Citrus Sinensis ID: 001200

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820-------830-------840-------850-------860-------870-------880-------890-------900-------910-------920-------930-------940-------950-------960-------970-------980-------990------1000------1010------1020------1030------1040------1050------1060------1070------1080------1090------1100------1110------1120-----
MDLLKYGTGLHIFKGTYTMQETRDRLYALVHKLKDYCLLLDGPTEDWIRMHDLVREVAISIASRDRHVFMLRNDIQIEWPVADMLKNCPTIFLHDCKHWEVPEGLEYPQLEFFCMSPRDHSIKIPNHVFAGMSNLRGLALSNMQFLSLPSLFHLPLNLQTLCLDRCALGDIAIIGNLKKLEILSLVDSNIEQLPEEMAQLTQLRLFDLSGCSKLKVIPPNLLSGLSRLEDLYMGNTSVKWEFEGLNVGRSNASLQELKLLSHLTTLEIQICDAMILPKGLFSKKLERYKIFIGDEWDWSGNYKNKRVLKLKLYTSNVDEVIMQLKGIEELYLDEVPGIKNVLYDLDIEGFLQLKHLHVQNNPFILFIVDSMAWVRYNAFLLLESLVLHNLIHLEKICLGQLRAESFYKLKIIKVRNCDKLKNIFSFSFVRGLPQLQTLNVINCKNMKEIFTVGRENDVDCHEVDKIEFSQLHSLTLKFLPQLTSFYSQVKTSAASQTRLKELSTHTLPREVILEDECDTLMPFFNEKVVFPNLETLELCAISTEKIWCNQLAAVYSQNLTRLIVHGCEKLKYLFPSSMIRNFVQLEHLEICYCSSLESIVGKESGEEATTTFVFPKVTFLKLWNLSELKTFYPGTHTSKWPMLKKLEVYGCDKVKIFTSRFLRFQEINEGQFDIPTQQALFLVEKVTSKLEELKLSGKDIAMICQSQFPKHIFRNLKNLEVVNDESENFRIGFLERFHNLEKLELRWSSYKEIFSNEEIVEHAEMLTQVKSLKLWELSDLMYIWKQDSKLDSITENLESLEVWWCENLINLVPSSASFKNLTTLELWYCQRLMNLVTSSTAKSLVCLTKLRIDGCRMLTEIISKEEDVAEDEIVFSKLKWVSLERLENLTSFCSGNYTLKFPSLEDLFVIECPKMKIFSHRVLSTPRLREVRQNWGLYKGCWEGDLNTTIQQLQKNELPLLLPIASSSSSLAAPTTGNQVPLNLSGNRKTQSFSLQPPLRTTSPTFSSGKPAADNNPSLSLSSCSTRTKQKAVLKLEIHGEKARQKAFSIVSKFTGVLSILFDPKDKKMIVIGDIDAVPVVRKLRKQLCATELVSIGPANEHDNEEGERNIEESKNNADETQKQV
ccHHHHHHHcccccccccHHHHHHHHHHHHHHHHHcccccccccccEEEEcHHHHHHHHHHHcccccEEEEEcccccccccccccccccEEEccccccccccccccccccEEEEEccccccccccHHHHccccccEEEEEcccccccccccccccccccEEEcccccccccccccccccccEEEccccccccccHHccccccccEEEEEccccccccccccccccccccccccccccccccccccccccccccHHHHcccccccEEEEEEcccccccccccccccccccEEEccccccccccccccEEEEEcccccccHHHcccccccEEEcccccccccccccccccccccccEEEEEccccEEEEEcccccccccccccccEEEEEccccccccccccccccccccccEEEEEcccccccccccccccccccccEEEEccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEcccccccccccccccccccccccEEccccccccccccccccccccccEEEEEcccccccccccccccccccccEEEEEccccccEEcccccccccccccccccccEEEEEcccccccccccccccccccccEEEEEcccccEEcccccccccccccccccccccccccccccccccccEEEEccccccccccccccccccccccEEEEEccccccccHHHHcccccccEEEEEEcccEEccccHHHHHHccccccccEEEEccccccccccccccccccccccccEEEEEcccccccccccccccccccEEEEEcccccccccccccccccccccEEEEEccccccEEEcccccccccccccccccEEEEccccccccccccccccccccccEEEEccccccccccccccccccEEEEEEEcccccccccccccHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEccccccHHHHccccEEEEccccEEEEEEccccccEEEEcccccHHHHHHHHHHHHcccEEEcccccccccHHHcccHHHHcccHHHHHHcc
cHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHccccccccccEEEHHHHHHHHHHHHHcccccEEEEEcccccccccHcHHccEEEEEEccccHHHccccccccccEEEEEccccccccccHHHHHcccccEEEEccccccccccccHHHHHHccEEEcccccccccccHHHccccEEEEcccccHHHccHHHHHHHccEEEEccccccccEccccHHHHHHcccEEEEcccccEEcccccccccccccHHHHHHcccccEEEEEcccccccHHHccHHHHHHcEEEccccHcccccccHHHHHHHcccccccccHHHHcccccEEEEEccccccccccccccccccccEEEEEEccccEEEcccccccccccHcccccEEEEcccHcHHHHccccccccccccccEEEEcccHHHHHccccHHHcccccccEEEEcccHcHHHHHccccccccccccccccccccccEEEEccccccccccccccccccccccHHHccccccccHHHccccccccccccccccccccccEEEEEccccccccccccccccccccEEEEEcccccccccccHHHHHHHHcccEEEEcccHHHHHHcccccccccccccccccccEEEHcccccccHcccccccccccccEEEEEEcccccEEcccccccccHcccEEEEccccccHHccHHHcccHHHHHHHcHHHHHHHcccccHHHHcccccccEEEEccccccHHHHHccccccEEEEEccccEEEcccccccccccccccHcEEEEcccHcHHHccccccccccccccccEEEEEccccccccccccccccccEEEEEcccHHHHHcccHHHHHcHHHccEEEEcccHHHHHHHcccccccccccccccccEEEEccccccHHccccccccccccccEEEEEccccccEcccccccccccEEEEEEcccccccccccHHHHHHHHHHccccEEccccccccccccccccccccccccccHHHHHHccccccccccccccccccHHHcccccccccccHHHHHHHHHHHHccccccccccEEEEEcccccHEEcccccccHEEEEEccccccHHHHHHHHHHHHHEEEcccccccccccccccccEccccccHHHccc
mdllkygtglhifkgtytMQETRDRLYALVHKLKDYcllldgptedwIRMHDLVREVAISIASRDRHVFMLRNDIQIEwpvadmlkncptiflhdckhwevpegleypqleffcmsprdhsikipnhvFAGMSNLRGLALSnmqflslpslfhlplnlqtlcldrcalgdiaiignLKKLEILSLVDSNIEQLPEEMAQLTQLRLfdlsgcsklkvippnllsglsrledlymgnTSVKWEFeglnvgrsnaSLQELKLLSHLTTLEIQICDamilpkglfskKLERYKIFigdewdwsgnyknkrVLKLKLYTSNVDEVIMQLKGIEElyldevpgiknVLYDLDIEGFLQLKHLHVQNNPFILFIVDSMAWVRYNAFLLLESLVLHNLIHLEKICLGQLRAESFYKLKIIKVRNCDKLKNIFSfsfvrglpqlqtlnvincknmkeiftvgrendvdchevdkiefsqlhsltlkflpqlTSFYSQVKTSAASQTRLKElsthtlpreviledecdtlmpffnekvvfpnletlELCAISTEKIWCNQLAAVYSQNLTRLIVHGCeklkylfpssmirnfvqLEHLEICYcsslesivgkesgeeatttfvfpKVTFLKLwnlselktfypgthtskwpmlkklevygcdkvkiFTSRFLRFQeinegqfdiptqQALFLVEKVTSKLEELKLSGKDIAMICQsqfpkhifrnlknlevvndesenfRIGFLERFHNLEKLELRWSSYKEIFSNEEIVEHAEMLTQVKSLKLWELSDLMYIWKQDSKLDSITENLESLEVWWCENLinlvpssasfknltTLELWYCQRLMNLVTSSTAKSLVCLTKLRIDGCRMLTEIISkeedvaedEIVFSKLKWVSLERLEnltsfcsgnytlkfpsledlfviecpkmkifshrvlstprlrevrqnwglykgcwegdLNTTIQQLQKnelplllpiassssslaapttgnqvplnlsgnrktqsfslqpplrttsptfssgkpaadnnpslslsscstRTKQKAVLKLEIHGEKARQKAFSIVSKFTGVlsilfdpkdkkmivigdidaVPVVRKLRKQLCATELvsigpanehdneegernieesknnadetqkqv
mdllkygtglhifkgtytmqeTRDRLYALVHKLKDYCLLLDGPTEDWIRMHDLVREVAISiasrdrhvFMLRNDIQIEWPVADMLKNCPTIFLHDCKHWEVPEGLEYPQLEFFCMSPRDHSIKIPNHVFAGMSNLRGLALSNMQFLSLPSLFHLPLNLQTLCLDRCALGDIAIIGNLKKLEILSLVDSNIEQLPEEMAQLTQLRLFDLSGCSKLKVIPPNLLSGLSRLEDLYMGNTSVKWEFEGLNVGRSNASLQELKLLSHLTTLEIQICDAMILPKGLFSKKLERYKIFigdewdwsgnykNKRVLKLKLYTSNVDEVIMQLKGIEELYLDEVPGIKNVLYDLDIEGFLQLKHLHVQNNPFILFIVDSMAWVRYNAFLLLESLVLHNLIHLEKICLGQLRAESFYKLKIIKVRNCDKLKNIFSfsfvrglpqlqTLNVINCKNMKEIFTVGRENDVDCHEVDKIEFSQLHSLTLKFLPQLTSFYSQVKTSAasqtrlkelsthtlprevILEDECDTLMPFFNEKVVFPNLETLELCAISTEKIWCNQLAAVYSQNLTRLIVHGCEKLKYLFPSSMIRNFVQLEHLEICYCSSLESIVGKESGEEATTTFVFPKVTFLKLWNLSELKTfypgthtskwpmlKKLEVYGCDKVKIFTSRFLRFQEINEGQFDIPTQQALFLVEKVTSKLEELKLSGKDIAMICQSQFPKHIFRNLKNLEVVNDESENFRIGFLERFHNLEKLELRWSSYKEIFSNEEIVEHAEMLTQVKSLKLWELSDLMYIWKQDSKLDSITENLESLEVWWCENLINLVPSSASFKNLTTLELWYCQRLMNLvtsstakslVCLTKLRIDGCRMLTEIiskeedvaedeIVFSKLKWVSLERLENLTSFCSGNYTLKFPSLEDLFVIECPKMKifshrvlstprlREVRQNWGLYKGCWEGDLNTTIQQLQKNELPLLLPIASSSSSLAAPTTGNQVPLNLSGNRKTQSFSLQPPLRTTSPTfssgkpaadnnpslslsscsTRTKQKAVLKLEIHGEKARQKAFSIVSKFTGVLSIlfdpkdkkmiviGDIDAVPVVRKLRKQLCATElvsigpanehdneegernieesknnadetqkqv
MDLLKYGTGLHIFKGTYTMQETRDRLYALVHKLKDYCLLLDGPTEDWIRMHDLVREVAISIASRDRHVFMLRNDIQIEWPVADMLKNCPTIFLHDCKHWEVPEGLEYPQLEFFCMSPRDHSIKIPNHVFAGMSNLRGLALSNMQflslpslfhlplnlQTLCLDRCALGDIAIIGNLKKLEILSLVDSNIEQLPEEMAQLTQLRLFDLSGCSKLKVIPPNLLSGLSRLEDLYMGNTSVKWEFEGLNVGRSNASLQELKLLSHLTTLEIQICDAMILPKGLFSKKLERYKIFIGDEWDWSGNYKNKRVLKLKLYTSNVDEVIMQLKGIEELYLDEVPGIKNVLYDLDIEGFLQLKHLHVQNNPFILFIVDSMAWVRYNAFLLLESLVLHNLIHLEKICLGQLRAESFYKLKIIKVRNCDKLKNIFSFSFVRGLPQLQTLNVINCKNMKEIFTVGRENDVDCHEVDKIEFSQLHSLTLKFLPQLTSFYSQVKTSAASQTRLKELSTHTLPREVILEDECDTLMPFFNEKVVFPNLETLELCAISTEKIWCNQLAAVYSQNLTRLIVHGCEKLKYLFPSSMIRNFVQLEHLEICYCSSLESIVGKESGEEATTTFVFPKVTFLKLWNLSELKTFYPGTHTSKWPMLKKLEVYGCDKVKIFTSRFLRFQEINEGQFDIPTQQALFLVEKVTSKLEELKLSGKDIAMICQSQFPKHIFRNLKNLEVVNDESENFRIGFLERFHNLEKLELRWSSYKEIFSNEEIVEHAEMLTQVKSLKLWELSDLMYIWKQDSKLDSITENLESLEVWWCENLINLVPSSASFKNLTTLELWYCQRLMNLVTSSTAKSLVCLTKLRIDGCRMLTEIISKEEDVAEDEIVFSKLKWVSLERLENLTSFCSGNYTLKFPSLEDLFVIECPKMKIFSHRVLSTPRLREVRQNWGLYKGCWEGDLNTTIQQLQKNElplllpiassssslaapTTGNQVPLNLSGNRKTQSFSLQPPLRTTSPTFSSGKPAADNNPSLSLSSCSTRTKQKAVLKLEIHGEKARQKAFSIVSKFTGVLSILFDPKDKKMIVIGDIDAVPVVRKLRKQLCATELVSIGPANEHDNEEGERNIEESKNNADETQKQV
***LKYGTGLHIFKGTYTMQETRDRLYALVHKLKDYCLLLDGPTEDWIRMHDLVREVAISIASRDRHVFMLRNDIQIEWPVADMLKNCPTIFLHDCKHWEVPEGLEYPQLEFFCMSPRDHSIKIPNHVFAGMSNLRGLALSNMQFLSLPSLFHLPLNLQTLCLDRCALGDIAIIGNLKKLEILSLVDSNIEQLPEEMAQLTQLRLFDLSGCSKLKVIPPNLLSGLSRLEDLYMGNTSVKWEFEGLNVGRSNASLQELKLLSHLTTLEIQICDAMILPKGLFSKKLERYKIFIGDEWDWSGNYKNKRVLKLKLYTSNVDEVIMQLKGIEELYLDEVPGIKNVLYDLDIEGFLQLKHLHVQNNPFILFIVDSMAWVRYNAFLLLESLVLHNLIHLEKICLGQLRAESFYKLKIIKVRNCDKLKNIFSFSFVRGLPQLQTLNVINCKNMKEIFTVGRENDVDCHEVDKIEFSQLHSLTLKFLPQLTSFYSQVKT*******LKELSTHTLPREVILEDECDTLMPFFNEKVVFPNLETLELCAISTEKIWCNQLAAVYSQNLTRLIVHGCEKLKYLFPSSMIRNFVQLEHLEICYCSSLESIVGKESGEEATTTFVFPKVTFLKLWNLSELKTFYPGTHTSKWPMLKKLEVYGCDKVKIFTSRFLRFQEINEGQFDIPTQQALFLVEKVTSKLEELKLSGKDIAMICQSQFPKHIFRNLKNLEVVNDESENFRIGFLERFHNLEKLELRWSSYKEIFSNEEIVEHAEMLTQVKSLKLWELSDLMYIWKQDSKLDSITENLESLEVWWCENLINLVPSSASFKNLTTLELWYCQRLMNLVTSSTAKSLVCLTKLRIDGCRMLTEIISKEEDVAEDEIVFSKLKWVSLERLENLTSFCSGNYTLKFPSLEDLFVIECPKMKIFSHRVLSTPRLREVRQNWGLYKGCWEGDLNTTIQQLQKNELPLLLP*********************************************************************VLKLEIHGEKARQKAFSIVSKFTGVLSILFDPKDKKMIVIGDIDAVPVVRKLRKQLCATELVSI*****************************
MDLLKYGTGLHIFKGTYTMQETRDRLYALVHKLKDYCLLLDGPTEDWIRMHDLVREVAISIASRDRHVFMLRNDIQIEWPVADMLKNCPTIFLHDCKHWEVPEGLEYPQLEFFCMSPRDHSIKIPNHVFAGMSNLRGLALSNMQFLSLPSLFHLPLNLQTLCLDRCALGDIAIIGNLKKLEILSLVDSNIEQLPEEMAQLTQLRLFDLSGCSKLKVIPPNLLSGLSRLEDLYMGNTSVKWEFEGLNVGRSNASLQELKLLSHLTTLEIQICDAMILPKGLFSKKLERYKIFIGDEWDWSGNYKNKRVLKLKLYTSNVDEVIMQLKGIEELYLDEVPGIKNVLYDLDIEGFLQLKHLHVQNNPFILFIVDSMAWVRYNAFLLLESLVLHNLIHLEKICLGQLRAESFYKLKIIKVRNCDKLKNIFSFSFVRGLPQLQTLNVINCKNMKEIFTVGRE******EVDKIEFSQLHSLTLKFLPQLTSFYSQVKTSAASQTRLKELSTHTLPREVILEDECDTLMPFFNEKVVFPNLETLELCAISTEKIWCNQLAAVYSQNLTRLIVHGCEKLKYLFPSSMIRNFVQLEHLEICYCSSLESIVGK*********FVFPKVTFLKLWNLSELKTFYPGTHTSKWPMLKKLEVYGCDKVKIFTSRFLRFQEINEGQFDIPTQQALFLVEKVTSKLEELKLSGKDIAMICQSQFPKHIFRNLKNLEVVNDESENFRIGFLERFHNLEKLELRWSSYKEIF*************QVKSLKLWELSDLMYIWKQDSKLDSITENLESLEVWWCENLINLVPSSASFKNLTTLELWYCQRLMNLVTSSTAKSLVCLTKLRIDGCRMLTEIIS*********IVFSKLKWVSLERLENLTSFCSGNYTLKFPSLEDLFVIECPKMKIFSHR*LSTPRLREVRQNWGLYKGCWEGDLNTTIQQLQKNELPL*******************VPLNLSGNRKTQSFSLQPPLRTTSPTF*************************AVLKLEIHGEKARQKAFSIVSKFTGVLSILFDPKDKKMIVIGDIDAVPVVRKLRKQLCATELVSI*****************************
MDLLKYGTGLHIFKGTYTMQETRDRLYALVHKLKDYCLLLDGPTEDWIRMHDLVREVAISIASRDRHVFMLRNDIQIEWPVADMLKNCPTIFLHDCKHWEVPEGLEYPQLEFFCMSPRDHSIKIPNHVFAGMSNLRGLALSNMQFLSLPSLFHLPLNLQTLCLDRCALGDIAIIGNLKKLEILSLVDSNIEQLPEEMAQLTQLRLFDLSGCSKLKVIPPNLLSGLSRLEDLYMGNTSVKWEFEGLNVGRSNASLQELKLLSHLTTLEIQICDAMILPKGLFSKKLERYKIFIGDEWDWSGNYKNKRVLKLKLYTSNVDEVIMQLKGIEELYLDEVPGIKNVLYDLDIEGFLQLKHLHVQNNPFILFIVDSMAWVRYNAFLLLESLVLHNLIHLEKICLGQLRAESFYKLKIIKVRNCDKLKNIFSFSFVRGLPQLQTLNVINCKNMKEIFTVGRENDVDCHEVDKIEFSQLHSLTLKFLPQLTSFYSQ**********LKELSTHTLPREVILEDECDTLMPFFNEKVVFPNLETLELCAISTEKIWCNQLAAVYSQNLTRLIVHGCEKLKYLFPSSMIRNFVQLEHLEICYCSSLESIVGKESGEEATTTFVFPKVTFLKLWNLSELKTFYPGTHTSKWPMLKKLEVYGCDKVKIFTSRFLRFQEINEGQFDIPTQQALFLVEKVTSKLEELKLSGKDIAMICQSQFPKHIFRNLKNLEVVNDESENFRIGFLERFHNLEKLELRWSSYKEIFSNEEIVEHAEMLTQVKSLKLWELSDLMYIWKQDSKLDSITENLESLEVWWCENLINLVPSSASFKNLTTLELWYCQRLMNLVTSSTAKSLVCLTKLRIDGCRMLTEIISKEEDVAEDEIVFSKLKWVSLERLENLTSFCSGNYTLKFPSLEDLFVIECPKMKIFSHRVLSTPRLREVRQNWGLYKGCWEGDLNTTIQQLQKNELPLLLPIASSSSSLAAPTTGNQVPLNLSGNRKTQSFSLQPPLRTTSPTFSSGKPAADNNPSLSLSSCSTRTKQKAVLKLEIHGEKARQKAFSIVSKFTGVLSILFDPKDKKMIVIGDIDAVPVVRKLRKQLCATELVSIGPAN*************************
MDLLKYGTGLHIFKGTYTMQETRDRLYALVHKLKDYCLLLDGPTEDWIRMHDLVREVAISIASRDRHVFMLRNDIQIEWPVADMLKNCPTIFLHDCKHWEVPEGLEYPQLEFFCMSPRDHSIKIPNHVFAGMSNLRGLALSNMQFLSLPSLFHLPLNLQTLCLDRCALGDIAIIGNLKKLEILSLVDSNIEQLPEEMAQLTQLRLFDLSGCSKLKVIPPNLLSGLSRLEDLYMGNTSVKWEFEGLNVGRSNASLQELKLLSHLTTLEIQICDAMILPKGLFSKKLERYKIFIGDEWDWSGNYKNKRVLKLKLYTSNVDEVIMQLKGIEELYLDEVPGIKNVLYDLDIEGFLQLKHLHVQNNPFILFIVDSMAWVRYNAFLLLESLVLHNLIHLEKICLGQLRAESFYKLKIIKVRNCDKLKNIFSFSFVRGLPQLQTLNVINCKNMKEIFTVGRENDVDCHEVDKIEFSQLHSLTLKFLPQLTSFYSQVKTSAASQTRLKELSTHTLPREVILEDECDTLMPFFNEKVVFPNLETLELCAISTEKIWCNQLAAVYSQNLTRLIVHGCEKLKYLFPSSMIRNFVQLEHLEICYCSSLESIVGKESGEEATTTFVFPKVTFLKLWNLSELKTFYPGTHTSKWPMLKKLEVYGCDKVKIFTSRFLRFQEINEGQFDIPTQQALFLVEKVTSKLEELKLSGKDIAMICQSQFPKHIFRNLKNLEVVNDESENFRIGFLERFHNLEKLELRWSSYKEIFSNEEIVEHAEMLTQVKSLKLWELSDLMYIWKQDSKLDSITENLESLEVWWCENLINLVPSSASFKNLTTLELWYCQRLMNLVTSSTAKSLVCLTKLRIDGCRMLTEIISKEEDVAEDEIVFSKLKWVSLERLENLTSFCSGNYTLKFPSLEDLFVIECPKMKIFSHRVLSTPRLREVRQNWGLYKGCWEGDLNTTIQQLQKNELPLLLPIASSSSSLAAPTTGNQVPLNLSGNRKTQSFSLQPPLRTTSPTFSSGKPAADNNPSLSLSSCSTRTKQKAVLKLEIHGEKARQKAFSIVSKFTGVLSILFDPKDKKMIVIGDIDAVPVVRKLRKQLCATELVSIGP***************************
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MDLLKYGTGLHIFKGTYTMQETRDRLYALVHKLKDYCLLLDGPTEDWIRMHDLVREVAISIASRDRHVFMLRNDIQIEWPVADMLKNCPTIFLHDCKHWEVPEGLEYPQLEFFCMSPRDHSIKIPNHVFAGMSNLRGLALSNMQFLSLPSLFHLPLNLQTLCLDRCALGDIAIIGNLKKLEILSLVDSNIEQLPEEMAQLTQLRLFDLSGCSKLKVIPPNLLSGLSRLEDLYMGNTSVKWEFEGLNVGRSNASLQELKLLSHLTTLEIQICDAMILPKGLFSKKLERYKIFIGDEWDWSGNYKNKRVLKLKLYTSNVDEVIMQLKGIEELYLDEVPGIKNVLYDLDIEGFLQLKHLHVQNNPFILFIVDSMAWVRYNAFLLLESLVLHNLIHLEKICLGQLRAESFYKLKIIKVRNCDKLKNIFSFSFVRGLPQLQTLNVINCKNMKEIFTVGRENDVDCHEVDKIEFSQLHSLTLKFLPQLTSFYSQVKTSAASQTRLKELSTHTLPREVILEDECDTLMPFFNEKVVFPNLETLELCAISTEKIWCNQLAAVYSQNLTRLIVHGCEKLKYLFPSSMIRNFVQLEHLEICYCSSLESIVGKESGEEATTTFVFPKVTFLKLWNLSELKTFYPGTHTSKWPMLKKLEVYGCDKVKIFTSRFLRFQEINEGQFDIPTQQALFLVEKVTSKLEELKLSGKDIAMICQSQFPKHIFRNLKNLEVVNDESENFRIGFLERFHNLEKLELRWSSYKEIFSNEEIVEHAEMLTQVKSLKLWELSDLMYIWKQDSKLDSITENLESLEVWWCENLINLVPSSASFKNLTTLELWYCQRLMNLVTSSTAKSLVCLTKLRIDGCRMLTEIISKEEDVAEDEIVFSKLKWVSLERLENLTSFCSGNYTLKFPSLEDLFVIECPKMKIFSHRVLSTPRLREVRQNWGLYKGCWEGDLNTTIQQLQKNELPLLLPIASSSSSLAAPTTGNQVPLNLSGNRKTQSFSLQPPLRTTSPTFSSGKPAADNNPSLSLSSCSTRTKQKAVLKLEIHGEKARQKAFSIVSKFTGVLSILFDPKDKKMIVIGDIDAVPVVRKLRKQLCATELVSIGPANEHDxxxxxxxxxxxxxxxxxxxxxV
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query1125 2.2.26 [Sep-21-2011]
O81825919 Probable disease resistan yes no 0.424 0.519 0.266 2e-30
Q9T048985 Disease resistance protei no no 0.362 0.414 0.260 1e-23
Q42484909 Disease resistance protei no no 0.367 0.454 0.245 8e-16
O35930734 Platelet glycoprotein Ib yes no 0.162 0.249 0.296 2e-07
Q9SH22884 Probable disease resistan no no 0.355 0.452 0.232 5e-06
P07359626 Platelet glycoprotein Ib yes no 0.122 0.220 0.296 1e-05
Q01513 2145 Adenylate cyclase OS=Podo yes no 0.073 0.038 0.369 2e-05
Q9RBS21024 Protein PopC OS=Ralstonia yes no 0.096 0.105 0.351 9e-05
Q9SI85893 Probable disease resistan no no 0.346 0.436 0.228 0.0002
Q01631 2300 Adenylate cyclase OS=Neur N/A no 0.090 0.044 0.361 0.0003
>sp|O81825|DRL28_ARATH Probable disease resistance protein At4g27220 OS=Arabidopsis thaliana GN=At4g27220 PE=2 SV=1 Back     alignment and function desciption
 Score =  135 bits (340), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 132/496 (26%), Positives = 224/496 (45%), Gaps = 19/496 (3%)

Query: 2   DLLKYGTGLHIFKGTYTMQETRDRLYALVHKLKDYCLLLDGPTEDWIRMHDLVREVAI-- 59
           +L+ Y     +  G +  ++  +    LV +LKD CLL DG + D ++MHD+VR+ AI  
Sbjct: 383 ELIMYWVAEGLLDGQHHYEDMMNEGVTLVERLKDSCLLEDGDSCDTVKMHDVVRDFAIWF 442

Query: 60  -SIASRDRHVFMLRNDIQIEWPVADMLKNCPTIFLHDCKHWEVPEG-LEYPQLEFFCMSP 117
            S      H  ++     IE+P    + +   + L   K   +P   +E  +     +  
Sbjct: 443 MSSQGEGFHSLVMAGRGLIEFPQDKFVSSVQRVSLMANKLERLPNNVIEGVETLVLLLQG 502

Query: 118 RDHSIKIPNHVFAGMSNLRGLALSNMQFLSLPSLFHLPLNLQTLCLDRC-ALGDIAIIGN 176
             H  ++PN       NLR L LS ++  +LP  F    +L++L L  C  L ++  + +
Sbjct: 503 NSHVKEVPNGFLQAFPNLRILDLSGVRIRTLPDSFSNLHSLRSLVLRNCKKLRNLPSLES 562

Query: 177 LKKLEILSLVDSNIEQLPEEMAQLTQLRLFDLSGCSKLKVIPPNLLSGLSRLEDLYMGNT 236
           L KL+ L L +S I +LP  +  L+ LR   +S   +L+ IP   +  LS LE L M  +
Sbjct: 563 LVKLQFLDLHESAIRELPRGLEALSSLRYICVSNTYQLQSIPAGTILQLSSLEVLDMAGS 622

Query: 237 SVKWEFEGLNVGRSNASLQELKLLSHLTTLEIQICDAMILPKGL--FSKKLERYKIFIGD 294
           +  W  +G       A+L E+  L HL  L I++ D +         +K+L +++     
Sbjct: 623 AYSWGIKG-EEREGQATLDEVTCLPHLQFLAIKLLDVLSFSYEFDSLTKRLTKFQFLFSP 681

Query: 295 EWDWSGNYKNKRVLKLKLYTSNVDEVIMQLKGIEELYLDEVPGIKNVLYDLDIE---GFL 351
               S     +  L +     +   +   L+ +  L L+   G+  +  +L  +    F+
Sbjct: 682 IRSVSPPGTGEGCLAISDVNVSNASIGWLLQHVTSLDLNYCEGLNGMFENLVTKSKSSFV 741

Query: 352 QLKHLHVQNNPFILFIVDSMAWVRYNAFLLLESLVLHNLIHLEKIC-LGQLRAESFYKLK 410
            +K L +   P +   + S    + + F  LE L L N ++LE I  L         KLK
Sbjct: 742 AMKALSIHYFPSL--SLASGCESQLDLFPNLEELSLDN-VNLESIGELNGFLGMRLQKLK 798

Query: 411 IIKVRNCDKLKNIFSFSFVRG-LPQLQTLNVINCKNMKEIFTVGRENDVDCHEVDKIEFS 469
           +++V  C +LK +FS   + G LP LQ + V++C  ++E+F         C E       
Sbjct: 799 LLQVSGCRQLKRLFSDQILAGTLPNLQEIKVVSCLRLEELFNFSSVPVDFCAES---LLP 855

Query: 470 QLHSLTLKFLPQLTSF 485
           +L  + LK+LPQL S 
Sbjct: 856 KLTVIKLKYLPQLRSL 871
Probable disease resistance protein.
Arabidopsis thaliana (taxid: 3702)
>sp|Q9T048|DRL27_ARATH Disease resistance protein At4g27190 OS=Arabidopsis thaliana GN=At4g27190 PE=2 SV=1 Back     alignment and function description
>sp|Q42484|RPS2_ARATH Disease resistance protein RPS2 OS=Arabidopsis thaliana GN=RPS2 PE=1 SV=1 Back     alignment and function description
>sp|O35930|GP1BA_MOUSE Platelet glycoprotein Ib alpha chain OS=Mus musculus GN=Gp1ba PE=2 SV=2 Back     alignment and function description
>sp|Q9SH22|DRL20_ARATH Probable disease resistance protein At1g63360 OS=Arabidopsis thaliana GN=At1g63360 PE=2 SV=1 Back     alignment and function description
>sp|P07359|GP1BA_HUMAN Platelet glycoprotein Ib alpha chain OS=Homo sapiens GN=GP1BA PE=1 SV=1 Back     alignment and function description
>sp|Q01513|CYAA_PODAS Adenylate cyclase OS=Podospora anserina PE=3 SV=1 Back     alignment and function description
>sp|Q9RBS2|POPC_RALSO Protein PopC OS=Ralstonia solanacearum (strain GMI1000) GN=popC PE=4 SV=2 Back     alignment and function description
>sp|Q9SI85|DRL14_ARATH Probable disease resistance protein At1g62630 OS=Arabidopsis thaliana GN=At1g62630 PE=3 SV=2 Back     alignment and function description
>sp|Q01631|CYAA_NEUCR Adenylate cyclase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=cr-1 PE=3 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query1125
359488108 1436 PREDICTED: disease resistance protein At 0.824 0.646 0.406 1e-171
2960878721152 unnamed protein product [Vitis vinifera] 0.755 0.737 0.426 1e-167
224111296 1315 cc-nbs-lrr resistance protein [Populus t 0.770 0.659 0.408 1e-162
359488288 1340 PREDICTED: LOW QUALITY PROTEIN: probable 0.737 0.619 0.390 1e-160
224143316 1337 cc-nbs-lrr resistance protein [Populus t 0.772 0.649 0.400 1e-157
255563252 1603 Disease resistance protein RPS5, putativ 0.870 0.610 0.380 1e-156
224111284 1340 cc-nbs-lrr resistance protein [Populus t 0.794 0.667 0.386 1e-151
359488027 1520 PREDICTED: disease resistance protein At 0.816 0.603 0.378 1e-151
255542484 2460 phosphoprotein phosphatase, putative [Ri 0.778 0.356 0.405 1e-151
2240834341144 cc-nbs-lrr resistance protein [Populus t 0.578 0.569 0.456 1e-146
>gi|359488108|ref|XP_003633701.1| PREDICTED: disease resistance protein At4g27190-like [Vitis vinifera] Back     alignment and taxonomy information
 Score =  610 bits (1572), Expect = e-171,   Method: Compositional matrix adjust.
 Identities = 407/1001 (40%), Positives = 572/1001 (57%), Gaps = 73/1001 (7%)

Query: 2    DLLKYGTGLHIFKGTYTMQETRDRLYALVHKLKDYCLLLDGPTEDWIRMHDLVREVAISI 61
            DLLKYG GL +F+GT T++E ++R+ ALV  LK    LL+     ++RMHDLVR  A  I
Sbjct: 421  DLLKYGVGLRLFQGTNTLEEAKNRIDALVDNLKSSNFLLETGHNAFVRMHDLVRSTARKI 480

Query: 62   ASRDRHVFMLRND-IQIE-WPVADMLKNCPTIFLHDCKHWEVPEGLEYPQLEFF-CMSPR 118
            AS   HVF L+N  +++E WP  D L+    + LHDC   E+PEGL  P+LE F C    
Sbjct: 481  ASDQHHVFTLQNTTVRVEGWPRIDELQKVTWVSLHDCDIRELPEGLACPKLELFGCYDVN 540

Query: 119  DHS-IKIPNHVFAGMSNLRGLALSNMQFLSLPSLFHLPLNLQTLCLDRCALGDIAIIGNL 177
             +S ++IPN+ F  M  L+ L LS MQ  SLP   H   NL+TLCLD C LG+I II  L
Sbjct: 541  TNSAVQIPNNFFEEMKQLKVLDLSRMQLPSLPLSCHCRTNLRTLCLDGCNLGEIVIIAEL 600

Query: 178  KKLEILSLVDSNIEQLPEEMAQLTQLRLFDLSGCSKLKVIPPNLLSGLSRLEDLYMGNTS 237
            KKLEILSL  S+IE+LP E+AQLT LRLFDL G  KLKVIPP+++S LS+LEDL M N+ 
Sbjct: 601  KKLEILSLTYSDIEKLPREIAQLTHLRLFDLKGSYKLKVIPPDVISSLSQLEDLCMENSF 660

Query: 238  VKWEFEGLNVGRSNASLQELKLLSHLTTLEIQICDAMILPKGLFSKKLERYKIFIGDEWD 297
             +WE E    G+SNA L ELK LSHLT+L+IQI DA +LPK +    L RY+IF+GD W 
Sbjct: 661  TQWEGE----GKSNACLAELKHLSHLTSLDIQIPDAKLLPKDIVFDTLVRYRIFVGDVWS 716

Query: 298  WSGNYKNKRVLKLKLYTSN---VDEVIMQLKGIEELYLDEVPGIKNVLYDLDIEGFLQLK 354
            W G  +  + L+L  + ++   VD +I  LK  E+L+L E+ G  NVL  LD EGFL+LK
Sbjct: 717  WGGISEANKTLQLNKFDTSLHLVDGIIKLLKRTEDLHLRELCGGTNVLSKLDGEGFLKLK 776

Query: 355  HLHVQNNPFILFIVDSMAWV-RYNAFLLLESLVLHNLIHLEKICLGQLRAESFYKLKIIK 413
            HL+V+++P I +IV+SM     + AF ++E+L L+ LI+L+++C GQ  A SF  L+ ++
Sbjct: 777  HLNVESSPEIQYIVNSMDLTPSHGAFPVMETLSLNQLINLQEVCRGQFPAGSFGCLRKVE 836

Query: 414  VRNCDKLKNIFSFSFVRGLPQLQTLNVINCKNMKEIFTVGRENDVDCHEVDKIEFSQLHS 473
            V +CD LK +FS S  RGL +L+   V  CK+M E+ + GR+ ++    V+   F +L S
Sbjct: 837  VEDCDGLKFLFSLSVARGLSRLEETKVTRCKSMVEMVSQGRK-EIKEDAVNVPLFPELRS 895

Query: 474  LTLKFLPQLTSF-YSQVKTSAASQTRLKELSTHTLPREVILEDECDTLMPFFNEKVVFPN 532
            LTL+ LP+L++F + +    +   + +   ST  L +  I + +       F+   +  N
Sbjct: 896  LTLEDLPKLSNFCFEENPVLSKPASTIVGPSTPPLNQPEIRDGQL-----LFS---LGGN 947

Query: 533  LETLEL-CAISTEKIWCNQLAAVYSQNLTRLIVHGCEKLKYLF---------------PS 576
            L +L L   +S  K++   L     QNL  L V  C+KL+ +F               P 
Sbjct: 948  LRSLNLKKCMSLLKLFPPSLL----QNLQELTVENCDKLEQVFDLEELNVDDGHVGLLPK 1003

Query: 577  SMIRNFVQLEHL-EICYCSSLESIVGKESGEEATTTFVFPKVTFLKLWNLSELKTFY-PG 634
                  + L  L  IC C S  +              +FPK+ ++ L  L  L +F  PG
Sbjct: 1004 LGKLRLIDLPKLRHICNCGSSRNHFPSSMASAPVGNIIFPKLFYISLGFLPNLTSFVSPG 1063

Query: 635  THT------------------SKWPMLKKLEVYGCDKVKIFTSRFLRFQEIN-EGQFDIP 675
             H+                   +WP+L++L V  C K+ +F      FQ+ + EG  D+P
Sbjct: 1064 YHSLQRLHHADLDTPFPVLFDERWPLLEELRVSECYKLDVFAFETPTFQQRHGEGNLDMP 1123

Query: 676  TQQALFLVEKVTSKLEELKLSGKDIAMICQSQFPKHIFRNLKNLEVVNDESENFRIG--F 733
                 FL       LEEL+L       I   QFP   F  L+ L V +       I    
Sbjct: 1124 L---FFLPHVAFPNLEELRLGDNRDTEIWPEQFPVDSFPRLRVLHVHDYRDILVVIPSFM 1180

Query: 734  LERFHNLEKLEL-RWSSYKEIFSNEEIVE--HAEMLTQVKSLKLWELSDLMYIWKQDSKL 790
            L+R HNLE L++   SS KE+F  E + E   A+ L +++ ++L +L  L  +WK++S+ 
Sbjct: 1181 LQRLHNLEVLKVGSCSSVKEVFQLEGLDEENQAKRLGRLREIELHDLPGLTRLWKENSEP 1240

Query: 791  DSITENLESLEVWWCENLINLVPSSASFKNLTTLELWYCQRLMNLVTSSTAKSLVCLTKL 850
                ++LESLEVW C +LINLVPSS SF+NL TL++  C  L +L++ S AKSLV L  L
Sbjct: 1241 GLDLQSLESLEVWNCGSLINLVPSSVSFQNLATLDVQSCGSLRSLISPSVAKSLVKLKTL 1300

Query: 851  RIDGCRMLTEIISKEEDVAEDEIVFSKLKWVSLERLENLTSFCSGNYTLKFPSLEDLFVI 910
            +I    M+ E+++ E   A DEI F KL+ + L  L NLTSF SG Y   FPSLE + V 
Sbjct: 1301 KIGRSDMMEEVVANEGGEATDEITFYKLQHMELLYLPNLTSFSSGGYIFSFPSLEQMLVK 1360

Query: 911  ECPKMKIFSHRVLSTPRLREVRQNWGLYKGCWEGDLNTTIQ 951
            ECPKMK+FS  +++ PRL+ ++   G  +  W+ DLNT I 
Sbjct: 1361 ECPKMKMFSPSLVTPPRLKRIK--VGDEEWPWQDDLNTAIH 1399

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|296087872|emb|CBI35155.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|224111296|ref|XP_002332952.1| cc-nbs-lrr resistance protein [Populus trichocarpa] gi|222834264|gb|EEE72741.1| cc-nbs-lrr resistance protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|359488288|ref|XP_003633735.1| PREDICTED: LOW QUALITY PROTEIN: probable disease resistance protein At1g61310-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|224143316|ref|XP_002336027.1| cc-nbs-lrr resistance protein [Populus trichocarpa] gi|222838884|gb|EEE77235.1| cc-nbs-lrr resistance protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|255563252|ref|XP_002522629.1| Disease resistance protein RPS5, putative [Ricinus communis] gi|223538105|gb|EEF39716.1| Disease resistance protein RPS5, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|224111284|ref|XP_002332949.1| cc-nbs-lrr resistance protein [Populus trichocarpa] gi|222834261|gb|EEE72738.1| cc-nbs-lrr resistance protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|359488027|ref|XP_002269288.2| PREDICTED: disease resistance protein At4g27190-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|255542484|ref|XP_002512305.1| phosphoprotein phosphatase, putative [Ricinus communis] gi|223548266|gb|EEF49757.1| phosphoprotein phosphatase, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|224083434|ref|XP_002307025.1| cc-nbs-lrr resistance protein [Populus trichocarpa] gi|222856474|gb|EEE94021.1| cc-nbs-lrr resistance protein [Populus trichocarpa] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query1125
TAIR|locus:2131689919 AT4G27220 [Arabidopsis thalian 0.422 0.516 0.264 4.2e-29
TAIR|locus:2136447985 AT4G27190 [Arabidopsis thalian 0.363 0.415 0.254 2.8e-19
TAIR|locus:2025421177 AT1G01490 [Arabidopsis thalian 0.081 0.519 0.442 2.8e-13
TAIR|locus:2172808103 AT5G23760 "AT5G23760" [Arabido 0.083 0.912 0.453 8.8e-12
TAIR|locus:2149594139 AT5G52750 [Arabidopsis thalian 0.057 0.467 0.560 3.9e-11
TAIR|locus:2149584118 AT5G52740 "AT5G52740" [Arabido 0.065 0.627 0.454 6.3e-11
TAIR|locus:2149614126 AT5G52760 [Arabidopsis thalian 0.059 0.531 0.521 8.1e-11
TAIR|locus:2005517909 RPS2 "RESISTANT TO P. SYRINGAE 0.248 0.308 0.237 0.00032
TAIR|locus:21171491201 AT4G19050 [Arabidopsis thalian 0.363 0.340 0.237 1.7e-08
TAIR|locus:2094498 1981 AT3G25510 [Arabidopsis thalian 0.233 0.132 0.242 2e-06
TAIR|locus:2131689 AT4G27220 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 359 (131.4 bits), Expect = 4.2e-29, Sum P(2) = 4.2e-29
 Identities = 131/496 (26%), Positives = 220/496 (44%)

Query:     2 DLLKYGTGLHIFKGTYTMQETRDRLYALVHKLKDYCLLLDGPTEDWIRMHDLVREVAISI 61
             +L+ Y     +  G +  ++  +    LV +LKD CLL DG + D ++MHD+VR+ AI  
Sbjct:   383 ELIMYWVAEGLLDGQHHYEDMMNEGVTLVERLKDSCLLEDGDSCDTVKMHDVVRDFAIWF 442

Query:    62 ASRDR---HVFMLRNDIQIEWPVADMLKNCPTIFLHDCKHWEVPEG-LEYPQLEFFCMSP 117
              S      H  ++     IE+P    + +   + L   K   +P   +E  +     +  
Sbjct:   443 MSSQGEGFHSLVMAGRGLIEFPQDKFVSSVQRVSLMANKLERLPNNVIEGVETLVLLLQG 502

Query:   118 RDHSIKIPNHVFAGMSNLRGLALSNMQXXXXXXXXXXXXXXQTLCLDRCA-LGDIAIIGN 176
               H  ++PN       NLR L LS ++              ++L L  C  L ++  + +
Sbjct:   503 NSHVKEVPNGFLQAFPNLRILDLSGVRIRTLPDSFSNLHSLRSLVLRNCKKLRNLPSLES 562

Query:   177 LKKLEILSLVDSNIEQLPEEMAQLTQLRLFDLSGCSKLKVIPPNLLSGLSRLEDLYMGNT 236
             L KL+ L L +S I +LP  +  L+ LR   +S   +L+ IP   +  LS LE L M  +
Sbjct:   563 LVKLQFLDLHESAIRELPRGLEALSSLRYICVSNTYQLQSIPAGTILQLSSLEVLDMAGS 622

Query:   237 SVKWEFEGLNVGRSNASLQELKLLSHLTTLEIQICDAMILPKGLFS--KKLERYKIFIGD 294
             +  W  +G       A+L E+  L HL  L I++ D +       S  K+L +++     
Sbjct:   623 AYSWGIKG-EEREGQATLDEVTCLPHLQFLAIKLLDVLSFSYEFDSLTKRLTKFQFLFSP 681

Query:   295 EWDWSGNYKNKRVLKLK-LYTSN--VDEVIMQLKGIEELYLDEVPGIKNVLYDLDIEGFL 351
                 S     +  L +  +  SN  +  ++  +  ++  Y + + G+   L       F+
Sbjct:   682 IRSVSPPGTGEGCLAISDVNVSNASIGWLLQHVTSLDLNYCEGLNGMFENLVTKSKSSFV 741

Query:   352 QLKHLHVQNNPFILFIVDSMAWVRYNAFLLLESLVLHNLIHLEKIC-LGQLRAESFYKLK 410
              +K L +   P +     S    + + F  LE L L N ++LE I  L         KLK
Sbjct:   742 AMKALSIHYFPSLSLA--SGCESQLDLFPNLEELSLDN-VNLESIGELNGFLGMRLQKLK 798

Query:   411 IIKVRNCDKLKNIFSFSFVRG-LPQLQTLNVINCKNMKEIFTVGRENDVD-CHEVDKIEF 468
             +++V  C +LK +FS   + G LP LQ + V++C  ++E+F       VD C E      
Sbjct:   799 LLQVSGCRQLKRLFSDQILAGTLPNLQEIKVVSCLRLEELFNFSSV-PVDFCAES---LL 854

Query:   469 SQLHSLTLKFLPQLTS 484
              +L  + LK+LPQL S
Sbjct:   855 PKLTVIKLKYLPQLRS 870
GO:0005634 "nucleus" evidence=ISM
GO:0006952 "defense response" evidence=IEA;ISS
GO:0043531 "ADP binding" evidence=IEA
TAIR|locus:2136447 AT4G27190 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2025421 AT1G01490 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2172808 AT5G23760 "AT5G23760" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2149594 AT5G52750 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2149584 AT5G52740 "AT5G52740" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2149614 AT5G52760 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2005517 RPS2 "RESISTANT TO P. SYRINGAE 2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2117149 AT4G19050 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2094498 AT3G25510 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
eugene3.03110007
cc-nbs-lrr resistance protein (1315 aa)
(Populus trichocarpa)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query1125
PLN032101153 PLN03210, PLN03210, Resistant to P 9e-07
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 5e-05
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 2e-04
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 5e-04
PLN03210 1153 PLN03210, PLN03210, Resistant to P 0.001
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 0.001
pfam0040362 pfam00403, HMA, Heavy-metal-associated domain 0.004
>gnl|CDD|215633 PLN03210, PLN03210, Resistant to P Back     alignment and domain information 
 Score = 53.0 bits (127), Expect = 9e-07
 Identities = 70/255 (27%), Positives = 103/255 (40%), Gaps = 52/255 (20%)

Query: 393 LEKICLGQLRAESFYKLKIIKVRNCDKLKNIFSFSFVRGLPQLQTLNVINCKNMKE---- 448
           LEK+  G     S   L+ I +R    LK I   S       L+TL + +C ++ E    
Sbjct: 623 LEKLWDG---VHSLTGLRNIDLRGSKNLKEIPDLSMA---TNLETLKLSDCSSLVELPSS 676

Query: 449 IFTVGRENDVDCHEVDKIE-------FSQLHSLTLKFLPQLTSFYSQVKTSAASQTRLKE 501
           I  + +  D+D    + +E          L+ L L    +L SF     ++  S   L E
Sbjct: 677 IQYLNKLEDLDMSRCENLEILPTGINLKSLYRLNLSGCSRLKSFPD--ISTNISWLDLDE 734

Query: 502 LSTHTLPREVILEDECDTLMPFFNEKVVFPNLETLELCAISTEKIWCNQ-----LAAVYS 556
            +    P  + LE                 NL+ L LC + +EK+W        L  + S
Sbjct: 735 TAIEEFPSNLRLE-----------------NLDELILCEMKSEKLWERVQPLTPLMTMLS 777

Query: 557 QNLTRLIVHGCEKLKYLFPSSMIRNFVQLEHLEICYCSSLESIVGKESGEEATTTFVFPK 616
            +LTRL +     L  L PSS I+N  +LEHLEI  C +LE++          T      
Sbjct: 778 PSLTRLFLSDIPSLVEL-PSS-IQNLHKLEHLEIENCINLETL---------PTGINLES 826

Query: 617 VTFLKLWNLSELKTF 631
           +  L L   S L+TF
Sbjct: 827 LESLDLSGCSRLRTF 841

syringae 6; Provisional. Length = 1153
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|215633 PLN03210, PLN03210, Resistant to P Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|215902 pfam00403, HMA, Heavy-metal-associated domain Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 1125
PLN00113968 leucine-rich repeat receptor-like protein kinase; 100.0
PLN00113968 leucine-rich repeat receptor-like protein kinase; 100.0
PLN032101153 Resistant to P. syringae 6; Provisional 99.96
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 99.95
KOG4194873 consensus Membrane glycoprotein LIG-1 [Signal tran 99.91
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.89
KOG4194873 consensus Membrane glycoprotein LIG-1 [Signal tran 99.89
KOG0472565 consensus Leucine-rich repeat protein [Function un 99.86
PLN032101153 Resistant to P. syringae 6; Provisional 99.85
KOG0472565 consensus Leucine-rich repeat protein [Function un 99.85
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.84
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.83
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.81
KOG0617264 consensus Ras suppressor protein (contains leucine 99.65
KOG0617264 consensus Ras suppressor protein (contains leucine 99.61
KOG4237498 consensus Extracellular matrix protein slit, conta 99.6
KOG160373 consensus Copper chaperone [Inorganic ion transpor 99.49
PRK15387788 E3 ubiquitin-protein ligase SspH2; Provisional 99.48
PRK15387788 E3 ubiquitin-protein ligase SspH2; Provisional 99.46
KOG4237498 consensus Extracellular matrix protein slit, conta 99.43
PRK15370754 E3 ubiquitin-protein ligase SlrP; Provisional 99.39
PRK15370754 E3 ubiquitin-protein ligase SlrP; Provisional 99.39
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 99.29
KOG4341483 consensus F-box protein containing LRR [General fu 99.14
KOG4341483 consensus F-box protein containing LRR [General fu 99.12
KOG0532722 consensus Leucine-rich repeat (LRR) protein, conta 99.09
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 99.06
KOG0532722 consensus Leucine-rich repeat (LRR) protein, conta 99.06
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.0
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.0
KOG1259490 consensus Nischarin, modulator of integrin alpha5 98.99
PF0040362 HMA: Heavy-metal-associated domain; InterPro: IPR0 98.98
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 98.96
KOG1259490 consensus Nischarin, modulator of integrin alpha5 98.89
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 98.77
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 98.69
COG260871 CopZ Copper chaperone [Inorganic ion transport and 98.64
KOG3207505 consensus Beta-tubulin folding cofactor E [Posttra 98.63
KOG3207505 consensus Beta-tubulin folding cofactor E [Posttra 98.58
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.42
KOG4656 247 consensus Copper chaperone for superoxide dismutas 98.36
KOG18591096 consensus Leucine-rich repeat proteins [General fu 98.33
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 98.31
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.3
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 98.25
PLN03150623 hypothetical protein; Provisional 98.22
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 98.13
PLN03150623 hypothetical protein; Provisional 98.13
PRK15386426 type III secretion protein GogB; Provisional 98.09
PRK15386426 type III secretion protein GogB; Provisional 98.04
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 98.0
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 98.0
KOG3665699 consensus ZYG-1-like serine/threonine protein kina 97.94
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 97.93
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 97.89
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 97.85
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 97.76
KOG3665699 consensus ZYG-1-like serine/threonine protein kina 97.76
KOG18591096 consensus Leucine-rich repeat proteins [General fu 97.64
KOG1947482 consensus Leucine rich repeat proteins, some prote 97.64
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 97.62
PLN02957 238 copper, zinc superoxide dismutase 97.54
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 97.49
KOG1947482 consensus Leucine rich repeat proteins, some prote 97.49
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 97.39
KOG2982418 consensus Uncharacterized conserved protein [Funct 97.34
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 97.21
PRK10671 834 copA copper exporting ATPase; Provisional 97.19
KOG2123388 consensus Uncharacterized conserved protein [Funct 96.8
KOG2982418 consensus Uncharacterized conserved protein [Funct 96.72
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 96.61
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 96.42
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 96.18
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 95.95
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 95.15
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 95.1
KOG2123388 consensus Uncharacterized conserved protein [Funct 94.96
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 94.35
COG2217 713 ZntA Cation transport ATPase [Inorganic ion transp 93.93
TIGR0000368 copper ion binding protein. This model describes a 93.82
KOG3864221 consensus Uncharacterized conserved protein [Funct 93.03
KOG3864221 consensus Uncharacterized conserved protein [Funct 92.5
PF1350417 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO 92.16
KOG0473326 consensus Leucine-rich repeat protein [Function un 91.8
PF1350417 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO 91.06
PF0268095 DUF211: Uncharacterized ArCR, COG1888; InterPro: I 90.37
KOG0473326 consensus Leucine-rich repeat protein [Function un 88.99
PRK10671 834 copA copper exporting ATPase; Provisional 87.3
KOG0207 951 consensus Cation transport ATPase [Inorganic ion t 86.95
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 86.45
smart0037026 LRR Leucine-rich repeats, outliers. 86.45
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 86.18
smart0037026 LRR Leucine-rich repeats, outliers. 86.18
PRK11033 741 zntA zinc/cadmium/mercury/lead-transporting ATPase 81.67
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information 
Probab=100.00  E-value=2.9e-33  Score=362.15  Aligned_cols=512  Identities=18%  Similarity=0.169  Sum_probs=303.9

Q ss_pred             CCCCEEEeecCCCccc-CCCC-CCCCccEEEecCCCCCCCCChhhhcCCCCCcEEEeecCCcc-ccCcccCCCCCCcEEE
Q 001200           86 KNCPTIFLHDCKHWEV-PEGL-EYPQLEFFCMSPRDHSIKIPNHVFAGMSNLRGLALSNMQFL-SLPSLFHLPLNLQTLC  162 (1125)
Q Consensus        86 ~~l~~L~l~~n~~~~l-~~~~-~~~~L~~L~l~~n~~~~~l~~~~f~~l~~Lr~L~Ls~~~i~-~lp~~l~~l~~Lr~L~  162 (1125)
                      .+++.|++++|.+... +..+ .+++|++|++++|.+...+|..+|.++++||+|++++|.+. .+|.  +.+++|++|+
T Consensus        69 ~~v~~L~L~~~~i~~~~~~~~~~l~~L~~L~Ls~n~~~~~ip~~~~~~l~~L~~L~Ls~n~l~~~~p~--~~l~~L~~L~  146 (968)
T PLN00113         69 SRVVSIDLSGKNISGKISSAIFRLPYIQTINLSNNQLSGPIPDDIFTTSSSLRYLNLSNNNFTGSIPR--GSIPNLETLD  146 (968)
T ss_pred             CcEEEEEecCCCccccCChHHhCCCCCCEEECCCCccCCcCChHHhccCCCCCEEECcCCccccccCc--cccCCCCEEE
Confidence            4788999999887643 3333 78999999999999887899888889999999999999887 3453  5688999999


Q ss_pred             ccCCCCCC-c-ccccCCCCCcEEEccCCCCC-CCchhhccCCCCCEEeecCCCCCCccCccccCCCCCccEEEeecCccc
Q 001200          163 LDRCALGD-I-AIIGNLKKLEILSLVDSNIE-QLPEEMAQLTQLRLFDLSGCSKLKVIPPNLLSGLSRLEDLYMGNTSVK  239 (1125)
Q Consensus       163 L~~~~l~~-l-~~~~~L~~L~~L~Ls~~~i~-~lp~~i~~L~~L~~L~L~~~~~l~~ip~~~l~~L~~L~~L~l~~~~~~  239 (1125)
                      |++|.+.. + ..++++.+|++|++++|.+. .+|..++++++|++|++++|.....+|.. ++++++|++|++++|.+.
T Consensus       147 Ls~n~~~~~~p~~~~~l~~L~~L~L~~n~l~~~~p~~~~~l~~L~~L~L~~n~l~~~~p~~-l~~l~~L~~L~L~~n~l~  225 (968)
T PLN00113        147 LSNNMLSGEIPNDIGSFSSLKVLDLGGNVLVGKIPNSLTNLTSLEFLTLASNQLVGQIPRE-LGQMKSLKWIYLGYNNLS  225 (968)
T ss_pred             CcCCcccccCChHHhcCCCCCEEECccCcccccCChhhhhCcCCCeeeccCCCCcCcCChH-HcCcCCccEEECcCCccC
Confidence            99998763 3 67899999999999999876 77888999999999999999844567776 899999999999988876


Q ss_pred             cccccccccCCCCChhhhCCCCCCCEEEeecCCCc-ccCCccccccccEEEEEeCCcccccCCCCCceEEEEecccCChh
Q 001200          240 WEFEGLNVGRSNASLQELKLLSHLTTLEIQICDAM-ILPKGLFSKKLERYKIFIGDEWDWSGNYKNKRVLKLKLYTSNVD  318 (1125)
Q Consensus       240 ~~~~~~~~~~~~~~~~~L~~L~~L~~L~l~~~~~~-~~~~~~~~~~L~~l~l~~~~~~~~~~~~~~l~~l~l~~~~~~l~  318 (1125)
                                 ...+..++++++|++|++++|.+. .+|..                                       
T Consensus       226 -----------~~~p~~l~~l~~L~~L~L~~n~l~~~~p~~---------------------------------------  255 (968)
T PLN00113        226 -----------GEIPYEIGGLTSLNHLDLVYNNLTGPIPSS---------------------------------------  255 (968)
T ss_pred             -----------CcCChhHhcCCCCCEEECcCceeccccChh---------------------------------------
Confidence                       345677889999999999888753 22222                                       


Q ss_pred             HHHhhhccccEEEccccCCcccccccccccccccCcEEEeecCCCeeEeeeCCcccccccccccceeecccccccceecc
Q 001200          319 EVIMQLKGIEELYLDEVPGIKNVLYDLDIEGFLQLKHLHVQNNPFILFIVDSMAWVRYNAFLLLESLVLHNLIHLEKICL  398 (1125)
Q Consensus       319 ~~~~~l~~L~~L~L~~~~~~~~~~~~~~~~~l~~L~~L~L~~~~~l~~l~~~~~~~~~~~~~~L~~L~l~~~~~l~~~~~  398 (1125)
                        +..+++|+.|+++++.........+  ..+++|++|++++|.....++     ..+..+++|+.|++.++.-....  
T Consensus       256 --l~~l~~L~~L~L~~n~l~~~~p~~l--~~l~~L~~L~Ls~n~l~~~~p-----~~~~~l~~L~~L~l~~n~~~~~~--  324 (968)
T PLN00113        256 --LGNLKNLQYLFLYQNKLSGPIPPSI--FSLQKLISLDLSDNSLSGEIP-----ELVIQLQNLEILHLFSNNFTGKI--  324 (968)
T ss_pred             --HhCCCCCCEEECcCCeeeccCchhH--hhccCcCEEECcCCeeccCCC-----hhHcCCCCCcEEECCCCccCCcC--
Confidence              2334455555555443222222222  445566666666554221111     11233445555555442211111  


Q ss_pred             CccCcccccCccEEEeccCCCcCcccchhhhccCCcccEEecccccccchhhcccccCCccCCcccceecCccCEEeecC
Q 001200          399 GQLRAESFYKLKIIKVRNCDKLKNIFSFSFVRGLPQLQTLNVINCKNMKEIFTVGRENDVDCHEVDKIEFSQLHSLTLKF  478 (1125)
Q Consensus       399 ~~~~~~~~~~L~~L~l~~C~~L~~l~~~~~~~~l~~L~~L~l~~c~~l~~i~~~~~~~~~~~~~~~~~~~~~L~~L~l~~  478 (1125)
                       +.....+++|+.|++++|.-...+|  ..++.+++|+.|+++++.-...++.            ....+++|+.|++.+
T Consensus       325 -~~~~~~l~~L~~L~L~~n~l~~~~p--~~l~~~~~L~~L~Ls~n~l~~~~p~------------~~~~~~~L~~L~l~~  389 (968)
T PLN00113        325 -PVALTSLPRLQVLQLWSNKFSGEIP--KNLGKHNNLTVLDLSTNNLTGEIPE------------GLCSSGNLFKLILFS  389 (968)
T ss_pred             -ChhHhcCCCCCEEECcCCCCcCcCC--hHHhCCCCCcEEECCCCeeEeeCCh------------hHhCcCCCCEEECcC
Confidence             0112245566666666543222222  2245556666666665432222210            112234455555544


Q ss_pred             CCcccccccccccccccccccceecccCCCceeecccccCcccccccccccccccceeeccccccccccccCcccccCCC
Q 001200          479 LPQLTSFYSQVKTSAASQTRLKELSTHTLPREVILEDECDTLMPFFNEKVVFPNLETLELCAISTEKIWCNQLAAVYSQN  558 (1125)
Q Consensus       479 ~~~l~~~~~~~~~~~~~~~~L~~L~l~~c~~l~~~~~~~~~~~~~~~~~~~~~~L~~L~l~~~~l~~~~~~~~~~~~l~~  558 (1125)
                      ++-...++.    .+.                                  .+++|+.|++++|.+....+..+.  .+++
T Consensus       390 n~l~~~~p~----~~~----------------------------------~~~~L~~L~L~~n~l~~~~p~~~~--~l~~  429 (968)
T PLN00113        390 NSLEGEIPK----SLG----------------------------------ACRSLRRVRLQDNSFSGELPSEFT--KLPL  429 (968)
T ss_pred             CEecccCCH----HHh----------------------------------CCCCCCEEECcCCEeeeECChhHh--cCCC
Confidence            322211111    122                                  344555555555554433332232  2556


Q ss_pred             CcEEEEecCCCccccCCchhhhhccCCcEEEEeccccccceecccccccccceeecCccceeccccCCccceecCCCccC
Q 001200          559 LTRLIVHGCEKLKYLFPSSMIRNFVQLEHLEICYCSSLESIVGKESGEEATTTFVFPKVTFLKLWNLSELKTFYPGTHTS  638 (1125)
Q Consensus       559 L~~L~l~~C~~L~~l~~~~~~~~l~~L~~L~l~~c~~l~~l~~~~~~~~~~~~~~~~~L~~L~l~~c~~L~~~~~~~~~~  638 (1125)
                      |+.|++++| .++...+ ..+..+++|+.|++++|.-...++..         ...++|+.|++++|.-...++....  
T Consensus       430 L~~L~Ls~N-~l~~~~~-~~~~~l~~L~~L~L~~n~~~~~~p~~---------~~~~~L~~L~ls~n~l~~~~~~~~~--  496 (968)
T PLN00113        430 VYFLDISNN-NLQGRIN-SRKWDMPSLQMLSLARNKFFGGLPDS---------FGSKRLENLDLSRNQFSGAVPRKLG--  496 (968)
T ss_pred             CCEEECcCC-cccCccC-hhhccCCCCcEEECcCceeeeecCcc---------cccccceEEECcCCccCCccChhhh--
Confidence            666666653 3444322 22345566666666666533222221         1235566666666544333332221  


Q ss_pred             CCCcccEEEEeccCceeeeecccccccccccCcccCCcccceeeeeeecCCceEeeeccccccccccccCCccccccccE
Q 001200          639 KWPMLKKLEVYGCDKVKIFTSRFLRFQEINEGQFDIPTQQALFLVEKVTSKLEELKLSGKDIAMICQSQFPKHIFRNLKN  718 (1125)
Q Consensus       639 ~~~~L~~L~i~~C~~L~~l~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~L~~L~l~~~~~~~~~~~~~~~~~~~~L~~  718 (1125)
                      .+++|+.|++++|.-...+|...                       ..+++|++|+|++|.+....+..+  ..+++|+.
T Consensus       497 ~l~~L~~L~Ls~N~l~~~~p~~~-----------------------~~l~~L~~L~Ls~N~l~~~~p~~~--~~l~~L~~  551 (968)
T PLN00113        497 SLSELMQLKLSENKLSGEIPDEL-----------------------SSCKKLVSLDLSHNQLSGQIPASF--SEMPVLSQ  551 (968)
T ss_pred             hhhccCEEECcCCcceeeCChHH-----------------------cCccCCCEEECCCCcccccCChhH--hCcccCCE
Confidence            36677777777764443444221                       346677777777777765433332  23667788


Q ss_pred             EEeeecCCC-cccHHHHhhcCCccEEEEEcceeEEEcc
Q 001200          719 LEVVNDESE-NFRIGFLERFHNLEKLELRWSSYKEIFS  755 (1125)
Q Consensus       719 L~l~~c~~l-~~~~~~l~~l~~L~~L~i~c~~l~~~~~  755 (1125)
                      |++++|... .+| ..+.++++|+.|+++.|.+...+|
T Consensus       552 L~Ls~N~l~~~~p-~~l~~l~~L~~l~ls~N~l~~~~p  588 (968)
T PLN00113        552 LDLSQNQLSGEIP-KNLGNVESLVQVNISHNHLHGSLP  588 (968)
T ss_pred             EECCCCcccccCC-hhHhcCcccCEEeccCCcceeeCC
Confidence            888877766 444 445677788888888555655444

>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>KOG1603 consensus Copper chaperone [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>PF00403 HMA: Heavy-metal-associated domain; InterPro: IPR006121 Proteins that transport heavy metals in micro-organisms and mammals share similarities in their sequences and structures Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>COG2608 CopZ Copper chaperone [Inorganic ion transport and metabolism] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>KOG4656 consensus Copper chaperone for superoxide dismutase [Inorganic ion transport and metabolism] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>PLN02957 copper, zinc superoxide dismutase Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>PRK10671 copA copper exporting ATPase; Provisional Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>COG2217 ZntA Cation transport ATPase [Inorganic ion transport and metabolism] Back     alignment and domain information
>TIGR00003 copper ion binding protein Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D Back     alignment and domain information
>KOG0473 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D Back     alignment and domain information
>PF02680 DUF211: Uncharacterized ArCR, COG1888; InterPro: IPR003831 This entry describes proteins of unknown function Back     alignment and domain information
>KOG0473 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>PRK10671 copA copper exporting ATPase; Provisional Back     alignment and domain information
>KOG0207 consensus Cation transport ATPase [Inorganic ion transport and metabolism] Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>PRK11033 zntA zinc/cadmium/mercury/lead-transporting ATPase; Provisional Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query1125
1gwb_B281 Structure Of Glycoprotein 1b Length = 281 2e-06
1m0z_A290 Crystal Structure Of The Von Willebrand Factor Bind 2e-06
1m10_B290 Crystal Structure Of The Complex Of Glycoprotein Ib 2e-06
1p8v_A279 Crystal Structure Of The Complex Of Platelet Recept 2e-06
1u0n_D265 The Ternary Von Willebrand Factor A1-Glycoprotein I 3e-06
3p72_A269 Structure Of Platelet Glycoprotein 1b Alpha With A 3e-06
1sq0_B288 Crystal Structure Of The Complex Of The Wild-Type V 3e-06
>pdb|1GWB|B Chain B, Structure Of Glycoprotein 1b Length = 281 Back     alignment and structure 
Iteration: 1

 Score = 51.6 bits (122), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 44/149 (29%), Positives = 66/149 (44%), Gaps = 14/149 (9%)
Query: 161 LCLDRCALGDIAIIGNLKKLEILSLVDSNIEQLPEEMAQLTQLRLFDLSGCSKLKVIPPN 220
           L LDRC L  + + G L  L  L L  + ++ LP     L  L + D+S  ++L  +P  
Sbjct: 61  LNLDRCELTKLQVDGTLPVLGTLDLSHNQLQSLPLLGQTLPALTVLDVS-FNRLTSLPLG 119
Query: 221 LLSGLSRLEDLYMGNTSVKWEFEGL--------NVGRSNASLQELKL-----LSHLTTLE 267
            L GL  L++LY+    +K    GL         +  +N +L EL       L +L TL 
Sbjct: 120 ALRGLGELQELYLKGNELKTLPPGLLTPTPKLEKLSLANNNLTELPAGLLNGLENLDTLL 179
Query: 268 IQICDAMILPKGLFSKKLERYKIFIGDEW 296
           +Q      +PKG F   L  +    G+ W
Sbjct: 180 LQENSLYTIPKGFFGSHLLPFAFLHGNPW 208
>pdb|1M0Z|A Chain A, Crystal Structure Of The Von Willebrand Factor Binding Domain Of Glycoprotein Ib Alpha Length = 290 Back     alignment and structure
>pdb|1M10|B Chain B, Crystal Structure Of The Complex Of Glycoprotein Ib Alpha And The Von Willebrand Factor A1 Domain Length = 290 Back     alignment and structure
>pdb|1P8V|A Chain A, Crystal Structure Of The Complex Of Platelet Receptor Gpib-alpha And Alpha-thrombin At 2.6a Length = 279 Back     alignment and structure
>pdb|1U0N|D Chain D, The Ternary Von Willebrand Factor A1-Glycoprotein Ibalpha- Botrocetin Complex Length = 265 Back     alignment and structure
>pdb|3P72|A Chain A, Structure Of Platelet Glycoprotein 1b Alpha With A Bound Peptide Inhibitor Length = 269 Back     alignment and structure
>pdb|1SQ0|B Chain B, Crystal Structure Of The Complex Of The Wild-Type Von Willebrand Factor A1 Domain And Glycoprotein Ib Alpha At 2.6 Angstrom Resolution Length = 288 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query1125
3j0a_A844 TOLL-like receptor 5; membrane protein, leucine-ri 4e-17
3j0a_A844 TOLL-like receptor 5; membrane protein, leucine-ri 4e-11
3j0a_A844 TOLL-like receptor 5; membrane protein, leucine-ri 2e-08
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 5e-16
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 2e-12
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 2e-11
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 1e-09
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 3e-06
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 7e-16
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 4e-12
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 1e-15
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 1e-12
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 2e-10
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 1e-15
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 1e-05
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 1e-15
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 4e-13
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 7e-12
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 4e-09
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 4e-05
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 1e-14
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 3e-14
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 9e-13
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 2e-14
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 8e-12
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 4e-10
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 8e-09
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 4e-14
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 7e-13
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 1e-12
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 2e-04
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 4e-14
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 8e-14
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 9e-13
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 4e-12
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 9e-12
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 5e-14
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 9e-12
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 8e-09
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 1e-07
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 2e-13
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 2e-05
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 5e-13
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 1e-12
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 6e-11
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 2e-08
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 2e-07
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 8e-13
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 6e-11
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 1e-08
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 1e-12
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 8e-12
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 3e-11
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 9e-11
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 2e-10
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 1e-12
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 1e-10
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 7e-09
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 1e-07
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 3e-04
1o6v_A466 Internalin A; bacterial infection, extracellular r 2e-12
1o6v_A466 Internalin A; bacterial infection, extracellular r 1e-11
1o6v_A466 Internalin A; bacterial infection, extracellular r 2e-11
1o6v_A466 Internalin A; bacterial infection, extracellular r 2e-10
1o6v_A466 Internalin A; bacterial infection, extracellular r 2e-07
1o6v_A466 Internalin A; bacterial infection, extracellular r 2e-06
4fmz_A347 Internalin; leucine rich repeat, structural genomi 2e-12
4fmz_A347 Internalin; leucine rich repeat, structural genomi 2e-12
4fmz_A347 Internalin; leucine rich repeat, structural genomi 4e-12
4fmz_A347 Internalin; leucine rich repeat, structural genomi 9e-12
4fmz_A347 Internalin; leucine rich repeat, structural genomi 5e-11
4fmz_A347 Internalin; leucine rich repeat, structural genomi 1e-05
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 2e-12
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 1e-09
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 5e-07
4ezg_A197 Putative uncharacterized protein; internalin-A, le 3e-12
4ezg_A197 Putative uncharacterized protein; internalin-A, le 6e-11
4ezg_A197 Putative uncharacterized protein; internalin-A, le 2e-08
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 4e-12
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 5e-12
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 2e-05
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 5e-12
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 1e-10
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 3e-10
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 6e-12
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 3e-07
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 8e-12
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 2e-11
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 1e-11
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 9e-11
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 8e-09
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 3e-11
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 1e-08
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 4e-08
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 3e-04
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 4e-11
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 8e-09
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 1e-05
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 4e-11
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 3e-09
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 4e-09
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 4e-11
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 1e-10
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 6e-09
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 4e-11
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 3e-10
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 1e-09
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 9e-08
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 4e-11
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 8e-09
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 2e-07
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 6e-11
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 7e-11
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 1e-10
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 2e-10
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 3e-05
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 1e-10
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 2e-10
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 2e-09
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 3e-07
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 4e-07
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 1e-04
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 1e-10
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 1e-09
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 1e-07
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 2e-10
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 3e-10
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 8e-09
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 3e-10
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 3e-08
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 1e-06
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 4e-10
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 2e-09
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 4e-06
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 5e-10
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 4e-08
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 1e-07
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 9e-04
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 5e-10
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 3e-08
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 8e-08
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 3e-06
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 1e-05
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 3e-05
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 9e-10
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 1e-09
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 3e-04
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 3e-09
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 2e-06
1vt4_I1221 APAF-1 related killer DARK; drosophila apoptosome, 3e-09
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-07
1vt4_I1221 APAF-1 related killer DARK; drosophila apoptosome, 7e-07
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 7e-09
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 1e-08
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 2e-08
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 6e-08
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 1e-08
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 4e-06
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 2e-05
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 2e-08
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 4e-08
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 2e-07
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 2e-06
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 3e-06
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 2e-04
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 4e-07
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 9e-06
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 5e-05
3m19_A251 Variable lymphocyte receptor A diversity region; a 5e-07
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 5e-07
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 1e-06
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 1e-06
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 2e-05
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 6e-05
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 7e-05
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 1e-04
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 4e-04
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 1e-04
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 4e-04
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
 Score = 86.0 bits (213), Expect = 4e-17
 Identities = 95/524 (18%), Positives = 169/524 (32%), Gaps = 103/524 (19%)

Query: 107 YPQLEFFCMSPRDHSIKIPNHVFAGMSNLRGLALSNMQFLSLP-SLFHLPLNLQTLCLDR 165
             QL+   +  +   + I    F  + NLR L L + +   L    F    +L  L L  
Sbjct: 47  LEQLQLLELGSQYTPLTIDKEAFRNLPNLRILDLGSSKIYFLHPDAFQGLFHLFELRLYF 106

Query: 166 CALGDIAI----IGNLKKLEILSLVDSNIEQLPEE--MAQLTQLRLFDLSGCSKLKVIPP 219
           C L D  +      NLK L  L L  + I  L       +L  L+  D S   ++ ++  
Sbjct: 107 CGLSDAVLKDGYFRNLKALTRLDLSKNQIRSLYLHPSFGKLNSLKSIDFSSN-QIFLVCE 165

Query: 220 NLLSGLS--RLEDLYMGNTSVK----WEFEGLNVGRSNASLQELKLLSHLTTLEIQICDA 273
           + L  L    L    +   S+      ++        N  L+ L +  +  T+       
Sbjct: 166 HELEPLQGKTLSFFSLAANSLYSRVSVDWGKCMNPFRNMVLEILDVSGNGWTV------- 218

Query: 274 MILPKGLFSKKLERYKIFIGDEWDWSGNYKNKRVLKLKLYTSNVDEV------IMQLKGI 327
                G FS  + + + F               ++       N+ +        +    +
Sbjct: 219 --DITGNFSNAISKSQAFSLIL--------AHHIMGAGFGFHNIKDPDQNTFAGLARSSV 268

Query: 328 EELYLDEVPGIKNVLYDLDIEGFLQLKHLHVQNNPFILFIVDSMAWVRYNAFLLLESLVL 387
             L L         ++ L+   F  LK L V N             + YN    +     
Sbjct: 269 RHLDLS-----HGFVFSLNSRVFETLKDLKVLN-------------LAYNKINKIADEAF 310

Query: 388 HNLIHLEKI-----CLGQLRAESFY---KLKIIKVRNCDKLKNIFSFSFVRGLPQLQTLN 439
           + L +L+ +      LG+L + +FY   K+  I ++    +  I   +F + L +LQTL+
Sbjct: 311 YGLDNLQVLNLSYNLLGELYSSNFYGLPKVAYIDLQKN-HIAIIQDQTF-KFLEKLQTLD 368

Query: 440 VINCKNMKEIFTVGRENDVDCHEVDKIEFSQLHSLTLKFLPQLTSFYSQVKTSAASQTRL 499
           + +   +  I  +    D+            L    L  LP++    + +     S+ RL
Sbjct: 369 LRDN-ALTTIHFIPSIPDIF-----------LSGNKLVTLPKINLTANLIHL---SENRL 413

Query: 500 KELSTHTLP------REVILEDECDTLMPFFNEKVVFPNLETLELCAISTEKIWCNQLAA 553
           + L            + +IL     +           P+LE L L          N L  
Sbjct: 414 ENLDILYFLLRVPHLQILILNQNRFSSCSGDQTPSENPSLEQLFLG--------ENMLQL 465

Query: 554 VYSQNLTRLIVHGCEKLKYL---------FPSSMIRNFVQLEHL 588
            +   L   +  G   L+ L          P  +  +   L  L
Sbjct: 466 AWETELCWDVFEGLSHLQVLYLNHNYLNSLPPGVFSHLTALRGL 509
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query1125
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 100.0
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 100.0
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 100.0
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 100.0
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 100.0
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 100.0
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 100.0
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 100.0
3j0a_A844 TOLL-like receptor 5; membrane protein, leucine-ri 100.0
3j0a_A844 TOLL-like receptor 5; membrane protein, leucine-ri 99.98
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 99.98
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 99.97
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 99.97
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 99.97
4g8a_A635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 99.96
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 99.96
4g8a_A635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 99.96
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 99.95
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 99.95
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 99.95
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 99.94
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 99.94
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 99.94
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 99.94
1o6v_A466 Internalin A; bacterial infection, extracellular r 99.93
1o6v_A466 Internalin A; bacterial infection, extracellular r 99.93
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 99.92
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 99.92
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 99.92
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 99.92
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 99.92
4fmz_A347 Internalin; leucine rich repeat, structural genomi 99.91
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 99.91
4fmz_A347 Internalin; leucine rich repeat, structural genomi 99.91
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 99.9
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 99.9
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 99.9
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 99.89
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 99.88
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 99.88
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.85
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.84
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.84
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.84
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.83
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.82
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.82
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.82
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.81
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.81
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 99.81
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 99.8
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.8
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.8
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.79
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.78
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 99.78
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 99.78
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.77
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.77
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 99.77
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.76
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.76
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.76
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.75
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.75
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.75
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.74
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.73
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 99.73
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.73
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.72
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.72
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.72
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.71
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.71
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.7
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.7
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.69
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.69
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.69
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.68
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 99.68
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 99.67
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.67
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.66
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.63
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.63
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.63
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 99.62
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.61
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.61
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.61
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.6
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.59
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.59
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.58
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.58
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.57
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 99.57
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.55
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.55
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.55
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.54
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 99.53
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.53
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 99.52
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.52
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 99.52
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.51
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.51
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.51
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 99.48
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.48
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.47
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.44
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.43
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.42
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.4
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.39
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.39
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.37
4b8c_D727 Glucose-repressible alcohol dehydrogenase transcr 99.35
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.34
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.34
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.33
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.33
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.32
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.29
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.28
4b8c_D727 Glucose-repressible alcohol dehydrogenase transcr 99.27
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.21
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.18
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.15
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.13
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.13
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.12
3iwl_A68 Copper transport protein ATOX1; beta-alpha-beta-BE 99.11
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.1
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.05
1cc8_A73 Protein (metallochaperone ATX1); copper transport, 99.01
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 98.97
2crl_A98 Copper chaperone for superoxide dismutase; SOD1, f 98.9
4a4j_A69 Pacszia, cation-transporting ATPase PACS; hydrolas 98.79
3dxs_X74 Copper-transporting ATPase RAN1; CXXC motif, ferre 98.76
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 98.74
4fdw_A401 Leucine rich hypothetical protein; putative cell s 98.73
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 98.71
3fry_A73 Probable copper-exporting P-type ATPase A; transpo 98.7
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 98.69
4fdw_A401 Leucine rich hypothetical protein; putative cell s 98.69
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 98.64
2xmw_A71 PACS-N, cation-transporting ATPase PACS; hydrolase 98.47
2roe_A66 Heavy metal binding protein; NMR {Thermus thermoph 98.43
2l3m_A71 Copper-ION-binding protein; structural genomics, c 98.43
2k2p_A85 Uncharacterized protein ATU1203; putative metal-bi 98.41
2xmm_A64 SSR2857 protein, ATX1; metal transport, copper hom 98.37
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 98.36
1qup_A 222 Superoxide dismutase 1 copper chaperone; two domai 98.36
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 98.33
1aw0_A72 Menkes copper-transporting ATPase; copper-binding 98.29
1q8l_A84 Copper-transporting ATPase 1; metal binding protei 98.24
1y3j_A77 Copper-transporting ATPase 1; ferrodoxin-like fold 98.23
3cjk_B75 Copper-transporting ATPase 1; HAH1, ATP7B, menkes 98.22
1osd_A72 MERP, hypothetical protein MERP; mercury resistanc 98.22
1jk9_B 249 CCS, copper chaperone for superoxide dismutase; pr 98.21
1mwy_A73 ZNTA; open-faced beta-sandwich fold, beta-alpha-be 98.2
2g9o_A90 Copper-transporting ATPase 1; menkes disease, solu 98.2
1fvq_A72 Copper-transporting ATPase; APO-CCC2A, hydrolase; 98.19
2qif_A69 Copper chaperone COPZ; tetranuclear Cu(I) cluster; 98.15
1kvi_A79 Copper-transporting ATPase 1; menkes, Cu-protein, 98.15
2aj0_A71 Probable cadmium-transporting ATPase; ferrodoxin-l 98.13
2ofg_X111 Zinc-transporting ATPase; ferredoxin-like fold, be 98.12
1cpz_A68 Protein (COPZ); copper chaperone, metal transport, 98.11
1yjr_A75 Copper-transporting ATPase 1; metallochaperone, pr 98.09
1yg0_A66 COP associated protein; open-faced beta-sandwich, 98.08
1opz_A76 Potential copper-transporting ATPase; mutation, fo 98.06
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.04
2ldi_A71 Zinc-transporting ATPase; metal homeostasis, metal 98.03
2kt2_A69 Mercuric reductase; nmera, MERA, HMA domain, mercu 98.03
2kyz_A67 Heavy metal binding protein; structural genomics, 98.01
2kkh_A95 Putative heavy metal transporter; zinc transport, 97.99
4gt6_A394 Cell surface protein; leucine rich repeats, putati 97.98
1jww_A80 Potential copper-transporting ATPase; beta-alpha-b 97.97
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 97.94
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 97.93
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 97.92
2a5y_B549 CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis 97.86
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 97.86
4gt6_A394 Cell surface protein; leucine rich repeats, putati 97.83
1p6t_A151 Potential copper-transporting ATPase; COPA, P-type 97.78
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 97.74
2ew9_A149 Copper-transporting ATPase 2; copper trafficking, 97.74
2rop_A202 Copper-transporting ATPase 2; wilson protein, mobi 97.64
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 97.56
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 97.55
2ew9_A149 Copper-transporting ATPase 2; copper trafficking, 97.51
2rop_A202 Copper-transporting ATPase 2; wilson protein, mobi 97.05
1p6t_A151 Potential copper-transporting ATPase; COPA, P-type 96.95
3j09_A 723 COPA, copper-exporting P-type ATPase A; copper tra 96.46
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 96.16
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 96.15
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 95.06
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 94.93
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 94.16
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 93.46
3bpd_A100 Uncharacterized protein; heptamer, Mg+2 ION, PSI-2 91.53
1vt4_I1221 APAF-1 related killer DARK; drosophila apoptosome, 91.24
2raq_A97 Conserved protein MTH889; alpha-beta protein, stru 90.02
2x3d_A96 SSO6206; unknown function; 2.70A {Sulfolobus solfa 89.26
3sfz_A1249 APAF-1, apoptotic peptidase activating factor 1; a 88.72
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
Probab=100.00  E-value=2.5e-40  Score=415.50  Aligned_cols=679  Identities=14%  Similarity=0.048  Sum_probs=362.4

Q ss_pred             CccEEEecCCCCCCC---CChhhhcCCCCCcEEEeecCCccccCcccCCCCCCcEEEccCCCCCC-c-c--cccCCCCCc
Q 001200          109 QLEFFCMSPRDHSIK---IPNHVFAGMSNLRGLALSNMQFLSLPSLFHLPLNLQTLCLDRCALGD-I-A--IIGNLKKLE  181 (1125)
Q Consensus       109 ~L~~L~l~~n~~~~~---l~~~~f~~l~~Lr~L~Ls~~~i~~lp~~l~~l~~Lr~L~L~~~~l~~-l-~--~~~~L~~L~  181 (1125)
                      +++.|+|+++.+.+.   +++ .|.++++|+.++++.+.+..+|..|+.+++|++|+|++|.+.. + .  .++++++|+
T Consensus        51 ~v~~L~L~~~~l~g~~~~l~~-~l~~L~~L~~l~~~~~~~~~l~~~~~~l~~L~~L~Ls~n~l~~~~~~~~~l~~l~~L~  129 (768)
T 3rgz_A           51 KVTSIDLSSKPLNVGFSAVSS-SLLSLTGLESLFLSNSHINGSVSGFKCSASLTSLDLSRNSLSGPVTTLTSLGSCSGLK  129 (768)
T ss_dssp             EEEEEECTTSCCCEEHHHHHH-HTTTCTTCCEEECTTSCEEECCCCCCCCTTCCEEECCSSEEEEEGGGGGGGGGCTTCC
T ss_pred             cEEEEECCCCCcCCccCccCh-hHhccCcccccCCcCCCcCCCchhhccCCCCCEEECCCCcCCCcCCChHHHhCCCCCC
Confidence            455566655555433   443 3456666666666666666666666777777777777766542 2 3  566677777


Q ss_pred             EEEccCCCCC-CCchhh-ccCCCCCEEeecCCCCCCccCccc---cCCCCCccEEEeecCccccccccccccCCCCChhh
Q 001200          182 ILSLVDSNIE-QLPEEM-AQLTQLRLFDLSGCSKLKVIPPNL---LSGLSRLEDLYMGNTSVKWEFEGLNVGRSNASLQE  256 (1125)
Q Consensus       182 ~L~Ls~~~i~-~lp~~i-~~L~~L~~L~L~~~~~l~~ip~~~---l~~L~~L~~L~l~~~~~~~~~~~~~~~~~~~~~~~  256 (1125)
                      +|++++|.+. .+|..+ +++++|++|++++|. +...+...   ++++++|++|++++|.+..             ...
T Consensus       130 ~L~Ls~n~l~~~~~~~~~~~l~~L~~L~Ls~n~-l~~~~~~~~~~~~~l~~L~~L~Ls~n~l~~-------------~~~  195 (768)
T 3rgz_A          130 FLNVSSNTLDFPGKVSGGLKLNSLEVLDLSANS-ISGANVVGWVLSDGCGELKHLAISGNKISG-------------DVD  195 (768)
T ss_dssp             EEECCSSEEECCSSCCSCCCCTTCSEEECCSSC-CEEETHHHHHHTTCCTTCCEEECCSSEEES-------------CCB
T ss_pred             EEECcCCccCCcCCHHHhccCCCCCEEECCCCc-cCCcCChhhhhhccCCCCCEEECCCCcccc-------------cCC
Confidence            7777766554 334433 666677777777666 55444333   5666677777776666540             112


Q ss_pred             hCCCCCCCEEEeecCCCcccCCccccccccEEEEEeCCcccccCCCCCceEEEEecccCChhHHHhhhccccEEEccccC
Q 001200          257 LKLLSHLTTLEIQICDAMILPKGLFSKKLERYKIFIGDEWDWSGNYKNKRVLKLKLYTSNVDEVIMQLKGIEELYLDEVP  336 (1125)
Q Consensus       257 L~~L~~L~~L~l~~~~~~~~~~~~~~~~L~~l~l~~~~~~~~~~~~~~l~~l~l~~~~~~l~~~~~~l~~L~~L~L~~~~  336 (1125)
                      +..+++|++|++++|.+....+.+                                         +.+++|++|+++++.
T Consensus       196 ~~~l~~L~~L~Ls~n~l~~~~~~l-----------------------------------------~~l~~L~~L~Ls~n~  234 (768)
T 3rgz_A          196 VSRCVNLEFLDVSSNNFSTGIPFL-----------------------------------------GDCSALQHLDISGNK  234 (768)
T ss_dssp             CTTCTTCCEEECCSSCCCSCCCBC-----------------------------------------TTCCSCCEEECCSSC
T ss_pred             cccCCcCCEEECcCCcCCCCCccc-----------------------------------------ccCCCCCEEECcCCc
Confidence            255666667777666653322111                                         123345555554443


Q ss_pred             CcccccccccccccccCcEEEeecCCCeeEeeeCCcccccccccccceeecccccccceeccCccCcccccCccEEEecc
Q 001200          337 GIKNVLYDLDIEGFLQLKHLHVQNNPFILFIVDSMAWVRYNAFLLLESLVLHNLIHLEKICLGQLRAESFYKLKIIKVRN  416 (1125)
Q Consensus       337 ~~~~~~~~~~~~~l~~L~~L~L~~~~~l~~l~~~~~~~~~~~~~~L~~L~l~~~~~l~~~~~~~~~~~~~~~L~~L~l~~  416 (1125)
                      ........  +..+++|++|++++|.....++       ...+++|+.|++.++.-...++.  .....+++|++|++++
T Consensus       235 l~~~~~~~--l~~l~~L~~L~Ls~n~l~~~~~-------~~~l~~L~~L~L~~n~l~~~ip~--~~~~~~~~L~~L~Ls~  303 (768)
T 3rgz_A          235 LSGDFSRA--ISTCTELKLLNISSNQFVGPIP-------PLPLKSLQYLSLAENKFTGEIPD--FLSGACDTLTGLDLSG  303 (768)
T ss_dssp             CCSCHHHH--TTTCSSCCEEECCSSCCEESCC-------CCCCTTCCEEECCSSEEEESCCC--CSCTTCTTCSEEECCS
T ss_pred             CCCcccHH--HhcCCCCCEEECCCCcccCccC-------ccccCCCCEEECcCCccCCccCH--HHHhhcCcCCEEECcC
Confidence            22221222  2456666666666665322111       11456666776666431111111  1112358899999998


Q ss_pred             CCCcCcccchhhhccCCcccEEecccccccchhhcccccCCccCCcccceecCccCEEeecCCCcccccccccccccccc
Q 001200          417 CDKLKNIFSFSFVRGLPQLQTLNVINCKNMKEIFTVGRENDVDCHEVDKIEFSQLHSLTLKFLPQLTSFYSQVKTSAASQ  496 (1125)
Q Consensus       417 C~~L~~l~~~~~~~~l~~L~~L~l~~c~~l~~i~~~~~~~~~~~~~~~~~~~~~L~~L~l~~~~~l~~~~~~~~~~~~~~  496 (1125)
                      |. ++...+ ..++.+++|++|++++|.-...++..           ....+++|+.|+++++.-...++.    .+..+
T Consensus       304 n~-l~~~~p-~~~~~l~~L~~L~L~~n~l~~~ip~~-----------~l~~l~~L~~L~Ls~n~l~~~~p~----~l~~l  366 (768)
T 3rgz_A          304 NH-FYGAVP-PFFGSCSLLESLALSSNNFSGELPMD-----------TLLKMRGLKVLDLSFNEFSGELPE----SLTNL  366 (768)
T ss_dssp             SE-EEECCC-GGGGGCTTCCEEECCSSEEEEECCHH-----------HHTTCTTCCEEECCSSEEEECCCT----THHHH
T ss_pred             Cc-CCCccc-hHHhcCCCccEEECCCCcccCcCCHH-----------HHhcCCCCCEEeCcCCccCccccH----HHHhh
Confidence            64 443333 34788899999999886533244310           134577888888887743323332    23444


Q ss_pred             c-ccceecccCCCceeecccccCcccccccccccccccceeeccccccccccccCcccccCCCCcEEEEecCCCccccCC
Q 001200          497 T-RLKELSTHTLPREVILEDECDTLMPFFNEKVVFPNLETLELCAISTEKIWCNQLAAVYSQNLTRLIVHGCEKLKYLFP  575 (1125)
Q Consensus       497 ~-~L~~L~l~~c~~l~~~~~~~~~~~~~~~~~~~~~~L~~L~l~~~~l~~~~~~~~~~~~l~~L~~L~l~~C~~L~~l~~  575 (1125)
                      + +|+.|++++|.....        .+.......+++|++|++++|.+....+..+..  +++|+.|++++| .++...|
T Consensus       367 ~~~L~~L~Ls~N~l~~~--------~~~~~~~~~~~~L~~L~L~~n~l~~~~p~~l~~--l~~L~~L~Ls~N-~l~~~~p  435 (768)
T 3rgz_A          367 SASLLTLDLSSNNFSGP--------ILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSN--CSELVSLHLSFN-YLSGTIP  435 (768)
T ss_dssp             TTTCSEEECCSSEEEEE--------CCTTTTCSTTCCCCEEECCSSEEEEECCGGGGG--CTTCCEEECCSS-EEESCCC
T ss_pred             hcCCcEEEccCCCcCCC--------cChhhhhcccCCccEEECCCCccccccCHHHhc--CCCCCEEECcCC-cccCccc
Confidence            4 677777777642210        000000011556777777777755444443432  667777777764 4554323


Q ss_pred             chhhhhccCCcEEEEeccccccceecccccccccceeecCccceeccccCCccceecCCCccCCCCcccEEEEeccCcee
Q 001200          576 SSMIRNFVQLEHLEICYCSSLESIVGKESGEEATTTFVFPKVTFLKLWNLSELKTFYPGTHTSKWPMLKKLEVYGCDKVK  655 (1125)
Q Consensus       576 ~~~~~~l~~L~~L~l~~c~~l~~l~~~~~~~~~~~~~~~~~L~~L~l~~c~~L~~~~~~~~~~~~~~L~~L~i~~C~~L~  655 (1125)
                       ..+..+++|+.|++++|.--..++....        .+++|+.|++++|.-...++....  .+++|+.|++++|.-..
T Consensus       436 -~~l~~l~~L~~L~L~~n~l~~~~p~~~~--------~l~~L~~L~L~~N~l~~~~p~~l~--~l~~L~~L~L~~N~l~~  504 (768)
T 3rgz_A          436 -SSLGSLSKLRDLKLWLNMLEGEIPQELM--------YVKTLETLILDFNDLTGEIPSGLS--NCTNLNWISLSNNRLTG  504 (768)
T ss_dssp             -GGGGGCTTCCEEECCSSCCCSCCCGGGG--------GCTTCCEEECCSSCCCSCCCGGGG--GCTTCCEEECCSSCCCS
T ss_pred             -HHHhcCCCCCEEECCCCcccCcCCHHHc--------CCCCceEEEecCCcccCcCCHHHh--cCCCCCEEEccCCccCC
Confidence             3356667777777777662223332211        456666666666554333333221  35666666666654332


Q ss_pred             eeecccccccccccCcccCCcccceeeeeeecCCceEeeeccccccccccccCCccccccccEEEeeecCCC-cccHHHH
Q 001200          656 IFTSRFLRFQEINEGQFDIPTQQALFLVEKVTSKLEELKLSGKDIAMICQSQFPKHIFRNLKNLEVVNDESE-NFRIGFL  734 (1125)
Q Consensus       656 ~l~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~L~~L~l~~~~~~~~~~~~~~~~~~~~L~~L~l~~c~~l-~~~~~~l  734 (1125)
                      .+|...                       ..+++|+.|++++|.+....+..  ...+++|+.|++++|+.. .+|....
T Consensus       505 ~~p~~~-----------------------~~l~~L~~L~L~~N~l~~~~p~~--l~~l~~L~~L~Ls~N~l~g~ip~~~~  559 (768)
T 3rgz_A          505 EIPKWI-----------------------GRLENLAILKLSNNSFSGNIPAE--LGDCRSLIWLDLNTNLFNGTIPAAMF  559 (768)
T ss_dssp             CCCGGG-----------------------GGCTTCCEEECCSSCCEEECCGG--GGGCTTCCEEECCSSEEESBCCGGGG
T ss_pred             cCChHH-----------------------hcCCCCCEEECCCCcccCcCCHH--HcCCCCCCEEECCCCccCCcCChHHh
Confidence            333211                       23556666666666554322211  123555666666666544 4443332


Q ss_pred             hhcCCccEEEEE-cceeEEEccCh----------------hhhhhhhhcccccEEeccCcccccccccCCCCcccccCcc
Q 001200          735 ERFHNLEKLELR-WSSYKEIFSNE----------------EIVEHAEMLTQVKSLKLWELSDLMYIWKQDSKLDSITENL  797 (1125)
Q Consensus       735 ~~l~~L~~L~i~-c~~l~~~~~~~----------------~~~~~~~~l~~L~~L~l~~~~~L~~i~~~~~~~~~~l~~L  797 (1125)
                       .+..+..+.+. +..+..+....                ..+.....++.++.+.+..    ..+.+..+.....+++|
T Consensus       560 -~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~l~~----~~~~g~~~~~~~~l~~L  634 (768)
T 3rgz_A          560 -KQSGKIAANFIAGKRYVYIKNDGMKKECHGAGNLLEFQGIRSEQLNRLSTRNPCNITS----RVYGGHTSPTFDNNGSM  634 (768)
T ss_dssp             -TTTTCBCCSTTCSCEEEEEECCSCCTTCCSSEEEEECTTCCGGGGGGGGGTCCSCTTS----CEEEEECCCSCSSSBCC
T ss_pred             -cccchhhhhccccccccccccccccccccccccccccccccchhhhcccccccccccc----ceecccCchhhhccccc
Confidence             22222222111 11111110000                0000011111111111111    00111112234567899


Q ss_pred             cEEEEecccCccccccCccccCCccEEeEecCCCccccchhHhhhcCCCccEEEEccccchhhhhccCcccccccccccc
Q 001200          798 ESLEVWWCENLINLVPSSASFKNLTTLELWYCQRLMNLVTSSTAKSLVCLTKLRIDGCRMLTEIISKEEDVAEDEIVFSK  877 (1125)
Q Consensus       798 ~~L~i~~c~~L~~l~~~~~~~~~L~~L~i~~C~~L~~l~~~~~~~~l~~L~~L~i~~c~~l~~~~~~~~~~~~~~~~~~~  877 (1125)
                      +.|+++++.--..+|..++.+++|+.|+++++.--..+|  ..+..+++|+.|+++++.--..++..       ...+++
T Consensus       635 ~~LdLs~N~l~g~ip~~l~~l~~L~~L~Ls~N~l~g~ip--~~l~~L~~L~~LdLs~N~l~g~ip~~-------l~~l~~  705 (768)
T 3rgz_A          635 MFLDMSYNMLSGYIPKEIGSMPYLFILNLGHNDISGSIP--DEVGDLRGLNILDLSSNKLDGRIPQA-------MSALTM  705 (768)
T ss_dssp             CEEECCSSCCBSCCCGGGGGCTTCCEEECCSSCCCSCCC--GGGGGCTTCCEEECCSSCCEECCCGG-------GGGCCC
T ss_pred             cEEECcCCcccccCCHHHhccccCCEEeCcCCccCCCCC--hHHhCCCCCCEEECCCCcccCcCChH-------HhCCCC
Confidence            999999987666788889999999999999986444665  34678899999999988633233221       224788


Q ss_pred             cceeccccCcccccccCCCccccCCCccEEEEcccCCcccCCCCCcCCCCccEEEeccCCccccccC
Q 001200          878 LKWVSLERLENLTSFCSGNYTLKFPSLEDLFVIECPKMKIFSHRVLSTPRLREVRQNWGLYKGCWEG  944 (1125)
Q Consensus       878 L~~L~l~~~~~L~~l~~~~~~~~~~sL~~L~i~~C~~l~~lp~~~~~~p~L~~~~~~~~~~~~~~~~  944 (1125)
                      |+.|++++++--..+|.++   .+.++....+.++|.|.-.|        +. .|-...+++|++++
T Consensus       706 L~~L~ls~N~l~g~iP~~~---~~~~~~~~~~~gN~~Lcg~~--------l~-~C~~~~~~~~~~~~  760 (768)
T 3rgz_A          706 LTEIDLSNNNLSGPIPEMG---QFETFPPAKFLNNPGLCGYP--------LP-RCDPSNADGYAHHQ  760 (768)
T ss_dssp             CSEEECCSSEEEEECCSSS---SGGGSCGGGGCSCTEEESTT--------SC-CCCSCC--------
T ss_pred             CCEEECcCCcccccCCCch---hhccCCHHHhcCCchhcCCC--------Cc-CCCCCccCCCCCCC
Confidence            9999999987777888765   34555556677888887544        22 46777899999993
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>3iwl_A Copper transport protein ATOX1; beta-alpha-beta-BETA-alpha-beta, cisplatin, platinum, chaperone, ION transport, metal-binding, metal transport; HET: TCE; 1.60A {Homo sapiens} SCOP: d.58.17.1 PDB: 1fe4_A* 1fee_A* 1tl4_A 1tl5_A 2k1r_B 1fe0_A* 3iwx_A 3cjk_A Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>1cc8_A Protein (metallochaperone ATX1); copper transport, mercury coordination, metal transport; 1.02A {Saccharomyces cerevisiae} SCOP: d.58.17.1 PDB: 1cc7_A 1fd8_A 1fes_A 2ggp_A 3k7r_A Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2crl_A Copper chaperone for superoxide dismutase; SOD1, familial ALS, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>4a4j_A Pacszia, cation-transporting ATPase PACS; hydrolase, copper homeostasis, zinc homeostasis, ATX1, metal-transporting atpases; 1.25A {Synechocystis} PDB: 4a48_A 2gcf_A 2xmw_A Back     alignment and structure
>3dxs_X Copper-transporting ATPase RAN1; CXXC motif, ferredoxin-like fold, ATP- binding, ethylene signaling pathway, hydrolase, ION transport; 1.70A {Arabidopsis thaliana} SCOP: d.58.17.0 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>3fry_A Probable copper-exporting P-type ATPase A; transport protein, metal binding domain, domain SWAP, ATP-BI cell membrane, copper transport; HET: CIT; 2.00A {Archaeoglobus fulgidus} Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>2xmw_A PACS-N, cation-transporting ATPase PACS; hydrolase, Cu(I)-binding, trafficking; 1.80A {Synechocystis SP} PDB: 2gcf_A Back     alignment and structure
>2roe_A Heavy metal binding protein; NMR {Thermus thermophilus} PDB: 2rog_A Back     alignment and structure
>2l3m_A Copper-ION-binding protein; structural genomics, center for structural genomics of infec diseases, csgid, metal binding protein; NMR {Bacillus anthracis} Back     alignment and structure
>2k2p_A Uncharacterized protein ATU1203; putative metal-binding domain ATU1203, ontario centre for ST proteomics, structural genomics; NMR {Agrobacterium tumefaciens str} Back     alignment and structure
>2xmm_A SSR2857 protein, ATX1; metal transport, copper homeostasis, chaperone, P-type atpas; 1.65A {Synechocystis SP} PDB: 2xmv_A 1sb6_A 2xmj_A 2xmk_A 2xmt_A 2xmu_A Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>1qup_A Superoxide dismutase 1 copper chaperone; two domains, beta-alpha-beta-BETA-alpha-beta and beta barrel; 1.80A {Saccharomyces cerevisiae} SCOP: b.1.8.1 d.58.17.1 Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>1aw0_A Menkes copper-transporting ATPase; copper-binding domain, hydrolase; NMR {Homo sapiens} SCOP: d.58.17.1 PDB: 2aw0_A Back     alignment and structure
>1q8l_A Copper-transporting ATPase 1; metal binding protein; NMR {Homo sapiens} SCOP: d.58.17.1 PDB: 1s6o_A 1s6u_A Back     alignment and structure
>1y3j_A Copper-transporting ATPase 1; ferrodoxin-like fold, beta-alpha-beta-BETA-alpha-beta structure, structural proteomics in europe, spine; NMR {Homo sapiens} PDB: 1y3k_A Back     alignment and structure
>3cjk_B Copper-transporting ATPase 1; HAH1, ATP7B, menkes disease, metal homeostasis, chaperone, ION transport, metal- binding, alternative splicing; 1.80A {Homo sapiens} PDB: 2k1r_A Back     alignment and structure
>1osd_A MERP, hypothetical protein MERP; mercury resistance, metal binding protein, perisplasm, structural genomics; 2.00A {Cupriavidus metallidurans} SCOP: d.58.17.1 PDB: 1afi_A 1afj_A 2hqi_A Back     alignment and structure
>1jk9_B CCS, copper chaperone for superoxide dismutase; protein-protein complex, heterodimer, metallochaperone, amyotrophic lateral sclerosis; 2.90A {Saccharomyces cerevisiae} SCOP: b.1.8.1 d.58.17.1 Back     alignment and structure
>1mwy_A ZNTA; open-faced beta-sandwich fold, beta-alpha-beta-BETA-alpha- beta, hydrolase; NMR {Escherichia coli} SCOP: d.58.17.1 PDB: 1mwz_A Back     alignment and structure
>2g9o_A Copper-transporting ATPase 1; menkes disease, solution structure, structural genomics, structural proteomics in europe, spine, hydrolase; NMR {Homo sapiens} PDB: 2ga7_A Back     alignment and structure
>1fvq_A Copper-transporting ATPase; APO-CCC2A, hydrolase; NMR {Saccharomyces cerevisiae} SCOP: d.58.17.1 PDB: 1fvs_A 2ggp_B Back     alignment and structure
>2qif_A Copper chaperone COPZ; tetranuclear Cu(I) cluster; 1.50A {Bacillus subtilis} SCOP: d.58.17.1 PDB: 3i9z_A 1k0v_A 1p8g_A Back     alignment and structure
>1kvi_A Copper-transporting ATPase 1; menkes, Cu-protein, hydrolase; NMR {Homo sapiens} SCOP: d.58.17.1 PDB: 1kvj_A Back     alignment and structure
>2aj0_A Probable cadmium-transporting ATPase; ferrodoxin-like fold, beta-alpha-beta-BETA-alpha-beta, metal binding protein, hydrolase; NMR {Listeria monocytogenes} PDB: 2aj1_A Back     alignment and structure
>1cpz_A Protein (COPZ); copper chaperone, metal transport, gene regulation; NMR {Enterococcus hirae} SCOP: d.58.17.1 Back     alignment and structure
>1yjr_A Copper-transporting ATPase 1; metallochaperone, protein-protein interaction, copper(I), metal homeostasis, structural proteomics in europe, spine; NMR {Homo sapiens} PDB: 1yjt_A 1yju_A 1yjv_A Back     alignment and structure
>1yg0_A COP associated protein; open-faced beta-sandwich, missing C-terminal beta-sheet, Met transport; NMR {Helicobacter pylori} Back     alignment and structure
>1opz_A Potential copper-transporting ATPase; mutation, folding, abbab fold, hydrolase; NMR {Bacillus subtilis} SCOP: d.58.17.1 PDB: 1oq3_A 1oq6_A Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>2ldi_A Zinc-transporting ATPase; metal homeostasis, metallochaperones, hydrolase; NMR {Synechocystis SP} Back     alignment and structure
>2kt2_A Mercuric reductase; nmera, MERA, HMA domain, mercuric resist metal-binding, oxidoreductase; NMR {Pseudomonas aeruginosa} PDB: 2kt3_A Back     alignment and structure
>2kyz_A Heavy metal binding protein; structural genomics, PSI-biology, protein structure initiative, joint for structural genomics, JCSG; NMR {Thermotoga maritima} Back     alignment and structure
>2kkh_A Putative heavy metal transporter; zinc transport, metal binding, metal selectivity, ferredoxin fold, ATP-binding, hydrolase; NMR {Arabidopsis thaliana} Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>1jww_A Potential copper-transporting ATPase; beta-alpha-beta-BETA-alpha-beta, hydrolase; NMR {Bacillus subtilis} SCOP: d.58.17.1 PDB: 2voy_A 1kqk_A Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>2a5y_B CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis elegans} SCOP: a.4.5.80 a.77.1.3 c.37.1.20 PDB: 3lqq_A* 3lqr_A* Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>1p6t_A Potential copper-transporting ATPase; COPA, P-type ATPase, water-soluble region, beta-alpha-beta- beta-alpha-beta fold; NMR {Bacillus subtilis} SCOP: d.58.17.1 d.58.17.1 PDB: 2rml_A Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>2ew9_A Copper-transporting ATPase 2; copper trafficking, ferrodoxin-like fold, structural genomics, structural proteomics in europe, spine, hydrolase; NMR {Homo sapiens} Back     alignment and structure
>2rop_A Copper-transporting ATPase 2; wilson protein, mobility, protein-protein interaction, alternative splicing, ATP-binding, copper transport cytoplasm; NMR {Homo sapiens} Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>2ew9_A Copper-transporting ATPase 2; copper trafficking, ferrodoxin-like fold, structural genomics, structural proteomics in europe, spine, hydrolase; NMR {Homo sapiens} Back     alignment and structure
>2rop_A Copper-transporting ATPase 2; wilson protein, mobility, protein-protein interaction, alternative splicing, ATP-binding, copper transport cytoplasm; NMR {Homo sapiens} Back     alignment and structure
>1p6t_A Potential copper-transporting ATPase; COPA, P-type ATPase, water-soluble region, beta-alpha-beta- beta-alpha-beta fold; NMR {Bacillus subtilis} SCOP: d.58.17.1 d.58.17.1 PDB: 2rml_A Back     alignment and structure
>3j09_A COPA, copper-exporting P-type ATPase A; copper transporter, adenosine triphosph archaeal proteins, cation transport proteins; 10.00A {Archaeoglobus fulgidus} Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>3bpd_A Uncharacterized protein; heptamer, Mg+2 ION, PSI-2, NYSGXRC, structural genom protein structure initiative; 2.80A {Archaeoglobus fulgidus dsm 4304} SCOP: d.58.61.1 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Back     alignment and structure
>2raq_A Conserved protein MTH889; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative; 3.11A {Methanothermobacter thermautotrophicusorganism_taxid} SCOP: d.58.61.1 Back     alignment and structure
>2x3d_A SSO6206; unknown function; 2.70A {Sulfolobus solfataricus} Back     alignment and structure
>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 1125
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 1e-08
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 4e-08
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 9e-05
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 9e-05
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 2e-04
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 6e-04
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 4e-04
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 4e-04
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 7e-04
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 0.001
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Internalin LRR domain
domain: Internalin A
species: Listeria monocytogenes [TaxId: 1639]

 Score = 56.2 bits (134), Expect = 1e-08
 Identities = 29/171 (16%), Positives = 60/171 (35%), Gaps = 28/171 (16%)

Query: 86  KNCPTIFLHDCKHWEVPEGLEYPQLEFFCMSPRDHSIKIPNHVFAGMSNLRGLALSNMQF 145
            N   + L+  +  ++        L    ++    S   P    +G++ L  L L   Q 
Sbjct: 219 TNLDELSLNGNQLKDIGTLASLTNLTDLDLANNQISNLAP---LSGLTKLTELKLGANQI 275

Query: 146 LSLPSLFHLPLN---------------------LQTLCLDRCALGDIAIIGNLKKLEILS 184
            ++  L  L                        L  L L    + DI+ + +L KL+ L 
Sbjct: 276 SNISPLAGLTALTNLELNENQLEDISPISNLKNLTYLTLYFNNISDISPVSSLTKLQRLF 335

Query: 185 LVDSNIEQLPEEMAQLTQLRLFDLSGCSKLKVIPPNLLSGLSRLEDLYMGN 235
             ++ +  +   +A LT +         ++  + P  L+ L+R+  L + +
Sbjct: 336 FANNKVSDVSS-LANLTNINWLSAGHN-QISDLTP--LANLTRITQLGLND 382
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query1125
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.81
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.78
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.73
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.69
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.68
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.67
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.67
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.64
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.62
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.62
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.62
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.6
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.6
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.58
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.57
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.57
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.56
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.48
d1fe0a_66 ATX1 metallochaperone protein (ATOX1) {Human (Homo 99.45
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.42
d1cc8a_72 ATX1 metallochaperone protein (ATOX1) {Baker's yea 99.41
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.41
d1qupa272 Copper chaperone for superoxide dismutase, N-termi 99.4
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.39
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.37
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.36
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.34
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.34
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.32
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.3
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.2
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.09
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.08
d2ggpb172 Copper transporter domain ccc2a {Baker's yeast (Sa 99.06
d1sb6a_64 Copper chaperone {Synechocystis sp. pcc 6803, Scat 99.05
d2aw0a_72 Menkes copper-transporting ATPase {Human (Homo sap 99.03
d1osda_72 Mercuric ion binding protein MerP {Ralstonia metal 98.99
d2qifa169 Copper chaperone {Bacillus subtilis, CopZ [TaxId: 98.99
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 98.96
d1cpza_68 Copper chaperone {Enterococcus hirae [TaxId: 1354] 98.92
d1kvja_79 Menkes copper-transporting ATPase {Human (Homo sap 98.92
d2ifga3156 High affinity nerve growth factor receptor, N-term 98.85
d2ifga3156 High affinity nerve growth factor receptor, N-term 98.84
d1p6ta172 Potential copper-translocating P-type ATPase CopA 98.84
d1q8la_84 Menkes copper-transporting ATPase {Human (Homo sap 98.82
d1p6ta279 Potential copper-translocating P-type ATPase CopA 98.79
d1mwza_73 Metal ion-transporting ATPase ZntA, N-terminal dom 98.73
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 98.69
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 98.63
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 98.43
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 97.74
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 97.31
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 96.7
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 96.7
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 95.77
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 95.68
d3bpda191 Uncharacterized protein AF1549 {Archaeoglobus fulg 89.02
d2raqa193 Uncharacterized protein MTH889 {Methanobacterium t 88.33
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Internalin LRR domain
domain: Internalin A
species: Listeria monocytogenes [TaxId: 1639]

Probab=99.81  E-value=3.6e-18  Score=193.85  Aligned_cols=340  Identities=21%  Similarity=0.229  Sum_probs=171.3

Q ss_pred             CCCCCcEEEeecCCccccCcccCCCCCCcEEEccCCCCCCcccccCCCCCcEEEccCCCCCCCchhhccCCCCCEEeecC
Q 001200          131 GMSNLRGLALSNMQFLSLPSLFHLPLNLQTLCLDRCALGDIAIIGNLKKLEILSLVDSNIEQLPEEMAQLTQLRLFDLSG  210 (1125)
Q Consensus       131 ~l~~Lr~L~Ls~~~i~~lp~~l~~l~~Lr~L~L~~~~l~~l~~~~~L~~L~~L~Ls~~~i~~lp~~i~~L~~L~~L~L~~  210 (1125)
                      .+.+|++|+++++.|+.+. .+..+++|++|+|++|.|+.+..++++++|++|++++|.+..++ .++++++|++|++++
T Consensus        42 ~l~~l~~L~l~~~~I~~l~-gl~~L~nL~~L~Ls~N~l~~l~~l~~L~~L~~L~L~~n~i~~i~-~l~~l~~L~~L~~~~  119 (384)
T d2omza2          42 DLDQVTTLQADRLGIKSID-GVEYLNNLTQINFSNNQLTDITPLKNLTKLVDILMNNNQIADIT-PLANLTNLTGLTLFN  119 (384)
T ss_dssp             HHTTCCEEECCSSCCCCCT-TGGGCTTCCEEECCSSCCCCCGGGTTCTTCCEEECCSSCCCCCG-GGTTCTTCCEEECCS
T ss_pred             HhCCCCEEECCCCCCCCcc-ccccCCCCCEEeCcCCcCCCCccccCCccccccccccccccccc-ccccccccccccccc
Confidence            3456666666666666653 45666666666666666666655666666666666666666554 356666666666665


Q ss_pred             CCCCCccCccccCCCCCccEEEeecCccccccccccccCCCCChhhhCCCCCCCEEEe--ecCCCcccCCccccccccEE
Q 001200          211 CSKLKVIPPNLLSGLSRLEDLYMGNTSVKWEFEGLNVGRSNASLQELKLLSHLTTLEI--QICDAMILPKGLFSKKLERY  288 (1125)
Q Consensus       211 ~~~l~~ip~~~l~~L~~L~~L~l~~~~~~~~~~~~~~~~~~~~~~~L~~L~~L~~L~l--~~~~~~~~~~~~~~~~L~~l  288 (1125)
                      +. +..++.  ......+..+....+.+..             ..........+....  .......+            
T Consensus       120 ~~-~~~~~~--~~~~~~~~~~~~~~~~l~~-------------~~~~~~~~~~~~~~~~~~~~~~~~~------------  171 (384)
T d2omza2         120 NQ-ITDIDP--LKNLTNLNRLELSSNTISD-------------ISALSGLTSLQQLSFGNQVTDLKPL------------  171 (384)
T ss_dssp             SC-CCCCGG--GTTCTTCSEEEEEEEEECC-------------CGGGTTCTTCSEEEEEESCCCCGGG------------
T ss_pred             cc-cccccc--ccccccccccccccccccc-------------cccccccccccccccccccchhhhh------------
Confidence            55 444443  3444455555544443320             001111111111111  11000000            


Q ss_pred             EEEeCCcccccCCCCCceEEEEecccCChhHHHhhhccccEEEccccCCcccccccccccccccCcEEEeecCCCeeEee
Q 001200          289 KIFIGDEWDWSGNYKNKRVLKLKLYTSNVDEVIMQLKGIEELYLDEVPGIKNVLYDLDIEGFLQLKHLHVQNNPFILFIV  368 (1125)
Q Consensus       289 ~l~~~~~~~~~~~~~~l~~l~l~~~~~~l~~~~~~l~~L~~L~L~~~~~~~~~~~~~~~~~l~~L~~L~L~~~~~l~~l~  368 (1125)
                                 ..                      ...........+..  .  .......+++++.+.++++. ++.  
T Consensus       172 -----------~~----------------------~~~~~~~~~~~~~~--~--~~~~~~~l~~~~~l~l~~n~-i~~--  211 (384)
T d2omza2         172 -----------AN----------------------LTTLERLDISSNKV--S--DISVLAKLTNLESLIATNNQ-ISD--  211 (384)
T ss_dssp             -----------TT----------------------CTTCCEEECCSSCC--C--CCGGGGGCTTCSEEECCSSC-CCC--
T ss_pred             -----------cc----------------------cccccccccccccc--c--cccccccccccceeeccCCc-cCC--
Confidence                       00                      00111111110000  0  00011334455555555443 111  


Q ss_pred             eCCcccccccccccceeecccccccceeccCccCcccccCccEEEeccCCCcCcccchhhhccCCcccEEecccccccch
Q 001200          369 DSMAWVRYNAFLLLESLVLHNLIHLEKICLGQLRAESFYKLKIIKVRNCDKLKNIFSFSFVRGLPQLQTLNVINCKNMKE  448 (1125)
Q Consensus       369 ~~~~~~~~~~~~~L~~L~l~~~~~l~~~~~~~~~~~~~~~L~~L~l~~C~~L~~l~~~~~~~~l~~L~~L~l~~c~~l~~  448 (1125)
                          .......++|+.|++.++ .++.+    .....+++|+.|++.+| .++.+++   +..+++|++|+++++ .+..
T Consensus       212 ----~~~~~~~~~L~~L~l~~n-~l~~~----~~l~~l~~L~~L~l~~n-~l~~~~~---~~~~~~L~~L~l~~~-~l~~  277 (384)
T d2omza2         212 ----ITPLGILTNLDELSLNGN-QLKDI----GTLASLTNLTDLDLANN-QISNLAP---LSGLTKLTELKLGAN-QISN  277 (384)
T ss_dssp             ----CGGGGGCTTCCEEECCSS-CCCCC----GGGGGCTTCSEEECCSS-CCCCCGG---GTTCTTCSEEECCSS-CCCC
T ss_pred             ----CCcccccCCCCEEECCCC-CCCCc----chhhcccccchhccccC-ccCCCCc---ccccccCCEeeccCc-ccCC
Confidence                112233445555555443 22222    11234566666666664 3454432   455666677666653 2333


Q ss_pred             hhcccccCCccCCcccceecCccCEEeecCCCcccccccccccccccccccceecccCCCceeecccccCcccccccccc
Q 001200          449 IFTVGRENDVDCHEVDKIEFSQLHSLTLKFLPQLTSFYSQVKTSAASQTRLKELSTHTLPREVILEDECDTLMPFFNEKV  528 (1125)
Q Consensus       449 i~~~~~~~~~~~~~~~~~~~~~L~~L~l~~~~~l~~~~~~~~~~~~~~~~L~~L~l~~c~~l~~~~~~~~~~~~~~~~~~  528 (1125)
                      +.             ....++.++.+.+.++. ++.+..     +..+++++.|++++|..-.+            ....
T Consensus       278 ~~-------------~~~~~~~l~~l~~~~n~-l~~~~~-----~~~~~~l~~L~ls~n~l~~l------------~~l~  326 (384)
T d2omza2         278 IS-------------PLAGLTALTNLELNENQ-LEDISP-----ISNLKNLTYLTLYFNNISDI------------SPVS  326 (384)
T ss_dssp             CG-------------GGTTCTTCSEEECCSSC-CSCCGG-----GGGCTTCSEEECCSSCCSCC------------GGGG
T ss_pred             CC-------------ccccccccccccccccc-cccccc-----cchhcccCeEECCCCCCCCC------------cccc
Confidence            32             12345555666555432 222221     45566677777776632111            1234


Q ss_pred             cccccceeeccccccccccccCcccccCCCCcEEEEecCCCccccCCchhhhhccCCcEEEEecc
Q 001200          529 VFPNLETLELCAISTEKIWCNQLAAVYSQNLTRLIVHGCEKLKYLFPSSMIRNFVQLEHLEICYC  593 (1125)
Q Consensus       529 ~~~~L~~L~l~~~~l~~~~~~~~~~~~l~~L~~L~l~~C~~L~~l~~~~~~~~l~~L~~L~l~~c  593 (1125)
                      .+++|++|++++|.++.+.  .+.  .+++|++|++++ ++++.+.|   +.++++|+.|+|+++
T Consensus       327 ~l~~L~~L~L~~n~l~~l~--~l~--~l~~L~~L~l~~-N~l~~l~~---l~~l~~L~~L~L~~N  383 (384)
T d2omza2         327 SLTKLQRLFFANNKVSDVS--SLA--NLTNINWLSAGH-NQISDLTP---LANLTRITQLGLNDQ  383 (384)
T ss_dssp             GCTTCCEEECCSSCCCCCG--GGG--GCTTCCEEECCS-SCCCBCGG---GTTCTTCSEEECCCE
T ss_pred             cCCCCCEEECCCCCCCCCh--hHc--CCCCCCEEECCC-CcCCCChh---hccCCCCCEeeCCCC
Confidence            5788999999998877653  232  489999999987 57888743   788999999999875
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1fe0a_ d.58.17.1 (A:) ATX1 metallochaperone protein (ATOX1) {Human (Homo sapiens), HAH1 [TaxId: 9606]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cc8a_ d.58.17.1 (A:) ATX1 metallochaperone protein (ATOX1) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1qupa2 d.58.17.1 (A:2-73) Copper chaperone for superoxide dismutase, N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d2ggpb1 d.58.17.1 (B:1-72) Copper transporter domain ccc2a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1sb6a_ d.58.17.1 (A:) Copper chaperone {Synechocystis sp. pcc 6803, Scatx1 [TaxId: 1148]} Back     information, alignment and structure
>d2aw0a_ d.58.17.1 (A:) Menkes copper-transporting ATPase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1osda_ d.58.17.1 (A:) Mercuric ion binding protein MerP {Ralstonia metallidurans CH34 [TaxId: 266264]} Back     information, alignment and structure
>d2qifa1 d.58.17.1 (A:1-69) Copper chaperone {Bacillus subtilis, CopZ [TaxId: 1423]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cpza_ d.58.17.1 (A:) Copper chaperone {Enterococcus hirae [TaxId: 1354]} Back     information, alignment and structure
>d1kvja_ d.58.17.1 (A:) Menkes copper-transporting ATPase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p6ta1 d.58.17.1 (A:1-72) Potential copper-translocating P-type ATPase CopA (YvgX) {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1q8la_ d.58.17.1 (A:) Menkes copper-transporting ATPase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p6ta2 d.58.17.1 (A:73-151) Potential copper-translocating P-type ATPase CopA (YvgX) {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1mwza_ d.58.17.1 (A:) Metal ion-transporting ATPase ZntA, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d3bpda1 d.58.61.1 (A:1-91) Uncharacterized protein AF1549 {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2raqa1 d.58.61.1 (A:3-95) Uncharacterized protein MTH889 {Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure