* 3rn1_D* 3rmz_D* 3svw_D* 3sws_D* 3sxt_D* 3pxw_D* 3sle_D* 1mg2_A* ... Back     alignment and structure
>1hd7_A DNA-(apurinic or apyrimidinic site) lyase; DNA repair, endonuclease, APE1, HAP1, REF-1; 1.95A {Homo sapiens} SCOP: d.151.1.1 PDB: 1e9n_A 3u8u_A 2isi_A Back     alignment and structure
>3v9f_A Two-component system sensor histidine kinase/RESP regulator, hybrid (ONE-component...; beta-propeller, beta-sandwich; 3.30A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3v9f_A Two-component system sensor histidine kinase/RESP regulator, hybrid (ONE-component...; beta-propeller, beta-sandwich; 3.30A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1yiq_A Quinohemoprotein alcohol dehydrogenase; electron transfer, oxidoreductase; HET: PQQ HEM; 2.20A {Pseudomonas putida} Back     alignment and structure
>3c75_H MADH, methylamine dehydrogenase heavy chain; copper proteins, electron transfer complex, TTQ, electron transport, oxidoreductase, periplasm, transport, metal- binding; HET: TRQ; 2.50A {Paracoccus versutus} Back     alignment and structure
>3iuj_A Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas punctata} PDB: 3iul_A 3ium_A 3ivm_A* 3iur_A* 3iun_A* 3iuq_A* 3muo_A* 3mun_A* Back     alignment and structure
>2fp8_A Strictosidine synthase; six bladed beta propeller fold, lyase; 2.30A {Rauvolfia serpentina} PDB: 2fp9_A* 2fpc_A* 2vaq_A* 3v1s_A* 2fpb_A* 2v91_A* Back     alignment and structure
>3g91_A MTH0212, exodeoxyribonuclease; double-strand specific 3'-5' exonuclease, AP endonuclease; HET: PG4; 1.23A {Methanothermobacter thermautotrophicusorganism_taxid} PDB: 3fzi_A 3g0a_A 3g1k_A 3g2c_A 3g3c_A* 3g3y_A* 3g4t_A* 3g00_A 3g0r_A* 3g2d_A* 3g38_A 3g8v_A* 3ga6_A Back     alignment and structure
>3c75_H MADH, methylamine dehydrogenase heavy chain; copper proteins, electron transfer complex, TTQ, electron transport, oxidoreductase, periplasm, transport, metal- binding; HET: TRQ; 2.50A {Paracoccus versutus} Back     alignment and structure
>1mda_H Methylamine dehydrogenase (heavy subunit); electron transport; HET: TRQ; 2.50A {Paracoccus denitrificans} SCOP: b.69.2.1 Back     alignment and structure
>1kb0_A Quinohemoprotein alcohol dehydrogenase; beta-propeller fold, cytochrome C, oxidoreductase; HET: TRO HEC PQQ; 1.44A {Comamonas testosteroni} SCOP: a.3.1.6 b.70.1.1 Back     alignment and structure
>2qe8_A Uncharacterized protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE UNL PG4; 1.35A {Anabaena variabilis atcc 29413} Back     alignment and structure
>1mda_H Methylamine dehydrogenase (heavy subunit); electron transport; HET: TRQ; 2.50A {Paracoccus denitrificans} SCOP: b.69.2.1 Back     alignment and structure
>1kv9_A Type II quinohemoprotein alcohol dehydrogenase; electron transfer, oxidoreductase; HET: PQQ HEM EPE; 1.90A {Pseudomonas putida} SCOP: a.3.1.6 b.70.1.1 Back     alignment and structure
>2ei9_A Non-LTR retrotransposon R1BMKS ORF2 protein; four layered alpha beta sandwich, gene regulation; 2.00A {Bombyx mori} Back     alignment and structure
>1npe_A Nidogen, entactin; glycoprotein, basement membrane, beta-propeller, EGF-like, structural protein; 2.30A {Mus musculus} SCOP: b.68.5.1 Back     alignment and structure
>1kv9_A Type II quinohemoprotein alcohol dehydrogenase; electron transfer, oxidoreductase; HET: PQQ HEM EPE; 1.90A {Pseudomonas putida} SCOP: a.3.1.6 b.70.1.1 Back     alignment and structure
>1npe_A Nidogen, entactin; glycoprotein, basement membrane, beta-propeller, EGF-like, structural protein; 2.30A {Mus musculus} SCOP: b.68.5.1 Back     alignment and structure
>1w6s_A Methanol dehydrogenase subunit 1; anisotropic, electron transfer, oxidoreductase, calcium- binding, methanol utilization, PQQ; HET: PQQ; 1.2A {Methylobacterium extorquens} SCOP: b.70.1.1 PDB: 1h4i_A* 1h4j_A* 2d0v_A* 1lrw_A* Back     alignment and structure
>3ngq_A CCR4-NOT transcription complex subunit 6-like; alpha/beta sandwich fold, hydrolase; HET: 1PS; 1.80A {Homo sapiens} PDB: 3ngo_A 3ngn_A Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>2iwa_A Glutamine cyclotransferase; pyroglutamate, acyltransferase, glutaminyl CYCL N-terminal cyclisation; HET: NAG; 1.6A {Carica papaya} PDB: 2faw_A* Back     alignment and structure
>2ad6_A Methanol dehydrogenase subunit 1; PQQ configuration, native, oxidoredu; HET: PQQ; 1.50A {Methylophilus methylotrophus} SCOP: b.70.1.1 PDB: 2ad7_A* 2ad8_A* 4aah_A* 1g72_A* Back     alignment and structure
>2a40_B Deoxyribonuclease-1; WAVE, WH2, WAsp, actin, DNAse I, ARP2/3, structural protein; HET: HIC NAG ATP; 1.80A {Bos taurus} SCOP: d.151.1.1 PDB: 1dnk_A* 2a3z_B* 2a41_B* 2a42_B* 2d1k_B* 2dnj_A* 3cjc_D* 3dni_A* 1atn_D* Back     alignment and structure
>2fp8_A Strictosidine synthase; six bladed beta propeller fold, lyase; 2.30A {Rauvolfia serpentina} PDB: 2fp9_A* 2fpc_A* 2vaq_A* 3v1s_A* 2fpb_A* 2v91_A* Back     alignment and structure
>3nol_A Glutamine cyclotransferase; beta-propeller, glutaminyl cyclase, pyrogl transferase; 1.70A {Zymomonas mobilis} PDB: 3nom_A Back     alignment and structure
>2e6j_A Hydin protein; PAPD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1flg_A Protein (quinoprotein ethanol dehydrogenase); superbarrel, oxidoreductase; HET: PQQ; 2.60A {Pseudomonas aeruginosa} SCOP: b.70.1.1 Back     alignment and structure
>2ys4_A Hydrocephalus-inducing protein homolog; hydin, PAPD-like, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3ott_A Two-component system sensor histidine kinase; beta-propeller, beta-sandwich, transcription; HET: TBR; 2.30A {Bacteroides thetaiotaomicron} PDB: 3va6_A Back     alignment and structure
>3nol_A Glutamine cyclotransferase; beta-propeller, glutaminyl cyclase, pyrogl transferase; 1.70A {Zymomonas mobilis} PDB: 3nom_A Back     alignment and structure
>2ece_A 462AA long hypothetical selenium-binding protein; beta propeller, structural genomics, unknown function; 2.00A {Sulfolobus tokodaii} Back     alignment and structure
>3mbr_X Glutamine cyclotransferase; beta-propeller; 1.44A {Xanthomonas campestris} Back     alignment and structure
>1flg_A Protein (quinoprotein ethanol dehydrogenase); superbarrel, oxidoreductase; HET: PQQ; 2.60A {Pseudomonas aeruginosa} SCOP: b.70.1.1 Back     alignment and structure
>3v65_B Low-density lipoprotein receptor-related protein; laminin-G, beta-propeller, protein binding; 3.30A {Rattus norvegicus} Back     alignment and structure
>2p4o_A Hypothetical protein; putative lactonase, structural genomics, joint center for ST genomics, JCSG, protein structure initiative, PSI-2; HET: MSE; 1.90A {Nostoc punctiforme} SCOP: b.68.6.3 Back     alignment and structure
>2ad6_A Methanol dehydrogenase subunit 1; PQQ configuration, native, oxidoredu; HET: PQQ; 1.50A {Methylophilus methylotrophus} SCOP: b.70.1.1 PDB: 2ad7_A* 2ad8_A* 4aah_A* 1g72_A* Back     alignment and structure
>3sov_A LRP-6, low-density lipoprotein receptor-related protein; beta propeller, protein binding-antagonist complex; HET: NAG FUC; 1.27A {Homo sapiens} PDB: 3soq_A* 3sob_B Back     alignment and structure
>2xe4_A Oligopeptidase B; hydrolase-inhibitor complex, hydrolase, protease inhibitor trypanosomes, CLAN SC; HET: FC0 RGL; 1.65A {Leishmania major} Back     alignment and structure
>2iwa_A Glutamine cyclotransferase; pyroglutamate, acyltransferase, glutaminyl CYCL N-terminal cyclisation; HET: NAG; 1.6A {Carica papaya} PDB: 2faw_A* Back     alignment and structure
>1w6s_A Methanol dehydrogenase subunit 1; anisotropic, electron transfer, oxidoreductase, calcium- binding, methanol utilization, PQQ; HET: PQQ; 1.2A {Methylobacterium extorquens} SCOP: b.70.1.1 PDB: 1h4i_A* 1h4j_A* 2d0v_A* 1lrw_A* Back     alignment and structure
>1k3i_A Galactose oxidase precursor; blade beta propeller, prosequence form, precursor of copper enzyme., oxidoreductase; 1.40A {Fusarium SP} SCOP: b.1.18.2 b.18.1.1 b.69.1.1 PDB: 1gof_A 1gog_A 1goh_A 2eie_A 2jkx_A 2vz1_A 2vz3_A 2eic_A 2eib_A 1t2x_A 2eid_A 2wq8_A Back     alignment and structure
>1k3i_A Galactose oxidase precursor; blade beta propeller, prosequence form, precursor of copper enzyme., oxidoreductase; 1.40A {Fusarium SP} SCOP: b.1.18.2 b.18.1.1 b.69.1.1 PDB: 1gof_A 1gog_A 1goh_A 2eie_A 2jkx_A 2vz1_A 2vz3_A 2eic_A 2eib_A 1t2x_A 2eid_A 2wq8_A Back     alignment and structure
>3nok_A Glutaminyl cyclase; beta-propeller, cyclotransferase, pyrogl transferase; HET: MES DDQ; 1.65A {Myxococcus xanthus} Back     alignment and structure
>2xbg_A YCF48-like protein; photosynthesis, photosystem II, beta-propeller, assembly FAC; 1.50A {Thermosynechococcus elongatus} Back     alignment and structure
>1msp_A MSP, major sperm protein; cytoskeletal protein, cell motility protein; 2.50A {Ascaris suum} SCOP: b.1.11.2 PDB: 3msp_A 2bvu_A 2msp_A 1grw_A Back     alignment and structure
>3ott_A Two-component system sensor histidine kinase; beta-propeller, beta-sandwich, transcription; HET: TBR; 2.30A {Bacteroides thetaiotaomicron} PDB: 3va6_A Back     alignment and structure
>3v64_C Agrin; beta propeller, laminin-G, signaling, protein binding; HET: NAG; 2.85A {Rattus norvegicus} Back     alignment and structure
>1fwx_A Nitrous oxide reductase; beta-propeller domain, cupredoxin domain, CUZ site, CUA site oxidoreductase; 1.60A {Paracoccus denitrificans} SCOP: b.6.1.4 b.69.3.1 PDB: 2iwk_A 2iwf_A Back     alignment and structure
>1m1s_A WR4; structural genomics, major sperm protein, bioinformatics, PSI, protein structure initiative; 1.80A {Caenorhabditis elegans} SCOP: b.1.11.2 Back     alignment and structure
>1row_A SSP-19, MSP-domain protein like family member; beta barrel, structural genomics, PSI, protein structure initiative; 2.00A {Caenorhabditis elegans} SCOP: b.1.11.2 Back     alignment and structure
>3mbr_X Glutamine cyclotransferase; beta-propeller; 1.44A {Xanthomonas campestris} Back     alignment and structure
>3m0c_C LDL receptor, low-density lipoprotein receptor; protein complex, beta propeller, cholesterol clearance, PCSK autocatalytic cleavage; 7.01A {Homo sapiens} Back     alignment and structure
>1ijq_A LDL receptor, low-density lipoprotein receptor; beta-propeller, lipid transport; 1.50A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 Back     alignment and structure
>3nok_A Glutaminyl cyclase; beta-propeller, cyclotransferase, pyrogl transferase; HET: MES DDQ; 1.65A {Myxococcus xanthus} Back     alignment and structure
>3p5b_L Low density lipoprotein receptor variant; B-propellor, convertase, hydrolase-lipid binding P complex; 3.30A {Homo sapiens} PDB: 3p5c_L Back     alignment and structure
>2ece_A 462AA long hypothetical selenium-binding protein; beta propeller, structural genomics, unknown function; 2.00A {Sulfolobus tokodaii} Back     alignment and structure
>1z9l_A Vesicle-associated membrane protein-associated protein A; VAP-A, cytoplasmic domain, protein binding; HET: MSE; 1.70A {Rattus norvegicus} PDB: 1z9o_A 2rr3_A 3ikk_A Back     alignment and structure
>1sr4_B CDT B, cytolethal distending toxin protein B; bacterial, virulence, DNA damage, genotoxin, cytotoxins, cell cycle, apoptosis, lectin; 2.00A {Haemophilus ducreyi} SCOP: d.151.1.1 PDB: 2f2f_B Back     alignment and structure
>3tc9_A Hypothetical hydrolase; 6-bladed beta-propeller, immunoglobulin-like, structural GEN joint center for structural genomics, JCSG; 2.23A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2cri_A Vesicle-associated membrane protein-associated protein A; VAP-A, VAP-33, beta sandwitch fold, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>1wic_A Hypothetical protein riken cDNA 6030424E15; beta sandwich fold, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: b.1.11.2 Back     alignment and structure
>3v65_B Low-density lipoprotein receptor-related protein; laminin-G, beta-propeller, protein binding; 3.30A {Rattus norvegicus} Back     alignment and structure
>2p4o_A Hypothetical protein; putative lactonase, structural genomics, joint center for ST genomics, JCSG, protein structure initiative, PSI-2; HET: MSE; 1.90A {Nostoc punctiforme} SCOP: b.68.6.3 Back     alignment and structure
>2xbg_A YCF48-like protein; photosynthesis, photosystem II, beta-propeller, assembly FAC; 1.50A {Thermosynechococcus elongatus} Back     alignment and structure
>3p5b_L Low density lipoprotein receptor variant; B-propellor, convertase, hydrolase-lipid binding P complex; 3.30A {Homo sapiens} PDB: 3p5c_L Back     alignment and structure
>4hw6_A Hypothetical protein, IPT/TIG domain protein; putative carbohydrate bindning two domains protein, IPT/TIG (PF01833), 6-beta-propeller; HET: MSE; 1.70A {Bacteroides ovatus} Back     alignment and structure
>2f1n_A CDT B, cytolethal distending toxin subunit B; E.coli, DNAse I, microbatch; 1.73A {Escherichia coli} SCOP: d.151.1.1 Back     alignment and structure
>3v64_C Agrin; beta propeller, laminin-G, signaling, protein binding; HET: NAG; 2.85A {Rattus norvegicus} Back     alignment and structure
>1ijq_A LDL receptor, low-density lipoprotein receptor; beta-propeller, lipid transport; 1.50A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 Back     alignment and structure
>4a0p_A LRP6, LRP-6, low-density lipoprotein receptor-related protein; signaling, WNT signalling, WNT3A, DKK1, MESD; HET: NAG; 1.90A {Homo sapiens} PDB: 3s2k_A* 3s8z_A* 3s8v_A* Back     alignment and structure
>3m0c_C LDL receptor, low-density lipoprotein receptor; protein complex, beta propeller, cholesterol clearance, PCSK autocatalytic cleavage; 7.01A {Homo sapiens} Back     alignment and structure
>1fwx_A Nitrous oxide reductase; beta-propeller domain, cupredoxin domain, CUZ site, CUA site oxidoreductase; 1.60A {Paracoccus denitrificans} SCOP: b.6.1.4 b.69.3.1 PDB: 2iwk_A 2iwf_A Back     alignment and structure
>2qsv_A Uncharacterized protein; MCSG, structural genomics, porphyromonas gingivalis W83, PSI protein structure initiative; 2.10A {Porphyromonas gingivalis} Back     alignment and structure
>3sov_A LRP-6, low-density lipoprotein receptor-related protein; beta propeller, protein binding-antagonist complex; HET: NAG FUC; 1.27A {Homo sapiens} PDB: 3soq_A* 3sob_B Back     alignment and structure
>1n7d_A LDL receptor, low-density lipoprotein receptor; familial hypercholesterolemia, cholestero metabolism, lipid transport; HET: NAG BMA MAN KEG; 3.70A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 g.3.11.1 g.3.11.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 PDB: 2lgp_A 1xfe_A 1f5y_A 1ldl_A 1ldr_A 1d2j_A 1f8z_A Back     alignment and structure
>1n7d_A LDL receptor, low-density lipoprotein receptor; familial hypercholesterolemia, cholestero metabolism, lipid transport; HET: NAG BMA MAN KEG; 3.70A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 g.3.11.1 g.3.11.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 PDB: 2lgp_A 1xfe_A 1f5y_A 1ldl_A 1ldr_A 1d2j_A 1f8z_A Back     alignment and structure
>2xe4_A Oligopeptidase B; hydrolase-inhibitor complex, hydrolase, protease inhibitor trypanosomes, CLAN SC; HET: FC0 RGL; 1.65A {Leishmania major} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 1149
d1i9za_345 d.151.1.2 (A:) Synaptojanin, IPP5C domain {Fission 2e-40
d1i9za_345 d.151.1.2 (A:) Synaptojanin, IPP5C domain {Fission 7e-39
d2imqx1280 d.151.1.2 (X:3-282) Salivary nitrophorin {Bedbug ( 2e-22
d2imqx1280 d.151.1.2 (X:3-282) Salivary nitrophorin {Bedbug ( 7e-19
d1vyhc1317 b.69.4.1 (C:92-408) Platelet-activating factor ace 2e-05
d1vyhc1317 b.69.4.1 (C:92-408) Platelet-activating factor ace 4e-04
d1pgua2287 b.69.4.1 (A:327-613) Actin interacting protein 1 { 2e-04
d1tbga_340 b.69.4.1 (A:) beta1-subunit of the signal-transduc 5e-04
d1p22a2293 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (be 8e-04
d1k8kc_371 b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 0.002
d1gxra_337 b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Hum 0.003
d1erja_388 b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yea 0.003
>d1i9za_ d.151.1.2 (A:) Synaptojanin, IPP5C domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 345 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: DNase I-like
superfamily: DNase I-like
family: Inositol polyphosphate 5-phosphatase (IPP5)
domain: Synaptojanin, IPP5C domain
species: Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]

 Score =  150 bits (380), Expect = 2e-40
 Identities = 60/193 (31%), Positives = 91/193 (47%), Gaps = 21/193 (10%)

Query: 764 YIAAGASSVVQMLRSTNP-LSGLTVEGVPELSEADMVIFLGDFNYRLDGITYDEARDFIS 822
           ++AAG ++  +         SGL       +   D V++ GDFNYR+  +TY+E    I+
Sbjct: 166 HLAAGYTNYDERDHDYRTIASGLRFRRGRSIFNHDYVVWFGDFNYRIS-LTYEEVVPCIA 224

Query: 823 QRCFDWLRERDQLRAEMEAGNVFQGMREADIKFPPTYKFEKHLAGLAGYDSGEKKRVPAW 882
           Q    +L E DQL  +M  G VF    E  I FPPTYKF+    G   YD+ +K RVPAW
Sbjct: 225 QGKLSYLFEYDQLNKQMLTGKVFPFFSELPITFPPTYKFDI---GTDIYDTSDKHRVPAW 281

Query: 883 CDRILYRDSRSDLASECSLECPVASSILRYEACMDVTDSDHKPVRCIFSVDIARVDESVR 942
            DRILYR                   +      + +  SDH+P+   +  +I +VD   +
Sbjct: 282 TDRILYRGEL----------------VPHSYQSVPLYYSDHRPIYATYEANIVKVDREKK 325

Query: 943 RQEFGDIMTSNEK 955
           +  F ++    ++
Sbjct: 326 KILFEELYNQRKQ 338
>d1i9za_ d.151.1.2 (A:) Synaptojanin, IPP5C domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 345 Back     information, alignment and structure
>d2imqx1 d.151.1.2 (X:3-282) Salivary nitrophorin {Bedbug (Cimex lectularius) [TaxId: 79782]} Length = 280 Back     information, alignment and structure
>d2imqx1 d.151.1.2 (X:3-282) Salivary nitrophorin {Bedbug (Cimex lectularius) [TaxId: 79782]} Length = 280 Back     information, alignment and structure
>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Length = 317 Back     information, alignment and structure
>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Length = 317 Back     information, alignment and structure
>d1pgua2 b.69.4.1 (A:327-613) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 287 Back     information, alignment and structure
>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Length = 340 Back     information, alignment and structure
>d1p22a2 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} Length = 293 Back     information, alignment and structure
>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} Length = 371 Back     information, alignment and structure
>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 337 Back     information, alignment and structure
>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 388 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query1149
d1i9za_345 Synaptojanin, IPP5C domain {Fission yeast (Schizos 100.0
d2imqx1280 Salivary nitrophorin {Bedbug (Cimex lectularius) [ 100.0
d1vyhc1317 Platelet-activating factor acetylhydrolase IB subu 100.0
d1erja_388 Tup1, C-terminal domain {Baker's yeast (Saccharomy 100.0
d1gxra_337 Groucho/tle1, C-terminal domain {Human (Homo sapie 100.0
d1nr0a1311 Actin interacting protein 1 {Nematode (Caenorhabdi 100.0
d1tbga_340 beta1-subunit of the signal-transducing G protein 99.97
d1nr0a2299 Actin interacting protein 1 {Nematode (Caenorhabdi 99.97
d1nexb2355 Cdc4 propeller domain {Baker's yeast (Saccharomyce 99.97
d2ovrb2342 F-box/WD repeat-containing protein 7, FBXW7 {Human 99.97
d1k8kc_371 Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taur 99.97
d1p22a2293 F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Hom 99.96
d1nexb2355 Cdc4 propeller domain {Baker's yeast (Saccharomyce 99.96
d1vyhc1317 Platelet-activating factor acetylhydrolase IB subu 99.96
d1pgua2287 Actin interacting protein 1 {Baker's yeast (Saccha 99.96
d1gxra_337 Groucho/tle1, C-terminal domain {Human (Homo sapie 99.96
d1nr0a1311 Actin interacting protein 1 {Nematode (Caenorhabdi 99.96
d1erja_388 Tup1, C-terminal domain {Baker's yeast (Saccharomy 99.95
d1pgua1325 Actin interacting protein 1 {Baker's yeast (Saccha 99.95
d1tbga_340 beta1-subunit of the signal-transducing G protein 99.94
d1yfqa_342 Cell cycle arrest protein BUB3 {Baker's yeast (Sac 99.93
d2ovrb2342 F-box/WD repeat-containing protein 7, FBXW7 {Human 99.93
d1sq9a_393 Antiviral protein Ski8 (Ski8p) {Baker's yeast (Sac 99.93
d1nr0a2299 Actin interacting protein 1 {Nematode (Caenorhabdi 99.93
d1k8kc_371 Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taur 99.92
d1p22a2293 F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Hom 99.91
d1sq9a_393 Antiviral protein Ski8 (Ski8p) {Baker's yeast (Sac 99.91
d1pgua1325 Actin interacting protein 1 {Baker's yeast (Saccha 99.91
d1k32a3360 Tricorn protease domain 2 {Archaeon Thermoplasma a 99.89
d1yfqa_342 Cell cycle arrest protein BUB3 {Baker's yeast (Sac 99.89
d1hzua2426 C-terminal (heme d1) domain of cytochrome cd1-nitr 99.86
d1pgua2287 Actin interacting protein 1 {Baker's yeast (Saccha 99.85
d1qksa2432 C-terminal (heme d1) domain of cytochrome cd1-nitr 99.85
d1l0qa2301 Surface layer protein {Archaeon Methanosarcina maz 99.79
d1hzua2426 C-terminal (heme d1) domain of cytochrome cd1-nitr 99.76
d1k32a3360 Tricorn protease domain 2 {Archaeon Thermoplasma a 99.75
d1pbyb_337 Quinohemoprotein amine dehydrogenase B chain {Para 99.75
d1qksa2432 C-terminal (heme d1) domain of cytochrome cd1-nitr 99.7
d1jmxb_346 Quinohemoprotein amine dehydrogenase B chain {Pseu 99.7
d1jmxb_346 Quinohemoprotein amine dehydrogenase B chain {Pseu 99.66
d1l0qa2301 Surface layer protein {Archaeon Methanosarcina maz 99.6
d2bbkh_355 Methylamine dehydrogenase, H-chain {Paracoccus den 99.56
d2madh_373 Methylamine dehydrogenase, H-chain {Gram negative 99.55
d2madh_373 Methylamine dehydrogenase, H-chain {Gram negative 99.51
d1ri6a_333 Putative isomerase YbhE {Escherichia coli [TaxId: 99.48
d1pbyb_337 Quinohemoprotein amine dehydrogenase B chain {Para 99.48
d2bbkh_355 Methylamine dehydrogenase, H-chain {Paracoccus den 99.43
d2bgra1470 Dipeptidyl peptidase IV/CD26, N-terminal domain {P 99.22
d2ddra1299 Sphingomyelin phosphodiesterase C {Bacillus cereus 99.19
d1mdah_368 Methylamine dehydrogenase, H-chain {Paracoccus den 99.16
d1zwxa1293 Sphingomyelin phosphodiesterase C {Listeria ivanov 99.12
d1ri6a_333 Putative isomerase YbhE {Escherichia coli [TaxId: 99.09
d1mdah_368 Methylamine dehydrogenase, H-chain {Paracoccus den 98.99
d1wdua_228 Endonuclease domain of TRAS1 retrotransposon (ORF2 98.82
d1qnia2441 Nitrous oxide reductase, N-terminal domain {Pseudo 98.59
d1qnia2441 Nitrous oxide reductase, N-terminal domain {Pseudo 98.51
d2bgra1470 Dipeptidyl peptidase IV/CD26, N-terminal domain {P 98.41
d1vyba_236 Endonuclease domain of LINE-1 reverse transcriptas 98.35
d2p4oa1302 Hypothetical protein All0351 homologue {Nostoc pun 98.23
d1q7fa_279 Brain tumor cg10719-pa {Fruit fly (Drosophila mela 98.22
d2f1na1250 Cytolethal distending toxin subunit B {Escherichia 98.06
d2a40b1260 Deoxyribonuclease I {Cow (Bos taurus) [TaxId: 9913 98.0
d1sr4b_261 Cytolethal distending toxin subunit B {Haemophilus 97.92
d2p4oa1302 Hypothetical protein All0351 homologue {Nostoc pun 97.89
d1hd7a_275 DNA repair endonuclease Hap1 {Human (Homo sapiens) 97.65
d2hqsa1269 TolB, C-terminal domain {Escherichia coli [TaxId: 97.58
d2dg1a1319 Lactonase Drp35 {Staphylococcus aureus [TaxId: 128 97.57
d1akoa_268 DNA-repair enzyme exonuclease III {Escherichia col 97.54
d1pjxa_314 Diisopropylfluorophosphatase (phosphotriesterase, 97.49
d1q7fa_279 Brain tumor cg10719-pa {Fruit fly (Drosophila mela 97.44
d2dg1a1319 Lactonase Drp35 {Staphylococcus aureus [TaxId: 128 97.43
d1rwia_260 Serine/threonine-protein kinase PknD {Mycobacteriu 97.31
d2ghsa1295 Regucalcin {Agrobacterium tumefaciens [TaxId: 358] 97.28
d1k32a2281 Tricorn protease N-terminal domain {Archaeon Therm 97.23
d1jofa_365 3-carboxy-cis,cis-mucoante lactonizing enzyme {Neu 97.19
d1jofa_365 3-carboxy-cis,cis-mucoante lactonizing enzyme {Neu 96.94
d1pjxa_314 Diisopropylfluorophosphatase (phosphotriesterase, 96.84
d1grwa_124 Major sperm protein, MSP {Nematode (Caenorhabditis 95.92
d1rwia_260 Serine/threonine-protein kinase PknD {Mycobacteriu 95.83
d1rowa_107 SSP-19 {Nematode (Caenorhabditis elegans) [TaxId: 95.61
d1m1sa_109 WR4 {Nematode (Caenorhabditis elegans) [TaxId: 623 95.53
d2hqsa1269 TolB, C-terminal domain {Escherichia coli [TaxId: 95.46
d1wica_152 MSP domain containing protein 2, Mospd2 {Mouse (Mu 93.87
d1xfda1465 Dipeptidyl aminopeptidase-like protein 6, DPP6, N- 93.64
d1xfda1465 Dipeptidyl aminopeptidase-like protein 6, DPP6, N- 91.48
d2ghsa1295 Regucalcin {Agrobacterium tumefaciens [TaxId: 358] 91.48
d1k32a2281 Tricorn protease N-terminal domain {Archaeon Therm 90.78
>d1i9za_ d.151.1.2 (A:) Synaptojanin, IPP5C domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: DNase I-like
superfamily: DNase I-like
family: Inositol polyphosphate 5-phosphatase (IPP5)
domain: Synaptojanin, IPP5C domain
species: Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]

Probab=100.00  E-value=4.6e-75  Score=667.58  Aligned_cols=332  Identities=30%  Similarity=0.545  Sum_probs=290.3

Q ss_pred             CCCchhhhhhccccccceeeeeceEEEEEEEEeCCCCCCchhhcccccCCC-CCcceEEEEeecc-ccccchhhhhhhhh
Q 001123          529 GPLDSILCKELAGKEFLYTRMENLKILAGTWNVGQGRASQDALISWLGSAA-SDVGIVVVGLQEV-EMGAGFLAMSAAKE  606 (1149)
Q Consensus       529 ~pld~~i~~~l~~re~~yt~~~~~~i~v~TWNv~~~~~~~~~l~~wl~~~~-~~~Di~viGlQEi-~~~~~~~~~~~~ke  606 (1149)
                      +|++++++++|..|+.+|+..++++|+++|||||+.+|+ ++|.+||.... ..||||||||||+ ++++..+..     
T Consensus         2 d~~~~~~~~~l~~r~~~~~~~~~l~I~v~TWNv~~~~~~-~~l~~~l~~~~~~~~DI~viglQEi~~~~~~~~~~-----   75 (345)
T d1i9za_           2 DPIHEYVNHELRKRENEFSEHKNVKIFVASYNLNGCSAT-TKLENWLFPENTPLADIYVVGFQEIVQLTPQQVIS-----   75 (345)
T ss_dssp             CHHHHHHHHHHHHTGGGTEEEEEEEEEEEEEECTTCCCC-SCCHHHHSCSSSCCCSEEEEEEECSSCCC-----C-----
T ss_pred             CcHHHHHHHHHHHHHHhhcCCCceEEEEEEEcCCCccCC-cchHHhhccCCCCCCCEEEEEcccCCccchhhhcc-----
Confidence            578899999999999999999999999999999988775 57999997543 4589999999997 676654421     


Q ss_pred             hccCCCCcchhhHHHHHhcccC----CCCcEEEEeeeccceeeeeeeeeccccCccceeEeeeEeecccccccCcceeEE
Q 001123          607 TVGLEGSAVGHWWLDMIGKILD----DGSTFERVGSRQLAGLLIAVWVRKNLKDYVGDVDVAAVPCGFGRAIGNKGAVGL  682 (1149)
Q Consensus       607 ~~~~~~~~~~~~W~~~i~~~L~----~~~~y~~v~s~qL~Gl~l~vfvr~~l~~~i~~v~~~~v~tG~~g~~gNKGaV~i  682 (1149)
                          .++...+.|.+.+.++++    .+..|.++.+.+|+||+|+||+|+++.++|++|++++++||++|.+||||||++
T Consensus        76 ----~~~~~~~~w~~~~~~~~~~~~~~~~~Y~~v~~~~~~g~~l~vf~r~~~~~~i~~v~~~~~~~g~~g~~gnKGaV~v  151 (345)
T d1i9za_          76 ----ADPAKRREWESCVKRLLNGKCTSGPGYVQLRSGQLVGTALMIFCKESCLPSIKNVEGTVKKTGLGGVSGNKGAVAI  151 (345)
T ss_dssp             ----CCHHHHHHHHHHHHHHHHHTCCSSCCEEEEEEEEETTEEEEEEEEGGGGGGEEEEEEEEEECCCC----CCEEEEE
T ss_pred             ----cCchhhHHHHHHHHHhccccccCCCCeEEEEEecccCcEEEEEEcchhccccccceeEEEecCcCCcccCCceEEE
Confidence                122345779999988774    356899999999999999999999999999999999999999999999999999


Q ss_pred             EEEEeceEEEEeeecccccchhHHHHHHHHHHHHHhcccCCCCCccccccCCCchhhhhhhhhhhhhhhhhhhccCCchh
Q 001123          683 RVRVYDRIMCFVNCHFAAHLEAVNRRNADFDHVYRTMTFCRPSNLCSAAAGTMPFLLLSCVLACSMYLLWLVYRSGLPLV  762 (1149)
Q Consensus       683 r~~~~~t~lcFVn~HLaA~~~~~~~Rn~d~~~I~~~l~F~~~~~~~~~~~~~~~~~~~s~~~~~~~~~~~~~~~~~~~~~  762 (1149)
                      ||++++++||||||||+||++++++||+||..|+++|.|...                                      
T Consensus       152 r~~i~~t~l~fvn~HL~ag~~~~~~R~~~~~~i~~~l~~~~~--------------------------------------  193 (345)
T d1i9za_         152 RFDYEDTGLCFITSHLAAGYTNYDERDHDYRTIASGLRFRRG--------------------------------------  193 (345)
T ss_dssp             EEEETTEEEEEEEEECCCCSSCHHHHHHHHHHHHHHCCCGGG--------------------------------------
T ss_pred             EEEECCEEEEEEEecccCcccchHHHHHHHHHHHHhhccccc--------------------------------------
Confidence            999999999999999999999999999999999999987531                                      


Q ss_pred             hhhhccccchhhhcccCCCCCCCcccCCCcccCccEEEEECccCCCCCCCChHHHHHHHhhcChHHHHHhhHHHHHhHcC
Q 001123          763 LYIAAGASSVVQMLRSTNPLSGLTVEGVPELSEADMVIFLGDFNYRLDGITYDEARDFISQRCFDWLRERDQLRAEMEAG  842 (1149)
Q Consensus       763 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~i~~~D~vfw~GDlNyRi~~~~~~~v~~~i~~~~~~~Ll~~DQL~~~~~~g  842 (1149)
                                                  ..+.++|++|||||||||++. +++++.+++.++++..|+++|||+.+++.+
T Consensus       194 ----------------------------~~~~~~d~v~~~GDlN~R~~~-~~~~~~~~i~~~~~~~l~~~dql~~~~~~~  244 (345)
T d1i9za_         194 ----------------------------RSIFNHDYVVWFGDFNYRISL-TYEEVVPCIAQGKLSYLFEYDQLNKQMLTG  244 (345)
T ss_dssp             ----------------------------CCTTSSSEEEEEEECCCCBSS-CHHHHHHHHHTTCHHHHHTTBHHHHHHHTT
T ss_pred             ----------------------------cccccCceeEEeccccccccC-chhhhHhhhhccchhHHHHHHHHHhhhhcc
Confidence                                        124578999999999999995 999999999999999999999999999999


Q ss_pred             CcCCCCccCCcccCCCccccccccCCccccCCCCccccccccceeeecCCCccccccccCCCcccceeeeeeecccccCC
Q 001123          843 NVFQGMREADIKFPPTYKFEKHLAGLAGYDSGEKKRVPAWCDRILYRDSRSDLASECSLECPVASSILRYEACMDVTDSD  922 (1149)
Q Consensus       843 ~~f~gf~E~~I~F~PTYKyd~~~~g~~~yDts~k~R~PsWcDRIL~~~~~~~~~~~~~~~~p~~~~~~~Y~s~~~~~~SD  922 (1149)
                      .+|.+|.|++|+|+|||||+.+   ++.||++.|+|+|||||||||++..               .++.|.|+ ++..||
T Consensus       245 ~~~~~~~E~~I~F~PTyk~~~~---~~~yd~~~k~RiPsWcDRIL~~~~~---------------~~~~Y~s~-~~~~SD  305 (345)
T d1i9za_         245 KVFPFFSELPITFPPTYKFDIG---TDIYDTSDKHRVPAWTDRILYRGEL---------------VPHSYQSV-PLYYSD  305 (345)
T ss_dssp             SSSTTCBCCCCCSCCCBCBCTT---SSCBCCSTTCCCCBCCEEEEEESSC---------------EEEEEEEC-CCCSSS
T ss_pred             CcccCcccCCCCCCCCCeEECC---CCccCCCCCeeCccccceEEeeCce---------------eeeeeecc-CCCCCC
Confidence            9999999999999999999975   4689999999999999999999642               34789986 788999


Q ss_pred             CCceeeEEEEEccccCHHHHHHHHHHHhhcchhh
Q 001123          923 HKPVRCIFSVDIARVDESVRRQEFGDIMTSNEKV  956 (1149)
Q Consensus       923 HkPV~a~f~v~v~~vd~~~~~~~~~~i~~~~~~~  956 (1149)
                      ||||+|.|+|+++.+|+++|+++++|++++.++.
T Consensus       306 H~PV~a~f~v~v~~~~~~~~~~~~~~~~~~~~~~  339 (345)
T d1i9za_         306 HRPIYATYEANIVKVDREKKKILFEELYNQRKQE  339 (345)
T ss_dssp             BCCEEEEEEEEEEEECHHHHHHHHHHHHHHHHHH
T ss_pred             cccEEEEEEEEEEEECHHHHHHHHHHHHHHHHHH
Confidence            9999999999999999999999999999864443
>d2imqx1 d.151.1.2 (X:3-282) Salivary nitrophorin {Bedbug (Cimex lectularius) [TaxId: 79782]} Back     information, alignment and structure
>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2ovrb2 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1p22a2 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1pgua2 b.69.4.1 (A:327-613) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1pgua1 b.69.4.1 (A:2-326) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1yfqa_ b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2ovrb2 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sq9a_ b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1p22a2 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sq9a_ b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1pgua1 b.69.4.1 (A:2-326) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1k32a3 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1yfqa_ b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1hzua2 b.70.2.1 (A:118-543) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1pgua2 b.69.4.1 (A:327-613) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1qksa2 b.70.2.1 (A:136-567) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1l0qa2 b.69.2.3 (A:1-301) Surface layer protein {Archaeon Methanosarcina mazei [TaxId: 2209]} Back     information, alignment and structure
>d1hzua2 b.70.2.1 (A:118-543) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1k32a3 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1pbyb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1qksa2 b.70.2.1 (A:136-567) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1jmxb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1jmxb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1l0qa2 b.69.2.3 (A:1-301) Surface layer protein {Archaeon Methanosarcina mazei [TaxId: 2209]} Back     information, alignment and structure
>d2bbkh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d2madh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Gram negative methylotrophic bacteria (Thiobacillus versutus) [TaxId: 34007]} Back     information, alignment and structure
>d2madh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Gram negative methylotrophic bacteria (Thiobacillus versutus) [TaxId: 34007]} Back     information, alignment and structure
>d1ri6a_ b.69.11.1 (A:) Putative isomerase YbhE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1pbyb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d2bbkh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d2bgra1 b.70.3.1 (A:39-508) Dipeptidyl peptidase IV/CD26, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d2ddra1 d.151.1.3 (A:7-305) Sphingomyelin phosphodiesterase C {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d1mdah_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1zwxa1 d.151.1.3 (A:41-333) Sphingomyelin phosphodiesterase C {Listeria ivanovii [TaxId: 1638]} Back     information, alignment and structure
>d1ri6a_ b.69.11.1 (A:) Putative isomerase YbhE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1mdah_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1wdua_ d.151.1.1 (A:) Endonuclease domain of TRAS1 retrotransposon (ORF2) {Silkworm (Bombyx mori) [TaxId: 7091]} Back     information, alignment and structure
>d1qnia2 b.69.3.1 (A:10-450) Nitrous oxide reductase, N-terminal domain {Pseudomonas nautica [TaxId: 2743]} Back     information, alignment and structure
>d1qnia2 b.69.3.1 (A:10-450) Nitrous oxide reductase, N-terminal domain {Pseudomonas nautica [TaxId: 2743]} Back     information, alignment and structure
>d2bgra1 b.70.3.1 (A:39-508) Dipeptidyl peptidase IV/CD26, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1vyba_ d.151.1.1 (A:) Endonuclease domain of LINE-1 reverse transcriptase homolog {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2p4oa1 b.68.6.3 (A:4-305) Hypothetical protein All0351 homologue {Nostoc punctiforme [TaxId: 272131]} Back     information, alignment and structure
>d1q7fa_ b.68.9.1 (A:) Brain tumor cg10719-pa {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2f1na1 d.151.1.1 (A:1-250) Cytolethal distending toxin subunit B {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2a40b1 d.151.1.1 (B:1-260) Deoxyribonuclease I {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1sr4b_ d.151.1.1 (B:) Cytolethal distending toxin subunit B {Haemophilus ducreyi [TaxId: 730]} Back     information, alignment and structure
>d2p4oa1 b.68.6.3 (A:4-305) Hypothetical protein All0351 homologue {Nostoc punctiforme [TaxId: 272131]} Back     information, alignment and structure
>d1hd7a_ d.151.1.1 (A:) DNA repair endonuclease Hap1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2hqsa1 b.68.4.1 (A:163-431) TolB, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2dg1a1 b.68.6.1 (A:6-324) Lactonase Drp35 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1akoa_ d.151.1.1 (A:) DNA-repair enzyme exonuclease III {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1pjxa_ b.68.6.1 (A:) Diisopropylfluorophosphatase (phosphotriesterase, DFP) {Squid (Loligo vulgaris) [TaxId: 6622]} Back     information, alignment and structure
>d1q7fa_ b.68.9.1 (A:) Brain tumor cg10719-pa {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2dg1a1 b.68.6.1 (A:6-324) Lactonase Drp35 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1rwia_ b.68.9.1 (A:) Serine/threonine-protein kinase PknD {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2ghsa1 b.68.6.1 (A:20-314) Regucalcin {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1k32a2 b.68.7.1 (A:39-319) Tricorn protease N-terminal domain {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1jofa_ b.69.10.1 (A:) 3-carboxy-cis,cis-mucoante lactonizing enzyme {Neurospora crassa [TaxId: 5141]} Back     information, alignment and structure
>d1jofa_ b.69.10.1 (A:) 3-carboxy-cis,cis-mucoante lactonizing enzyme {Neurospora crassa [TaxId: 5141]} Back     information, alignment and structure
>d1pjxa_ b.68.6.1 (A:) Diisopropylfluorophosphatase (phosphotriesterase, DFP) {Squid (Loligo vulgaris) [TaxId: 6622]} Back     information, alignment and structure
>d1grwa_ b.1.11.2 (A:) Major sperm protein, MSP {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1rwia_ b.68.9.1 (A:) Serine/threonine-protein kinase PknD {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1rowa_ b.1.11.2 (A:) SSP-19 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1m1sa_ b.1.11.2 (A:) WR4 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d2hqsa1 b.68.4.1 (A:163-431) TolB, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1wica_ b.1.11.2 (A:) MSP domain containing protein 2, Mospd2 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1xfda1 b.70.3.1 (A:127-591) Dipeptidyl aminopeptidase-like protein 6, DPP6, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xfda1 b.70.3.1 (A:127-591) Dipeptidyl aminopeptidase-like protein 6, DPP6, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ghsa1 b.68.6.1 (A:20-314) Regucalcin {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1k32a2 b.68.7.1 (A:39-319) Tricorn protease N-terminal domain {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure