Citrus Sinensis ID: 001212
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 1122 | ||||||
| 255548475 | 1306 | ATP binding protein, putative [Ricinus c | 0.977 | 0.839 | 0.723 | 0.0 | |
| 225437545 | 1297 | PREDICTED: DNA mismatch repair protein M | 0.974 | 0.842 | 0.702 | 0.0 | |
| 224128348 | 1288 | predicted protein [Populus trichocarpa] | 0.957 | 0.833 | 0.680 | 0.0 | |
| 297743972 | 1237 | unnamed protein product [Vitis vinifera] | 0.924 | 0.838 | 0.681 | 0.0 | |
| 356572787 | 1269 | PREDICTED: DNA mismatch repair protein M | 0.961 | 0.850 | 0.661 | 0.0 | |
| 147861780 | 1349 | hypothetical protein VITISV_032225 [Viti | 0.981 | 0.816 | 0.653 | 0.0 | |
| 15235223 | 1324 | DNA mismatch repair protein Msh6-1 [Arab | 0.975 | 0.826 | 0.643 | 0.0 | |
| 297814117 | 1326 | hypothetical protein ARALYDRAFT_912022 [ | 0.975 | 0.825 | 0.640 | 0.0 | |
| 334186287 | 1321 | DNA mismatch repair protein Msh6-1 [Arab | 0.972 | 0.825 | 0.641 | 0.0 | |
| 2104549 | 1362 | AGAA.3 [Arabidopsis thaliana] | 0.975 | 0.803 | 0.624 | 0.0 |
| >gi|255548475|ref|XP_002515294.1| ATP binding protein, putative [Ricinus communis] gi|223545774|gb|EEF47278.1| ATP binding protein, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
Score = 1564 bits (4049), Expect = 0.0, Method: Compositional matrix adjust.
Identities = 814/1125 (72%), Positives = 920/1125 (81%), Gaps = 28/1125 (2%)
Query: 1 MAPGKRQNNGRSPLVNPQRQITSFFSKSNSPSPSPTISKLNPNKSNSNPNPNPNSNSNRT 60
MAP ++ +NGRSPLVNPQRQITSFF K+ SPSPSP+ S + + S ++ +
Sbjct: 1 MAPSRKPSNGRSPLVNPQRQITSFFCKTTSPSPSPSPSPSPAS-TLSKGQTPKSNPNPNP 59
Query: 61 PSPSPSPTTPSPLQSNPKKSRLVIGQTPSPPPSTP---AAAKSYGEDVLRKRIRVYWPLD 117
SP PTTPSP+QS KK LVIG+TP+P PS A S+G++V+ KR++VYWPLD
Sbjct: 60 KPSSPGPTTPSPVQSKTKKPLLVIGKTPTPSPSPSMPRVMANSFGKEVVEKRVKVYWPLD 119
Query: 118 KAWYEGCVKSFDKECNKHLVQYDDGEDELLDLGKEKIEWVQESVSLLKRLRRDS--FKKV 175
K WYEGCVKS+D++ KHLVQYDD E+E+LDLG EKIEWV+ESV+ KRLRR S FK
Sbjct: 120 KTWYEGCVKSYDEDSGKHLVQYDDFEEEVLDLGNEKIEWVEESVTKFKRLRRGSLAFKNT 179
Query: 176 VVEDDEEMENV----EDEISDDRSDSSDDDWNKNVGKEDVSEDEEVDLVDEQENKVLRG- 230
V+ED EEM++V E+ D DSSD+DW KNV K D+SEDE+ DL DE E +G
Sbjct: 180 VIED-EEMKDVADIEEENACVDGDDSSDEDWAKNVDK-DISEDEDADLEDEVEEDSYKGA 237
Query: 231 ----RKRKSSGVKKSKSD----GNAVNADFKSPIIKPVKIFGSDKLSNGFDN--PVMGDV 280
RKRK G K S G+ K I+PVK G + NG N + D
Sbjct: 238 KSDSRKRKVYGAKASVKKKKSCGDVSEGAVKVSFIEPVKD-GGNGFCNGLGNGNASINDA 296
Query: 281 SERFSAREADKFHFLGPDRRDAKRRRPGDVYYDPRTLYLPPDFLRNLSEGQKQWWEFKSK 340
SERFS REA+K FLG +RRDAKR+RPGD YDPRTLYLPP F+++LS GQ+QWWEFKSK
Sbjct: 297 SERFSMREAEKMWFLGAERRDAKRKRPGDADYDPRTLYLPPSFVKSLSGGQRQWWEFKSK 356
Query: 341 HMDKVIFFKMGKFYELFEMDAHVGAKELDLQYMKGEQPHCGFPERNFSMNVEKLARKGYR 400
HMDKV+FFKMGKFYELFEMDAHVGAKELDLQYMKGEQPHCGFPER FSMNVEKL RKGYR
Sbjct: 357 HMDKVLFFKMGKFYELFEMDAHVGAKELDLQYMKGEQPHCGFPERIFSMNVEKLTRKGYR 416
Query: 401 VLVVEQTETPEQLELRRKEKGSKDKVVKREICAVVTKGTLTEGELLSANPDASYLMALTE 460
VLV+EQTETPEQLELRRKEKGSKDKVVKREICAVVTKGTLTEGELL+ANPDASYLMA+TE
Sbjct: 417 VLVIEQTETPEQLELRRKEKGSKDKVVKREICAVVTKGTLTEGELLTANPDASYLMAVTE 476
Query: 461 SNQSPASQSTDRCFGICVVDVATSRIILGQVMDDLDCSVLCCLLSELRPVEIIKPANMLS 520
S Q+ Q+ + FGICV DVATSRIILGQ +DD +CS LC LLSELRPVEIIKPA LS
Sbjct: 477 SQQNLEGQNFEPTFGICVADVATSRIILGQFVDDSECSSLCRLLSELRPVEIIKPAKSLS 536
Query: 521 PETERAILRHTRNPLVNDLVPLSEFWDAETTVLEIKNIYNRIT----AESLNKADSNVAN 576
ETER +LRHTRNPLVNDLVPLSEFWDAE TV E+K IY I+ + SLNK D + AN
Sbjct: 537 SETERLLLRHTRNPLVNDLVPLSEFWDAEKTVHEVKIIYKHISDQSASRSLNKEDKDTAN 596
Query: 577 SQAEGDGLTCLPGILSELISTGDSGSQVLSALGGTLFYLKKSFLDETLLRFAKFELLPCS 636
Q +G +CLP IL EL++ GD+G LSALGGTL+YLK++FLDETLLRFAKFE LPCS
Sbjct: 597 LQFTEEGPSCLPEILLELVNKGDNGRLALSALGGTLYYLKQAFLDETLLRFAKFESLPCS 656
Query: 637 GFGDMAKKPYMVLDAPALENLEVFENSRSGDSSGTLYAQLNHCVTAFGKRLLRTWLARPL 696
F D+A+KPYM+LDA ALENLE+FENSR+G SGTLYAQLNHCVTAFGKRLL+TWLARPL
Sbjct: 657 DFCDVAQKPYMILDAAALENLEIFENSRNGGLSGTLYAQLNHCVTAFGKRLLKTWLARPL 716
Query: 697 YNSGLIRERQDAVAGLRGVNQPFALEFRKALSRLPDMERLLARLFASSEANGRNSNKVVL 756
Y+ I +RQDAVAGLRGVNQP LEFRKALSRLPDMERL+AR+FASSEANGRN+NKV+L
Sbjct: 717 YHLRSIVDRQDAVAGLRGVNQPATLEFRKALSRLPDMERLIARIFASSEANGRNANKVIL 776
Query: 757 YEDAAKKQLQEFISALHGCELMDQACSSLGAILENTESRQLHHILTPGKGLPAIVSILKH 816
YEDAAKK LQEFISAL GCELM+QACSSL ILEN ESRQLHH+LTPGK P I SILKH
Sbjct: 777 YEDAAKKLLQEFISALRGCELMEQACSSLAVILENVESRQLHHLLTPGKSRPHIHSILKH 836
Query: 817 FKDAFDWVEANNSGRIIPHGGVDMDYDSACKKVKEIEASLTKHLKEQRKLLGDTSITYVT 876
FK+AFDWVEANNSGR+IPH GVD++YDSAC+K++ IE+SLTKHLKEQ+K+LGD SI YVT
Sbjct: 837 FKEAFDWVEANNSGRVIPHEGVDIEYDSACEKLRVIESSLTKHLKEQQKILGDKSIMYVT 896
Query: 877 IGKDLYLLEVPESLRGSVPRDYELRSSKKGFFRYWTPNIKKLLGELSQAESEKESALKSI 936
+GK+ YLLEVPE RGS+PRDYELRSSKKGF+RYWTP+IKKLLGELSQAESEKE ALK+I
Sbjct: 897 VGKEAYLLEVPEHFRGSIPRDYELRSSKKGFYRYWTPSIKKLLGELSQAESEKELALKNI 956
Query: 937 LQRLIGQFCEHHNKWRQMVAATAELDALISLAIASDFYEGPTCRPVILDSCSNEEPYISA 996
LQRLI QFCEHH+KWRQ+ +ATAELD LISLAIASDFYEG CRPVIL S S+E P SA
Sbjct: 957 LQRLIVQFCEHHDKWRQLNSATAELDVLISLAIASDFYEGQACRPVILGSSSSEMPCFSA 1016
Query: 997 KSLGHPVLRSDSLGKGEFVPNDITIGGHGNASFILLTGPNMGGKSTLLRQVCLAVILAQV 1056
KSLGHP+L+SDSLGKG FVPND++IGG ASFILLTGPNMGGKSTLLRQVCLAVILAQV
Sbjct: 1017 KSLGHPILKSDSLGKGAFVPNDVSIGGSDGASFILLTGPNMGGKSTLLRQVCLAVILAQV 1076
Query: 1057 GADVPAEIFEISPVDRIFVRMGAKDHIMAGQSTFLTELSETALML 1101
GADVPAE FE+SPVDRIFVRMGAKDHIMAGQSTFLTELSETALML
Sbjct: 1077 GADVPAESFELSPVDRIFVRMGAKDHIMAGQSTFLTELSETALML 1121
|
Source: Ricinus communis Species: Ricinus communis Genus: Ricinus Family: Euphorbiaceae Order: Malpighiales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|225437545|ref|XP_002275930.1| PREDICTED: DNA mismatch repair protein Msh6-1-like [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|224128348|ref|XP_002320307.1| predicted protein [Populus trichocarpa] gi|222861080|gb|EEE98622.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|297743972|emb|CBI36942.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|356572787|ref|XP_003554547.1| PREDICTED: DNA mismatch repair protein Msh6-1-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|147861780|emb|CAN78918.1| hypothetical protein VITISV_032225 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|15235223|ref|NP_192116.1| DNA mismatch repair protein Msh6-1 [Arabidopsis thaliana] gi|6226648|sp|O04716.2|MSH6_ARATH RecName: Full=DNA mismatch repair protein MSH6; Short=AtMSH6; AltName: Full=MutS protein homolog 6 gi|3912921|gb|AAC78699.1| G/T DNA mismatch repair enzyme [Arabidopsis thaliana] gi|5763966|emb|CAB53337.1| mismatch repair protein msh6-1 [Arabidopsis thaliana] gi|7268591|emb|CAB80700.1| G/T DNA mismatch repair enzyme [Arabidopsis thaliana] gi|332656719|gb|AEE82119.1| DNA mismatch repair protein Msh6-1 [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|297814117|ref|XP_002874942.1| hypothetical protein ARALYDRAFT_912022 [Arabidopsis lyrata subsp. lyrata] gi|297320779|gb|EFH51201.1| hypothetical protein ARALYDRAFT_912022 [Arabidopsis lyrata subsp. lyrata] | Back alignment and taxonomy information |
|---|
| >gi|334186287|ref|NP_001190656.1| DNA mismatch repair protein Msh6-1 [Arabidopsis thaliana] gi|332656720|gb|AEE82120.1| DNA mismatch repair protein Msh6-1 [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|2104549|gb|AAB57798.1| AGAA.3 [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 1122 | ||||||
| TAIR|locus:2132233 | 1324 | MSH6 "AT4G02070" [Arabidopsis | 0.754 | 0.639 | 0.699 | 0.0 | |
| ZFIN|ZDB-GENE-020905-3 | 1369 | msh6 "mutS homolog 6 (E. coli) | 0.440 | 0.360 | 0.348 | 4.9e-131 | |
| RGD|2322311 | 1361 | Msh6 "mutS homolog 6 (E. coli) | 0.636 | 0.524 | 0.376 | 2.5e-120 | |
| MGI|MGI:1343961 | 1358 | Msh6 "mutS homolog 6 (E. coli) | 0.640 | 0.529 | 0.370 | 1.1e-119 | |
| UNIPROTKB|E1BWV7 | 1357 | MSH6 "Uncharacterized protein" | 0.643 | 0.532 | 0.367 | 2.3e-119 | |
| UNIPROTKB|E1BYJ2 | 1341 | MSH6 "Uncharacterized protein" | 0.643 | 0.538 | 0.367 | 2.3e-119 | |
| FB|FBgn0036486 | 1190 | Msh6 "Msh6" [Drosophila melano | 0.693 | 0.653 | 0.343 | 6.8e-111 | |
| WB|WBGene00003422 | 1186 | msh-6 [Caenorhabditis elegans | 0.720 | 0.681 | 0.320 | 9.2e-107 | |
| UNIPROTKB|Q9N3T8 | 1186 | msh-6 "Protein MSH-6" [Caenorh | 0.720 | 0.681 | 0.320 | 9.2e-107 | |
| DICTYBASE|DDB_G0268614 | 1260 | msh6 "mutS homolog" [Dictyoste | 0.465 | 0.414 | 0.330 | 1.3e-103 |
| TAIR|locus:2132233 MSH6 "AT4G02070" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 3056 (1080.8 bits), Expect = 0., Sum P(3) = 0.
Identities = 596/852 (69%), Positives = 694/852 (81%)
Query: 252 FKSPIIKPVKIFG-SDKLSNGF-DNPVMGDVSERFSAREADKFHFLGPDRRDAKRRRPGD 309
FK+ +++P K G +D++ G DN + GD RF AR+++KF FLG DRRDAKRRRP D
Sbjct: 302 FKASVVEPAKKIGQADRVVKGLEDNVLDGDALARFGARDSEKFRFLGVDRRDAKRRRPTD 361
Query: 310 VYYDPRTLYLPPDFLRNLSEGQKQWWEFKSKHMDKVIFFKMGKFYELFEMDAHVGAKELD 369
YDPRTLYLPPDF++ L+ GQ+QWWEFK+KHMDKV+FFKMGKFYELFEMDAHVGAKELD
Sbjct: 362 ENYDPRTLYLPPDFVKKLTGGQRQWWEFKAKHMDKVVFFKMGKFYELFEMDAHVGAKELD 421
Query: 370 LQYMKGEQPHCGFPERNFSMNVEKLARKGYRVLVVEQTETPEQLELRRKEKGSKDKVVKR 429
+QYMKGEQPHCGFPE+NFS+N+EKL RKGYRVLVVEQTETP+QLE RRKE GSKDKVVKR
Sbjct: 422 IQYMKGEQPHCGFPEKNFSVNIEKLVRKGYRVLVVEQTETPDQLEQRRKETGSKDKVVKR 481
Query: 430 EICAVVTKGTLTEGELLSANPDASYLMALTESNQSPASQSTDRCFGICVVDVATSRIILG 489
E+CAVVTKGTLT+GE+L NPDASYLMALTE +S + + + FG+C+VDVAT +IILG
Sbjct: 482 EVCAVVTKGTLTDGEMLLTNPDASYLMALTEGGESLTNPTAEHNFGVCLVDVATQKIILG 541
Query: 490 QVMXXXXXXXXXXXXXXXRPVEIIKPANMLSPETERAILRHTRNPLVNDLVPLSEFWDAE 549
Q RPVEIIKPA +LS TER I+R TRNPLVN+LVPLSEFWD+E
Sbjct: 542 QFKDDQDCSALSCLLSEMRPVEIIKPAKVLSYATERTIVRQTRNPLVNNLVPLSEFWDSE 601
Query: 550 TTVLEIKNIYNRITAESLNKADSNVANSQAEGDGLTCLPGILSELISTGDSGSQVLSALG 609
T+ E+ IY RI + + S + GDG + LP +LSEL + +GS LSALG
Sbjct: 602 KTIYEVGIIYKRINCQPSSAYSSE---GKILGDGSSFLPKMLSELATEDKNGSLALSALG 658
Query: 610 GTLFYLKKSFLDETLLRFAKFELLPCSGFGDMAKKPYMVLDAPALENLEVFENSRSGDSS 669
G ++YL+++FLDE+LLRFAKFE LP F ++ +K +MVLDA ALENLE+FENSR+G S
Sbjct: 659 GAIYYLRQAFLDESLLRFAKFESLPYCDFSNVNEKQHMVLDAAALENLEIFENSRNGGYS 718
Query: 670 GTLYAQLNHCVTAFGKRLLRTWLARPLYNSGLIRERQDAVAGLRGVNQPFALEFRKALSR 729
GTLYAQLN C+TA GKRLL+TWLARPLYN+ LI+ERQDAVA LRG N P++LEFRK+LSR
Sbjct: 719 GTLYAQLNQCITASGKRLLKTWLARPLYNTELIKERQDAVAILRGENLPYSLEFRKSLSR 778
Query: 730 LPDMERLLARLFASSEANGRNSNKVVLYEDAAKKQLQEFISALHGCELMDQACSSLGAIL 789
LPDMERL+AR+F+S EA+GRN +KVVLYED AKKQ+QEFIS L GCE M +ACSSL AIL
Sbjct: 779 LPDMERLIARMFSSIEASGRNGDKVVLYEDTAKKQVQEFISTLRGCETMAEACSSLRAIL 838
Query: 790 ENTESRQLHHILTPGKGLPAIVSILKHFKDAFDWVEANNSGRIIPHGGVDMDYDSACKKV 849
++ SR+L H+LTPG+ LP I S +K+FKDAFDWVEA+NSGR+IPH G D +YD ACK V
Sbjct: 839 KHDTSRRLLHLLTPGQSLPNISSSIKYFKDAFDWVEAHNSGRVIPHEGADEEYDCACKTV 898
Query: 850 KEIEASLTKHLKEQRKLLGDTSITYVTIGKDLYLLEVPESLRGSVPRDYELRSSKKGFFR 909
+E E+SL KHLKEQRKLLGD SI YVT+GKD YLLEVPESL GSVP DYEL SSKKG R
Sbjct: 899 EEFESSLKKHLKEQRKLLGDASINYVTVGKDEYLLEVPESLSGSVPHDYELCSSKKGVSR 958
Query: 910 YWTPNIKKLLGELSQAESEKESALKSILQRLIGQFCEHHNKWRQMVAATAELDALISLAI 969
YWTP IKKLL ELSQA+SEKESALKSI QRLIG+FCEH KWRQ+V+ATAELD LISLA
Sbjct: 959 YWTPTIKKLLKELSQAKSEKESALKSISQRLIGRFCEHQEKWRQLVSATAELDVLISLAF 1018
Query: 970 ASDFYEGPTCRPVILDSCSNEEPYISAKSLGHPVLRSDSLGKGEFVPNDITIGGHGNASF 1029
ASD YEG CRPVI S S+ P++SA LGHPVLR DSLG+G FVPN++ IGG ASF
Sbjct: 1019 ASDSYEGVRCRPVISGSTSDGVPHLSATGLGHPVLRGDSLGRGSFVPNNVKIGGAEKASF 1078
Query: 1030 ILLTGPNMGGKSTLLRQVCLAVILAQVGADVPAEIFEISPVDRIFVRMGAKDHIMAGQST 1089
ILLTGPNMGGKSTLLRQVCLAVILAQ+GADVPAE FE+SPVD+I VRMGAKDHIMAGQST
Sbjct: 1079 ILLTGPNMGGKSTLLRQVCLAVILAQIGADVPAETFEVSPVDKICVRMGAKDHIMAGQST 1138
Query: 1090 FLTELSETALML 1101
FLTELSETA+ML
Sbjct: 1139 FLTELSETAVML 1150
|
|
| ZFIN|ZDB-GENE-020905-3 msh6 "mutS homolog 6 (E. coli)" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| RGD|2322311 Msh6 "mutS homolog 6 (E. coli)" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:1343961 Msh6 "mutS homolog 6 (E. coli)" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E1BWV7 MSH6 "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E1BYJ2 MSH6 "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| FB|FBgn0036486 Msh6 "Msh6" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
| WB|WBGene00003422 msh-6 [Caenorhabditis elegans (taxid:6239)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q9N3T8 msh-6 "Protein MSH-6" [Caenorhabditis elegans (taxid:6239)] | Back alignment and assigned GO terms |
|---|
| DICTYBASE|DDB_G0268614 msh6 "mutS homolog" [Dictyostelium discoideum (taxid:44689)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
| eugene3.00140670 | hypothetical protein (1288 aa) | ||||||||||
(Populus trichocarpa) | |||||||||||
| eugene3.00120511 | • | • | • | • | • | 0.798 | |||||
| gw1.XIX.1944.1 | • | • | • | • | 0.688 | ||||||
| gw1.V.2541.1 | • | • | • | 0.597 | |||||||
| estExt_Genewise1_v1.C_LG_I1046 | • | • | • | 0.527 | |||||||
| estExt_Genewise1_v1.C_LG_IX3930 | • | • | • | 0.519 | |||||||
| fgenesh4_pg.C_scaffold_15300000001 | • | 0.502 | |||||||||
| eugene3.00660007 | • | • | • | 0.436 | |||||||
| eugene3.07100002 | • | 0.431 | |||||||||
| eugene3.00140751 | • | • | • | 0.423 |
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 1122 | |||
| COG0249 | 843 | COG0249, MutS, Mismatch repair ATPase (MutS family | 1e-132 | |
| PRK05399 | 854 | PRK05399, PRK05399, DNA mismatch repair protein Mu | 1e-108 | |
| TIGR01070 | 840 | TIGR01070, mutS1, DNA mismatch repair protein MutS | 4e-80 | |
| smart00533 | 308 | smart00533, MUTSd, DNA-binding domain of DNA misma | 7e-61 | |
| pfam05192 | 290 | pfam05192, MutS_III, MutS domain III | 6e-55 | |
| pfam00488 | 235 | pfam00488, MutS_V, MutS domain V | 1e-41 | |
| cd03286 | 218 | cd03286, ABC_MSH6_euk, ATP-binding cassette domain | 3e-41 | |
| pfam01624 | 113 | pfam01624, MutS_I, MutS domain I | 1e-39 | |
| cd03284 | 216 | cd03284, ABC_MutS1, ATP-binding cassette domain of | 5e-35 | |
| cd03243 | 202 | cd03243, ABC_MutS_homologs, ATP-binding cassette d | 1e-34 | |
| smart00534 | 185 | smart00534, MUTSac, ATPase domain of DNA mismatch | 3e-34 | |
| cd03285 | 222 | cd03285, ABC_MSH2_euk, ATP-binding cassette domain | 5e-26 | |
| cd03287 | 222 | cd03287, ABC_MSH3_euk, ATP-binding cassette domain | 1e-25 | |
| cd03281 | 213 | cd03281, ABC_MSH5_euk, ATP-binding cassette domain | 3e-25 | |
| cd03282 | 204 | cd03282, ABC_MSH4_euk, ATP-binding cassette domain | 2e-20 | |
| cd03283 | 199 | cd03283, ABC_MutS-like, ATP-binding cassette domai | 2e-19 | |
| pfam05190 | 92 | pfam05190, MutS_IV, MutS family domain IV | 4e-19 | |
| TIGR01069 | 771 | TIGR01069, mutS2, MutS2 family protein | 1e-13 | |
| PRK00409 | 782 | PRK00409, PRK00409, recombination and DNA strand e | 6e-12 | |
| cd03280 | 200 | cd03280, ABC_MutS2, ATP-binding cassette domain of | 3e-11 | |
| cd03227 | 162 | cd03227, ABC_Class2, ATP-binding cassette domain o | 1e-10 | |
| COG1193 | 753 | COG1193, COG1193, Mismatch repair ATPase (MutS fam | 2e-09 | |
| pfam05188 | 133 | pfam05188, MutS_II, MutS domain II | 3e-04 | |
| cd00267 | 157 | cd00267, ABC_ATPase, ATP-binding cassette transpor | 0.001 |
| >gnl|CDD|223327 COG0249, MutS, Mismatch repair ATPase (MutS family) [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
Score = 422 bits (1086), Expect = e-132
Identities = 229/776 (29%), Positives = 343/776 (44%), Gaps = 111/776 (14%)
Query: 332 KQWWEFKSKHMDKVIFFKMGKFYELFEMDAHVGAKELDL-QYMKGEQPHCGFPERNFSMN 390
+Q+ E K+++ D ++FF+MG FYELF DA + A+ LD+ +G P G P
Sbjct: 11 QQYLEIKAQYPDTLLFFRMGDFYELFFEDAKIAARLLDITLTKRGNIPMAGVPYHALDYY 70
Query: 391 VEKLARKGYRVLVVEQTETPEQLELRRKEKGSKDKVVKREICAVVTKGTLTEGELLSANP 450
+ KL GY+V + EQ E P VV+R++ VVT GTLT+ LLS
Sbjct: 71 LAKLIELGYKVAICEQLEDP----------AEAKGVVERKVVRVVTPGTLTDEALLSDR- 119
Query: 451 DASYLMALTESNQSPASQSTDRCFGICVVDVATSRIILGQVMDDLDCSVLCCLLSEL--- 507
+ +YL AL + D G+ +D++T + + + LLSEL
Sbjct: 120 ENNYLAAL--------AIDRDGKVGLAFIDLSTGEFFVSEFEREK-------LLSELKRL 164
Query: 508 RPVEIIKPANMLSPETERAILRHTRNPLVNDLVPLSEFWDAETTVLEIKNIYNRITAESL 567
+P E++ ++LS L P S F D + + +
Sbjct: 165 QPKELLLSESLLSSTLAEIQKGLFVVRL-----PASFF-DEDDAEEILSEYF-------- 210
Query: 568 NKADSNVANSQAEGDGLTCLPGILSELISTGDSGSQVLSALGGTLFYLKKSFLDETL-LR 626
G+ S LSA G L YLK + ++
Sbjct: 211 ---------------------GVRDLDGFGLISTPLALSAAGALLSYLKDTQKTFLPHIQ 249
Query: 627 FAKFELLPCSGFGDMAKKPYMVLDAPALENLEVFENSRSGDSSGTLYAQLNHCVTAFGKR 686
+ L + YMVLDA NLE+F N R G+L+ L+ VT G R
Sbjct: 250 IIQRYDL----------EDYMVLDAATRRNLELFSNLRGNGKKGSLFWLLDRTVTPMGSR 299
Query: 687 LLRTWLARPLYNSGLIRERQDAVAGLRGVNQPFALE-FRKALSRLPDMERLLARLFASSE 745
LL+ WL +PL + I ER DAV L + P E R+ L ++PD+ERLL+RL
Sbjct: 300 LLKRWLLQPLLDKEEIEERLDAVEEL--KDNPELREKLREMLKKVPDLERLLSRL----- 352
Query: 746 ANGRNSNKVVLYEDAAKKQLQEFISALHGCELMDQACSSLGAILENTESRQLHHILTPGK 805
+ GR S + +L +L++ + + E+ L +L +
Sbjct: 353 SLGRASPRDLL-------RLRDSLEKIP--EIFKLL-------SSLKSESDLLLLLEDIE 396
Query: 806 GLPAIVSILKHFKDAFDWVEANNSGRIIPHGGVDMDYDSACKKVKEIEASLTKHLKEQRK 865
L + +L+ + A + I G +++ D + + + K E+R+
Sbjct: 397 SLDYLAELLELLETAINEDPPLAVRDGIIKEGYNIELDELRDLLNNAKEWIAKLELEERE 456
Query: 866 LLGDTSITYVTIGKDLYLLEVPESLRGSVPRDYELRSSKKGFFRYWTPNIKKLLGELSQA 925
G S+ Y +EV +S VP DY R + K R+ TP +K+L +L A
Sbjct: 457 RTGIKSLKIKYNKVYGYYIEVTKSNAKLVPDDYIRRQTLKNAERFTTPELKELEEKLLDA 516
Query: 926 ESEKESALKSILQRLIGQFCEHHNKWRQMVAATAELDALISLAIASDFYEGPTCRPVILD 985
E + + + L + H N+ + + A AELD L SLA + RP
Sbjct: 517 EEKILALEYELFDELREKILAHINELQALAKALAELDVLSSLAEIAAEQ--NYVRPEF-- 572
Query: 986 SCSNEEPYISAKSLGHPVLRSDSLGKGEFVPNDITIGGHGNASFILLTGPNMGGKSTLLR 1045
+ + K HPV+ +++ FVPNDI + G+ IL+TGPNMGGKST LR
Sbjct: 573 ---VDSNDLEIKEGRHPVV--EAVLDNGFVPNDIDLSGNRR--IILITGPNMGGKSTYLR 625
Query: 1046 QVCLAVILAQVGADVPAEIFEISPVDRIFVRMGAKDHIMAGQSTFLTELSETALML 1101
QV L VILAQ+G+ VPAE I VDRIF R+GA D + +G+STF+ E+ ETA +L
Sbjct: 626 QVALIVILAQIGSFVPAEKARIGIVDRIFTRIGAADDLASGRSTFMVEMLETANIL 681
|
Length = 843 |
| >gnl|CDD|235444 PRK05399, PRK05399, DNA mismatch repair protein MutS; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|233259 TIGR01070, mutS1, DNA mismatch repair protein MutS | Back alignment and domain information |
|---|
| >gnl|CDD|214710 smart00533, MUTSd, DNA-binding domain of DNA mismatch repair MUTS family | Back alignment and domain information |
|---|
| >gnl|CDD|218489 pfam05192, MutS_III, MutS domain III | Back alignment and domain information |
|---|
| >gnl|CDD|215944 pfam00488, MutS_V, MutS domain V | Back alignment and domain information |
|---|
| >gnl|CDD|213253 cd03286, ABC_MSH6_euk, ATP-binding cassette domain of eukaryotic MutS6 homolog | Back alignment and domain information |
|---|
| >gnl|CDD|216613 pfam01624, MutS_I, MutS domain I | Back alignment and domain information |
|---|
| >gnl|CDD|213251 cd03284, ABC_MutS1, ATP-binding cassette domain of MutS1 homolog | Back alignment and domain information |
|---|
| >gnl|CDD|213210 cd03243, ABC_MutS_homologs, ATP-binding cassette domain of MutS homologs | Back alignment and domain information |
|---|
| >gnl|CDD|197777 smart00534, MUTSac, ATPase domain of DNA mismatch repair MUTS family | Back alignment and domain information |
|---|
| >gnl|CDD|213252 cd03285, ABC_MSH2_euk, ATP-binding cassette domain of eukaryotic MutS2 homolog | Back alignment and domain information |
|---|
| >gnl|CDD|213254 cd03287, ABC_MSH3_euk, ATP-binding cassette domain of eukaryotic MutS3 homolog | Back alignment and domain information |
|---|
| >gnl|CDD|213248 cd03281, ABC_MSH5_euk, ATP-binding cassette domain of eukaryotic MutS5 homolog | Back alignment and domain information |
|---|
| >gnl|CDD|213249 cd03282, ABC_MSH4_euk, ATP-binding cassette domain of eukaryotic MutS4 homolog | Back alignment and domain information |
|---|
| >gnl|CDD|213250 cd03283, ABC_MutS-like, ATP-binding cassette domain of MutS-like homolog | Back alignment and domain information |
|---|
| >gnl|CDD|218487 pfam05190, MutS_IV, MutS family domain IV | Back alignment and domain information |
|---|
| >gnl|CDD|130141 TIGR01069, mutS2, MutS2 family protein | Back alignment and domain information |
|---|
| >gnl|CDD|234750 PRK00409, PRK00409, recombination and DNA strand exchange inhibitor protein; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|213247 cd03280, ABC_MutS2, ATP-binding cassette domain of MutS2 | Back alignment and domain information |
|---|
| >gnl|CDD|213194 cd03227, ABC_Class2, ATP-binding cassette domain of non-transporter proteins | Back alignment and domain information |
|---|
| >gnl|CDD|224114 COG1193, COG1193, Mismatch repair ATPase (MutS family) [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >gnl|CDD|218486 pfam05188, MutS_II, MutS domain II | Back alignment and domain information |
|---|
| >gnl|CDD|213179 cd00267, ABC_ATPase, ATP-binding cassette transporter nucleotide-binding domain | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 1122 | |||
| KOG0217 | 1125 | consensus Mismatch repair ATPase MSH6 (MutS family | 100.0 | |
| TIGR01070 | 840 | mutS1 DNA mismatch repair protein MutS. | 100.0 | |
| COG0249 | 843 | MutS Mismatch repair ATPase (MutS family) [DNA rep | 100.0 | |
| PRK05399 | 854 | DNA mismatch repair protein MutS; Provisional | 100.0 | |
| KOG0218 | 1070 | consensus Mismatch repair MSH3 [Replication, recom | 100.0 | |
| KOG0219 | 902 | consensus Mismatch repair ATPase MSH2 (MutS family | 100.0 | |
| KOG0220 | 867 | consensus Mismatch repair ATPase MSH4 (MutS family | 100.0 | |
| KOG0221 | 849 | consensus Mismatch repair ATPase MSH5 (MutS family | 100.0 | |
| PRK00409 | 782 | recombination and DNA strand exchange inhibitor pr | 100.0 | |
| TIGR01069 | 771 | mutS2 MutS2 family protein. Function of MutS2 is u | 100.0 | |
| smart00533 | 308 | MUTSd DNA-binding domain of DNA mismatch repair MU | 100.0 | |
| PF00488 | 235 | MutS_V: MutS domain V C-terminus.; InterPro: IPR00 | 100.0 | |
| PF01624 | 113 | MutS_I: MutS domain I C-terminus.; InterPro: IPR00 | 99.97 | |
| COG1193 | 753 | Mismatch repair ATPase (MutS family) [DNA replicat | 99.97 | |
| cd03286 | 218 | ABC_MSH6_euk MutS6 homolog in eukaryotes. The MutS | 99.97 | |
| cd03287 | 222 | ABC_MSH3_euk MutS3 homolog in eukaryotes. The MutS | 99.96 | |
| cd03281 | 213 | ABC_MSH5_euk MutS5 homolog in eukaryotes. The MutS | 99.94 | |
| cd03285 | 222 | ABC_MSH2_euk MutS2 homolog in eukaryotes. The MutS | 99.93 | |
| cd03282 | 204 | ABC_MSH4_euk MutS4 homolog in eukaryotes. The MutS | 99.93 | |
| cd03284 | 216 | ABC_MutS1 MutS1 homolog in eukaryotes. The MutS pr | 99.92 | |
| PF05192 | 204 | MutS_III: MutS domain III C-terminus.; InterPro: I | 99.91 | |
| cd03280 | 200 | ABC_MutS2 MutS2 homologs in bacteria and eukaryote | 99.88 | |
| cd03243 | 202 | ABC_MutS_homologs The MutS protein initiates DNA m | 99.87 | |
| cd03283 | 199 | ABC_MutS-like MutS-like homolog in eukaryotes. The | 99.86 | |
| smart00534 | 185 | MUTSac ATPase domain of DNA mismatch repair MUTS f | 99.83 | |
| cd03227 | 162 | ABC_Class2 ABC-type Class 2 contains systems invol | 99.54 | |
| PF05188 | 137 | MutS_II: MutS domain II; InterPro: IPR007860 Misma | 99.37 | |
| PF05190 | 92 | MutS_IV: MutS family domain IV C-terminus.; InterP | 99.34 | |
| PF09465 | 55 | LBR_tudor: Lamin-B receptor of TUDOR domain; Inter | 99.15 | |
| KOG4675 | 273 | consensus Uncharacterized conserved protein, conta | 97.94 | |
| KOG0219 | 902 | consensus Mismatch repair ATPase MSH2 (MutS family | 97.55 | |
| smart00333 | 57 | TUDOR Tudor domain. Domain of unknown function pre | 97.14 | |
| cd04508 | 48 | TUDOR Tudor domains are found in many eukaryotic o | 96.95 | |
| smart00743 | 61 | Agenet Tudor-like domain present in plant sequence | 96.9 | |
| COG4133 | 209 | CcmA ABC-type transport system involved in cytochr | 96.8 | |
| COG4619 | 223 | ABC-type uncharacterized transport system, ATPase | 96.74 | |
| PF09038 | 122 | 53-BP1_Tudor: Tumour suppressor p53-binding protei | 96.67 | |
| PF13555 | 62 | AAA_29: P-loop containing region of AAA domain | 96.41 | |
| COG1121 | 254 | ZnuC ABC-type Mn/Zn transport systems, ATPase comp | 96.17 | |
| COG1120 | 258 | FepC ABC-type cobalamin/Fe3+-siderophores transpor | 96.1 | |
| cd00267 | 157 | ABC_ATPase ABC (ATP-binding cassette) transporter | 95.87 | |
| PF00005 | 137 | ABC_tran: ABC transporter This structure is on hol | 95.83 | |
| PRK15177 | 213 | Vi polysaccharide export ATP-binding protein VexC; | 95.74 | |
| cd03238 | 176 | ABC_UvrA The excision repair protein UvrA; Nucleot | 95.73 | |
| COG4559 | 259 | ABC-type hemin transport system, ATPase component | 95.64 | |
| PRK10247 | 225 | putative ABC transporter ATP-binding protein YbbL; | 95.58 | |
| cd03265 | 220 | ABC_DrrA DrrA is the ATP-binding protein component | 95.57 | |
| TIGR01166 | 190 | cbiO cobalt transport protein ATP-binding subunit. | 95.5 | |
| COG1119 | 257 | ModF ABC-type molybdenum transport system, ATPase | 95.5 | |
| COG3839 | 338 | MalK ABC-type sugar transport systems, ATPase comp | 95.44 | |
| cd03226 | 205 | ABC_cobalt_CbiO_domain2 Domain II of the ABC compo | 95.43 | |
| TIGR02211 | 221 | LolD_lipo_ex lipoprotein releasing system, ATP-bin | 95.42 | |
| TIGR02323 | 253 | CP_lyasePhnK phosphonate C-P lyase system protein | 95.41 | |
| PRK10584 | 228 | putative ABC transporter ATP-binding protein YbbA; | 95.4 | |
| cd03255 | 218 | ABC_MJ0796_Lo1CDE_FtsE This family is comprised of | 95.35 | |
| cd03269 | 210 | ABC_putative_ATPase This subfamily is involved in | 95.34 | |
| cd03259 | 213 | ABC_Carb_Solutes_like ABC Carbohydrate and Solute | 95.33 | |
| cd03268 | 208 | ABC_BcrA_bacitracin_resist The BcrA subfamily repr | 95.3 | |
| cd03261 | 235 | ABC_Org_Solvent_Resistant ABC (ATP-binding cassett | 95.29 | |
| cd03225 | 211 | ABC_cobalt_CbiO_domain1 Domain I of the ABC compon | 95.27 | |
| TIGR02770 | 230 | nickel_nikD nickel import ATP-binding protein NikD | 95.27 | |
| cd03230 | 173 | ABC_DR_subfamily_A This family of ATP-binding prot | 95.26 | |
| cd03232 | 192 | ABC_PDR_domain2 The pleiotropic drug resistance-li | 95.23 | |
| cd03221 | 144 | ABCF_EF-3 ABCF_EF-3 Elongation factor 3 (EF-3) is | 95.22 | |
| TIGR00960 | 216 | 3a0501s02 Type II (General) Secretory Pathway (IIS | 95.22 | |
| cd03267 | 236 | ABC_NatA_like Similar in sequence to NatA, this is | 95.22 | |
| cd03228 | 171 | ABCC_MRP_Like The MRP (Mutidrug Resistance Protein | 95.22 | |
| cd03279 | 213 | ABC_sbcCD SbcCD and other Mre11/Rad50 (MR) complex | 95.22 | |
| cd03257 | 228 | ABC_NikE_OppD_transporters The ABC transporter sub | 95.21 | |
| cd03223 | 166 | ABCD_peroxisomal_ALDP Peroxisomal ATP-binding cass | 95.19 | |
| TIGR03608 | 206 | L_ocin_972_ABC putative bacteriocin export ABC tra | 95.19 | |
| cd03218 | 232 | ABC_YhbG The ABC transporters belonging to the Yhb | 95.19 | |
| cd03250 | 204 | ABCC_MRP_domain1 Domain 1 of the ABC subfamily C. | 95.17 | |
| cd03263 | 220 | ABC_subfamily_A The ABCA subfamily mediates the tr | 95.16 | |
| cd03266 | 218 | ABC_NatA_sodium_exporter NatA is the ATPase compon | 95.16 | |
| cd03237 | 246 | ABC_RNaseL_inhibitor_domain2 The ATPase domain 2 o | 95.14 | |
| cd03293 | 220 | ABC_NrtD_SsuB_transporters NrtD and SsuB are the A | 95.14 | |
| cd03292 | 214 | ABC_FtsE_transporter FtsE is a hydrophilic nucleot | 95.14 | |
| TIGR01189 | 198 | ccmA heme ABC exporter, ATP-binding protein CcmA. | 95.14 | |
| TIGR03410 | 230 | urea_trans_UrtE urea ABC transporter, ATP-binding | 95.13 | |
| TIGR01978 | 243 | sufC FeS assembly ATPase SufC. SufC is part of the | 95.13 | |
| cd03216 | 163 | ABC_Carb_Monos_I This family represents the domain | 95.12 | |
| TIGR02673 | 214 | FtsE cell division ATP-binding protein FtsE. This | 95.12 | |
| PRK11629 | 233 | lolD lipoprotein transporter ATP-binding subunit; | 95.11 | |
| cd03254 | 229 | ABCC_Glucan_exporter_like Glucan exporter ATP-bind | 95.09 | |
| KOG0064 | 728 | consensus Peroxisomal long-chain acyl-CoA transpor | 95.08 | |
| COG0488 | 530 | Uup ATPase components of ABC transporters with dup | 95.08 | |
| cd03235 | 213 | ABC_Metallic_Cations ABC component of the metal-ty | 95.08 | |
| cd03264 | 211 | ABC_drug_resistance_like ABC-type multidrug transp | 95.06 | |
| PRK13539 | 207 | cytochrome c biogenesis protein CcmA; Provisional | 95.06 | |
| PRK10419 | 268 | nikE nickel transporter ATP-binding protein NikE; | 95.05 | |
| cd03215 | 182 | ABC_Carb_Monos_II This family represents domain II | 95.05 | |
| PRK10895 | 241 | lipopolysaccharide ABC transporter ATP-binding pro | 95.04 | |
| TIGR01184 | 230 | ntrCD nitrate transport ATP-binding subunits C and | 95.04 | |
| TIGR02315 | 243 | ABC_phnC phosphonate ABC transporter, ATP-binding | 95.03 | |
| cd03262 | 213 | ABC_HisP_GlnQ_permeases HisP and GlnQ are the ATP- | 95.02 | |
| cd03298 | 211 | ABC_ThiQ_thiamine_transporter ABC-type thiamine tr | 95.02 | |
| PRK14242 | 253 | phosphate transporter ATP-binding protein; Provisi | 95.02 | |
| cd03260 | 227 | ABC_PstB_phosphate_transporter Phosphate uptake is | 95.01 | |
| cd03301 | 213 | ABC_MalK_N The N-terminal ATPase domain of the mal | 95.0 | |
| cd03247 | 178 | ABCC_cytochrome_bd The CYD subfamily implicated in | 95.0 | |
| cd03224 | 222 | ABC_TM1139_LivF_branched LivF (TM1139) is part of | 95.0 | |
| PRK11248 | 255 | tauB taurine transporter ATP-binding subunit; Prov | 94.99 | |
| PF13476 | 202 | AAA_23: AAA domain; PDB: 3AV0_B 3AUY_B 3AUX_A 2O5V | 94.98 | |
| cd03246 | 173 | ABCC_Protease_Secretion This family represents the | 94.98 | |
| cd03234 | 226 | ABCG_White The White subfamily represents ABC tran | 94.98 | |
| cd03219 | 236 | ABC_Mj1267_LivG_branched The Mj1267/LivG ABC trans | 94.97 | |
| cd03258 | 233 | ABC_MetN_methionine_transporter MetN (also known a | 94.96 | |
| cd03296 | 239 | ABC_CysA_sulfate_importer Part of the ABC transpor | 94.95 | |
| PRK10744 | 260 | pstB phosphate transporter ATP-binding protein; Pr | 94.92 | |
| PRK10908 | 222 | cell division protein FtsE; Provisional | 94.92 | |
| PRK11831 | 269 | putative ABC transporter ATP-binding protein YrbF; | 94.91 | |
| CHL00131 | 252 | ycf16 sulfate ABC transporter protein; Validated | 94.91 | |
| COG4555 | 245 | NatA ABC-type Na+ transport system, ATPase compone | 94.9 | |
| cd03256 | 241 | ABC_PhnC_transporter ABC-type phosphate/phosphonat | 94.9 | |
| cd03222 | 177 | ABC_RNaseL_inhibitor The ABC ATPase RNase L inhibi | 94.9 | |
| cd03249 | 238 | ABC_MTABC3_MDL1_MDL2 MTABC3 (also known as ABCB6) | 94.89 | |
| PRK13543 | 214 | cytochrome c biogenesis protein CcmA; Provisional | 94.87 | |
| cd03251 | 234 | ABCC_MsbA MsbA is an essential ABC transporter, cl | 94.87 | |
| cd03229 | 178 | ABC_Class3 This class is comprised of all BPD (Bin | 94.86 | |
| cd03248 | 226 | ABCC_TAP TAP, the Transporter Associated with Anti | 94.85 | |
| TIGR01277 | 213 | thiQ thiamine ABC transporter, ATP-binding protein | 94.84 | |
| PRK10771 | 232 | thiQ thiamine transporter ATP-binding subunit; Pro | 94.83 | |
| TIGR03005 | 252 | ectoine_ehuA ectoine/hydroxyectoine ABC transporte | 94.83 | |
| PRK13540 | 200 | cytochrome c biogenesis protein CcmA; Provisional | 94.81 | |
| COG1118 | 345 | CysA ABC-type sulfate/molybdate transport systems, | 94.8 | |
| cd03214 | 180 | ABC_Iron-Siderophores_B12_Hemin ABC transporters, | 94.79 | |
| cd03253 | 236 | ABCC_ATM1_transporter ATM1 is an ABC transporter t | 94.79 | |
| PRK15112 | 267 | antimicrobial peptide ABC system ATP-binding prote | 94.79 | |
| COG1131 | 293 | CcmA ABC-type multidrug transport system, ATPase c | 94.76 | |
| PRK11614 | 237 | livF leucine/isoleucine/valine transporter ATP-bin | 94.76 | |
| cd03245 | 220 | ABCC_bacteriocin_exporters ABC-type bacteriocin ex | 94.74 | |
| PRK11247 | 257 | ssuB aliphatic sulfonates transport ATP-binding su | 94.74 | |
| cd03252 | 237 | ABCC_Hemolysin The ABC-transporter hemolysin B is | 94.73 | |
| PRK13638 | 271 | cbiO cobalt transporter ATP-binding subunit; Provi | 94.73 | |
| cd03213 | 194 | ABCG_EPDR ABCG transporters are involved in eye pi | 94.73 | |
| cd03272 | 243 | ABC_SMC3_euk Eukaryotic SMC3 proteins; SMC protein | 94.72 | |
| PRK13538 | 204 | cytochrome c biogenesis protein CcmA; Provisional | 94.72 | |
| TIGR03864 | 236 | PQQ_ABC_ATP ABC transporter, ATP-binding subunit, | 94.71 | |
| cd03220 | 224 | ABC_KpsT_Wzt ABC_KpsT_Wzt The KpsT/Wzt ABC transpo | 94.7 | |
| PRK13536 | 340 | nodulation factor exporter subunit NodI; Provision | 94.7 | |
| PRK14247 | 250 | phosphate ABC transporter ATP-binding protein; Pro | 94.69 | |
| cd03295 | 242 | ABC_OpuCA_Osmoprotection OpuCA is a the ATP bindin | 94.68 | |
| TIGR01288 | 303 | nodI ATP-binding ABC transporter family nodulation | 94.68 | |
| PRK09493 | 240 | glnQ glutamine ABC transporter ATP-binding protein | 94.67 | |
| cd03294 | 269 | ABC_Pro_Gly_Bertaine This family comprises the gly | 94.65 | |
| PRK13541 | 195 | cytochrome c biogenesis protein CcmA; Provisional | 94.65 | |
| cd03278 | 197 | ABC_SMC_barmotin Barmotin is a tight junction-asso | 94.64 | |
| cd03275 | 247 | ABC_SMC1_euk Eukaryotic SMC1 proteins; SMC protein | 94.63 | |
| TIGR03411 | 242 | urea_trans_UrtD urea ABC transporter, ATP-binding | 94.63 | |
| TIGR02324 | 224 | CP_lyasePhnL phosphonate C-P lyase system protein | 94.63 | |
| TIGR03522 | 301 | GldA_ABC_ATP gliding motility-associated ABC trans | 94.63 | |
| PRK14262 | 250 | phosphate ABC transporter ATP-binding protein; Pro | 94.61 | |
| PRK14253 | 249 | phosphate ABC transporter ATP-binding protein; Pro | 94.61 | |
| PRK11264 | 250 | putative amino-acid ABC transporter ATP-binding pr | 94.6 | |
| PRK11124 | 242 | artP arginine transporter ATP-binding subunit; Pro | 94.59 | |
| TIGR02769 | 265 | nickel_nikE nickel import ATP-binding protein NikE | 94.58 | |
| PRK14274 | 259 | phosphate ABC transporter ATP-binding protein; Pro | 94.58 | |
| PRK13644 | 274 | cbiO cobalt transporter ATP-binding subunit; Provi | 94.58 | |
| PRK09544 | 251 | znuC high-affinity zinc transporter ATPase; Review | 94.58 | |
| TIGR01188 | 302 | drrA daunorubicin resistance ABC transporter ATP-b | 94.56 | |
| PRK14250 | 241 | phosphate ABC transporter ATP-binding protein; Pro | 94.56 | |
| PRK11300 | 255 | livG leucine/isoleucine/valine transporter ATP-bin | 94.56 | |
| PRK15056 | 272 | manganese/iron transporter ATP-binding protein; Pr | 94.56 | |
| PRK13632 | 271 | cbiO cobalt transporter ATP-binding subunit; Provi | 94.55 | |
| PRK13649 | 280 | cbiO cobalt transporter ATP-binding subunit; Provi | 94.55 | |
| PRK13548 | 258 | hmuV hemin importer ATP-binding subunit; Provision | 94.54 | |
| PRK14273 | 254 | phosphate ABC transporter ATP-binding protein; Pro | 94.54 | |
| PRK13648 | 269 | cbiO cobalt transporter ATP-binding subunit; Provi | 94.53 | |
| cd03290 | 218 | ABCC_SUR1_N The SUR domain 1. The sulfonylurea rec | 94.53 | |
| PRK14259 | 269 | phosphate ABC transporter ATP-binding protein; Pro | 94.52 | |
| PRK13645 | 289 | cbiO cobalt transporter ATP-binding subunit; Provi | 94.5 | |
| cd03244 | 221 | ABCC_MRP_domain2 Domain 2 of the ABC subfamily C. | 94.5 | |
| PRK14255 | 252 | phosphate ABC transporter ATP-binding protein; Pro | 94.49 | |
| PRK14275 | 286 | phosphate ABC transporter ATP-binding protein; Pro | 94.48 | |
| PRK14241 | 258 | phosphate transporter ATP-binding protein; Provisi | 94.47 | |
| cd03217 | 200 | ABC_FeS_Assembly ABC-type transport system involve | 94.47 | |
| PRK14251 | 251 | phosphate ABC transporter ATP-binding protein; Pro | 94.45 | |
| PRK13537 | 306 | nodulation ABC transporter NodI; Provisional | 94.45 | |
| PRK09580 | 248 | sufC cysteine desulfurase ATPase component; Review | 94.45 | |
| TIGR00972 | 247 | 3a0107s01c2 phosphate ABC transporter, ATP-binding | 94.44 | |
| PRK14245 | 250 | phosphate ABC transporter ATP-binding protein; Pro | 94.43 | |
| PRK14237 | 267 | phosphate transporter ATP-binding protein; Provisi | 94.43 | |
| PRK14248 | 268 | phosphate ABC transporter ATP-binding protein; Pro | 94.42 | |
| PRK14267 | 253 | phosphate ABC transporter ATP-binding protein; Pro | 94.41 | |
| PRK14268 | 258 | phosphate ABC transporter ATP-binding protein; Pro | 94.41 | |
| PRK10619 | 257 | histidine/lysine/arginine/ornithine transporter su | 94.41 | |
| PRK14240 | 250 | phosphate transporter ATP-binding protein; Provisi | 94.41 | |
| PRK13547 | 272 | hmuV hemin importer ATP-binding subunit; Provision | 94.4 | |
| PRK14239 | 252 | phosphate transporter ATP-binding protein; Provisi | 94.4 | |
| PRK14235 | 267 | phosphate transporter ATP-binding protein; Provisi | 94.39 | |
| PRK13641 | 287 | cbiO cobalt transporter ATP-binding subunit; Provi | 94.36 | |
| PRK14264 | 305 | phosphate ABC transporter ATP-binding protein; Pro | 94.35 | |
| PRK11432 | 351 | fbpC ferric transporter ATP-binding subunit; Provi | 94.35 | |
| PRK11701 | 258 | phnK phosphonate C-P lyase system protein PhnK; Pr | 94.34 | |
| PRK13635 | 279 | cbiO cobalt transporter ATP-binding subunit; Provi | 94.33 | |
| PRK14256 | 252 | phosphate ABC transporter ATP-binding protein; Pro | 94.31 | |
| PRK14272 | 252 | phosphate ABC transporter ATP-binding protein; Pro | 94.3 | |
| PRK14261 | 253 | phosphate ABC transporter ATP-binding protein; Pro | 94.3 | |
| PRK14269 | 246 | phosphate ABC transporter ATP-binding protein; Pro | 94.3 | |
| cd03231 | 201 | ABC_CcmA_heme_exporter CcmA, the ATP-binding compo | 94.28 | |
| PRK14270 | 251 | phosphate ABC transporter ATP-binding protein; Pro | 94.27 | |
| PRK14244 | 251 | phosphate ABC transporter ATP-binding protein; Pro | 94.26 | |
| cd03233 | 202 | ABC_PDR_domain1 The pleiotropic drug resistance (P | 94.25 | |
| PRK09536 | 402 | btuD corrinoid ABC transporter ATPase; Reviewed | 94.25 | |
| PRK11000 | 369 | maltose/maltodextrin transporter ATP-binding prote | 94.24 | |
| TIGR03740 | 223 | galliderm_ABC gallidermin-class lantibiotic protec | 94.23 | |
| PRK13546 | 264 | teichoic acids export protein ATP-binding subunit; | 94.23 | |
| PRK09984 | 262 | phosphonate/organophosphate ester transporter subu | 94.22 | |
| TIGR00968 | 237 | 3a0106s01 sulfate ABC transporter, ATP-binding pro | 94.21 | |
| PRK14246 | 257 | phosphate ABC transporter ATP-binding protein; Pro | 94.2 | |
| PRK03695 | 248 | vitamin B12-transporter ATPase; Provisional | 94.18 | |
| cd03236 | 255 | ABC_RNaseL_inhibitor_domain1 The ATPase domain 1 o | 94.17 | |
| TIGR03873 | 256 | F420-0_ABC_ATP proposed F420-0 ABC transporter, AT | 94.17 | |
| cd03369 | 207 | ABCC_NFT1 Domain 2 of NFT1 (New full-length MRP-ty | 94.15 | |
| cd03300 | 232 | ABC_PotA_N PotA is an ABC-type transporter and the | 94.15 | |
| cd03274 | 212 | ABC_SMC4_euk Eukaryotic SMC4 proteins; SMC protein | 94.15 | |
| PRK10253 | 265 | iron-enterobactin transporter ATP-binding protein; | 94.14 | |
| TIGR02982 | 220 | heterocyst_DevA ABC exporter ATP-binding subunit, | 94.14 | |
| TIGR02322 | 179 | phosphon_PhnN phosphonate metabolism protein/1,5-b | 94.13 | |
| PRK14265 | 274 | phosphate ABC transporter ATP-binding protein; Pro | 94.11 | |
| PRK13640 | 282 | cbiO cobalt transporter ATP-binding subunit; Provi | 94.1 | |
| PRK13633 | 280 | cobalt transporter ATP-binding subunit; Provisiona | 94.06 | |
| PRK13637 | 287 | cbiO cobalt transporter ATP-binding subunit; Provi | 94.06 | |
| PRK14271 | 276 | phosphate ABC transporter ATP-binding protein; Pro | 94.05 | |
| TIGR03258 | 362 | PhnT 2-aminoethylphosphonate ABC transport system, | 94.04 | |
| PRK10078 | 186 | ribose 1,5-bisphosphokinase; Provisional | 94.01 | |
| PRK14266 | 250 | phosphate ABC transporter ATP-binding protein; Pro | 94.0 | |
| PRK13651 | 305 | cobalt transporter ATP-binding subunit; Provisiona | 94.0 | |
| cd03297 | 214 | ABC_ModC_molybdenum_transporter ModC is an ABC-typ | 93.99 | |
| PRK13647 | 274 | cbiO cobalt transporter ATP-binding subunit; Provi | 93.99 | |
| PRK14236 | 272 | phosphate transporter ATP-binding protein; Provisi | 93.97 | |
| PRK14252 | 265 | phosphate ABC transporter ATP-binding protein; Pro | 93.97 | |
| TIGR03265 | 353 | PhnT2 putative 2-aminoethylphosphonate ABC transpo | 93.95 | |
| PRK10418 | 254 | nikD nickel transporter ATP-binding protein NikD; | 93.94 | |
| PRK14238 | 271 | phosphate transporter ATP-binding protein; Provisi | 93.93 | |
| PRK13650 | 279 | cbiO cobalt transporter ATP-binding subunit; Provi | 93.92 | |
| PRK13646 | 286 | cbiO cobalt transporter ATP-binding subunit; Provi | 93.91 | |
| PRK14258 | 261 | phosphate ABC transporter ATP-binding protein; Pro | 93.9 | |
| PRK13634 | 290 | cbiO cobalt transporter ATP-binding subunit; Provi | 93.9 | |
| PRK13652 | 277 | cbiO cobalt transporter ATP-binding subunit; Provi | 93.89 | |
| PRK11153 | 343 | metN DL-methionine transporter ATP-binding subunit | 93.88 | |
| PRK11231 | 255 | fecE iron-dicitrate transporter ATP-binding subuni | 93.84 | |
| PRK10575 | 265 | iron-hydroxamate transporter ATP-binding subunit; | 93.83 | |
| PRK11650 | 356 | ugpC glycerol-3-phosphate transporter ATP-binding | 93.82 | |
| PRK14254 | 285 | phosphate ABC transporter ATP-binding protein; Pro | 93.81 | |
| cd03240 | 204 | ABC_Rad50 The catalytic domains of Rad50 are simil | 93.76 | |
| TIGR03771 | 223 | anch_rpt_ABC anchored repeat-type ABC transporter, | 93.73 | |
| PRK10070 | 400 | glycine betaine transporter ATP-binding subunit; P | 93.71 | |
| PRK13643 | 288 | cbiO cobalt transporter ATP-binding subunit; Provi | 93.7 | |
| PRK13639 | 275 | cbiO cobalt transporter ATP-binding subunit; Provi | 93.7 | |
| PRK14249 | 251 | phosphate ABC transporter ATP-binding protein; Pro | 93.69 | |
| TIGR02142 | 354 | modC_ABC molybdenum ABC transporter, ATP-binding p | 93.67 | |
| KOG0062 | 582 | consensus ATPase component of ABC transporters wit | 93.67 | |
| PRK09452 | 375 | potA putrescine/spermidine ABC transporter ATPase | 93.66 | |
| PRK14260 | 259 | phosphate ABC transporter ATP-binding protein; Pro | 93.64 | |
| PRK14243 | 264 | phosphate transporter ATP-binding protein; Provisi | 93.6 | |
| PRK10851 | 353 | sulfate/thiosulfate transporter subunit; Provision | 93.57 | |
| COG2884 | 223 | FtsE Predicted ATPase involved in cell division [C | 93.56 | |
| PRK10938 | 490 | putative molybdenum transport ATP-binding protein | 93.55 | |
| PRK11607 | 377 | potG putrescine transporter ATP-binding subunit; P | 93.54 | |
| PRK09700 | 510 | D-allose transporter ATP-binding protein; Provisio | 93.48 | |
| PRK13642 | 277 | cbiO cobalt transporter ATP-binding subunit; Provi | 93.46 | |
| PRK09825 | 176 | idnK D-gluconate kinase; Provisional | 93.45 | |
| cd03276 | 198 | ABC_SMC6_euk Eukaryotic SMC6 proteins; SMC protein | 93.41 | |
| COG1122 | 235 | CbiO ABC-type cobalt transport system, ATPase comp | 93.38 | |
| PRK14263 | 261 | phosphate ABC transporter ATP-binding protein; Pro | 93.38 | |
| PRK13549 | 506 | xylose transporter ATP-binding subunit; Provisiona | 93.37 | |
| TIGR03269 | 520 | met_CoM_red_A2 methyl coenzyme M reductase system, | 93.36 | |
| cd03299 | 235 | ABC_ModC_like Archeal protein closely related to M | 93.36 | |
| PRK13636 | 283 | cbiO cobalt transporter ATP-binding subunit; Provi | 93.31 | |
| PRK11144 | 352 | modC molybdate transporter ATP-binding protein; Pr | 93.31 | |
| cd03291 | 282 | ABCC_CFTR1 The CFTR subfamily domain 1. The cystic | 93.31 | |
| COG0410 | 237 | LivF ABC-type branched-chain amino acid transport | 93.28 | |
| COG3950 | 440 | Predicted ATP-binding protein involved in virulenc | 93.23 | |
| COG0396 | 251 | sufC Cysteine desulfurase activator ATPase [Posttr | 93.23 | |
| PRK10762 | 501 | D-ribose transporter ATP binding protein; Provisio | 93.22 | |
| cd01130 | 186 | VirB11-like_ATPase Type IV secretory pathway compo | 93.22 | |
| TIGR02314 | 343 | ABC_MetN D-methionine ABC transporter, ATP-binding | 93.21 | |
| PRK15064 | 530 | ABC transporter ATP-binding protein; Provisional | 93.12 | |
| PRK11819 | 556 | putative ABC transporter ATP-binding protein; Revi | 93.11 | |
| TIGR03415 | 382 | ABC_choXWV_ATP choline ABC transporter, ATP-bindin | 93.11 | |
| TIGR02633 | 500 | xylG D-xylose ABC transporter, ATP-binding protein | 93.09 | |
| TIGR03263 | 180 | guanyl_kin guanylate kinase. Members of this famil | 93.08 | |
| PRK10938 | 490 | putative molybdenum transport ATP-binding protein | 93.08 | |
| PRK15064 | 530 | ABC transporter ATP-binding protein; Provisional | 93.07 | |
| TIGR01186 | 363 | proV glycine betaine/L-proline transport ATP bindi | 93.06 | |
| PF02463 | 220 | SMC_N: RecF/RecN/SMC N terminal domain; InterPro: | 93.06 | |
| TIGR03719 | 552 | ABC_ABC_ChvD ATP-binding cassette protein, ChvD fa | 93.04 | |
| cd03288 | 257 | ABCC_SUR2 The SUR domain 2. The sulfonylurea recep | 93.03 | |
| PRK09700 | 510 | D-allose transporter ATP-binding protein; Provisio | 93.02 | |
| cd03242 | 270 | ABC_RecF RecF is a recombinational DNA repair ATPa | 93.0 | |
| COG4604 | 252 | CeuD ABC-type enterochelin transport system, ATPas | 93.0 | |
| PRK13549 | 506 | xylose transporter ATP-binding subunit; Provisiona | 93.0 | |
| TIGR00235 | 207 | udk uridine kinase. Model contains a number of lon | 92.98 | |
| PRK10636 | 638 | putative ABC transporter ATP-binding protein; Prov | 92.96 | |
| cd03273 | 251 | ABC_SMC2_euk Eukaryotic SMC2 proteins; SMC protein | 92.86 | |
| PRK15439 | 510 | autoinducer 2 ABC transporter ATP-binding protein | 92.85 | |
| PRK13631 | 320 | cbiO cobalt transporter ATP-binding subunit; Provi | 92.85 | |
| PRK10762 | 501 | D-ribose transporter ATP binding protein; Provisio | 92.82 | |
| PRK15134 | 529 | microcin C ABC transporter ATP-binding protein Yej | 92.82 | |
| PRK10636 | 638 | putative ABC transporter ATP-binding protein; Prov | 92.81 | |
| cd03277 | 213 | ABC_SMC5_euk Eukaryotic SMC5 proteins; SMC protein | 92.78 | |
| COG1134 | 249 | TagH ABC-type polysaccharide/polyol phosphate tran | 92.77 | |
| COG1126 | 240 | GlnQ ABC-type polar amino acid transport system, A | 92.73 | |
| cd03241 | 276 | ABC_RecN RecN ATPase involved in DNA repair; ABC ( | 92.73 | |
| PF06003 | 264 | SMN: Survival motor neuron protein (SMN); InterPro | 92.69 | |
| COG3910 | 233 | Predicted ATPase [General function prediction only | 92.68 | |
| TIGR03719 | 552 | ABC_ABC_ChvD ATP-binding cassette protein, ChvD fa | 92.6 | |
| TIGR02633 | 500 | xylG D-xylose ABC transporter, ATP-binding protein | 92.55 | |
| TIGR03269 | 520 | met_CoM_red_A2 methyl coenzyme M reductase system, | 92.55 | |
| PRK11147 | 635 | ABC transporter ATPase component; Reviewed | 92.52 | |
| cd03239 | 178 | ABC_SMC_head The structural maintenance of chromos | 92.51 | |
| PRK15439 | 510 | autoinducer 2 ABC transporter ATP-binding protein | 92.5 | |
| cd00820 | 107 | PEPCK_HprK Phosphoenolpyruvate carboxykinase (PEPC | 92.47 | |
| cd03289 | 275 | ABCC_CFTR2 The CFTR subfamily domain 2. The cystic | 92.47 | |
| PRK15134 | 529 | microcin C ABC transporter ATP-binding protein Yej | 92.46 | |
| PLN00104 | 450 | MYST -like histone acetyltransferase; Provisional | 92.41 | |
| PRK09270 | 229 | nucleoside triphosphate hydrolase domain-containin | 92.4 | |
| PRK13545 | 549 | tagH teichoic acids export protein ATP-binding sub | 92.37 | |
| PRK11819 | 556 | putative ABC transporter ATP-binding protein; Revi | 92.36 | |
| PRK11288 | 501 | araG L-arabinose transporter ATP-binding protein; | 92.32 | |
| PRK15093 | 330 | antimicrobial peptide ABC transporter ATP-binding | 92.29 | |
| smart00382 | 148 | AAA ATPases associated with a variety of cellular | 92.24 | |
| PRK10982 | 491 | galactose/methyl galaxtoside transporter ATP-bindi | 92.22 | |
| PF13304 | 303 | AAA_21: AAA domain; PDB: 3QKS_B 1US8_B 1F2U_B 1F2T | 92.18 | |
| PRK11288 | 501 | araG L-arabinose transporter ATP-binding protein; | 92.08 | |
| PRK11147 | 635 | ABC transporter ATPase component; Reviewed | 92.04 | |
| cd02023 | 198 | UMPK Uridine monophosphate kinase (UMPK, EC 2.7.1. | 91.91 | |
| PRK15079 | 331 | oligopeptide ABC transporter ATP-binding protein O | 91.91 | |
| COG1136 | 226 | SalX ABC-type antimicrobial peptide transport syst | 91.83 | |
| cd02025 | 220 | PanK Pantothenate kinase (PanK) catalyzes the phos | 91.78 | |
| COG3842 | 352 | PotA ABC-type spermidine/putrescine transport syst | 91.76 | |
| PRK10261 | 623 | glutathione transporter ATP-binding protein; Provi | 91.74 | |
| TIGR03185 | 650 | DNA_S_dndD DNA sulfur modification protein DndD. T | 91.73 | |
| PLN03073 | 718 | ABC transporter F family; Provisional | 91.67 | |
| PRK10982 | 491 | galactose/methyl galaxtoside transporter ATP-bindi | 91.65 | |
| TIGR01360 | 188 | aden_kin_iso1 adenylate kinase, isozyme 1 subfamil | 91.6 | |
| COG4178 | 604 | ABC-type uncharacterized transport system, permeas | 91.55 | |
| PRK14257 | 329 | phosphate ABC transporter ATP-binding protein; Pro | 91.55 | |
| PF13671 | 143 | AAA_33: AAA domain; PDB: 1LTQ_A 2IA5_K 1RC8_A 1LY1 | 91.44 | |
| PF13207 | 121 | AAA_17: AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6 | 91.44 | |
| PRK11022 | 326 | dppD dipeptide transporter ATP-binding subunit; Pr | 91.41 | |
| COG0411 | 250 | LivG ABC-type branched-chain amino acid transport | 91.35 | |
| PLN03073 | 718 | ABC transporter F family; Provisional | 91.18 | |
| PRK10261 | 623 | glutathione transporter ATP-binding protein; Provi | 91.15 | |
| PF13173 | 128 | AAA_14: AAA domain | 91.13 | |
| PRK11308 | 327 | dppF dipeptide transporter ATP-binding subunit; Pr | 91.13 | |
| PRK13409 | 590 | putative ATPase RIL; Provisional | 91.09 | |
| PRK00064 | 361 | recF recombination protein F; Reviewed | 91.08 | |
| COG2274 | 709 | SunT ABC-type bacteriocin/lantibiotic exporters, c | 91.06 | |
| PRK10246 | 1047 | exonuclease subunit SbcC; Provisional | 90.93 | |
| TIGR02524 | 358 | dot_icm_DotB Dot/Icm secretion system ATPase DotB. | 90.91 | |
| TIGR00554 | 290 | panK_bact pantothenate kinase, bacterial type. Sho | 90.91 | |
| PRK00300 | 205 | gmk guanylate kinase; Provisional | 90.88 | |
| cd01131 | 198 | PilT Pilus retraction ATPase PilT. PilT is a nucle | 90.84 | |
| COG3638 | 258 | ABC-type phosphate/phosphonate transport system, A | 90.8 | |
| TIGR00611 | 365 | recf recF protein. All proteins in this family for | 90.8 | |
| COG4161 | 242 | ArtP ABC-type arginine transport system, ATPase co | 90.79 | |
| PRK08118 | 167 | topology modulation protein; Reviewed | 90.76 | |
| COG4988 | 559 | CydD ABC-type transport system involved in cytochr | 90.76 | |
| PRK05480 | 209 | uridine/cytidine kinase; Provisional | 90.64 | |
| PRK07261 | 171 | topology modulation protein; Provisional | 90.62 | |
| PRK14732 | 196 | coaE dephospho-CoA kinase; Provisional | 90.62 | |
| PRK14738 | 206 | gmk guanylate kinase; Provisional | 90.61 | |
| TIGR00618 | 1042 | sbcc exonuclease SbcC. This family is based on the | 90.46 | |
| COG1125 | 309 | OpuBA ABC-type proline/glycine betaine transport s | 90.43 | |
| PRK14079 | 349 | recF recombination protein F; Provisional | 90.37 | |
| PRK13409 | 590 | putative ATPase RIL; Provisional | 90.24 | |
| cd02026 | 273 | PRK Phosphoribulokinase (PRK) is an enzyme involve | 90.2 | |
| cd03270 | 226 | ABC_UvrA_I The excision repair protein UvrA domain | 90.2 | |
| cd02019 | 69 | NK Nucleoside/nucleotide kinase (NK) is a protein | 90.09 | |
| TIGR03015 | 269 | pepcterm_ATPase putative secretion ATPase, PEP-CTE | 90.09 | |
| COG1116 | 248 | TauB ABC-type nitrate/sulfonate/bicarbonate transp | 90.01 | |
| TIGR01842 | 544 | type_I_sec_PrtD type I secretion system ABC transp | 89.97 | |
| PRK05416 | 288 | glmZ(sRNA)-inactivating NTPase; Provisional | 89.83 | |
| PHA02562 | 562 | 46 endonuclease subunit; Provisional | 89.79 | |
| TIGR00954 | 659 | 3a01203 Peroxysomal Fatty Acyl CoA Transporter (FA | 89.77 | |
| TIGR01187 | 325 | potA spermidine/putrescine ABC transporter ATP-bin | 89.73 | |
| PRK09473 | 330 | oppD oligopeptide transporter ATP-binding componen | 89.6 | |
| cd02021 | 150 | GntK Gluconate kinase (GntK) catalyzes the phospho | 89.59 | |
| PLN03211 | 659 | ABC transporter G-25; Provisional | 89.59 | |
| TIGR01313 | 163 | therm_gnt_kin carbohydrate kinase, thermoresistant | 89.53 | |
| TIGR02168 | 1179 | SMC_prok_B chromosome segregation protein SMC, com | 89.52 | |
| cd03271 | 261 | ABC_UvrA_II The excision repair protein UvrA domai | 89.49 | |
| PRK13695 | 174 | putative NTPase; Provisional | 89.46 | |
| PRK05541 | 176 | adenylylsulfate kinase; Provisional | 89.45 | |
| PRK06762 | 166 | hypothetical protein; Provisional | 89.44 | |
| TIGR00101 | 199 | ureG urease accessory protein UreG. This model rep | 89.37 | |
| COG4152 | 300 | ABC-type uncharacterized transport system, ATPase | 89.36 | |
| PRK02224 | 880 | chromosome segregation protein; Provisional | 89.27 | |
| PRK06995 | 484 | flhF flagellar biosynthesis regulator FlhF; Valida | 89.16 | |
| TIGR00634 | 563 | recN DNA repair protein RecN. All proteins in this | 89.1 | |
| COG4586 | 325 | ABC-type uncharacterized transport system, ATPase | 89.09 | |
| KOG0060 | 659 | consensus Long-chain acyl-CoA transporter, ABC sup | 89.08 | |
| PRK14721 | 420 | flhF flagellar biosynthesis regulator FlhF; Provis | 89.07 | |
| TIGR01192 | 585 | chvA glucan exporter ATP-binding protein. This mod | 89.06 | |
| COG4674 | 249 | Uncharacterized ABC-type transport system, ATPase | 89.06 | |
| COG4778 | 235 | PhnL ABC-type phosphonate transport system, ATPase | 89.05 | |
| COG1117 | 253 | PstB ABC-type phosphate transport system, ATPase c | 89.04 | |
| cd01120 | 165 | RecA-like_NTPases RecA-like NTPases. This family i | 89.01 | |
| cd03112 | 158 | CobW_like The function of this protein family is u | 88.93 | |
| PRK10869 | 553 | recombination and repair protein; Provisional | 88.53 | |
| cd04155 | 173 | Arl3 Arl3 subfamily. Arl3 (Arf-like 3) is an Arf f | 88.51 | |
| cd01672 | 200 | TMPK Thymidine monophosphate kinase (TMPK), also k | 88.3 | |
| TIGR02788 | 308 | VirB11 P-type DNA transfer ATPase VirB11. The VirB | 88.19 | |
| KOG0127 | 678 | consensus Nucleolar protein fibrillarin NOP77 (RRM | 88.16 | |
| cd00071 | 137 | GMPK Guanosine monophosphate kinase (GMPK, EC 2.7. | 88.13 | |
| KOG0927 | 614 | consensus Predicted transporter (ABC superfamily) | 88.11 | |
| TIGR03238 | 504 | dnd_assoc_3 dnd system-associated protein 3. cereu | 88.08 | |
| COG0419 | 908 | SbcC ATPase involved in DNA repair [DNA replicatio | 88.04 | |
| PRK06761 | 282 | hypothetical protein; Provisional | 88.01 | |
| PF03215 | 519 | Rad17: Rad17 cell cycle checkpoint protein | 87.84 | |
| TIGR03797 | 686 | NHPM_micro_ABC2 NHPM bacteriocin system ABC transp | 87.78 | |
| PRK10789 | 569 | putative multidrug transporter membrane\ATP-bindin | 87.72 | |
| TIGR02204 | 576 | MsbA_rel ABC transporter, permease/ATP-binding pro | 87.69 | |
| PF06414 | 199 | Zeta_toxin: Zeta toxin; InterPro: IPR010488 This e | 87.61 | |
| cd00009 | 151 | AAA The AAA+ (ATPases Associated with a wide varie | 87.6 | |
| PF00004 | 132 | AAA: ATPase family associated with various cellula | 87.59 | |
| PRK10416 | 318 | signal recognition particle-docking protein FtsY; | 87.54 | |
| PF05729 | 166 | NACHT: NACHT domain | 87.49 | |
| COG1101 | 263 | PhnK ABC-type uncharacterized transport system, AT | 87.47 | |
| PRK10535 | 648 | macrolide transporter ATP-binding /permease protei | 87.43 | |
| COG1129 | 500 | MglA ABC-type sugar transport system, ATPase compo | 87.31 | |
| KOG2355 | 291 | consensus Predicted ABC-type transport, ATPase com | 87.22 | |
| COG3845 | 501 | ABC-type uncharacterized transport systems, ATPase | 87.21 | |
| COG1127 | 263 | Ttg2A ABC-type transport system involved in resist | 87.14 | |
| COG0488 | 530 | Uup ATPase components of ABC transporters with dup | 87.02 | |
| TIGR02203 | 571 | MsbA_lipidA lipid A export permease/ATP-binding pr | 86.81 | |
| TIGR00606 | 1311 | rad50 rad50. This family is based on the phylogeno | 86.79 | |
| PRK11176 | 582 | lipid transporter ATP-binding/permease protein; Pr | 86.76 | |
| PRK03846 | 198 | adenylylsulfate kinase; Provisional | 86.7 | |
| cd00227 | 175 | CPT Chloramphenicol (Cm) phosphotransferase (CPT). | 86.6 | |
| PLN03140 | 1470 | ABC transporter G family member; Provisional | 86.59 | |
| TIGR00630 | 924 | uvra excinuclease ABC, A subunit. This family is b | 86.56 | |
| PRK05057 | 172 | aroK shikimate kinase I; Reviewed | 86.56 | |
| TIGR00956 | 1394 | 3a01205 Pleiotropic Drug Resistance (PDR) Family p | 86.5 | |
| TIGR02857 | 529 | CydD thiol reductant ABC exporter, CydD subunit. U | 86.5 | |
| COG4138 | 248 | BtuD ABC-type cobalamin transport system, ATPase c | 86.46 | |
| PTZ00202 | 550 | tuzin; Provisional | 86.44 | |
| COG4615 | 546 | PvdE ABC-type siderophore export system, fused ATP | 86.44 | |
| COG4637 | 373 | Predicted ATPase [General function prediction only | 86.38 | |
| TIGR01420 | 343 | pilT_fam pilus retraction protein PilT. This model | 86.36 | |
| PRK08233 | 182 | hypothetical protein; Provisional | 86.28 | |
| TIGR00955 | 617 | 3a01204 The Eye Pigment Precursor Transporter (EPP | 86.27 | |
| PF11717 | 55 | Tudor-knot: RNA binding activity-knot of a chromod | 86.17 | |
| PRK10790 | 592 | putative multidrug transporter membrane\ATP-bindin | 86.14 | |
| TIGR00150 | 133 | HI0065_YjeE ATPase, YjeE family. Members of this f | 86.12 | |
| cd04129 | 187 | Rho2 Rho2 subfamily. Rho2 is a fungal GTPase that | 86.11 | |
| TIGR00017 | 217 | cmk cytidylate kinase. This family consists of cyt | 86.08 | |
| PRK00889 | 175 | adenylylsulfate kinase; Provisional | 86.07 | |
| PRK13949 | 169 | shikimate kinase; Provisional | 86.04 | |
| PRK04296 | 190 | thymidine kinase; Provisional | 85.82 | |
| COG1106 | 371 | Predicted ATPases [General function prediction onl | 85.81 | |
| KOG0056 | 790 | consensus Heavy metal exporter HMT1, ABC superfami | 85.7 | |
| PRK13657 | 588 | cyclic beta-1,2-glucan ABC transporter; Provisiona | 85.65 | |
| PRK14974 | 336 | cell division protein FtsY; Provisional | 85.62 | |
| PRK01156 | 895 | chromosome segregation protein; Provisional | 85.61 | |
| PF13401 | 131 | AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S | 85.3 | |
| cd01876 | 170 | YihA_EngB The YihA (EngB) subfamily. This subfamil | 85.19 | |
| TIGR01257 | 2272 | rim_protein retinal-specific rim ABC transporter. | 85.18 | |
| PRK11174 | 588 | cysteine/glutathione ABC transporter membrane/ATP- | 85.14 | |
| TIGR01271 | 1490 | CFTR_protein cystic fibrosis transmembrane conduct | 84.96 | |
| PRK10522 | 547 | multidrug transporter membrane component/ATP-bindi | 84.94 | |
| KOG3064 | 303 | consensus RNA-binding nuclear protein (MAK16) cont | 84.93 | |
| TIGR01194 | 555 | cyc_pep_trnsptr cyclic peptide transporter. This m | 84.92 | |
| PRK14722 | 374 | flhF flagellar biosynthesis regulator FlhF; Provis | 84.92 | |
| PRK01184 | 184 | hypothetical protein; Provisional | 84.88 | |
| cd02020 | 147 | CMPK Cytidine monophosphate kinase (CMPK) catalyze | 84.88 | |
| PLN02796 | 347 | D-glycerate 3-kinase | 84.81 | |
| TIGR02868 | 529 | CydC thiol reductant ABC exporter, CydC subunit. T | 84.65 | |
| COG4167 | 267 | SapF ABC-type antimicrobial peptide transport syst | 84.6 | |
| TIGR01193 | 708 | bacteriocin_ABC ABC-type bacteriocin transporter. | 84.54 | |
| KOG0979 | 1072 | consensus Structural maintenance of chromosome pro | 84.51 | |
| PRK11160 | 574 | cysteine/glutathione ABC transporter membrane/ATP- | 84.5 | |
| PRK03918 | 880 | chromosome segregation protein; Provisional | 84.38 | |
| KOG0927 | 614 | consensus Predicted transporter (ABC superfamily) | 84.32 | |
| smart00763 | 361 | AAA_PrkA PrkA AAA domain. This is a family of PrkA | 84.3 | |
| PLN02165 | 334 | adenylate isopentenyltransferase | 84.26 | |
| TIGR00750 | 300 | lao LAO/AO transport system ATPase. Mutations have | 84.24 | |
| TIGR03375 | 694 | type_I_sec_LssB type I secretion system ATPase, Ls | 84.19 | |
| TIGR02169 | 1164 | SMC_prok_A chromosome segregation protein SMC, pri | 84.1 | |
| cd01129 | 264 | PulE-GspE PulE/GspE The type II secretory pathway | 83.98 | |
| TIGR01257 | 2272 | rim_protein retinal-specific rim ABC transporter. | 83.9 | |
| PRK14737 | 186 | gmk guanylate kinase; Provisional | 83.62 | |
| COG4185 | 187 | Uncharacterized protein conserved in bacteria [Fun | 83.59 | |
| cd04159 | 159 | Arl10_like Arl10-like subfamily. Arl9/Arl10 was id | 83.58 | |
| KOG1970 | 634 | consensus Checkpoint RAD17-RFC complex, RAD17/RAD2 | 83.57 | |
| TIGR02858 | 270 | spore_III_AA stage III sporulation protein AA. Mem | 83.54 | |
| PRK08533 | 230 | flagellar accessory protein FlaH; Reviewed | 83.52 | |
| TIGR03796 | 710 | NHPM_micro_ABC1 NHPM bacteriocin system ABC transp | 83.46 | |
| PRK04863 | 1486 | mukB cell division protein MukB; Provisional | 83.36 | |
| COG0194 | 191 | Gmk Guanylate kinase [Nucleotide transport and met | 83.25 | |
| cd02027 | 149 | APSK Adenosine 5'-phosphosulfate kinase (APSK) cat | 83.24 | |
| PTZ00243 | 1560 | ABC transporter; Provisional | 83.18 | |
| PF04931 | 784 | DNA_pol_phi: DNA polymerase phi; InterPro: IPR0070 | 83.09 | |
| PRK02496 | 184 | adk adenylate kinase; Provisional | 82.99 | |
| TIGR00958 | 711 | 3a01208 Conjugate Transporter-2 (CT2) Family prote | 82.95 | |
| PHA02530 | 300 | pseT polynucleotide kinase; Provisional | 82.93 | |
| PRK06547 | 172 | hypothetical protein; Provisional | 82.9 |
| >KOG0217 consensus Mismatch repair ATPase MSH6 (MutS family) [Replication, recombination and repair] | Back alignment and domain information |
|---|
Probab=100.00 E-value=6.6e-169 Score=1486.10 Aligned_cols=949 Identities=41% Similarity=0.655 Sum_probs=775.1
Q ss_pred ccccCCccccceeEEeccCCCeEEeEEEEeeeCCCCeEEEEccCCcchhcccCcceEEEEecchhh--hhhccccccccc
Q 001212 98 AKSYGEDVLRKRIRVYWPLDKAWYEGCVKSFDKECNKHLVQYDDGEDELLDLGKEKIEWVQESVSL--LKRLRRDSFKKV 175 (1122)
Q Consensus 98 ~~~~~~~~vg~rv~v~wp~d~~~y~g~v~~~~~~~~~h~v~Yddg~~e~~~l~~e~~~~~~~~~~~--~~~~~~~~~~~~ 175 (1122)
.-..|++.+| .||.+.|..++....+ |-++...-+..-+|+-+|....... ..+.+. ..+
T Consensus 8 ~~t~~~e~~~-----------~~~~~~v~~~~~~e~k----~l~~~t~k~~~~~e~~~~~~~~~r~~~~~rv~~---~e~ 69 (1125)
T KOG0217|consen 8 HMTFFEETPG-----------KLYRNSVGLKPKEEPK----SLRNGTLKIKNLKEKEEFKSGQPREVVSSRVKE---YEA 69 (1125)
T ss_pred ceeecccCcc-----------hhcccccccCCccchh----hhcCCCcCcCccchhhHhhccCccccccccccc---hhh
Confidence 3445777777 7999999988876665 6555544444444666665311111 111111 111
Q ss_pred ccCChhhhhccc-CccccCCCCCcchhhh-cccCC-CCCCcccc-------cchhhhhhh--------ccccCCccccCC
Q 001212 176 VVEDDEEMENVE-DEISDDRSDSSDDDWN-KNVGK-EDVSEDEE-------VDLVDEQEN--------KVLRGRKRKSSG 237 (1122)
Q Consensus 176 ~~~~~~~~~~~~-~~~~~~~~~~~d~~~~-~~~~~-~~~~~~e~-------~~~~~e~e~--------~~~~~~~~~~~~ 237 (1122)
+..+.+.-.+.. ...-...+++||+||+ |++.+ +++++++| ++..+|++. +.+++|.+++..
T Consensus 70 ~~~d~~~~~~~~~~~~k~~~~sDsd~d~g~k~~~~~~~~d~~~~D~~~~d~~~~~~ee~~~~~~~~~~~~~~~r~~~a~~ 149 (1125)
T KOG0217|consen 70 VGDDADIVVESSSEKPKSGLDSDSDEDFGGKEVEEKEDSDEELDDETASDYEVVISEESEGGEPVCRVSDTDSRSRKAES 149 (1125)
T ss_pred cCCCccceeeecccCCccccCCCcccccCcccccccccccccccccccCCcceeccccccCCCcccccCCCcccchhccc
Confidence 221111111111 2222344667778886 33322 22222111 111111111 234566666644
Q ss_pred ccCCC-----CCCCCCCCCccccccCCccc-cCC-CCCCCCC-CCCCcccccccccccccccccccCC-CCCccCCCCCC
Q 001212 238 VKKSK-----SDGNAVNADFKSPIIKPVKI-FGS-DKLSNGF-DNPVMGDVSERFSAREADKFHFLGP-DRRDAKRRRPG 308 (1122)
Q Consensus 238 ~~k~~-----~~~~~~~~~~~~~~~~~~~~-~~~-~~~~~~~-~~~~~~~~~~~~~~~~~~~~~~l~~-~~rD~~~r~p~ 308 (1122)
..|++ +...+...+.......|.+- .+. ++.+.+. ....-++..+|+.++.++++.||.+ ++||+++|||+
T Consensus 150 v~k~~~kk~~~~~~~~~~~~~~~~~~p~~~~~~~a~r~~~~~~~i~~~~~~~~~~~a~~~E~~r~l~~e~~RD~~rrr~~ 229 (1125)
T KOG0217|consen 150 VSKGKSKKSPSDSGAVSMGHDLDFNDPMPLREGQASRSASGYCGISNGETELSRMEAFDHEKERYLKLEDVRDALRRRRG 229 (1125)
T ss_pred ccccccCCCCCCccccccccccccCCCCccccCccccccccccccccccccccchhhhcccchhhccHHHhhhhhcCCCC
Confidence 22222 22334445555555666662 122 2222222 2223344467778888888777775 57999999999
Q ss_pred CCCCCCCCCCCCchhhcCCCHHHHHHHHHHhhCCCeEEEEeeCceEEEehhhHHHhhhhcceeeecCCCCcCCcCcccHh
Q 001212 309 DVYYDPRTLYLPPDFLRNLSEGQKQWWEFKSKHMDKVIFFKMGKFYELFEMDAHVGAKELDLQYMKGEQPHCGFPERNFS 388 (1122)
Q Consensus 309 dp~ydp~Tl~iP~~~~~~~TP~~~Qyw~iK~~~~D~vlffk~GkFYElf~~DA~i~ak~L~L~~~~g~~p~~GfPe~sl~ 388 (1122)
||+|||+||||||++|+++||+++|||+||++|||+|||||+|||||||++||.+++++|+|+||++++|||||||++|+
T Consensus 230 dp~yDp~TLyiP~s~~~kftpg~kqwWeiKs~~fD~ivfFk~GKFyELye~DA~vg~~~~dl~f~~vN~~~~GfPE~sf~ 309 (1125)
T KOG0217|consen 230 DPEYDPRTLYIPPSFWKKFTPGEKQWWEIKSDNFDTIVFFKKGKFYELYEMDALVGARLFDLKFMDVNMPHSGFPEGSFD 309 (1125)
T ss_pred CCCCCccceecCHHHHhcCCchhhhhhhhhhhcccEEEEEecchHHHHHhhhhhhhhhhcceeecccccccCCCCccchh
Confidence 99999999999999999999999999999999999999999999999999999999999999999999999999999999
Q ss_pred HHHHHHHHcCCeEEEEecCCChHHHHHHhhhcCCCCCeeeeeEEEEeeCCcccccccCCCCCCCcEEEEEEecCCCCCCC
Q 001212 389 MNVEKLARKGYRVLVVEQTETPEQLELRRKEKGSKDKVVKREICAVVTKGTLTEGELLSANPDASYLMALTESNQSPASQ 468 (1122)
Q Consensus 389 ~y~~kLv~~GyKVavvEQ~Et~~~~~~r~k~~~~k~kvv~Rev~~ViTpGTl~d~~~l~~~~~~~yl~aI~e~~~~~~~~ 468 (1122)
.|+.+|+++|||||+|||+|||.++++|++..|+|+|||+||||+|+|+||++|..++. ++.+.|||||.|+..+. .
T Consensus 310 ~~a~q~iq~GYkvarVEQtEt~l~~e~r~~~~~~kdkvvrRev~~ilt~GT~td~~l~~-~~~akylmai~e~~~~~--~ 386 (1125)
T KOG0217|consen 310 YWADQFIQKGYKVARVEQTETPLGKEIRERKTGKKDKVVRREVCRILTNGTLTDIALLT-SDLAKYLMAIKESEESY--S 386 (1125)
T ss_pred hHHHHHHhccceeeeeccccChHHhhhhhcccccchhhHHHHHHHHhcCCcchhHHHhc-cHHHHHHHHHhhcCCCC--C
Confidence 99999999999999999999999999999999999999999999999999999977664 45678999999976542 1
Q ss_pred CCCcEEEEEEEEcCCCeEEEEEEcCcccHHHHHHHHHhcCCcEEEecCCCCChHHHHHHHhhcCCCccccccCCccccCh
Q 001212 469 STDRCFGICVVDVATSRIILGQVMDDLDCSVLCCLLSELRPVEIIKPANMLSPETERAILRHTRNPLVNDLVPLSEFWDA 548 (1122)
Q Consensus 469 ~~~~~~Gva~vD~stg~~~l~qf~Dd~~~s~L~t~L~~~~P~EIi~~~~~~s~~~~~~l~~~~~~~~~~~~~~~~~f~~~ 548 (1122)
.+...+|+|++|++||+|+++||+||..++.|.|+|++++|+|+|.+.++++..|...++....+..+..++|..+||+.
T Consensus 387 ~~~~s~gvc~iDtstge~~~~eF~DDr~~s~L~tlLs~~rp~E~I~e~~~ls~~t~~~ik~~~~~~~~~n~~~~~eFwds 466 (1125)
T KOG0217|consen 387 TGEVSFGVCFIDTSTGEINIGEFCDDRHCSKLDTLLSQVRPVELIEERKNLSDPTKVIIKLKLSSNLVENLVPKSEFWDS 466 (1125)
T ss_pred cCceeeeEEEEEcccceEEEEEeecchhhhHHHHHHHcccHHHHHHHhhccCCceeeeeeeeecchhhhcccChhhhcch
Confidence 45688999999999999999999999999999999999999999999999998887777666666667777888899999
Q ss_pred hhHHHHH--HHHHhhcccccccccccccccccccCCCCcccchhhhhhhccCCCchHHHHHHHHHHHHHHHhccchhhhc
Q 001212 549 ETTVLEI--KNIYNRITAESLNKADSNVANSQAEGDGLTCLPGILSELISTGDSGSQVLSALGGTLFYLKKSFLDETLLR 626 (1122)
Q Consensus 549 ~~~~~~l--~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~p~~l~~l~~~~~~~~~al~Algall~YL~~~~l~~~ll~ 626 (1122)
+++..++ .+||... |...+|.++.. ..++++++++|+|++++||+.+++++.+++
T Consensus 467 ek~~~eii~~dy~~~~--------------------g~e~~~sil~~---p~~~~~la~safg~~~~Ylk~~~id~~lls 523 (1125)
T KOG0217|consen 467 EKTGREIISEDYFESL--------------------GLEDSPSILKS---PNTDKELALSAFGGLFYYLKKLLIDEELLS 523 (1125)
T ss_pred hhHHHHHhhhhhhhcc--------------------cccCchhhccC---CCccchhhHHHHHHHHHHHHHHhhHHHHhh
Confidence 9988754 2444310 12344444332 234578999999999999999999999999
Q ss_pred ccceeecCCCCCccCCCCCceecCHHHHHhcCCcccCCCCCCcccHHhHhhhcCChHHHHHHHHhhhccCCCHHHHHHHH
Q 001212 627 FAKFELLPCSGFGDMAKKPYMVLDAPALENLEVFENSRSGDSSGTLYAQLNHCVTAFGKRLLRTWLARPLYNSGLIRERQ 706 (1122)
Q Consensus 627 ~~~f~~~~~~~~~~~~~~~~M~LD~~Tl~nLEI~~n~~~g~~~gSL~~~Ln~c~T~~GkRlLr~Wl~~PL~d~~~I~~R~ 706 (1122)
+++|+.|+... ...|+||++||+|||||.|+++|+.+||||.++|+|.||||||||++||++||+|.+.|++||
T Consensus 524 m~n~~ey~~~~------~s~mvlD~~tL~NleIf~Ns~~G~~~gtL~~~~~~csTpfGKRllk~Wl~~Pl~~~~~I~~R~ 597 (1125)
T KOG0217|consen 524 MKNFEEYDSLD------QSEMVLDGATLENLEIFSNSRNGGDEGTLFYAVNRCSTPFGKRLLKTWLMAPLCDKEDIKQRQ 597 (1125)
T ss_pred hhhhhhcchhc------ccceeecchhhhhhhhhccCCCCCCchhHHHHHhhccChHHHHHHHHHhhCcCCCHHHHHHHH
Confidence 99999886433 234999999999999999999999999999999999999999999999999999999999999
Q ss_pred HHHHHHHcCChhhHHHHHHhcCCCCcHHHHHHHHhccccccCCCCccchhhHHHHHHHHHHHHHHHhhhHHHHHHHHHHH
Q 001212 707 DAVAGLRGVNQPFALEFRKALSRLPDMERLLARLFASSEANGRNSNKVVLYEDAAKKQLQEFISALHGCELMDQACSSLG 786 (1122)
Q Consensus 707 daVe~L~~~~~~~~~~lr~~Lk~lpDleRll~ri~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~L~~~~~~~~~~~~l~ 786 (1122)
|||+.|.. ++..+..+...|+++||+||+|.|+|..+.. +++++.+|+.+|.+|+.+..++..+.
T Consensus 598 dav~~l~~-~~~~~~~~~e~l~klPDlERlL~Rih~~~~~--------------~~k~i~~f~rvLegfk~~~~~~~~~~ 662 (1125)
T KOG0217|consen 598 DAVDSLGK-APMDRTKVGETLKKLPDLERLLVRIHNGGEK--------------NKKKIADFIRVLEGFKEINKLLGSLI 662 (1125)
T ss_pred HHHHHHhc-CchhHHHHHHHHhhCCcHHHHHHHHHhcCcc--------------chhHHHHHHHHHHHHHHHHHHHHHHH
Confidence 99999986 5667779999999999999999999976532 35789999999999999988887766
Q ss_pred HHHhhcC-hhhHHhhhcCCCCchhHHHHHHHHHhhhchHhhcCCCCeeeCCCCChhHHHHHHHHHHHHHHHHHHHHHHHH
Q 001212 787 AILENTE-SRQLHHILTPGKGLPAIVSILKHFKDAFDWVEANNSGRIIPHGGVDMDYDSACKKVKEIEASLTKHLKEQRK 865 (1122)
Q Consensus 787 ~~l~~~~-s~~l~~l~~~~~~~~~l~~~l~~i~~~~d~~~~~~~g~ii~~~G~d~elD~~~~~~~~i~~~L~~~l~~~~~ 865 (1122)
..+.... ..++..++ ..+|++..-+..+..+|||..+.++|.|+|..|+|.+||.+...+.+++++|.++|+++++
T Consensus 663 ~v~~~~~~~~~is~~~---~~~p~~~~~i~~~~~af~r~~a~~eg~i~P~~Gfd~eyD~a~k~~~e~e~~L~~~L~~~rk 739 (1125)
T KOG0217|consen 663 NVLKEGEGLRLISELL---ESMPNLSEEIENWTEAFDRVKAVKEGVIVPLEGFDEEYDEAMKRVDEAENELLAYLEEYRK 739 (1125)
T ss_pred HHHHhhHHHHHHHHHh---cCcchhhHHHHHHHHHHHHHHHhhcCccCCCccccHHHHHHhhHHHHHHHHHHHHHHHHHH
Confidence 5543221 22233222 3489999999999999999999999999999999999999999999999999999999999
Q ss_pred HhcCCCceEEEecCceEEEEecccccCCCCCcEEEeeeecceEEEecchHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q 001212 866 LLGDTSITYVTIGKDLYLLEVPESLRGSVPRDYELRSSKKGFFRYWTPNIKKLLGELSQAESEKESALKSILQRLIGQFC 945 (1122)
Q Consensus 866 ~l~~~~i~y~~~~~~~y~ieV~~~~~~~vp~~~~~~ss~k~~~rf~t~el~~l~~~l~~~~~~~~~~~~~il~~l~~~~~ 945 (1122)
.+++.+|.|+++++..|++|||++....+|.+|+..+++||+.||+||++.++...+.++++++.....++.++++.+|.
T Consensus 740 ~l~c~si~~~~vGk~~y~lEvP~n~~~~s~~~~~~~S~~Kg~~RY~tp~~~kli~~l~~aee~~~~~~~d~~~r~~~~f~ 819 (1125)
T KOG0217|consen 740 RLGCSSIVFVDVGKDVYQLEVPENGGVPSSLRYELMSAKKGVSRYYTPDLRKLIAHLDEAEERKKSSLSDLKRRLIVRFD 819 (1125)
T ss_pred hcCCCceeEeecCceEEEEecCcccCCCCchHHHHHHhhcCcccccCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhh
Confidence 99999999999999999999999988778888999999999999999999999999999999999999999999999999
Q ss_pred hhhhHHHHHHHHHHHHHhHHHHHHHhhhcCCCccceeeeCCCCCCCCeEEEeecCCCceecccCCCCceeccceeeCCCC
Q 001212 946 EHHNKWRQMVAATAELDALISLAIASDFYEGPTCRPVILDSCSNEEPYISAKSLGHPVLRSDSLGKGEFVPNDITIGGHG 1025 (1122)
Q Consensus 946 ~~~~~l~~~~~~ia~LD~L~SlA~~a~~~~~~~~rP~~~~~~~~~~~~l~i~~~RHP~le~~~~~~~~fVPNDi~L~~~~ 1025 (1122)
+|+..|+++++++|.||||+|||.+|..+++++|||+|++..+ +.+.+.++.+||||+.... ..+.|||||+.+|+..
T Consensus 820 ~~~~~w~~tv~~~a~iD~l~sla~~s~~~~~~~Crp~i~~~~d-t~~~l~~~~~~Hpcfsl~s-~~~~fipN~v~~g~~~ 897 (1125)
T KOG0217|consen 820 EHYIIWQATVKALASIDCLLSLAETSKGLGGPMCRPEIVESTD-TPGFLIVKGLRHPCFSLPS-TGTSFIPNDVELGGAE 897 (1125)
T ss_pred hhHHHHHHHHHHHHHHHHHHHHHHhhccCCCCcccceeecccC-CCceeEEecccCceeecCc-CCCccccchhhccccc
Confidence 9999999999999999999999999999999999999997532 2348999999999998743 3368999999999777
Q ss_pred CceEEEEEecCCCchHHHHHHHHHHHHHHHcCCcccCCccccCCcceEeeccCCccccccCCChHHHHHHHHHHHHHhcc
Q 001212 1026 NASFILLTGPNMGGKSTLLRQVCLAVILAQVGADVPAEIFEISPVDRIFVRMGAKDHIMAGQSTFLTELSETALMLVRFF 1105 (1122)
Q Consensus 1026 ~~~~~IITGPNMgGKST~LRqvaLivILAQiG~fVPA~~a~l~ivDrIfTRiGa~D~i~~g~STFmvEM~Eta~IL~~AT 1105 (1122)
.++++|+||||||||||+|||+|++||||||||||||+.|+++++|||||||||+|+|+.|+||||+|+.||+.||++||
T Consensus 898 e~~~~llTGpNmgGKSTllRq~c~~vilaq~G~~VPa~~~~~tpidrI~tRlGA~D~im~g~STF~vELsET~~IL~~aT 977 (1125)
T KOG0217|consen 898 ENREGLLTGPNMGGKSTLLRQACIAVILAQIGCDVPAEVMELTPIDRIFTRLGANDDIMSGESTFFVELSETKKILKHAT 977 (1125)
T ss_pred cceeeeeccCCcCCchHHHHHHHHHHHHHHhCCCccHHHhcccchHHHhhhcccccchhcCCceEEEeccchHHHHhhcC
Confidence 77889999999999999999999999999999999999999999999999999999999999999999999999999999
Q ss_pred ccHHHHHHHHh
Q 001212 1106 CSLNQLCRYIH 1116 (1122)
Q Consensus 1106 ~sl~~l~~~~~ 1116 (1122)
++++++.|+|.
T Consensus 978 ~~SLvi~DELG 988 (1125)
T KOG0217|consen 978 RHSLVIVDELG 988 (1125)
T ss_pred ccceeeehhhc
Confidence 98777777763
|
|
| >TIGR01070 mutS1 DNA mismatch repair protein MutS | Back alignment and domain information |
|---|
| >COG0249 MutS Mismatch repair ATPase (MutS family) [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PRK05399 DNA mismatch repair protein MutS; Provisional | Back alignment and domain information |
|---|
| >KOG0218 consensus Mismatch repair MSH3 [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >KOG0219 consensus Mismatch repair ATPase MSH2 (MutS family) [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >KOG0220 consensus Mismatch repair ATPase MSH4 (MutS family) [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >KOG0221 consensus Mismatch repair ATPase MSH5 (MutS family) [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >PRK00409 recombination and DNA strand exchange inhibitor protein; Reviewed | Back alignment and domain information |
|---|
| >TIGR01069 mutS2 MutS2 family protein | Back alignment and domain information |
|---|
| >smart00533 MUTSd DNA-binding domain of DNA mismatch repair MUTS family | Back alignment and domain information |
|---|
| >PF00488 MutS_V: MutS domain V C-terminus | Back alignment and domain information |
|---|
| >PF01624 MutS_I: MutS domain I C-terminus | Back alignment and domain information |
|---|
| >COG1193 Mismatch repair ATPase (MutS family) [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >cd03286 ABC_MSH6_euk MutS6 homolog in eukaryotes | Back alignment and domain information |
|---|
| >cd03287 ABC_MSH3_euk MutS3 homolog in eukaryotes | Back alignment and domain information |
|---|
| >cd03281 ABC_MSH5_euk MutS5 homolog in eukaryotes | Back alignment and domain information |
|---|
| >cd03285 ABC_MSH2_euk MutS2 homolog in eukaryotes | Back alignment and domain information |
|---|
| >cd03282 ABC_MSH4_euk MutS4 homolog in eukaryotes | Back alignment and domain information |
|---|
| >cd03284 ABC_MutS1 MutS1 homolog in eukaryotes | Back alignment and domain information |
|---|
| >PF05192 MutS_III: MutS domain III C-terminus | Back alignment and domain information |
|---|
| >cd03280 ABC_MutS2 MutS2 homologs in bacteria and eukaryotes | Back alignment and domain information |
|---|
| >cd03243 ABC_MutS_homologs The MutS protein initiates DNA mismatch repair by recognizing mispaired and unpaired bases embedded in duplex DNA and activating endo- and exonucleases to remove the mismatch | Back alignment and domain information |
|---|
| >cd03283 ABC_MutS-like MutS-like homolog in eukaryotes | Back alignment and domain information |
|---|
| >smart00534 MUTSac ATPase domain of DNA mismatch repair MUTS family | Back alignment and domain information |
|---|
| >cd03227 ABC_Class2 ABC-type Class 2 contains systems involved in cellular processes other than transport | Back alignment and domain information |
|---|
| >PF05188 MutS_II: MutS domain II; InterPro: IPR007860 Mismatch repair contributes to the overall fidelity of DNA replication and is essential for combating the adverse effects of damage to the genome | Back alignment and domain information |
|---|
| >PF05190 MutS_IV: MutS family domain IV C-terminus | Back alignment and domain information |
|---|
| >PF09465 LBR_tudor: Lamin-B receptor of TUDOR domain; InterPro: IPR019023 The Lamin-B receptor is a chromatin and lamin binding protein in the inner nuclear membrane | Back alignment and domain information |
|---|
| >KOG4675 consensus Uncharacterized conserved protein, contains ENT domain [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0219 consensus Mismatch repair ATPase MSH2 (MutS family) [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >smart00333 TUDOR Tudor domain | Back alignment and domain information |
|---|
| >cd04508 TUDOR Tudor domains are found in many eukaryotic organisms and have been implicated in protein-protein interactions in which methylated protein substrates bind to these domains | Back alignment and domain information |
|---|
| >smart00743 Agenet Tudor-like domain present in plant sequences | Back alignment and domain information |
|---|
| >COG4133 CcmA ABC-type transport system involved in cytochrome c biogenesis, ATPase component [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >COG4619 ABC-type uncharacterized transport system, ATPase component [General function prediction only] | Back alignment and domain information |
|---|
| >PF09038 53-BP1_Tudor: Tumour suppressor p53-binding protein-1 Tudor; InterPro: IPR015125 This domain consist of ten beta-strands and a carboxy-terminal alpha-helix | Back alignment and domain information |
|---|
| >PF13555 AAA_29: P-loop containing region of AAA domain | Back alignment and domain information |
|---|
| >COG1121 ZnuC ABC-type Mn/Zn transport systems, ATPase component [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >COG1120 FepC ABC-type cobalamin/Fe3+-siderophores transport systems, ATPase components [Inorganic ion transport and metabolism / Coenzyme metabolism] | Back alignment and domain information |
|---|
| >cd00267 ABC_ATPase ABC (ATP-binding cassette) transporter nucleotide-binding domain; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules | Back alignment and domain information |
|---|
| >PF00005 ABC_tran: ABC transporter This structure is on hold until Dec 1999; InterPro: IPR003439 ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energise diverse biological systems | Back alignment and domain information |
|---|
| >PRK15177 Vi polysaccharide export ATP-binding protein VexC; Provisional | Back alignment and domain information |
|---|
| >cd03238 ABC_UvrA The excision repair protein UvrA; Nucleotide excision repair in eubacteria is a process that repairs DNA damage by the removal of a 12-13-mer oligonucleotide containing the lesion | Back alignment and domain information |
|---|
| >COG4559 ABC-type hemin transport system, ATPase component [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PRK10247 putative ABC transporter ATP-binding protein YbbL; Provisional | Back alignment and domain information |
|---|
| >cd03265 ABC_DrrA DrrA is the ATP-binding protein component of a bacterial exporter complex that confers resistance to the antibiotics daunorubicin and doxorubicin | Back alignment and domain information |
|---|
| >TIGR01166 cbiO cobalt transport protein ATP-binding subunit | Back alignment and domain information |
|---|
| >COG1119 ModF ABC-type molybdenum transport system, ATPase component/photorepair protein PhrA [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >COG3839 MalK ABC-type sugar transport systems, ATPase components [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >cd03226 ABC_cobalt_CbiO_domain2 Domain II of the ABC component of a cobalt transport family found in bacteria, archaea, and eukaryota | Back alignment and domain information |
|---|
| >TIGR02211 LolD_lipo_ex lipoprotein releasing system, ATP-binding protein | Back alignment and domain information |
|---|
| >TIGR02323 CP_lyasePhnK phosphonate C-P lyase system protein PhnK | Back alignment and domain information |
|---|
| >PRK10584 putative ABC transporter ATP-binding protein YbbA; Provisional | Back alignment and domain information |
|---|
| >cd03255 ABC_MJ0796_Lo1CDE_FtsE This family is comprised of MJ0796 ATP-binding cassette, macrolide-specific ABC-type efflux carrier (MacAB), and proteins involved in cell division (FtsE), and release of liporoteins from the cytoplasmic membrane (LolCDE) | Back alignment and domain information |
|---|
| >cd03269 ABC_putative_ATPase This subfamily is involved in drug resistance, nodulation, lipid transport, and bacteriocin and lantibiotic immunity | Back alignment and domain information |
|---|
| >cd03259 ABC_Carb_Solutes_like ABC Carbohydrate and Solute Transporters-like subgroup | Back alignment and domain information |
|---|
| >cd03268 ABC_BcrA_bacitracin_resist The BcrA subfamily represents ABC transporters involved in peptide antibiotic resistance | Back alignment and domain information |
|---|
| >cd03261 ABC_Org_Solvent_Resistant ABC (ATP-binding cassette) transport system involved in resistant to organic solvents; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules | Back alignment and domain information |
|---|
| >cd03225 ABC_cobalt_CbiO_domain1 Domain I of the ABC component of a cobalt transport family found in bacteria, archaea, and eukaryota | Back alignment and domain information |
|---|
| >TIGR02770 nickel_nikD nickel import ATP-binding protein NikD | Back alignment and domain information |
|---|
| >cd03230 ABC_DR_subfamily_A This family of ATP-binding proteins belongs to a multisubunit transporter involved in drug resistance (BcrA and DrrA), nodulation, lipid transport, and lantibiotic immunity | Back alignment and domain information |
|---|
| >cd03232 ABC_PDR_domain2 The pleiotropic drug resistance-like (PDR) family of ATP-binding cassette (ABC) transporters | Back alignment and domain information |
|---|
| >cd03221 ABCF_EF-3 ABCF_EF-3 Elongation factor 3 (EF-3) is a cytosolic protein required by fungal ribosomes for in vitro protein synthesis and for in vivo growth | Back alignment and domain information |
|---|
| >TIGR00960 3a0501s02 Type II (General) Secretory Pathway (IISP) Family protein | Back alignment and domain information |
|---|
| >cd03267 ABC_NatA_like Similar in sequence to NatA, this is the ATPase component of a bacterial ABC-type Na+ transport system called NatAB, which catalyzes ATP-dependent electrogenic Na+ extrusion without mechanically coupled to proton or K+ uptake | Back alignment and domain information |
|---|
| >cd03228 ABCC_MRP_Like The MRP (Mutidrug Resistance Protein)-like transporters are involved in drug, peptide, and lipid export | Back alignment and domain information |
|---|
| >cd03279 ABC_sbcCD SbcCD and other Mre11/Rad50 (MR) complexes are implicated in the metabolism of DNA ends | Back alignment and domain information |
|---|
| >cd03257 ABC_NikE_OppD_transporters The ABC transporter subfamily specific for the transport of dipeptides, oligopeptides (OppD), and nickel (NikDE) | Back alignment and domain information |
|---|
| >cd03223 ABCD_peroxisomal_ALDP Peroxisomal ATP-binding cassette transporter (Pat) is involved in the import of very long-chain fatty acids (VLCFA) into the peroxisome | Back alignment and domain information |
|---|
| >TIGR03608 L_ocin_972_ABC putative bacteriocin export ABC transporter, lactococcin 972 group | Back alignment and domain information |
|---|
| >cd03218 ABC_YhbG The ABC transporters belonging to the YhbG family are similar to members of the Mj1267_LivG family, which is involved in the transport of branched-chain amino acids | Back alignment and domain information |
|---|
| >cd03250 ABCC_MRP_domain1 Domain 1 of the ABC subfamily C | Back alignment and domain information |
|---|
| >cd03263 ABC_subfamily_A The ABCA subfamily mediates the transport of a variety of lipid compounds | Back alignment and domain information |
|---|
| >cd03266 ABC_NatA_sodium_exporter NatA is the ATPase component of a bacterial ABC-type Na+ transport system called NatAB, which catalyzes ATP-dependent electrogenic Na+ extrusion without mechanically coupled proton or K+ uptake | Back alignment and domain information |
|---|
| >cd03237 ABC_RNaseL_inhibitor_domain2 The ATPase domain 2 of RNase L inhibitor | Back alignment and domain information |
|---|
| >cd03293 ABC_NrtD_SsuB_transporters NrtD and SsuB are the ATP-binding subunits of the bacterial ABC-type nitrate and sulfonate transport systems, respectively | Back alignment and domain information |
|---|
| >cd03292 ABC_FtsE_transporter FtsE is a hydrophilic nucleotide-binding protein that binds FtsX to form a heterodimeric ATP-binding cassette (ABC)-type transporter that associates with the bacterial inner membrane | Back alignment and domain information |
|---|
| >TIGR01189 ccmA heme ABC exporter, ATP-binding protein CcmA | Back alignment and domain information |
|---|
| >TIGR03410 urea_trans_UrtE urea ABC transporter, ATP-binding protein UrtE | Back alignment and domain information |
|---|
| >TIGR01978 sufC FeS assembly ATPase SufC | Back alignment and domain information |
|---|
| >cd03216 ABC_Carb_Monos_I This family represents the domain I of the carbohydrate uptake proteins that transport only monosaccharides (Monos) | Back alignment and domain information |
|---|
| >TIGR02673 FtsE cell division ATP-binding protein FtsE | Back alignment and domain information |
|---|
| >PRK11629 lolD lipoprotein transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >cd03254 ABCC_Glucan_exporter_like Glucan exporter ATP-binding protein | Back alignment and domain information |
|---|
| >KOG0064 consensus Peroxisomal long-chain acyl-CoA transporter, ABC superfamily [Lipid transport and metabolism] | Back alignment and domain information |
|---|
| >COG0488 Uup ATPase components of ABC transporters with duplicated ATPase domains [General function prediction only] | Back alignment and domain information |
|---|
| >cd03235 ABC_Metallic_Cations ABC component of the metal-type transporters | Back alignment and domain information |
|---|
| >cd03264 ABC_drug_resistance_like ABC-type multidrug transport system, ATPase component | Back alignment and domain information |
|---|
| >PRK13539 cytochrome c biogenesis protein CcmA; Provisional | Back alignment and domain information |
|---|
| >PRK10419 nikE nickel transporter ATP-binding protein NikE; Provisional | Back alignment and domain information |
|---|
| >cd03215 ABC_Carb_Monos_II This family represents domain II of the carbohydrate uptake proteins that transport only monosaccharides (Monos) | Back alignment and domain information |
|---|
| >PRK10895 lipopolysaccharide ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >TIGR01184 ntrCD nitrate transport ATP-binding subunits C and D | Back alignment and domain information |
|---|
| >TIGR02315 ABC_phnC phosphonate ABC transporter, ATP-binding protein | Back alignment and domain information |
|---|
| >cd03262 ABC_HisP_GlnQ_permeases HisP and GlnQ are the ATP-binding components of the bacterial periplasmic histidine and glutamine permeases, repectively | Back alignment and domain information |
|---|
| >cd03298 ABC_ThiQ_thiamine_transporter ABC-type thiamine tranport system; part of the binding-protein-dependent transport system tbpA-thiPQ for thiamine and TPP | Back alignment and domain information |
|---|
| >PRK14242 phosphate transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >cd03260 ABC_PstB_phosphate_transporter Phosphate uptake is of fundamental importance in the cell physiology of bacteria because phosphate is required as a nutrient | Back alignment and domain information |
|---|
| >cd03301 ABC_MalK_N The N-terminal ATPase domain of the maltose transporter, MalK | Back alignment and domain information |
|---|
| >cd03247 ABCC_cytochrome_bd The CYD subfamily implicated in cytochrome bd biogenesis | Back alignment and domain information |
|---|
| >cd03224 ABC_TM1139_LivF_branched LivF (TM1139) is part of the LIV-I bacterial ABC-type two-component transport system that imports neutral, branched-chain amino acids | Back alignment and domain information |
|---|
| >PRK11248 tauB taurine transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PF13476 AAA_23: AAA domain; PDB: 3AV0_B 3AUY_B 3AUX_A 2O5V_A 3QG5_B 3QF7_A 3THO_A | Back alignment and domain information |
|---|
| >cd03246 ABCC_Protease_Secretion This family represents the ABC component of the protease secretion system PrtD, a 60-kDa integral membrane protein sharing 37% identity with HlyB, the ABC component of the alpha-hemolysin secretion pathway, in the C-terminal domain | Back alignment and domain information |
|---|
| >cd03234 ABCG_White The White subfamily represents ABC transporters homologous to the Drosophila white gene, which acts as a dimeric importer for eye pigment precursors | Back alignment and domain information |
|---|
| >cd03219 ABC_Mj1267_LivG_branched The Mj1267/LivG ABC transporter subfamily is involved in the transport of the hydrophobic amino acids leucine, isoleucine and valine | Back alignment and domain information |
|---|
| >cd03258 ABC_MetN_methionine_transporter MetN (also known as YusC) is an ABC-type transporter encoded by metN of the metNPQ operon in Bacillus subtilis that is involved in methionine transport | Back alignment and domain information |
|---|
| >cd03296 ABC_CysA_sulfate_importer Part of the ABC transporter complex cysAWTP involved in sulfate import | Back alignment and domain information |
|---|
| >PRK10744 pstB phosphate transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK10908 cell division protein FtsE; Provisional | Back alignment and domain information |
|---|
| >PRK11831 putative ABC transporter ATP-binding protein YrbF; Provisional | Back alignment and domain information |
|---|
| >CHL00131 ycf16 sulfate ABC transporter protein; Validated | Back alignment and domain information |
|---|
| >COG4555 NatA ABC-type Na+ transport system, ATPase component [Energy production and conversion / Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >cd03256 ABC_PhnC_transporter ABC-type phosphate/phosphonate transport system | Back alignment and domain information |
|---|
| >cd03222 ABC_RNaseL_inhibitor The ABC ATPase RNase L inhibitor (RLI) is a key enzyme in ribosomal biogenesis, formation of translation preinitiation complexes, and assembly of HIV capsids | Back alignment and domain information |
|---|
| >cd03249 ABC_MTABC3_MDL1_MDL2 MTABC3 (also known as ABCB6) is a mitochondrial ATP-binding cassette protein involved in iron homeostasis and one of four ABC transporters expressed in the mitochondrial inner membrane, the other three being MDL1(ABC7), MDL2, and ATM1 | Back alignment and domain information |
|---|
| >PRK13543 cytochrome c biogenesis protein CcmA; Provisional | Back alignment and domain information |
|---|
| >cd03251 ABCC_MsbA MsbA is an essential ABC transporter, closely related to eukaryotic MDR proteins | Back alignment and domain information |
|---|
| >cd03229 ABC_Class3 This class is comprised of all BPD (Binding Protein Dependent) systems that are largely represented in archaea and eubacteria and are primarily involved in scavenging solutes from the environment | Back alignment and domain information |
|---|
| >cd03248 ABCC_TAP TAP, the Transporter Associated with Antigen Processing; TAP is essential for peptide delivery from the cytosol into the lumen of the endoplasmic reticulum (ER), where these peptides are loaded on major histocompatibility complex (MHC) I molecules | Back alignment and domain information |
|---|
| >TIGR01277 thiQ thiamine ABC transporter, ATP-binding protein | Back alignment and domain information |
|---|
| >PRK10771 thiQ thiamine transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >TIGR03005 ectoine_ehuA ectoine/hydroxyectoine ABC transporter, ATP-binding protein | Back alignment and domain information |
|---|
| >PRK13540 cytochrome c biogenesis protein CcmA; Provisional | Back alignment and domain information |
|---|
| >COG1118 CysA ABC-type sulfate/molybdate transport systems, ATPase component [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >cd03214 ABC_Iron-Siderophores_B12_Hemin ABC transporters, involved in the uptake of siderophores, heme, and vitamin B12, are widely conserved in bacteria and archaea | Back alignment and domain information |
|---|
| >cd03253 ABCC_ATM1_transporter ATM1 is an ABC transporter that is expressed in the mitochondria | Back alignment and domain information |
|---|
| >PRK15112 antimicrobial peptide ABC system ATP-binding protein SapF; Provisional | Back alignment and domain information |
|---|
| >COG1131 CcmA ABC-type multidrug transport system, ATPase component [Defense mechanisms] | Back alignment and domain information |
|---|
| >PRK11614 livF leucine/isoleucine/valine transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >cd03245 ABCC_bacteriocin_exporters ABC-type bacteriocin exporters | Back alignment and domain information |
|---|
| >PRK11247 ssuB aliphatic sulfonates transport ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >cd03252 ABCC_Hemolysin The ABC-transporter hemolysin B is a central component of the secretion machinery that translocates the toxin, hemolysin A, in a Sec-independent fashion across both membranes of E | Back alignment and domain information |
|---|
| >PRK13638 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >cd03213 ABCG_EPDR ABCG transporters are involved in eye pigment (EP) precursor transport, regulation of lipid-trafficking mechanisms, and pleiotropic drug resistance (DR) | Back alignment and domain information |
|---|
| >cd03272 ABC_SMC3_euk Eukaryotic SMC3 proteins; SMC proteins are large (approximately 110 to 170 kDa), and each is arranged into five recognizable domains | Back alignment and domain information |
|---|
| >PRK13538 cytochrome c biogenesis protein CcmA; Provisional | Back alignment and domain information |
|---|
| >TIGR03864 PQQ_ABC_ATP ABC transporter, ATP-binding subunit, PQQ-dependent alcohol dehydrogenase system | Back alignment and domain information |
|---|
| >cd03220 ABC_KpsT_Wzt ABC_KpsT_Wzt The KpsT/Wzt ABC transporter subfamily is involved in extracellular polysaccharide export | Back alignment and domain information |
|---|
| >PRK13536 nodulation factor exporter subunit NodI; Provisional | Back alignment and domain information |
|---|
| >PRK14247 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >cd03295 ABC_OpuCA_Osmoprotection OpuCA is a the ATP binding component of a bacterial solute transporter that serves a protective role to cells growing in a hyperosmolar environment | Back alignment and domain information |
|---|
| >TIGR01288 nodI ATP-binding ABC transporter family nodulation protein NodI | Back alignment and domain information |
|---|
| >PRK09493 glnQ glutamine ABC transporter ATP-binding protein; Reviewed | Back alignment and domain information |
|---|
| >cd03294 ABC_Pro_Gly_Bertaine This family comprises the glycine betaine/L-proline ATP binding subunit in bacteria and its equivalents in archaea | Back alignment and domain information |
|---|
| >PRK13541 cytochrome c biogenesis protein CcmA; Provisional | Back alignment and domain information |
|---|
| >cd03278 ABC_SMC_barmotin Barmotin is a tight junction-associated protein expressed in rat epithelial cells which is thought to have an important regulatory role in tight junction barrier function | Back alignment and domain information |
|---|
| >cd03275 ABC_SMC1_euk Eukaryotic SMC1 proteins; SMC proteins are large (approximately 110 to 170 kDa), and each is arranged into five recognizable domains | Back alignment and domain information |
|---|
| >TIGR03411 urea_trans_UrtD urea ABC transporter, ATP-binding protein UrtD | Back alignment and domain information |
|---|
| >TIGR02324 CP_lyasePhnL phosphonate C-P lyase system protein PhnL | Back alignment and domain information |
|---|
| >TIGR03522 GldA_ABC_ATP gliding motility-associated ABC transporter ATP-binding subunit GldA | Back alignment and domain information |
|---|
| >PRK14262 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK14253 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK11264 putative amino-acid ABC transporter ATP-binding protein YecC; Provisional | Back alignment and domain information |
|---|
| >PRK11124 artP arginine transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >TIGR02769 nickel_nikE nickel import ATP-binding protein NikE | Back alignment and domain information |
|---|
| >PRK14274 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK13644 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK09544 znuC high-affinity zinc transporter ATPase; Reviewed | Back alignment and domain information |
|---|
| >TIGR01188 drrA daunorubicin resistance ABC transporter ATP-binding subunit | Back alignment and domain information |
|---|
| >PRK14250 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK11300 livG leucine/isoleucine/valine transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK15056 manganese/iron transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK13632 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK13649 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK13548 hmuV hemin importer ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK14273 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK13648 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >cd03290 ABCC_SUR1_N The SUR domain 1 | Back alignment and domain information |
|---|
| >PRK14259 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK13645 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >cd03244 ABCC_MRP_domain2 Domain 2 of the ABC subfamily C | Back alignment and domain information |
|---|
| >PRK14255 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK14275 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK14241 phosphate transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >cd03217 ABC_FeS_Assembly ABC-type transport system involved in Fe-S cluster assembly, ATPase component | Back alignment and domain information |
|---|
| >PRK14251 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK13537 nodulation ABC transporter NodI; Provisional | Back alignment and domain information |
|---|
| >PRK09580 sufC cysteine desulfurase ATPase component; Reviewed | Back alignment and domain information |
|---|
| >TIGR00972 3a0107s01c2 phosphate ABC transporter, ATP-binding protein | Back alignment and domain information |
|---|
| >PRK14245 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK14237 phosphate transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK14248 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK14267 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK14268 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK10619 histidine/lysine/arginine/ornithine transporter subunit; Provisional | Back alignment and domain information |
|---|
| >PRK14240 phosphate transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK13547 hmuV hemin importer ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK14239 phosphate transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK14235 phosphate transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK13641 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK14264 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK11432 fbpC ferric transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK11701 phnK phosphonate C-P lyase system protein PhnK; Provisional | Back alignment and domain information |
|---|
| >PRK13635 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK14256 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK14272 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK14261 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK14269 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >cd03231 ABC_CcmA_heme_exporter CcmA, the ATP-binding component of the bacterial CcmAB transporter | Back alignment and domain information |
|---|
| >PRK14270 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK14244 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >cd03233 ABC_PDR_domain1 The pleiotropic drug resistance (PDR) family of ATP-binding cassette (ABC) transporters | Back alignment and domain information |
|---|
| >PRK09536 btuD corrinoid ABC transporter ATPase; Reviewed | Back alignment and domain information |
|---|
| >PRK11000 maltose/maltodextrin transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >TIGR03740 galliderm_ABC gallidermin-class lantibiotic protection ABC transporter, ATP-binding subunit | Back alignment and domain information |
|---|
| >PRK13546 teichoic acids export protein ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK09984 phosphonate/organophosphate ester transporter subunit; Provisional | Back alignment and domain information |
|---|
| >TIGR00968 3a0106s01 sulfate ABC transporter, ATP-binding protein | Back alignment and domain information |
|---|
| >PRK14246 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK03695 vitamin B12-transporter ATPase; Provisional | Back alignment and domain information |
|---|
| >cd03236 ABC_RNaseL_inhibitor_domain1 The ATPase domain 1 of RNase L inhibitor | Back alignment and domain information |
|---|
| >TIGR03873 F420-0_ABC_ATP proposed F420-0 ABC transporter, ATP-binding protein | Back alignment and domain information |
|---|
| >cd03369 ABCC_NFT1 Domain 2 of NFT1 (New full-length MRP-type transporter 1) | Back alignment and domain information |
|---|
| >cd03300 ABC_PotA_N PotA is an ABC-type transporter and the ATPase component of the spermidine/putrescine-preferential uptake system consisting of PotA, -B, -C, and -D | Back alignment and domain information |
|---|
| >cd03274 ABC_SMC4_euk Eukaryotic SMC4 proteins; SMC proteins are large (approximately 110 to 170 kDa), and each is arranged into five recognizable domains | Back alignment and domain information |
|---|
| >PRK10253 iron-enterobactin transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >TIGR02982 heterocyst_DevA ABC exporter ATP-binding subunit, DevA family | Back alignment and domain information |
|---|
| >TIGR02322 phosphon_PhnN phosphonate metabolism protein/1,5-bisphosphokinase (PRPP-forming) PhnN | Back alignment and domain information |
|---|
| >PRK14265 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK13640 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK13633 cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK13637 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK14271 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >TIGR03258 PhnT 2-aminoethylphosphonate ABC transport system, ATP-binding component PhnT | Back alignment and domain information |
|---|
| >PRK10078 ribose 1,5-bisphosphokinase; Provisional | Back alignment and domain information |
|---|
| >PRK14266 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK13651 cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >cd03297 ABC_ModC_molybdenum_transporter ModC is an ABC-type transporter and the ATPase component of a molybdate transport system that also includes the periplasmic binding protein ModA and the membrane protein ModB | Back alignment and domain information |
|---|
| >PRK13647 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK14236 phosphate transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK14252 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >TIGR03265 PhnT2 putative 2-aminoethylphosphonate ABC transporter, ATP-binding protein | Back alignment and domain information |
|---|
| >PRK10418 nikD nickel transporter ATP-binding protein NikD; Provisional | Back alignment and domain information |
|---|
| >PRK14238 phosphate transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK13650 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK13646 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK14258 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK13634 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK13652 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK11153 metN DL-methionine transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK11231 fecE iron-dicitrate transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK10575 iron-hydroxamate transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK11650 ugpC glycerol-3-phosphate transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK14254 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >cd03240 ABC_Rad50 The catalytic domains of Rad50 are similar to the ATP-binding cassette of ABC transporters, but are not associated with membrane-spanning domains | Back alignment and domain information |
|---|
| >TIGR03771 anch_rpt_ABC anchored repeat-type ABC transporter, ATP-binding subunit | Back alignment and domain information |
|---|
| >PRK10070 glycine betaine transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK13643 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK13639 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK14249 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >TIGR02142 modC_ABC molybdenum ABC transporter, ATP-binding protein | Back alignment and domain information |
|---|
| >KOG0062 consensus ATPase component of ABC transporters with duplicated ATPase domains/Translation elongation factor EF-3b [Amino acid transport and metabolism; Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >PRK09452 potA putrescine/spermidine ABC transporter ATPase protein; Reviewed | Back alignment and domain information |
|---|
| >PRK14260 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK14243 phosphate transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK10851 sulfate/thiosulfate transporter subunit; Provisional | Back alignment and domain information |
|---|
| >COG2884 FtsE Predicted ATPase involved in cell division [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >PRK10938 putative molybdenum transport ATP-binding protein ModF; Provisional | Back alignment and domain information |
|---|
| >PRK11607 potG putrescine transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK09700 D-allose transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK13642 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK09825 idnK D-gluconate kinase; Provisional | Back alignment and domain information |
|---|
| >cd03276 ABC_SMC6_euk Eukaryotic SMC6 proteins; SMC proteins are large (approximately 110 to 170 kDa), and each is arranged into five recognizable domains | Back alignment and domain information |
|---|
| >COG1122 CbiO ABC-type cobalt transport system, ATPase component [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PRK14263 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK13549 xylose transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >TIGR03269 met_CoM_red_A2 methyl coenzyme M reductase system, component A2 | Back alignment and domain information |
|---|
| >cd03299 ABC_ModC_like Archeal protein closely related to ModC | Back alignment and domain information |
|---|
| >PRK13636 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK11144 modC molybdate transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >cd03291 ABCC_CFTR1 The CFTR subfamily domain 1 | Back alignment and domain information |
|---|
| >COG0410 LivF ABC-type branched-chain amino acid transport systems, ATPase component [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >COG3950 Predicted ATP-binding protein involved in virulence [General function prediction only] | Back alignment and domain information |
|---|
| >COG0396 sufC Cysteine desulfurase activator ATPase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK10762 D-ribose transporter ATP binding protein; Provisional | Back alignment and domain information |
|---|
| >cd01130 VirB11-like_ATPase Type IV secretory pathway component VirB11, and related ATPases | Back alignment and domain information |
|---|
| >TIGR02314 ABC_MetN D-methionine ABC transporter, ATP-binding protein | Back alignment and domain information |
|---|
| >PRK15064 ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK11819 putative ABC transporter ATP-binding protein; Reviewed | Back alignment and domain information |
|---|
| >TIGR03415 ABC_choXWV_ATP choline ABC transporter, ATP-binding protein | Back alignment and domain information |
|---|
| >TIGR02633 xylG D-xylose ABC transporter, ATP-binding protein | Back alignment and domain information |
|---|
| >TIGR03263 guanyl_kin guanylate kinase | Back alignment and domain information |
|---|
| >PRK10938 putative molybdenum transport ATP-binding protein ModF; Provisional | Back alignment and domain information |
|---|
| >PRK15064 ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >TIGR01186 proV glycine betaine/L-proline transport ATP binding subunit | Back alignment and domain information |
|---|
| >PF02463 SMC_N: RecF/RecN/SMC N terminal domain; InterPro: IPR003395 This domain is found at the N terminus of structural maintenance of chromosomes (SMC) proteins, which function together with other proteins in a range of chromosomal transactions, including chromosome condensation, sister-chromatid cohesion, recombination, DNA repair and epigenetic silencing of gene expression [] | Back alignment and domain information |
|---|
| >TIGR03719 ABC_ABC_ChvD ATP-binding cassette protein, ChvD family | Back alignment and domain information |
|---|
| >cd03288 ABCC_SUR2 The SUR domain 2 | Back alignment and domain information |
|---|
| >PRK09700 D-allose transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >cd03242 ABC_RecF RecF is a recombinational DNA repair ATPase that maintains replication in the presence of DNA damage | Back alignment and domain information |
|---|
| >COG4604 CeuD ABC-type enterochelin transport system, ATPase component [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PRK13549 xylose transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >TIGR00235 udk uridine kinase | Back alignment and domain information |
|---|
| >PRK10636 putative ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >cd03273 ABC_SMC2_euk Eukaryotic SMC2 proteins; SMC proteins are large (approximately 110 to 170 kDa), and each is arranged into five recognizable domains | Back alignment and domain information |
|---|
| >PRK15439 autoinducer 2 ABC transporter ATP-binding protein LsrA; Provisional | Back alignment and domain information |
|---|
| >PRK13631 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK10762 D-ribose transporter ATP binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK15134 microcin C ABC transporter ATP-binding protein YejF; Provisional | Back alignment and domain information |
|---|
| >PRK10636 putative ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >cd03277 ABC_SMC5_euk Eukaryotic SMC5 proteins; SMC proteins are large (approximately 110 to 170 kDa), and each is arranged into five recognizable domains | Back alignment and domain information |
|---|
| >COG1134 TagH ABC-type polysaccharide/polyol phosphate transport system, ATPase component [Carbohydrate transport and metabolism / Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >COG1126 GlnQ ABC-type polar amino acid transport system, ATPase component [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >cd03241 ABC_RecN RecN ATPase involved in DNA repair; ABC (ATP-binding cassette) transporter nucleotide-binding domain; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds including sugars, ions, peptides, and more complex organic molecules | Back alignment and domain information |
|---|
| >PF06003 SMN: Survival motor neuron protein (SMN); InterPro: IPR010304 This family consists of several eukaryotic survival motor neuron (SMN) proteins | Back alignment and domain information |
|---|
| >COG3910 Predicted ATPase [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR03719 ABC_ABC_ChvD ATP-binding cassette protein, ChvD family | Back alignment and domain information |
|---|
| >TIGR02633 xylG D-xylose ABC transporter, ATP-binding protein | Back alignment and domain information |
|---|
| >TIGR03269 met_CoM_red_A2 methyl coenzyme M reductase system, component A2 | Back alignment and domain information |
|---|
| >PRK11147 ABC transporter ATPase component; Reviewed | Back alignment and domain information |
|---|
| >cd03239 ABC_SMC_head The structural maintenance of chromosomes (SMC) proteins are essential for successful chromosome transmission during replication and segregation of the genome in all organisms | Back alignment and domain information |
|---|
| >PRK15439 autoinducer 2 ABC transporter ATP-binding protein LsrA; Provisional | Back alignment and domain information |
|---|
| >cd00820 PEPCK_HprK Phosphoenolpyruvate carboxykinase (PEPCK), a critical gluconeogenic enzyme, catalyzes the first committed step in the diversion of tricarboxylic acid cycle intermediates toward gluconeogenesis | Back alignment and domain information |
|---|
| >cd03289 ABCC_CFTR2 The CFTR subfamily domain 2 | Back alignment and domain information |
|---|
| >PRK15134 microcin C ABC transporter ATP-binding protein YejF; Provisional | Back alignment and domain information |
|---|
| >PLN00104 MYST -like histone acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK09270 nucleoside triphosphate hydrolase domain-containing protein; Reviewed | Back alignment and domain information |
|---|
| >PRK13545 tagH teichoic acids export protein ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK11819 putative ABC transporter ATP-binding protein; Reviewed | Back alignment and domain information |
|---|
| >PRK11288 araG L-arabinose transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK15093 antimicrobial peptide ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >smart00382 AAA ATPases associated with a variety of cellular activities | Back alignment and domain information |
|---|
| >PRK10982 galactose/methyl galaxtoside transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PF13304 AAA_21: AAA domain; PDB: 3QKS_B 1US8_B 1F2U_B 1F2T_B 3QKT_A 1II8_B 3QKR_B 3QKU_A | Back alignment and domain information |
|---|
| >PRK11288 araG L-arabinose transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK11147 ABC transporter ATPase component; Reviewed | Back alignment and domain information |
|---|
| >cd02023 UMPK Uridine monophosphate kinase (UMPK, EC 2 | Back alignment and domain information |
|---|
| >PRK15079 oligopeptide ABC transporter ATP-binding protein OppF; Provisional | Back alignment and domain information |
|---|
| >COG1136 SalX ABC-type antimicrobial peptide transport system, ATPase component [Defense mechanisms] | Back alignment and domain information |
|---|
| >cd02025 PanK Pantothenate kinase (PanK) catalyzes the phosphorylation of pantothenic acid to form 4'-phosphopantothenic, which is the first of five steps in coenzyme A (CoA) biosynthetic pathway | Back alignment and domain information |
|---|
| >COG3842 PotA ABC-type spermidine/putrescine transport systems, ATPase components [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PRK10261 glutathione transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >TIGR03185 DNA_S_dndD DNA sulfur modification protein DndD | Back alignment and domain information |
|---|
| >PLN03073 ABC transporter F family; Provisional | Back alignment and domain information |
|---|
| >PRK10982 galactose/methyl galaxtoside transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >TIGR01360 aden_kin_iso1 adenylate kinase, isozyme 1 subfamily | Back alignment and domain information |
|---|
| >COG4178 ABC-type uncharacterized transport system, permease and ATPase components [General function prediction only] | Back alignment and domain information |
|---|
| >PRK14257 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PF13671 AAA_33: AAA domain; PDB: 1LTQ_A 2IA5_K 1RC8_A 1LY1_A 1RRC_A 1RPZ_A 3ZVM_A 1YJ5_A 3ZVL_A 3U7E_B | Back alignment and domain information |
|---|
| >PF13207 AAA_17: AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6_G 2QT1_A 2QSZ_A 2QSY_A 2QT0_A 2QG6_A 2P0E_A | Back alignment and domain information |
|---|
| >PRK11022 dppD dipeptide transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >COG0411 LivG ABC-type branched-chain amino acid transport systems, ATPase component [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PLN03073 ABC transporter F family; Provisional | Back alignment and domain information |
|---|
| >PRK10261 glutathione transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PF13173 AAA_14: AAA domain | Back alignment and domain information |
|---|
| >PRK11308 dppF dipeptide transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK13409 putative ATPase RIL; Provisional | Back alignment and domain information |
|---|
| >PRK00064 recF recombination protein F; Reviewed | Back alignment and domain information |
|---|
| >COG2274 SunT ABC-type bacteriocin/lantibiotic exporters, contain an N-terminal double-glycine peptidase domain [Defense mechanisms] | Back alignment and domain information |
|---|
| >PRK10246 exonuclease subunit SbcC; Provisional | Back alignment and domain information |
|---|
| >TIGR02524 dot_icm_DotB Dot/Icm secretion system ATPase DotB | Back alignment and domain information |
|---|
| >TIGR00554 panK_bact pantothenate kinase, bacterial type | Back alignment and domain information |
|---|
| >PRK00300 gmk guanylate kinase; Provisional | Back alignment and domain information |
|---|
| >cd01131 PilT Pilus retraction ATPase PilT | Back alignment and domain information |
|---|
| >COG3638 ABC-type phosphate/phosphonate transport system, ATPase component [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR00611 recf recF protein | Back alignment and domain information |
|---|
| >COG4161 ArtP ABC-type arginine transport system, ATPase component [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PRK08118 topology modulation protein; Reviewed | Back alignment and domain information |
|---|
| >COG4988 CydD ABC-type transport system involved in cytochrome bd biosynthesis, ATPase and permease components [Energy production and conversion / Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK05480 uridine/cytidine kinase; Provisional | Back alignment and domain information |
|---|
| >PRK07261 topology modulation protein; Provisional | Back alignment and domain information |
|---|
| >PRK14732 coaE dephospho-CoA kinase; Provisional | Back alignment and domain information |
|---|
| >PRK14738 gmk guanylate kinase; Provisional | Back alignment and domain information |
|---|
| >TIGR00618 sbcc exonuclease SbcC | Back alignment and domain information |
|---|
| >COG1125 OpuBA ABC-type proline/glycine betaine transport systems, ATPase components [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PRK14079 recF recombination protein F; Provisional | Back alignment and domain information |
|---|
| >PRK13409 putative ATPase RIL; Provisional | Back alignment and domain information |
|---|
| >cd02026 PRK Phosphoribulokinase (PRK) is an enzyme involved in the Benson-Calvin cycle in chloroplasts or photosynthetic prokaryotes | Back alignment and domain information |
|---|
| >cd03270 ABC_UvrA_I The excision repair protein UvrA domain I; Nucleotide excision repair in eubacteria is a process that repairs DNA damage by the removal of a 12-13-mer oligonucleotide containing the lesion | Back alignment and domain information |
|---|
| >cd02019 NK Nucleoside/nucleotide kinase (NK) is a protein superfamily consisting of multiple families of enzymes that share structural similarity and are functionally related to the catalysis of the reversible phosphate group transfer from nucleoside triphosphates to nucleosides/nucleotides, nucleoside monophosphates, or sugars | Back alignment and domain information |
|---|
| >TIGR03015 pepcterm_ATPase putative secretion ATPase, PEP-CTERM locus subfamily | Back alignment and domain information |
|---|
| >COG1116 TauB ABC-type nitrate/sulfonate/bicarbonate transport system, ATPase component [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR01842 type_I_sec_PrtD type I secretion system ABC transporter, PrtD family | Back alignment and domain information |
|---|
| >PRK05416 glmZ(sRNA)-inactivating NTPase; Provisional | Back alignment and domain information |
|---|
| >PHA02562 46 endonuclease subunit; Provisional | Back alignment and domain information |
|---|
| >TIGR00954 3a01203 Peroxysomal Fatty Acyl CoA Transporter (FAT) Family protei | Back alignment and domain information |
|---|
| >TIGR01187 potA spermidine/putrescine ABC transporter ATP-binding subunit | Back alignment and domain information |
|---|
| >PRK09473 oppD oligopeptide transporter ATP-binding component; Provisional | Back alignment and domain information |
|---|
| >cd02021 GntK Gluconate kinase (GntK) catalyzes the phosphoryl transfer from ATP to gluconate | Back alignment and domain information |
|---|
| >PLN03211 ABC transporter G-25; Provisional | Back alignment and domain information |
|---|
| >TIGR01313 therm_gnt_kin carbohydrate kinase, thermoresistant glucokinase family | Back alignment and domain information |
|---|
| >TIGR02168 SMC_prok_B chromosome segregation protein SMC, common bacterial type | Back alignment and domain information |
|---|
| >cd03271 ABC_UvrA_II The excision repair protein UvrA domain II; Nucleotide excision repair in eubacteria is a process that repairs DNA damage by the removal of a 12-13-mer oligonucleotide containing the lesion | Back alignment and domain information |
|---|
| >PRK13695 putative NTPase; Provisional | Back alignment and domain information |
|---|
| >PRK05541 adenylylsulfate kinase; Provisional | Back alignment and domain information |
|---|
| >PRK06762 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >TIGR00101 ureG urease accessory protein UreG | Back alignment and domain information |
|---|
| >COG4152 ABC-type uncharacterized transport system, ATPase component [General function prediction only] | Back alignment and domain information |
|---|
| >PRK02224 chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >PRK06995 flhF flagellar biosynthesis regulator FlhF; Validated | Back alignment and domain information |
|---|
| >TIGR00634 recN DNA repair protein RecN | Back alignment and domain information |
|---|
| >COG4586 ABC-type uncharacterized transport system, ATPase component [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0060 consensus Long-chain acyl-CoA transporter, ABC superfamily (involved in peroxisome organization and biogenesis) [Lipid transport and metabolism; General function prediction only] | Back alignment and domain information |
|---|
| >PRK14721 flhF flagellar biosynthesis regulator FlhF; Provisional | Back alignment and domain information |
|---|
| >TIGR01192 chvA glucan exporter ATP-binding protein | Back alignment and domain information |
|---|
| >COG4674 Uncharacterized ABC-type transport system, ATPase component [General function prediction only] | Back alignment and domain information |
|---|
| >COG4778 PhnL ABC-type phosphonate transport system, ATPase component [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >COG1117 PstB ABC-type phosphate transport system, ATPase component [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >cd01120 RecA-like_NTPases RecA-like NTPases | Back alignment and domain information |
|---|
| >cd03112 CobW_like The function of this protein family is unkown | Back alignment and domain information |
|---|
| >PRK10869 recombination and repair protein; Provisional | Back alignment and domain information |
|---|
| >cd04155 Arl3 Arl3 subfamily | Back alignment and domain information |
|---|
| >cd01672 TMPK Thymidine monophosphate kinase (TMPK), also known as thymidylate kinase, catalyzes the phosphorylation of thymidine monophosphate (TMP) to thymidine diphosphate (TDP) utilizing ATP as its preferred phophoryl donor | Back alignment and domain information |
|---|
| >TIGR02788 VirB11 P-type DNA transfer ATPase VirB11 | Back alignment and domain information |
|---|
| >KOG0127 consensus Nucleolar protein fibrillarin NOP77 (RRM superfamily) [RNA processing and modification] | Back alignment and domain information |
|---|
| >cd00071 GMPK Guanosine monophosphate kinase (GMPK, EC 2 | Back alignment and domain information |
|---|
| >KOG0927 consensus Predicted transporter (ABC superfamily) [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR03238 dnd_assoc_3 dnd system-associated protein 3 | Back alignment and domain information |
|---|
| >COG0419 SbcC ATPase involved in DNA repair [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PRK06761 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PF03215 Rad17: Rad17 cell cycle checkpoint protein | Back alignment and domain information |
|---|
| >TIGR03797 NHPM_micro_ABC2 NHPM bacteriocin system ABC transporter, ATP-binding protein | Back alignment and domain information |
|---|
| >PRK10789 putative multidrug transporter membrane\ATP-binding components; Provisional | Back alignment and domain information |
|---|
| >TIGR02204 MsbA_rel ABC transporter, permease/ATP-binding protein | Back alignment and domain information |
|---|
| >PF06414 Zeta_toxin: Zeta toxin; InterPro: IPR010488 This entry represents a domain originally identified in bacterial zeta toxin proteins, where it comprises the whole protein [] | Back alignment and domain information |
|---|
| >cd00009 AAA The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold | Back alignment and domain information |
|---|
| >PF00004 AAA: ATPase family associated with various cellular activities (AAA); InterPro: IPR003959 AAA ATPases (ATPases Associated with diverse cellular Activities) form a large protein family and play a number of roles in the cell including cell-cycle regulation, protein proteolysis and disaggregation, organelle biogenesis and intracellular transport | Back alignment and domain information |
|---|
| >PRK10416 signal recognition particle-docking protein FtsY; Provisional | Back alignment and domain information |
|---|
| >PF05729 NACHT: NACHT domain | Back alignment and domain information |
|---|
| >COG1101 PhnK ABC-type uncharacterized transport system, ATPase component [General function prediction only] | Back alignment and domain information |
|---|
| >PRK10535 macrolide transporter ATP-binding /permease protein; Provisional | Back alignment and domain information |
|---|
| >COG1129 MglA ABC-type sugar transport system, ATPase component [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >KOG2355 consensus Predicted ABC-type transport, ATPase component/CCR4 associated factor [General function prediction only; Transcription] | Back alignment and domain information |
|---|
| >COG3845 ABC-type uncharacterized transport systems, ATPase components [General function prediction only] | Back alignment and domain information |
|---|
| >COG1127 Ttg2A ABC-type transport system involved in resistance to organic solvents, ATPase component [Secondary metabolites biosynthesis, transport, and catabolism] | Back alignment and domain information |
|---|
| >COG0488 Uup ATPase components of ABC transporters with duplicated ATPase domains [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR02203 MsbA_lipidA lipid A export permease/ATP-binding protein MsbA | Back alignment and domain information |
|---|
| >TIGR00606 rad50 rad50 | Back alignment and domain information |
|---|
| >PRK11176 lipid transporter ATP-binding/permease protein; Provisional | Back alignment and domain information |
|---|
| >PRK03846 adenylylsulfate kinase; Provisional | Back alignment and domain information |
|---|
| >cd00227 CPT Chloramphenicol (Cm) phosphotransferase (CPT) | Back alignment and domain information |
|---|
| >PLN03140 ABC transporter G family member; Provisional | Back alignment and domain information |
|---|
| >TIGR00630 uvra excinuclease ABC, A subunit | Back alignment and domain information |
|---|
| >PRK05057 aroK shikimate kinase I; Reviewed | Back alignment and domain information |
|---|
| >TIGR00956 3a01205 Pleiotropic Drug Resistance (PDR) Family protein | Back alignment and domain information |
|---|
| >TIGR02857 CydD thiol reductant ABC exporter, CydD subunit | Back alignment and domain information |
|---|
| >COG4138 BtuD ABC-type cobalamin transport system, ATPase component [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >PTZ00202 tuzin; Provisional | Back alignment and domain information |
|---|
| >COG4615 PvdE ABC-type siderophore export system, fused ATPase and permease components [Secondary metabolites biosynthesis, transport, and catabolism / Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >COG4637 Predicted ATPase [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR01420 pilT_fam pilus retraction protein PilT | Back alignment and domain information |
|---|
| >PRK08233 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >TIGR00955 3a01204 The Eye Pigment Precursor Transporter (EPP) Family protein | Back alignment and domain information |
|---|
| >PF11717 Tudor-knot: RNA binding activity-knot of a chromodomain ; PDB: 2EKO_A 2RO0_A 2RNZ_A 1WGS_A 3E9G_A 3E9F_A 2K3X_A 2K3Y_A 2EFI_A 2F5K_F | Back alignment and domain information |
|---|
| >PRK10790 putative multidrug transporter membrane\ATP-binding components; Provisional | Back alignment and domain information |
|---|
| >TIGR00150 HI0065_YjeE ATPase, YjeE family | Back alignment and domain information |
|---|
| >cd04129 Rho2 Rho2 subfamily | Back alignment and domain information |
|---|
| >TIGR00017 cmk cytidylate kinase | Back alignment and domain information |
|---|
| >PRK00889 adenylylsulfate kinase; Provisional | Back alignment and domain information |
|---|
| >PRK13949 shikimate kinase; Provisional | Back alignment and domain information |
|---|
| >PRK04296 thymidine kinase; Provisional | Back alignment and domain information |
|---|
| >COG1106 Predicted ATPases [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0056 consensus Heavy metal exporter HMT1, ABC superfamily [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PRK13657 cyclic beta-1,2-glucan ABC transporter; Provisional | Back alignment and domain information |
|---|
| >PRK14974 cell division protein FtsY; Provisional | Back alignment and domain information |
|---|
| >PRK01156 chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >PF13401 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S_B | Back alignment and domain information |
|---|
| >cd01876 YihA_EngB The YihA (EngB) subfamily | Back alignment and domain information |
|---|
| >TIGR01257 rim_protein retinal-specific rim ABC transporter | Back alignment and domain information |
|---|
| >PRK11174 cysteine/glutathione ABC transporter membrane/ATP-binding component; Reviewed | Back alignment and domain information |
|---|
| >TIGR01271 CFTR_protein cystic fibrosis transmembrane conductor regulator (CFTR) | Back alignment and domain information |
|---|
| >PRK10522 multidrug transporter membrane component/ATP-binding component; Provisional | Back alignment and domain information |
|---|
| >KOG3064 consensus RNA-binding nuclear protein (MAK16) containing a distinct C4 Zn-finger [RNA processing and modification] | Back alignment and domain information |
|---|
| >TIGR01194 cyc_pep_trnsptr cyclic peptide transporter | Back alignment and domain information |
|---|
| >PRK14722 flhF flagellar biosynthesis regulator FlhF; Provisional | Back alignment and domain information |
|---|
| >PRK01184 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >cd02020 CMPK Cytidine monophosphate kinase (CMPK) catalyzes the reversible phosphorylation of cytidine monophosphate (CMP) to produce cytidine diphosphate (CDP), using ATP as the preferred phosphoryl donor | Back alignment and domain information |
|---|
| >PLN02796 D-glycerate 3-kinase | Back alignment and domain information |
|---|
| >TIGR02868 CydC thiol reductant ABC exporter, CydC subunit | Back alignment and domain information |
|---|
| >COG4167 SapF ABC-type antimicrobial peptide transport system, ATPase component [Defense mechanisms] | Back alignment and domain information |
|---|
| >TIGR01193 bacteriocin_ABC ABC-type bacteriocin transporter | Back alignment and domain information |
|---|
| >KOG0979 consensus Structural maintenance of chromosome protein SMC5/Spr18, SMC superfamily [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning; Replication, recombination and repair] | Back alignment and domain information |
|---|
| >PRK11160 cysteine/glutathione ABC transporter membrane/ATP-binding component; Reviewed | Back alignment and domain information |
|---|
| >PRK03918 chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >KOG0927 consensus Predicted transporter (ABC superfamily) [General function prediction only] | Back alignment and domain information |
|---|
| >smart00763 AAA_PrkA PrkA AAA domain | Back alignment and domain information |
|---|
| >PLN02165 adenylate isopentenyltransferase | Back alignment and domain information |
|---|
| >TIGR00750 lao LAO/AO transport system ATPase | Back alignment and domain information |
|---|
| >TIGR03375 type_I_sec_LssB type I secretion system ATPase, LssB family | Back alignment and domain information |
|---|
| >TIGR02169 SMC_prok_A chromosome segregation protein SMC, primarily archaeal type | Back alignment and domain information |
|---|
| >cd01129 PulE-GspE PulE/GspE The type II secretory pathway is the main terminal branch of the general secretory pathway (GSP) | Back alignment and domain information |
|---|
| >TIGR01257 rim_protein retinal-specific rim ABC transporter | Back alignment and domain information |
|---|
| >PRK14737 gmk guanylate kinase; Provisional | Back alignment and domain information |
|---|
| >COG4185 Uncharacterized protein conserved in bacteria [Function unknown] | Back alignment and domain information |
|---|
| >cd04159 Arl10_like Arl10-like subfamily | Back alignment and domain information |
|---|
| >KOG1970 consensus Checkpoint RAD17-RFC complex, RAD17/RAD24 component [Cell cycle control, cell division, chromosome partitioning; Replication, recombination and repair] | Back alignment and domain information |
|---|
| >TIGR02858 spore_III_AA stage III sporulation protein AA | Back alignment and domain information |
|---|
| >PRK08533 flagellar accessory protein FlaH; Reviewed | Back alignment and domain information |
|---|
| >TIGR03796 NHPM_micro_ABC1 NHPM bacteriocin system ABC transporter, peptidase/ATP-binding protein | Back alignment and domain information |
|---|
| >PRK04863 mukB cell division protein MukB; Provisional | Back alignment and domain information |
|---|
| >COG0194 Gmk Guanylate kinase [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >cd02027 APSK Adenosine 5'-phosphosulfate kinase (APSK) catalyzes the phosphorylation of adenosine 5'-phosphosulfate to form 3'-phosphoadenosine 5'-phosphosulfate (PAPS) | Back alignment and domain information |
|---|
| >PTZ00243 ABC transporter; Provisional | Back alignment and domain information |
|---|
| >PF04931 DNA_pol_phi: DNA polymerase phi; InterPro: IPR007015 Proteins of this family are predominantly nucleolar | Back alignment and domain information |
|---|
| >PRK02496 adk adenylate kinase; Provisional | Back alignment and domain information |
|---|
| >TIGR00958 3a01208 Conjugate Transporter-2 (CT2) Family protein | Back alignment and domain information |
|---|
| >PHA02530 pseT polynucleotide kinase; Provisional | Back alignment and domain information |
|---|
| >PRK06547 hypothetical protein; Provisional | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 1122 | ||||
| 2o8b_B | 1022 | Human Mutsalpha (Msh2MSH6) BOUND TO ADP AND A G T M | 1e-151 | ||
| 3thw_B | 918 | Human Mutsbeta Complexed With An Idl Of 4 Bases (Lo | 1e-60 | ||
| 1wbb_A | 800 | Crystal Structure Of E. Coli Dna Mismatch Repair En | 6e-34 | ||
| 1wbd_A | 800 | Crystal Structure Of E. Coli Dna Mismatch Repair En | 7e-34 | ||
| 3k0s_A | 799 | Crystal Structure Of E.Coli Dna Mismatch Repair Pro | 7e-34 | ||
| 1ng9_A | 800 | E.Coli Muts R697a: An Atpase-Asymmetry Mutant Lengt | 7e-34 | ||
| 1wb9_A | 800 | Crystal Structure Of E. Coli Dna Mismatch Repair En | 7e-34 | ||
| 1oh5_A | 800 | The Crystal Structure Of E. Coli Muts Binding To Dn | 7e-34 | ||
| 1nne_A | 765 | Crystal Structure Of The Muts-adpbef3-dna Complex L | 1e-30 | ||
| 1e3m_A | 800 | The Crystal Structure Of E. Coli Muts Binding To Dn | 3e-30 | ||
| 2o8e_A | 934 | Human Mutsalpha (Msh2MSH6) BOUND TO A G T MISPAIR, | 1e-29 | ||
| 2o8b_A | 934 | Human Mutsalpha (Msh2MSH6) BOUND TO ADP AND A G T M | 1e-29 | ||
| 1ewr_A | 649 | Crystal Structure Of Taq Muts Length = 649 | 4e-28 | ||
| 1ewq_A | 765 | Crystal Structure Taq Muts Complexed With A Heterod | 6e-28 | ||
| 1fw6_A | 768 | Crystal Structure Of A Taq Muts-Dna-Adp Ternary Com | 6e-28 |
| >pdb|2O8B|B Chain B, Human Mutsalpha (Msh2MSH6) BOUND TO ADP AND A G T MISPAIR Length = 1022 | Back alignment and structure |
|
| >pdb|3THW|B Chain B, Human Mutsbeta Complexed With An Idl Of 4 Bases (Loop4) And Adp Length = 918 | Back alignment and structure |
| >pdb|1WBB|A Chain A, Crystal Structure Of E. Coli Dna Mismatch Repair Enzyme Muts, E38a Mutant, In Complex With A G.T Mismatch Length = 800 | Back alignment and structure |
| >pdb|1WBD|A Chain A, Crystal Structure Of E. Coli Dna Mismatch Repair Enzyme Muts, E38q Mutant, In Complex With A G.T Mismatch Length = 800 | Back alignment and structure |
| >pdb|3K0S|A Chain A, Crystal Structure Of E.Coli Dna Mismatch Repair Protein Muts, D693n Mutant, In Complex With Gt Mismatched Dna Length = 799 | Back alignment and structure |
| >pdb|1NG9|A Chain A, E.Coli Muts R697a: An Atpase-Asymmetry Mutant Length = 800 | Back alignment and structure |
| >pdb|1WB9|A Chain A, Crystal Structure Of E. Coli Dna Mismatch Repair Enzyme Muts, E38t Mutant, In Complex With A G.T Mismatch Length = 800 | Back alignment and structure |
| >pdb|1OH5|A Chain A, The Crystal Structure Of E. Coli Muts Binding To Dna With A C:a Mismatch Length = 800 | Back alignment and structure |
| >pdb|1NNE|A Chain A, Crystal Structure Of The Muts-adpbef3-dna Complex Length = 765 | Back alignment and structure |
| >pdb|1E3M|A Chain A, The Crystal Structure Of E. Coli Muts Binding To Dna With A G:t Mismatch Length = 800 | Back alignment and structure |
| >pdb|2O8E|A Chain A, Human Mutsalpha (Msh2MSH6) BOUND TO A G T MISPAIR, WITH ADP BOUND TO Msh2 Only Length = 934 | Back alignment and structure |
| >pdb|2O8B|A Chain A, Human Mutsalpha (Msh2MSH6) BOUND TO ADP AND A G T MISPAIR Length = 934 | Back alignment and structure |
| >pdb|1EWR|A Chain A, Crystal Structure Of Taq Muts Length = 649 | Back alignment and structure |
| >pdb|1EWQ|A Chain A, Crystal Structure Taq Muts Complexed With A Heteroduplex Dna At 2.2 A Resolution Length = 765 | Back alignment and structure |
| >pdb|1FW6|A Chain A, Crystal Structure Of A Taq Muts-Dna-Adp Ternary Complex Length = 768 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 1122 | |||
| 2o8b_B | 1022 | DNA mismatch repair protein MSH6; DNA damage respo | 0.0 | |
| 3thx_B | 918 | DNA mismatch repair protein MSH3; ABC family ATPas | 1e-161 | |
| 3thx_A | 934 | DNA mismatch repair protein MSH2; ABC family ATPas | 1e-113 | |
| 1wb9_A | 800 | DNA mismatch repair protein MUTS; DNA-binding, ATP | 9e-58 | |
| 1wb9_A | 800 | DNA mismatch repair protein MUTS; DNA-binding, ATP | 8e-41 | |
| 1ewq_A | 765 | DNA mismatch repair protein MUTS; multiple domains | 4e-56 | |
| 1ewq_A | 765 | DNA mismatch repair protein MUTS; multiple domains | 2e-40 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 2e-12 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 5e-10 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 4e-04 | |
| 1twf_A | 1733 | B220, DNA-directed RNA polymerase II largest subun | 8e-07 | |
| 1twf_A | 1733 | B220, DNA-directed RNA polymerase II largest subun | 1e-05 | |
| 1twf_A | 1733 | B220, DNA-directed RNA polymerase II largest subun | 4e-05 | |
| 1twf_A | 1733 | B220, DNA-directed RNA polymerase II largest subun | 2e-04 | |
| 1twf_A | 1733 | B220, DNA-directed RNA polymerase II largest subun | 4e-04 | |
| 1twf_A | 1733 | B220, DNA-directed RNA polymerase II largest subun | 8e-04 | |
| 3h0g_A | 1752 | DNA-directed RNA polymerase II subunit RPB1; trans | 1e-05 | |
| 3h0g_A | 1752 | DNA-directed RNA polymerase II subunit RPB1; trans | 5e-05 | |
| 3h0g_A | 1752 | DNA-directed RNA polymerase II subunit RPB1; trans | 2e-04 | |
| 3h0g_A | 1752 | DNA-directed RNA polymerase II subunit RPB1; trans | 3e-04 | |
| 3h0g_A | 1752 | DNA-directed RNA polymerase II subunit RPB1; trans | 4e-04 | |
| 3h0g_A | 1752 | DNA-directed RNA polymerase II subunit RPB1; trans | 6e-04 | |
| 3h0g_A | 1752 | DNA-directed RNA polymerase II subunit RPB1; trans | 6e-04 | |
| 3h0g_A | 1752 | DNA-directed RNA polymerase II subunit RPB1; trans | 9e-04 |
| >2o8b_B DNA mismatch repair protein MSH6; DNA damage response, somatic hypermutat protein-DNA complex, DNA mispair, cancer; HET: DNA ADP; 2.75A {Homo sapiens} PDB: 2o8c_B* 2o8d_B* 2o8e_B* 2o8f_B* Length = 1022 | Back alignment and structure |
|---|
Score = 836 bits (2161), Expect = 0.0
Identities = 313/856 (36%), Positives = 463/856 (54%), Gaps = 42/856 (4%)
Query: 278 GDVSERFSAREADKFHFLGPD-RRDAKRRRPGDVYYDPRTLYLPPDFLRNLSEGQKQWWE 336
GD S R + + +L + RRD RRRP +D TLY+P DFL + + G ++WW+
Sbjct: 18 GDDSSRPTVWYHETLEWLKEEKRRDEHRRRPDHPDFDASTLYVPEDFLNSCTPGMRKWWQ 77
Query: 337 FKSKHMDKVIFFKMGKFYELFEMDAHVGAKELDLQYMKGEQPHCGFPERNFSMNVEKLAR 396
KS++ D VI +K+GKFYEL+ MDA +G EL L +MKG H GFPE F + L +
Sbjct: 78 IKSQNFDLVICYKVGKFYELYHMDALIGVSELGLVFMKGNWAHSGFPEIAFGRYSDSLVQ 137
Query: 397 KGYRVLVVEQTETPEQLELRRKEKGS---KDKVVKREICAVVTKGTLTEGELLSANPDAS 453
KGY+V VEQTETPE +E R ++ D+VV+REIC ++TKGT T L + +
Sbjct: 138 KGYKVARVEQTETPEMMEARCRKMAHISKYDRVVRREICRIITKGTQTYSVLEGDPSE-N 196
Query: 454 YLMAL-TESNQSPASQSTDRCFGICVVDVATSRIILGQVMDDLDCSVLCCLLSELRPVEI 512
Y L + + S R +G+C VD + + +GQ DD CS L++ PV++
Sbjct: 197 YSKYLLSLKEKEEDSSGHTRAYGVCFVDTSLGKFFIGQFSDDRHCSRFRTLVAHYPPVQV 256
Query: 513 IKPANMLSPETERAILRHTRNPLVNDLVPLSEFWDAETTVLEIKNIYNRITAESLNKADS 572
+ LS ET+ + L L+P S+FWDA T+ + E + S
Sbjct: 257 LFEKGNLSKETKTILKSSLSCSLQEGLIPGSQFWDASKTLRTLLE------EEYFREKLS 310
Query: 573 NVANSQAEGDGLTCLPGILSELISTGDSGSQVLSALGGTLFYLKKSFLDETLLRFAKFEL 632
+ S ++ G+ LSALGG +FYLKK +D+ LL A FE
Sbjct: 311 DGIGVMLPQVLKGMTSESDSIGLTPGEKSELALSALGGCVFYLKKCLIDQELLSMANFEE 370
Query: 633 LPCSGFGDMAKKP----------YMVLDAPALENLEVFENSRSGDSSGTLYAQLNHCVTA 682
++ MVLDA L NLE+F N +G + GTL +++ C T
Sbjct: 371 YIPLDSDTVSTTRSGAIFTKAYQRMVLDAVTLNNLEIFLNGTNGSTEGTLLERVDTCHTP 430
Query: 683 FGKRLLRTWLARPLYNSGLIRERQDAVAGLRGVNQPFALEFRKALSRLPDMERLLARLFA 742
FGKRLL+ WL PL N I +R DA+ L E + L +LPD+ERLL+++
Sbjct: 431 FGKRLLKQWLCAPLCNHYAINDRLDAIEDLMV-VPDKISEVVELLKKLPDLERLLSKIHN 489
Query: 743 SSEA---NGRNSNKVVLYEDAA--KKQLQEFISALHGCELMDQACSSLGAILENTESRQL 797
++ ++YE+ KK++ +F+SAL G ++M + + + + +S+ L
Sbjct: 490 VGSPLKSQNHPDSRAIMYEETTYSKKKIIDFLSALEGFKVMCKIIGIMEEVADGFKSKIL 549
Query: 798 HHILT-----PGKGLPAIVSILKHFKDAFDWVEANNSGRIIPHGGVDMDYDSACKKVKEI 852
+++ P P + L + AFD +A +G I P G D DYD A ++E
Sbjct: 550 KQVISLQTKNPEGRFPDLTVELNRWDTAFDHEKARKTGLITPKAGFDSDYDQALADIREN 609
Query: 853 EASLTKHLKEQRKLLGDTSITYVTIGKDLYLLEVPESLRG-SVPRDYELRSSKKGFFRYW 911
E SL ++L++QR +G +I Y IG++ Y LE+PE+ ++P +YEL+S+KKG RYW
Sbjct: 610 EQSLLEYLEKQRNRIGCRTIVYWGIGRNRYQLEIPENFTTRNLPEEYELKSTKKGCKRYW 669
Query: 912 TPNIKKLLGELSQAESEKESALKSILQRLIGQFCEHHNKWRQMVAATAELDALISLAIAS 971
T I+K L L AE ++ +LK ++RL F +++ W+ V A LD L+ LA S
Sbjct: 670 TKTIEKKLANLINAEERRDVSLKDCMRRLFYNFDKNYKDWQSAVECIAVLDVLLCLANYS 729
Query: 972 DFYEGPTCRPVILDSCSNEEPYISAKSLGHPVLRSDSLGKGEFVPNDITIGG------HG 1025
+GP CRPVIL + P++ K HP + + + +F+PNDI IG +G
Sbjct: 730 RGGDGPMCRPVILLP-EDTPPFLELKGSRHPCI-TKTFFGDDFIPNDILIGCEEEEQENG 787
Query: 1026 NASFILLTGPNMGGKSTLLRQVCLAVILAQVGADVPAEIFEISPVDRIFVRMGAKDHIMA 1085
A +L+TGPNMGGKSTL+RQ L ++AQ+G VPAE+ ++P+DR+F R+GA D IM+
Sbjct: 788 KAYCVLVTGPNMGGKSTLMRQAGLLAVMAQMGCYVPAEVCRLTPIDRVFTRLGASDRIMS 847
Query: 1086 GQSTFLTELSETALML 1101
G+STF ELSETA +L
Sbjct: 848 GESTFFVELSETASIL 863
|
| >3thx_B DNA mismatch repair protein MSH3; ABC family ATPase, mismatch recognition, mismatched unpaired DNA binding protein-DNA complex; HET: DNA ADP; 2.70A {Homo sapiens} PDB: 3thw_B* 3thy_B* 3thz_B* Length = 918 | Back alignment and structure |
|---|
| >3thx_A DNA mismatch repair protein MSH2; ABC family ATPase, mismatch recognition, mismatched unpaired DNA binding protein-DNA complex; HET: DNA ADP; 2.70A {Homo sapiens} PDB: 2o8c_A* 2o8d_A* 2o8f_A* 3thw_A* 2o8b_A* 3thy_A* 3thz_A* 2o8e_A* Length = 934 | Back alignment and structure |
|---|
| >1wb9_A DNA mismatch repair protein MUTS; DNA-binding, ATP-binding, DNA binding, DNA repair, mismatch recognition; HET: DNA ADP; 2.10A {Escherichia coli} SCOP: a.113.1.1 c.37.1.12 c.55.6.1 d.75.2.1 PDB: 1wbb_A* 1e3m_A* 1oh5_A* 1oh6_A* 1oh7_A* 1oh8_A* 1w7a_A* 2wtu_A* 1wbd_A* 1ng9_A* 3k0s_A* Length = 800 | Back alignment and structure |
|---|
| >1wb9_A DNA mismatch repair protein MUTS; DNA-binding, ATP-binding, DNA binding, DNA repair, mismatch recognition; HET: DNA ADP; 2.10A {Escherichia coli} SCOP: a.113.1.1 c.37.1.12 c.55.6.1 d.75.2.1 PDB: 1wbb_A* 1e3m_A* 1oh5_A* 1oh6_A* 1oh7_A* 1oh8_A* 1w7a_A* 2wtu_A* 1wbd_A* 1ng9_A* 3k0s_A* Length = 800 | Back alignment and structure |
|---|
| >1ewq_A DNA mismatch repair protein MUTS; multiple domains of protein, mostly mixed alpha-beta structures, one domain is entirely helical; HET: DNA; 2.20A {Thermus aquaticus} SCOP: a.113.1.1 c.37.1.12 c.55.6.1 d.75.2.1 PDB: 1nne_A* 1fw6_A* 1ewr_A* Length = 765 | Back alignment and structure |
|---|
| >1ewq_A DNA mismatch repair protein MUTS; multiple domains of protein, mostly mixed alpha-beta structures, one domain is entirely helical; HET: DNA; 2.20A {Thermus aquaticus} SCOP: a.113.1.1 c.37.1.12 c.55.6.1 d.75.2.1 PDB: 1nne_A* 1fw6_A* 1ewr_A* Length = 765 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1twf_A B220, DNA-directed RNA polymerase II largest subunit; transcription, mRNA, multiprotein complex; HET: UTP; 2.30A {Saccharomyces cerevisiae} SCOP: e.29.1.2 PDB: 1i3q_A 1i6h_A 1k83_A* 1nik_A 1nt9_A 1pqv_A 1r5u_A 1r9s_A* 1r9t_A* 1sfo_A* 1twa_A* 1twc_A* 1i50_A* 1twg_A* 1twh_A* 1wcm_A 1y1v_A 1y1w_A 1y1y_A 1y77_A* ... Length = 1733 | Back alignment and structure |
|---|
| >1twf_A B220, DNA-directed RNA polymerase II largest subunit; transcription, mRNA, multiprotein complex; HET: UTP; 2.30A {Saccharomyces cerevisiae} SCOP: e.29.1.2 PDB: 1i3q_A 1i6h_A 1k83_A* 1nik_A 1nt9_A 1pqv_A 1r5u_A 1r9s_A* 1r9t_A* 1sfo_A* 1twa_A* 1twc_A* 1i50_A* 1twg_A* 1twh_A* 1wcm_A 1y1v_A 1y1w_A 1y1y_A 1y77_A* ... Length = 1733 | Back alignment and structure |
|---|
| >1twf_A B220, DNA-directed RNA polymerase II largest subunit; transcription, mRNA, multiprotein complex; HET: UTP; 2.30A {Saccharomyces cerevisiae} SCOP: e.29.1.2 PDB: 1i3q_A 1i6h_A 1k83_A* 1nik_A 1nt9_A 1pqv_A 1r5u_A 1r9s_A* 1r9t_A* 1sfo_A* 1twa_A* 1twc_A* 1i50_A* 1twg_A* 1twh_A* 1wcm_A 1y1v_A 1y1w_A 1y1y_A 1y77_A* ... Length = 1733 | Back alignment and structure |
|---|
| >1twf_A B220, DNA-directed RNA polymerase II largest subunit; transcription, mRNA, multiprotein complex; HET: UTP; 2.30A {Saccharomyces cerevisiae} SCOP: e.29.1.2 PDB: 1i3q_A 1i6h_A 1k83_A* 1nik_A 1nt9_A 1pqv_A 1r5u_A 1r9s_A* 1r9t_A* 1sfo_A* 1twa_A* 1twc_A* 1i50_A* 1twg_A* 1twh_A* 1wcm_A 1y1v_A 1y1w_A 1y1y_A 1y77_A* ... Length = 1733 | Back alignment and structure |
|---|
| >1twf_A B220, DNA-directed RNA polymerase II largest subunit; transcription, mRNA, multiprotein complex; HET: UTP; 2.30A {Saccharomyces cerevisiae} SCOP: e.29.1.2 PDB: 1i3q_A 1i6h_A 1k83_A* 1nik_A 1nt9_A 1pqv_A 1r5u_A 1r9s_A* 1r9t_A* 1sfo_A* 1twa_A* 1twc_A* 1i50_A* 1twg_A* 1twh_A* 1wcm_A 1y1v_A 1y1w_A 1y1y_A 1y77_A* ... Length = 1733 | Back alignment and structure |
|---|
| >1twf_A B220, DNA-directed RNA polymerase II largest subunit; transcription, mRNA, multiprotein complex; HET: UTP; 2.30A {Saccharomyces cerevisiae} SCOP: e.29.1.2 PDB: 1i3q_A 1i6h_A 1k83_A* 1nik_A 1nt9_A 1pqv_A 1r5u_A 1r9s_A* 1r9t_A* 1sfo_A* 1twa_A* 1twc_A* 1i50_A* 1twg_A* 1twh_A* 1wcm_A 1y1v_A 1y1w_A 1y1y_A 1y77_A* ... Length = 1733 | Back alignment and structure |
|---|
| >3h0g_A DNA-directed RNA polymerase II subunit RPB1; transcription, multi-protein complex, DNA- binding, magnesium; 3.65A {Schizosaccharomyces pombe} Length = 1752 | Back alignment and structure |
|---|
| >3h0g_A DNA-directed RNA polymerase II subunit RPB1; transcription, multi-protein complex, DNA- binding, magnesium; 3.65A {Schizosaccharomyces pombe} Length = 1752 | Back alignment and structure |
|---|
| >3h0g_A DNA-directed RNA polymerase II subunit RPB1; transcription, multi-protein complex, DNA- binding, magnesium; 3.65A {Schizosaccharomyces pombe} Length = 1752 | Back alignment and structure |
|---|
| >3h0g_A DNA-directed RNA polymerase II subunit RPB1; transcription, multi-protein complex, DNA- binding, magnesium; 3.65A {Schizosaccharomyces pombe} Length = 1752 | Back alignment and structure |
|---|
| >3h0g_A DNA-directed RNA polymerase II subunit RPB1; transcription, multi-protein complex, DNA- binding, magnesium; 3.65A {Schizosaccharomyces pombe} Length = 1752 | Back alignment and structure |
|---|
| >3h0g_A DNA-directed RNA polymerase II subunit RPB1; transcription, multi-protein complex, DNA- binding, magnesium; 3.65A {Schizosaccharomyces pombe} Length = 1752 | Back alignment and structure |
|---|
| >3h0g_A DNA-directed RNA polymerase II subunit RPB1; transcription, multi-protein complex, DNA- binding, magnesium; 3.65A {Schizosaccharomyces pombe} Length = 1752 | Back alignment and structure |
|---|
| >3h0g_A DNA-directed RNA polymerase II subunit RPB1; transcription, multi-protein complex, DNA- binding, magnesium; 3.65A {Schizosaccharomyces pombe} Length = 1752 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 1122 | |||
| 2o8b_B | 1022 | DNA mismatch repair protein MSH6; DNA damage respo | 100.0 | |
| 3thx_B | 918 | DNA mismatch repair protein MSH3; ABC family ATPas | 100.0 | |
| 1wb9_A | 800 | DNA mismatch repair protein MUTS; DNA-binding, ATP | 100.0 | |
| 1ewq_A | 765 | DNA mismatch repair protein MUTS; multiple domains | 100.0 | |
| 3thx_A | 934 | DNA mismatch repair protein MSH2; ABC family ATPas | 100.0 | |
| 2l8d_A | 66 | Lamin-B receptor; DNA binding protein; NMR {Gallus | 97.47 | |
| 2dig_A | 68 | Lamin-B receptor; tudor domain, integral nuclear e | 97.44 | |
| 2g3r_A | 123 | Tumor suppressor P53-binding protein 1; tandem tud | 97.18 | |
| 3p8d_A | 67 | Medulloblastoma antigen MU-MB-50.72; tudor domain, | 97.16 | |
| 2equ_A | 74 | PHD finger protein 20-like 1; tudor domain, struct | 97.01 | |
| 3qii_A | 85 | PHD finger protein 20; tudor domain, structural ge | 96.96 | |
| 1mhn_A | 59 | SurviVal motor neuron protein; SMN, SMA, spinal mu | 96.77 | |
| 2eqj_A | 66 | Metal-response element-binding transcription facto | 96.64 | |
| 1ssf_A | 156 | Transformation related protein 53 binding protein | 96.64 | |
| 2ldm_A | 81 | Uncharacterized protein; PHF20, tudor domain, epig | 95.56 | |
| 4a4f_A | 64 | SurviVal of motor neuron-related-splicing factor; | 96.3 | |
| 3s6w_A | 54 | Tudor domain-containing protein 3; methylated argi | 96.22 | |
| 1znw_A | 207 | Guanylate kinase, GMP kinase; ATP:GMP-phosphotrans | 96.14 | |
| 1g5v_A | 88 | SurviVal motor neuron protein 1; mRNA processing, | 96.13 | |
| 3tif_A | 235 | Uncharacterized ABC transporter ATP-binding prote; | 95.86 | |
| 2pcj_A | 224 | ABC transporter, lipoprotein-releasing system ATP- | 95.85 | |
| 3tr0_A | 205 | Guanylate kinase, GMP kinase; purines, pyrimidines | 95.75 | |
| 3a00_A | 186 | Guanylate kinase, GMP kinase; domain movement, dim | 95.69 | |
| 2m0o_A | 79 | PHD finger protein 1; tudor domain, H3K36ME3 bindi | 95.68 | |
| 2d9t_A | 78 | Tudor domain-containing protein 3; structural geno | 95.68 | |
| 1ye8_A | 178 | Protein THEP1, hypothetical UPF0334 kinase-like pr | 95.6 | |
| 2olj_A | 263 | Amino acid ABC transporter; ABC domain, ATPase, hy | 95.59 | |
| 1vpl_A | 256 | ABC transporter, ATP-binding protein; TM0544, stru | 95.59 | |
| 2onk_A | 240 | Molybdate/tungstate ABC transporter, ATP-binding p | 95.58 | |
| 1b0u_A | 262 | Histidine permease; ABC transporter, transport pro | 95.57 | |
| 1sgw_A | 214 | Putative ABC transporter; structural genomics, P p | 95.57 | |
| 1ji0_A | 240 | ABC transporter; ATP binding protein, structural g | 95.54 | |
| 2zu0_C | 267 | Probable ATP-dependent transporter SUFC; iron-sulf | 95.53 | |
| 2cbz_A | 237 | Multidrug resistance-associated protein 1; ABC pro | 95.52 | |
| 3gfo_A | 275 | Cobalt import ATP-binding protein CBIO 1; structur | 95.5 | |
| 2qi9_C | 249 | Vitamin B12 import ATP-binding protein BTUD; inner | 95.49 | |
| 2jeo_A | 245 | Uridine-cytidine kinase 1; UCK, transferase, ATP-b | 95.47 | |
| 2yz2_A | 266 | Putative ABC transporter ATP-binding protein TM_0; | 95.47 | |
| 1htw_A | 158 | HI0065; nucleotide-binding fold, structural genomi | 95.47 | |
| 2d2e_A | 250 | SUFC protein; ABC-ATPase, SUF protein, 310-helix, | 95.47 | |
| 2pze_A | 229 | Cystic fibrosis transmembrane conductance regulat; | 95.46 | |
| 1mv5_A | 243 | LMRA, multidrug resistance ABC transporter ATP-bin | 95.44 | |
| 2ehv_A | 251 | Hypothetical protein PH0186; KAIC, RECA ATPase, un | 95.41 | |
| 4gp7_A | 171 | Metallophosphoesterase; polynucleotide kinase phos | 95.41 | |
| 1g6h_A | 257 | High-affinity branched-chain amino acid transport | 95.38 | |
| 1zp6_A | 191 | Hypothetical protein ATU3015; alpha-beta protein., | 95.36 | |
| 2ixe_A | 271 | Antigen peptide transporter 1; ABC ATPase, hydrola | 95.36 | |
| 2ff7_A | 247 | Alpha-hemolysin translocation ATP-binding protein | 95.36 | |
| 2ihy_A | 279 | ABC transporter, ATP-binding protein; ATPase, ABC | 95.35 | |
| 3kta_A | 182 | Chromosome segregation protein SMC; structural mai | 95.33 | |
| 2nq2_C | 253 | Hypothetical ABC transporter ATP-binding protein H | 95.3 | |
| 3pnw_C | 77 | Tudor domain-containing protein 3; FAB, structural | 95.28 | |
| 4g1u_C | 266 | Hemin import ATP-binding protein HMUV; membrane tr | 95.28 | |
| 3fvq_A | 359 | Fe(3+) IONS import ATP-binding protein FBPC; nucle | 95.25 | |
| 2ghi_A | 260 | Transport protein; multidrug resistance protein, M | 95.14 | |
| 3asz_A | 211 | Uridine kinase; cytidine phosphorylation, transfer | 95.09 | |
| 2bdt_A | 189 | BH3686; alpha-beta protein, structural genomics, P | 95.07 | |
| 2pjz_A | 263 | Hypothetical protein ST1066; ATP binding protein, | 95.03 | |
| 1z6g_A | 218 | Guanylate kinase; structural genomics, SGC, struct | 95.02 | |
| 1s96_A | 219 | Guanylate kinase, GMP kinase; E.coli, dimer, SAD, | 95.01 | |
| 3b85_A | 208 | Phosphate starvation-inducible protein; PHOH2, ATP | 94.98 | |
| 2bbs_A | 290 | Cystic fibrosis transmembrane conductance regulato | 94.98 | |
| 3lnc_A | 231 | Guanylate kinase, GMP kinase; ALS collaborative cr | 94.97 | |
| 4hcz_A | 58 | PHD finger protein 1; protein-peptide complex, tud | 94.97 | |
| 2yyz_A | 359 | Sugar ABC transporter, ATP-binding protein; sugar | 94.95 | |
| 4eun_A | 200 | Thermoresistant glucokinase; putative sugar kinase | 94.91 | |
| 1lvg_A | 198 | Guanylate kinase, GMP kinase; transferase; HET: AD | 94.9 | |
| 1z47_A | 355 | CYSA, putative ABC-transporter ATP-binding protein | 94.88 | |
| 3d31_A | 348 | Sulfate/molybdate ABC transporter, ATP-binding pro | 94.87 | |
| 2it1_A | 362 | 362AA long hypothetical maltose/maltodextrin trans | 94.87 | |
| 1v43_A | 372 | Sugar-binding transport ATP-binding protein; ATPas | 94.86 | |
| 3rlf_A | 381 | Maltose/maltodextrin import ATP-binding protein M; | 94.85 | |
| 1f2t_A | 149 | RAD50 ABC-ATPase; DNA double-strand break repair, | 94.84 | |
| 4a74_A | 231 | DNA repair and recombination protein RADA; hydrola | 94.77 | |
| 3c8u_A | 208 | Fructokinase; YP_612366.1, putative fructose trans | 94.76 | |
| 3tui_C | 366 | Methionine import ATP-binding protein METN; ABC-tr | 94.67 | |
| 1g29_1 | 372 | MALK, maltose transport protein MALK; ATPase, acti | 94.65 | |
| 1kag_A | 173 | SKI, shikimate kinase I; transferase, structural g | 94.63 | |
| 1kgd_A | 180 | CASK, peripheral plasma membrane CASK; maguk, guan | 94.62 | |
| 1oxx_K | 353 | GLCV, glucose, ABC transporter, ATP binding protei | 94.6 | |
| 2eyu_A | 261 | Twitching motility protein PILT; pilus retraction | 94.42 | |
| 2w0m_A | 235 | SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus | 94.4 | |
| 3gd7_A | 390 | Fusion complex of cystic fibrosis transmembrane co | 94.3 | |
| 2j41_A | 207 | Guanylate kinase; GMP, GMK, transferase, ATP-bindi | 94.27 | |
| 2i3b_A | 189 | HCR-ntpase, human cancer-related ntpase; AAA, ross | 94.23 | |
| 3qks_A | 203 | DNA double-strand break repair RAD50 ATPase; RECA- | 94.22 | |
| 1knq_A | 175 | Gluconate kinase; ALFA/beta structure, transferase | 94.21 | |
| 3tau_A | 208 | Guanylate kinase, GMP kinase; structural genomics, | 94.11 | |
| 2bbw_A | 246 | Adenylate kinase 4, AK4; nucleotide kinase, nucleo | 94.06 | |
| 2xk0_A | 69 | Polycomb protein PCL; transcription, aromatic CAGE | 94.03 | |
| 3qf7_A | 365 | RAD50; ABC-ATPase, ATPase, hydrolase; HET: ANP; 1. | 94.03 | |
| 1nlf_A | 279 | Regulatory protein REPA; replicative DNA helicase | 94.01 | |
| 3ec2_A | 180 | DNA replication protein DNAC; helicase loader, rep | 93.98 | |
| 1tf7_A | 525 | KAIC; homohexamer, hexamer, circadian clock protei | 93.93 | |
| 3uie_A | 200 | Adenylyl-sulfate kinase 1, chloroplastic; rossmann | 93.83 | |
| 3aez_A | 312 | Pantothenate kinase; transferase, homodimer, COA b | 93.76 | |
| 1nij_A | 318 | Hypothetical protein YJIA; structural genomics, P- | 93.72 | |
| 3jvv_A | 356 | Twitching mobility protein; hexameric P-loop ATPas | 93.55 | |
| 1sq5_A | 308 | Pantothenate kinase; P-loop, transferase; HET: PAU | 93.48 | |
| 3nh6_A | 306 | ATP-binding cassette SUB-family B member 6, mitoc; | 93.42 | |
| 1cr0_A | 296 | DNA primase/helicase; RECA-type protein fold, tran | 93.42 | |
| 2if2_A | 204 | Dephospho-COA kinase; alpha-beta protein, structur | 93.23 | |
| 4aby_A | 415 | DNA repair protein RECN; hydrolase, double strand | 93.23 | |
| 1p9r_A | 418 | General secretion pathway protein E; bacterial typ | 93.2 | |
| 2v9p_A | 305 | Replication protein E1; AAA+ molecular motor, DNA | 93.12 | |
| 1jjv_A | 206 | Dephospho-COA kinase; P-loop nucleotide-binding fo | 93.09 | |
| 3ozx_A | 538 | RNAse L inhibitor; ATP binding cassette protein, h | 92.79 | |
| 1rz3_A | 201 | Hypothetical protein rbstp0775; MCSG, structural g | 92.79 | |
| 2kjq_A | 149 | DNAA-related protein; solution structure, NESG, st | 92.75 | |
| 3auy_A | 371 | DNA double-strand break repair RAD50 ATPase; DNA r | 92.72 | |
| 3fdr_A | 94 | Tudor and KH domain-containing protein; TDRD2, str | 92.64 | |
| 3euj_A | 483 | Chromosome partition protein MUKB, linker; MUKB, M | 92.64 | |
| 3vaa_A | 199 | Shikimate kinase, SK; structural genomics, center | 92.58 | |
| 2e5p_A | 68 | Protein PHF1, PHD finger protein 1; tudor domain, | 92.54 | |
| 3sop_A | 270 | Neuronal-specific septin-3; hydrolase; HET: GDP; 2 | 92.48 | |
| 3qkt_A | 339 | DNA double-strand break repair RAD50 ATPase; RECA- | 92.46 | |
| 2yhs_A | 503 | FTSY, cell division protein FTSY; cell cycle, prot | 92.34 | |
| 3t61_A | 202 | Gluconokinase; PSI-biology, structural genomics, p | 92.34 | |
| 2pez_A | 179 | Bifunctional 3'-phosphoadenosine 5'- phosphosulfat | 92.3 | |
| 4e22_A | 252 | Cytidylate kinase; P-loop, CMP/ATP binding, transf | 92.3 | |
| 1n0w_A | 243 | DNA repair protein RAD51 homolog 1; DNA repair, ho | 92.23 | |
| 2iw3_A | 986 | Elongation factor 3A; acetylation, ATP-binding, pr | 92.18 | |
| 3b9q_A | 302 | Chloroplast SRP receptor homolog, alpha subunit CP | 92.14 | |
| 3ney_A | 197 | 55 kDa erythrocyte membrane protein; structural ge | 92.08 | |
| 1yqt_A | 538 | RNAse L inhibitor; ATP-binding cassette, ribosome | 92.06 | |
| 2eqk_A | 85 | Tudor domain-containing protein 4; structural geno | 92.0 | |
| 2ewv_A | 372 | Twitching motility protein PILT; pilus retraction | 91.97 | |
| 2e5q_A | 63 | PHD finger protein 19; tudor domain, isoform B, st | 91.91 | |
| 2gza_A | 361 | Type IV secretion system protein VIRB11; ATPase, h | 91.89 | |
| 2cvh_A | 220 | DNA repair and recombination protein RADB; filamen | 91.88 | |
| 2npi_A | 460 | Protein CLP1; CLP1-PCF11 complex, ATP binding, ter | 91.82 | |
| 2pt7_A | 330 | CAG-ALFA; ATPase, protein-protein complex, type IV | 91.76 | |
| 1cke_A | 227 | CK, MSSA, protein (cytidine monophosphate kinase); | 91.72 | |
| 1e69_A | 322 | Chromosome segregation SMC protein; structural mai | 91.64 | |
| 2o5v_A | 359 | DNA replication and repair protein RECF; ABC ATPas | 91.61 | |
| 2vp4_A | 230 | Deoxynucleoside kinase; ATP-binding, DNA synthesis | 91.56 | |
| 3bk7_A | 607 | ABC transporter ATP-binding protein; ABC ATPase, i | 91.53 | |
| 1rj9_A | 304 | FTSY, signal recognition protein; SRP-GTPase domai | 91.51 | |
| 3e70_C | 328 | DPA, signal recognition particle receptor; FTSY, S | 91.44 | |
| 1w1w_A | 430 | Structural maintenance of chromosome 1; cohesin, c | 91.44 | |
| 1lw7_A | 365 | Transcriptional regulator NADR; NMN, NMN adenylyl | 91.41 | |
| 2og2_A | 359 | Putative signal recognition particle receptor; nuc | 91.38 | |
| 1yqt_A | 538 | RNAse L inhibitor; ATP-binding cassette, ribosome | 91.33 | |
| 3j16_B | 608 | RLI1P; ribosome recycling, translation, eukarya, r | 91.17 | |
| 3tqc_A | 321 | Pantothenate kinase; biosynthesis of cofactors, pr | 91.15 | |
| 2dr3_A | 247 | UPF0273 protein PH0284; RECA superfamily ATPase, h | 91.02 | |
| 3bk7_A | 607 | ABC transporter ATP-binding protein; ABC ATPase, i | 90.86 | |
| 2qt1_A | 207 | Nicotinamide riboside kinase 1; non-protein kinase | 90.81 | |
| 2x8a_A | 274 | Nuclear valosin-containing protein-like; nuclear p | 90.74 | |
| 2qor_A | 204 | Guanylate kinase; phosphotransferase, purine metab | 90.61 | |
| 2oap_1 | 511 | GSPE-2, type II secretion system protein; hexameri | 90.58 | |
| 1pzn_A | 349 | RAD51, DNA repair and recombination protein RAD51, | 90.56 | |
| 3cm0_A | 186 | Adenylate kinase; ATP-binding, cytoplasm, nucleoti | 90.48 | |
| 3ozx_A | 538 | RNAse L inhibitor; ATP binding cassette protein, h | 90.4 | |
| 2ze6_A | 253 | Isopentenyl transferase; crown GALL tumor, cytokin | 90.38 | |
| 2qm8_A | 337 | GTPase/ATPase; G protein, G3E, metallochaperone, c | 90.32 | |
| 3b5x_A | 582 | Lipid A export ATP-binding/permease protein MSBA; | 90.23 | |
| 2diq_A | 110 | Tudor and KH domain-containing protein; tudor doma | 90.22 | |
| 1qhl_A | 227 | Protein (cell division protein MUKB); SMC, chromos | 90.22 | |
| 3j16_B | 608 | RLI1P; ribosome recycling, translation, eukarya, r | 90.17 | |
| 3kb2_A | 173 | SPBC2 prophage-derived uncharacterized protein YOR | 90.07 | |
| 1ly1_A | 181 | Polynucleotide kinase; PNK, phosphatase, transfera | 90.06 | |
| 2yvu_A | 186 | Probable adenylyl-sulfate kinase; transferase, str | 89.91 | |
| 3b60_A | 582 | Lipid A export ATP-binding/permease protein MSBA; | 89.81 | |
| 4a82_A | 578 | Cystic fibrosis transmembrane conductance regulat; | 89.75 | |
| 2yl4_A | 595 | ATP-binding cassette SUB-family B member 10, mitoc | 89.66 | |
| 3qf4_B | 598 | Uncharacterized ABC transporter ATP-binding prote | 89.58 | |
| 2iw3_A | 986 | Elongation factor 3A; acetylation, ATP-binding, pr | 89.57 | |
| 1tq4_A | 413 | IIGP1, interferon-inducible GTPase; interferon gam | 89.56 | |
| 1ixz_A | 254 | ATP-dependent metalloprotease FTSH; AAA domain fol | 89.52 | |
| 2obl_A | 347 | ESCN; ATPase, hydrolase; 1.80A {Escherichia coli O | 89.48 | |
| 3ux8_A | 670 | Excinuclease ABC, A subunit; UVRA, nucleotide exci | 89.45 | |
| 1in4_A | 334 | RUVB, holliday junction DNA helicase RUVB; AAA+-cl | 89.43 | |
| 1vma_A | 306 | Cell division protein FTSY; TM0570, structural gen | 89.27 | |
| 1svm_A | 377 | Large T antigen; AAA+ fold, viral protein; HET: AT | 89.19 | |
| 3lw7_A | 179 | Adenylate kinase related protein (ADKA-like); AMP, | 89.06 | |
| 1zu4_A | 320 | FTSY; GTPase, signal recognition particle, SRP, re | 89.03 | |
| 2qag_B | 427 | Septin-6, protein NEDD5; cell cycle, cell division | 88.97 | |
| 1via_A | 175 | Shikimate kinase; structural genomics, transferase | 88.92 | |
| 2yv5_A | 302 | YJEQ protein; hydrolase, GTPase, permutation, stru | 88.92 | |
| 3lda_A | 400 | DNA repair protein RAD51; DNA binding protein, ATP | 88.83 | |
| 3pih_A | 916 | Uvrabc system protein A; hydrolase, ABC ATPase, DN | 88.75 | |
| 4eaq_A | 229 | DTMP kinase, thymidylate kinase; structural genomi | 88.68 | |
| 2rhm_A | 193 | Putative kinase; P-loop containing nucleoside trip | 88.55 | |
| 1iy2_A | 278 | ATP-dependent metalloprotease FTSH; AAA domain fol | 88.33 | |
| 1m7g_A | 211 | Adenylylsulfate kinase; APS kinase, transferase, s | 88.14 | |
| 3cr8_A | 552 | Sulfate adenylyltranferase, adenylylsulfate kinase | 88.13 | |
| 1qhx_A | 178 | CPT, protein (chloramphenicol phosphotransferase); | 88.08 | |
| 3ux8_A | 670 | Excinuclease ABC, A subunit; UVRA, nucleotide exci | 88.07 | |
| 3qf4_A | 587 | ABC transporter, ATP-binding protein; multidrug tr | 88.01 | |
| 2p5t_B | 253 | PEZT; postsegregational killing system, phosphoryl | 87.99 | |
| 1gvn_B | 287 | Zeta; postsegregational killing system, plasmid; 1 | 87.96 | |
| 1oix_A | 191 | RAS-related protein RAB-11A; small G protein, intr | 87.95 | |
| 1y63_A | 184 | LMAJ004144AAA protein; structural genomics, protei | 87.9 | |
| 2dpy_A | 438 | FLII, flagellum-specific ATP synthase; beta barrel | 87.85 | |
| 1vht_A | 218 | Dephospho-COA kinase; structural genomics, transfe | 87.84 | |
| 1tf7_A | 525 | KAIC; homohexamer, hexamer, circadian clock protei | 87.79 | |
| 4ad8_A | 517 | DNA repair protein RECN; DNA binding protein, ATPa | 87.62 | |
| 2px0_A | 296 | Flagellar biosynthesis protein FLHF; SRP GTPase, f | 87.59 | |
| 1ls1_A | 295 | Signal recognition particle protein; FFH, SRP54, S | 87.57 | |
| 3nwj_A | 250 | ATSK2; P loop, shikimate, nucleoside monophosphate | 87.33 | |
| 2orw_A | 184 | Thymidine kinase; TMTK, TP4A, transferase; HET: 4T | 87.31 | |
| 1kht_A | 192 | Adenylate kinase; phosphotransferase, signaling pr | 87.29 | |
| 2f9l_A | 199 | RAB11B, member RAS oncogene family; RAB11B GTPase, | 87.23 | |
| 1tev_A | 196 | UMP-CMP kinase; ploop, NMP binding region, LID reg | 87.08 | |
| 2ygr_A | 993 | Uvrabc system protein A; hydrolase, nucleotide exc | 87.03 | |
| 1u0l_A | 301 | Probable GTPase ENGC; permutation, OB-fold, zinc-f | 87.01 | |
| 3hr8_A | 356 | Protein RECA; alpha and beta proteins (A/B, A+B), | 86.98 | |
| 2vli_A | 183 | Antibiotic resistance protein; transferase, tunica | 86.87 | |
| 1q3t_A | 236 | Cytidylate kinase; nucleotide monophosphate kinase | 86.73 | |
| 1ex7_A | 186 | Guanylate kinase; substrate-induced FIT, domain mo | 86.73 | |
| 2rcn_A | 358 | Probable GTPase ENGC; YJEQ, circularly permuted, G | 86.52 | |
| 2f1r_A | 171 | Molybdopterin-guanine dinucleotide biosynthesis pr | 86.34 | |
| 2r6f_A | 972 | Excinuclease ABC subunit A; UVRA, nucleotide excis | 85.84 | |
| 1np6_A | 174 | Molybdopterin-guanine dinucleotide biosynthesis pr | 85.55 | |
| 1sxj_E | 354 | Activator 1 40 kDa subunit; clamp loader, processi | 85.41 | |
| 3iij_A | 180 | Coilin-interacting nuclear ATPase protein; alpha a | 85.32 | |
| 3szr_A | 608 | Interferon-induced GTP-binding protein MX1; interf | 85.07 | |
| 2c95_A | 196 | Adenylate kinase 1; transferase, AP4A, nucleotide | 85.02 | |
| 1uf9_A | 203 | TT1252 protein; P-loop, nucleotide binding domain, | 84.96 | |
| 2jaq_A | 205 | Deoxyguanosine kinase; transferase, deoxyribonucle | 84.84 | |
| 2vf7_A | 842 | UVRA2, excinuclease ABC, subunit A.; DNA-binding p | 84.72 | |
| 1lv7_A | 257 | FTSH; alpha/beta domain, four helix bundle, hydrol | 84.68 | |
| 2qnr_A | 301 | Septin-2, protein NEDD5; structural genomics conso | 84.61 | |
| 1qf9_A | 194 | UMP/CMP kinase, protein (uridylmonophosphate/cytid | 84.56 | |
| 3bos_A | 242 | Putative DNA replication factor; P-loop containing | 84.34 | |
| 1pui_A | 210 | ENGB, probable GTP-binding protein ENGB; structura | 84.31 | |
| 1gtv_A | 214 | TMK, thymidylate kinase; transferase, transferase | 84.22 | |
| 1nks_A | 194 | Adenylate kinase; thermophilic, transferase; HET: | 84.09 | |
| 3dlm_A | 213 | Histone-lysine N-methyltransferase setdb1; setdb1_ | 83.96 | |
| 2z0h_A | 197 | DTMP kinase, thymidylate kinase; ATP-binding, nucl | 83.79 | |
| 3ake_A | 208 | Cytidylate kinase; CMP kinase, CMP complex, open c | 83.76 | |
| 2zr9_A | 349 | Protein RECA, recombinase A; recombination, RECA m | 83.65 | |
| 3r20_A | 233 | Cytidylate kinase; structural genomics, seattle st | 83.62 | |
| 2plr_A | 213 | DTMP kinase, probable thymidylate kinase; TMP-bind | 83.5 | |
| 1t9h_A | 307 | YLOQ, probable GTPase ENGC; N-terminal beta-barrel | 83.36 | |
| 2w58_A | 202 | DNAI, primosome component (helicase loader); ATP-b | 83.28 | |
| 3a4m_A | 260 | L-seryl-tRNA(SEC) kinase; P-loop motif, walker A m | 83.17 | |
| 1e6c_A | 173 | Shikimate kinase; phosphoryl transfer, ADP, shikim | 82.98 | |
| 1zd8_A | 227 | GTP:AMP phosphotransferase mitochondrial; ATP:AMP | 82.82 | |
| 1ukz_A | 203 | Uridylate kinase; transferase; HET: ADP AMP; 1.90A | 82.65 | |
| 1njg_A | 250 | DNA polymerase III subunit gamma; rossman-like fol | 82.58 | |
| 3trf_A | 185 | Shikimate kinase, SK; amino acid biosynthesis, tra | 82.53 | |
| 2wwf_A | 212 | Thymidilate kinase, putative; transferase, malaria | 82.49 | |
| 2ro0_A | 92 | Histone acetyltransferase ESA1; HAT, chromodomain, | 82.48 | |
| 1odf_A | 290 | YGR205W, hypothetical 33.3 kDa protein in ADE3-Ser | 82.4 | |
| 2wac_A | 218 | CG7008-PA; unknown function, tudor, beta-barrel, n | 82.39 | |
| 1ltq_A | 301 | Polynucleotide kinase; phosphatase, alpha/beta, P- | 82.31 | |
| 2bwj_A | 199 | Adenylate kinase 5; phosphoryl transfer reaction, | 82.31 | |
| 1nn5_A | 215 | Similar to deoxythymidylate kinase (thymidylate K; | 82.3 | |
| 2www_A | 349 | Methylmalonic aciduria type A protein, mitochondri | 81.92 | |
| 2v54_A | 204 | DTMP kinase, thymidylate kinase; nucleotide biosyn | 81.76 | |
| 2xb4_A | 223 | Adenylate kinase; ATP-binding, nucleotide-binding, | 81.74 | |
| 3cf0_A | 301 | Transitional endoplasmic reticulum ATPase; AAA, P9 | 81.6 | |
| 1sxj_C | 340 | Activator 1 40 kDa subunit; clamp loader, processi | 81.59 | |
| 1fnn_A | 389 | CDC6P, cell division control protein 6; ORC1, AAA | 81.51 | |
| 2eko_A | 87 | Histone acetyltransferase htatip; chromo domain, h | 81.36 | |
| 3ntk_A | 169 | Maternal protein tudor; tudor domain, OB-fold, GER | 81.2 | |
| 1wgs_A | 133 | MYST histone acetyltransferase 1; tudor domain, MY | 81.1 | |
| 2qag_C | 418 | Septin-7; cell cycle, cell division, GTP-binding, | 80.97 | |
| 2iyv_A | 184 | Shikimate kinase, SK; transferase, aromatic amino | 80.91 | |
| 2b8t_A | 223 | Thymidine kinase; deoxyribonucleoside kinase, zinc | 80.8 | |
| 2qby_A | 386 | CDC6 homolog 1, cell division control protein 6 ho | 80.71 | |
| 2pbr_A | 195 | DTMP kinase, thymidylate kinase; transferase, nucl | 80.62 | |
| 2p67_A | 341 | LAO/AO transport system kinase; ARGK, structural G | 80.49 | |
| 2pt5_A | 168 | Shikimate kinase, SK; aromatic amino acid biosynth | 80.2 | |
| 2cdn_A | 201 | Adenylate kinase; phosphoryl transfer, associative | 80.12 | |
| 1zak_A | 222 | Adenylate kinase; ATP:AMP-phosphotransferase, tran | 80.11 | |
| 3zvl_A | 416 | Bifunctional polynucleotide phosphatase/kinase; hy | 80.06 | |
| 3fb4_A | 216 | Adenylate kinase; psychrophIle, phosphotransferase | 80.01 |
| >2o8b_B DNA mismatch repair protein MSH6; DNA damage response, somatic hypermutat protein-DNA complex, DNA mispair, cancer; HET: DNA ADP; 2.75A {Homo sapiens} PDB: 2o8c_B* 2o8d_B* 2o8e_B* 2o8f_B* | Back alignment and structure |
|---|
Probab=100.00 E-value=2.2e-144 Score=1385.41 Aligned_cols=815 Identities=39% Similarity=0.658 Sum_probs=656.7
Q ss_pred ccccccccccccccccccCC-CCCccCCCCCCCCCCCCCCCCCCchhhcCCCHHHHHHHHHHhhCCCeEEEEeeCceEEE
Q 001212 278 GDVSERFSAREADKFHFLGP-DRRDAKRRRPGDVYYDPRTLYLPPDFLRNLSEGQKQWWEFKSKHMDKVIFFKMGKFYEL 356 (1122)
Q Consensus 278 ~~~~~~~~~~~~~~~~~l~~-~~rD~~~r~p~dp~ydp~Tl~iP~~~~~~~TP~~~Qyw~iK~~~~D~vlffk~GkFYEl 356 (1122)
|+..++++.|.|++|+||++ +|||++||||+||+|||||||||+++++++||||||||+||++||||||||||||||||
T Consensus 18 ~~~~~~~~~~~~~~~~~l~~~~~rD~~~r~~~~p~ydp~tl~ip~~~~~~~TPmm~Qy~~iK~~~~d~llffr~GdFYEl 97 (1022)
T 2o8b_B 18 GDDSSRPTVWYHETLEWLKEEKRRDEHRRRPDHPDFDASTLYVPEDFLNSCTPGMRKWWQIKSQNFDLVICYKVGKFYEL 97 (1022)
T ss_dssp ------CCSCGGGGCGGGSTTTCCCTTCCCTTSTTCCTTCCCCCHHHHTTSCHHHHHHHHHHHHCTTSEEEEEETTEEEE
T ss_pred CCccccccccccccchhcCccccccccCCCCCCCCCCCCcccCCchhhccCCHHHHHHHHHHHhCCCEEEEEECCCEEEE
Confidence 56678888999999999997 79999999999999999999999999999999999999999999999999999999999
Q ss_pred ehhhHHHhhhhcceeeecCCCCcCCcCcccHhHHHHHHHHcCCeEEEEecCCChHHHHHHhhhcC---CCCCeeeeeEEE
Q 001212 357 FEMDAHVGAKELDLQYMKGEQPHCGFPERNFSMNVEKLARKGYRVLVVEQTETPEQLELRRKEKG---SKDKVVKREICA 433 (1122)
Q Consensus 357 f~~DA~i~ak~L~L~~~~g~~p~~GfPe~sl~~y~~kLv~~GyKVavvEQ~Et~~~~~~r~k~~~---~k~kvv~Rev~~ 433 (1122)
|++||+++|++|||++|+|++||||||+|+++.|+++||++|||||||||+|+|++++.|.+.++ +++++|+||||+
T Consensus 98 f~~DA~~~a~~L~i~lt~~~~pmaGvP~ha~~~yl~~Lv~~GykVai~eQ~e~p~~~~~r~~~~~~~~k~~~~v~Rev~r 177 (1022)
T 2o8b_B 98 YHMDALIGVSELGLVFMKGNWAHSGFPEIAFGRYSDSLVQKGYKVARVEQTETPEMMEARCRKMAHISKYDRVVRREICR 177 (1022)
T ss_dssp EHHHHHHHHHHHCCCCCSSSSCEEEEEGGGHHHHHHHHHHTTCCEEEEEECSCHHHHHHHHHTCSSCCSGGGSCCEEEEE
T ss_pred ehhhHHHHHHhcCeEEecCCCCCCCCchhHHHHHHHHHHHCCCeEEEEeCCCCchhhhhhhhhcccccccCCceeeeEEE
Confidence 99999999999999999999999999999999999999999999999999999998888877543 446899999999
Q ss_pred EeeCCccccccc---CCCCCCCcEEEEEEecCCCCCCCCCCcEEEEEEEEcCCCeEEEEEEcCcccHHHHHHHHHhcCCc
Q 001212 434 VVTKGTLTEGEL---LSANPDASYLMALTESNQSPASQSTDRCFGICVVDVATSRIILGQVMDDLDCSVLCCLLSELRPV 510 (1122)
Q Consensus 434 ViTpGTl~d~~~---l~~~~~~~yl~aI~e~~~~~~~~~~~~~~Gva~vD~stg~~~l~qf~Dd~~~s~L~t~L~~~~P~ 510 (1122)
||||||++|+.+ +. ...++||+||++.... ..+....|||||+|++||+|++++|.|+..+++|.+.|.+++|+
T Consensus 178 vvTpGT~~d~~~~~~l~-~~~~n~l~ai~~~~~~--~~~~~~~~Gla~~D~sTGe~~~~e~~d~~~~~~L~~~L~~~~P~ 254 (1022)
T 2o8b_B 178 IITKGTQTYSVLEGDPS-ENYSKYLLSLKEKEED--SSGHTRAYGVCFVDTSLGKFFIGQFSDDRHCSRFRTLVAHYPPV 254 (1022)
T ss_dssp EECTTSCCCCTTSCCCS-CSSCCEEEEEEEEECS--CC-CCEEEEEEEECTTTCCEEEEEEEECSSCHHHHHHHHHSCEE
T ss_pred EECCCeeeccccccccc-CCCCcEEEEEEEcccc--ccCCCcEEEEEEEECCCCEEEEEEecCchHHHHHHHHHHhcCCc
Confidence 999999999874 43 3468999999974211 01123579999999999999999999998899999999999999
Q ss_pred EEEecCCCCChHHHHHHHhhcCCCccccccCCccccChhhHHHHHH--HHHhhcccccccccccccccccccCCCCcccc
Q 001212 511 EIIKPANMLSPETERAILRHTRNPLVNDLVPLSEFWDAETTVLEIK--NIYNRITAESLNKADSNVANSQAEGDGLTCLP 588 (1122)
Q Consensus 511 EIi~~~~~~s~~~~~~l~~~~~~~~~~~~~~~~~f~~~~~~~~~l~--~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~p 588 (1122)
|||++.+..+..+.+.+.......+...+.+..+||+...+...+. .+|..... ......||
T Consensus 255 Eil~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~f~~~~~----------------~~~~~~~~ 318 (1022)
T 2o8b_B 255 QVLFEKGNLSKETKTILKSSLSCSLQEGLIPGSQFWDASKTLRTLLEEEYFREKLS----------------DGIGVMLP 318 (1022)
T ss_dssp EEEEETTTCCHHHHHHHTTTTTTSEEEEECBTTTBCCHHHHHHHHHHTTTTSSSSC----------------CCC-CCCC
T ss_pred EEEecCCccchHHHHHHHhhhhhhhhhhcccchhhcchhhHHhhhhhhhhcccccc----------------cccchhhH
Confidence 9999988777766665543222222222235567898776665443 34432110 00113566
Q ss_pred hhhhhhhcc----C----CCchHHHHHHHHHHHHHHHhccchhhhcccceeecCCCCC----------ccCCCCCceecC
Q 001212 589 GILSELIST----G----DSGSQVLSALGGTLFYLKKSFLDETLLRFAKFELLPCSGF----------GDMAKKPYMVLD 650 (1122)
Q Consensus 589 ~~l~~l~~~----~----~~~~~al~Algall~YL~~~~l~~~ll~~~~f~~~~~~~~----------~~~~~~~~M~LD 650 (1122)
..+..+... + .+..++++|+|+||+||+.++++..++..++|..+..... ......+||.||
T Consensus 319 ~~l~~~~~~~~~~~~~~~~~~~~a~~A~gall~Yl~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~m~LD 398 (1022)
T 2o8b_B 319 QVLKGMTSESDSIGLTPGEKSELALSALGGCVFYLKKCLIDQELLSMANFEEYIPLDSDTVSTTRSGAIFTKAYQRMVLD 398 (1022)
T ss_dssp HHHHHTEECCSTTCSEECGGGHHHHHHHHHHHHHHHHHTCHHHHHTTCCEEECCCGGGGTCC---------CCCCBCBCC
T ss_pred HHHHHhhcchhhcccccccccHHHHHHHHHHHHHHHHhCcchhhhccccccccccccccccccccccccccCCCCeEEeC
Confidence 655443311 0 1246789999999999999988766655555544321110 013456899999
Q ss_pred HHHHHhcCCcccCCCCCCcccHHhHhhhcCChHHHHHHHHhhhccCCCHHHHHHHHHHHHHHHcCChhhHHHHHHhcCCC
Q 001212 651 APALENLEVFENSRSGDSSGTLYAQLNHCVTAFGKRLLRTWLARPLYNSGLIRERQDAVAGLRGVNQPFALEFRKALSRL 730 (1122)
Q Consensus 651 ~~Tl~nLEI~~n~~~g~~~gSL~~~Ln~c~T~~GkRlLr~Wl~~PL~d~~~I~~R~daVe~L~~~~~~~~~~lr~~Lk~l 730 (1122)
++|++||||++|.++|+.+||||++||+|+|+||+||||+||++||+|++.|++|||+|++|++ +..++..++..|+++
T Consensus 399 ~~T~~nLEl~~~~~~g~~~gSLl~~Ld~t~T~mG~RLLr~WL~~PL~d~~~I~~RldaVe~l~~-~~~~~~~l~~~L~~i 477 (1022)
T 2o8b_B 399 AVTLNNLEIFLNGTNGSTEGTLLERVDTCHTPFGKRLLKQWLCAPLCNHYAINDRLDAIEDLMV-VPDKISEVVELLKKL 477 (1022)
T ss_dssp HHHHHHTTCSSCCSSSSCCCSHHHHHCCCSSHHHHHHHHHHHHSCBCCHHHHHHHHHHHHHHHT-CHHHHHHHHHHHTTC
T ss_pred HHHHHhhcCCccCCCCCCCCcHHHHhCcCCCchhHHHHHHHHhCccCCHHHHHHHHHHHHHHHh-ChHHHHHHHHHHhcC
Confidence 9999999999998888889999999999999999999999999999999999999999999996 677888999999999
Q ss_pred CcHHHHHHHHhccccc---cCCCCccchhhHHH--HHHHHHHHHHHHhhhHHHHHHHHHHHHHHhhcChhhHHhhhcC--
Q 001212 731 PDMERLLARLFASSEA---NGRNSNKVVLYEDA--AKKQLQEFISALHGCELMDQACSSLGAILENTESRQLHHILTP-- 803 (1122)
Q Consensus 731 pDleRll~ri~~~~~~---~~~~~~~~~~~~~~--~~~~l~~~~~~L~~~~~~~~~~~~l~~~l~~~~s~~l~~l~~~-- 803 (1122)
|||||+++||+..+.. ..+...++++|++. ..+++.+|+..+.++..+..+...+........+.+|..+...
T Consensus 478 ~DlERll~Ri~~~~~~~~~~~~~~~~~i~~~~~~~~~~~l~~l~~~l~~l~~~~~i~~~l~~~~~~~~s~lL~~~~~~~~ 557 (1022)
T 2o8b_B 478 PDLERLLSKIHNVGSPLKSQNHPDSRAIMYEETTYSKKKIIDFLSALEGFKVMCKIIGIMEEVADGFKSKILKQVISLQT 557 (1022)
T ss_dssp CCHHHHHHHHHHHHCHHHHHHCGGGGCCCSCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHTTCCCHHHHHHTSBTT
T ss_pred ccHHHHHHHHHhcCCcccccccchhhhhhhhhhccchhhHHHHHHHHHHHHHHHHHHHHHHhhhcccCcHHHHHHHHhhc
Confidence 9999999999762211 01122345555542 5677888888876666555544444333334566777777532
Q ss_pred ---CCCchhHHHHHHHHHhhhchHhhcCCCCeeeCCCCChhHHHHHHHHHHHHHHHHHHHHHHHHHhcCCCceEEEecCc
Q 001212 804 ---GKGLPAIVSILKHFKDAFDWVEANNSGRIIPHGGVDMDYDSACKKVKEIEASLTKHLKEQRKLLGDTSITYVTIGKD 880 (1122)
Q Consensus 804 ---~~~~~~l~~~l~~i~~~~d~~~~~~~g~ii~~~G~d~elD~~~~~~~~i~~~L~~~l~~~~~~l~~~~i~y~~~~~~ 880 (1122)
...++++.+++..|..+||...+.+.|.+++++|++++||++++.+++++++|.++++++++.+++++++|++++++
T Consensus 558 ~~~~~~~~~l~~~~~~~~~~id~~~~~~~g~i~~~~g~~~~ld~~r~~~~~~~~~l~~~~~~~~~~~~~~~l~~~~~~~~ 637 (1022)
T 2o8b_B 558 KNPEGRFPDLTVELNRWDTAFDHEKARKTGLITPKAGFDSDYDQALADIRENEQSLLEYLEKQRNRIGCRTIVYWGIGRN 637 (1022)
T ss_dssp TSSSSCBCCCHHHHHHHHTTSCHHHHHHSCCCCCTTCC-CHHHHHHHHHHHHHHHHHHHHTSSGGGSSCSCCEEECCGGG
T ss_pred cccccchHHHHHHHHHHHHHhCchhhhcCCcEeeCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHhCCCceeEEEecCc
Confidence 14678888999999999998766678888889999999999999999999999999999888899888999988889
Q ss_pred eEEEEecccccCC-CCCcEEEeeeecceEEEecchHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhhhHHHHHHHHHH
Q 001212 881 LYLLEVPESLRGS-VPRDYELRSSKKGFFRYWTPNIKKLLGELSQAESEKESALKSILQRLIGQFCEHHNKWRQMVAATA 959 (1122)
Q Consensus 881 ~y~ieV~~~~~~~-vp~~~~~~ss~k~~~rf~t~el~~l~~~l~~~~~~~~~~~~~il~~l~~~~~~~~~~l~~~~~~ia 959 (1122)
+|+|+|+.....+ +|++|+..+++++..||+|+++++++.++..+++++...+.+++.++++.+.++...|..+++++|
T Consensus 638 ~y~i~v~~~~~~~~vp~~~~~~~t~~~~~rf~t~el~~~~~~l~~~~~~~~~~~~~l~~~l~~~~~~~~~~l~~~~~~la 717 (1022)
T 2o8b_B 638 RYQLEIPENFTTRNLPEEYELKSTKKGCKRYWTKTIEKKLANLINAEERRDVSLKDCMRRLFYNFDKNYKDWQSAVECIA 717 (1022)
T ss_dssp CCEEEECTTTTSSCCCC-CEEEEETTEEEECCTTTHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHTTHHHHHHHHHHHH
T ss_pred eEEEEEehhhhcccCCCceEEeeeccCccEEechHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence 9999999987776 899999999999999999999999999999999999999999999999999999999999999999
Q ss_pred HHHhHHHHHHHhhhcCCCccceeeeCCCCCCCCeEEEeecCCCceecccCCCCceeccceeeCCCC------CceEEEEE
Q 001212 960 ELDALISLAIASDFYEGPTCRPVILDSCSNEEPYISAKSLGHPVLRSDSLGKGEFVPNDITIGGHG------NASFILLT 1033 (1122)
Q Consensus 960 ~LD~L~SlA~~a~~~~~~~~rP~~~~~~~~~~~~l~i~~~RHP~le~~~~~~~~fVPNDi~L~~~~------~~~~~IIT 1033 (1122)
+|||++|||.+|.....+||||+|++. .++.+.|.|++||||+++.. ...+.|||||+.|+... .+++++||
T Consensus 718 ~lD~l~s~A~~a~~~~~~~~~P~~~~~-~~~~~~l~i~~~rHP~l~~~-~~~~~~v~ndi~l~~~~~~~~~~~g~i~~It 795 (1022)
T 2o8b_B 718 VLDVLLCLANYSRGGDGPMCRPVILLP-EDTPPFLELKGSRHPCITKT-FFGDDFIPNDILIGCEEEEQENGKAYCVLVT 795 (1022)
T ss_dssp HHHHHHHHHHHTTCSSSCEECCEECCT-TTSCCCEEEEEECCCC-------CCCCCCEEEEESCCCSCC---CCCEEEEE
T ss_pred HHHHHHhHHHHHhhccCCccCCccccC-CCCCceEEEEeccccEEEEE-ecCCceEeeeeeeccccccccCCCCcEEEEE
Confidence 999999999999843458999999842 11345799999999999853 22357999999997532 15899999
Q ss_pred ecCCCchHHHHHHHHHHHHHHHcCCcccCCccccCCcceEeeccCCccccccCCChHHHHHHHHHHHHHhccccHHHHHH
Q 001212 1034 GPNMGGKSTLLRQVCLAVILAQVGADVPAEIFEISPVDRIFVRMGAKDHIMAGQSTFLTELSETALMLVRFFCSLNQLCR 1113 (1122)
Q Consensus 1034 GPNMgGKST~LRqvaLivILAQiG~fVPA~~a~l~ivDrIfTRiGa~D~i~~g~STFmvEM~Eta~IL~~AT~sl~~l~~ 1113 (1122)
||||||||||||++||+++|||+||||||+.+.++++|+||+|+|+.|++..|.||||+||.+++.|+..||+..++|+|
T Consensus 796 GpNgsGKSTlLr~iGl~~~~aqiG~~Vpq~~~~l~v~d~I~~rig~~d~~~~~~stf~~em~~~a~al~la~~~sLlLLD 875 (1022)
T 2o8b_B 796 GPNMGGKSTLMRQAGLLAVMAQMGCYVPAEVCRLTPIDRVFTRLGASDRIMSGESTFFVELSETASILMHATAHSLVLVD 875 (1022)
T ss_dssp CCTTSSHHHHHHHHHHHHHHHTTTCCEESSEEEECCCSBEEEECC---------CHHHHHHHHHHHHHHHCCTTCEEEEE
T ss_pred CCCCCChHHHHHHHHHHHHHhheeEEeccCcCCCCHHHHHHHHcCCHHHHhhchhhhHHHHHHHHHHHHhCCCCcEEEEE
Confidence 99999999999999999999999999999999999999999999999999999999999999999999999975444444
Q ss_pred H
Q 001212 1114 Y 1114 (1122)
Q Consensus 1114 ~ 1114 (1122)
|
T Consensus 876 E 876 (1022)
T 2o8b_B 876 E 876 (1022)
T ss_dssp C
T ss_pred C
Confidence 3
|
| >3thx_B DNA mismatch repair protein MSH3; ABC family ATPase, mismatch recognition, mismatched unpaired DNA binding protein-DNA complex; HET: DNA ADP; 2.70A {Homo sapiens} PDB: 3thw_B* 3thy_B* 3thz_B* | Back alignment and structure |
|---|
| >1wb9_A DNA mismatch repair protein MUTS; DNA-binding, ATP-binding, DNA binding, DNA repair, mismatch recognition; HET: DNA ADP; 2.10A {Escherichia coli} SCOP: a.113.1.1 c.37.1.12 c.55.6.1 d.75.2.1 PDB: 1wbb_A* 1e3m_A* 1oh5_A* 1oh6_A* 1oh7_A* 1oh8_A* 1w7a_A* 2wtu_A* 1wbd_A* 1ng9_A* 3k0s_A* | Back alignment and structure |
|---|
| >1ewq_A DNA mismatch repair protein MUTS; multiple domains of protein, mostly mixed alpha-beta structures, one domain is entirely helical; HET: DNA; 2.20A {Thermus aquaticus} SCOP: a.113.1.1 c.37.1.12 c.55.6.1 d.75.2.1 PDB: 1nne_A* 1fw6_A* 1ewr_A* | Back alignment and structure |
|---|
| >3thx_A DNA mismatch repair protein MSH2; ABC family ATPase, mismatch recognition, mismatched unpaired DNA binding protein-DNA complex; HET: DNA ADP; 2.70A {Homo sapiens} PDB: 2o8c_A* 2o8d_A* 2o8f_A* 3thw_A* 2o8b_A* 3thy_A* 3thz_A* 2o8e_A* | Back alignment and structure |
|---|
| >2l8d_A Lamin-B receptor; DNA binding protein; NMR {Gallus gallus} | Back alignment and structure |
|---|
| >2dig_A Lamin-B receptor; tudor domain, integral nuclear envelope inner membrane protein, nuclear protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.34.9.1 | Back alignment and structure |
|---|
| >2g3r_A Tumor suppressor P53-binding protein 1; tandem tudor domains, cell cycle-transcription complex; 1.25A {Homo sapiens} SCOP: b.34.9.1 b.34.9.1 PDB: 2ig0_A* 3lgf_A* 3lgl_A* 3lh0_A* 1xni_A | Back alignment and structure |
|---|
| >3p8d_A Medulloblastoma antigen MU-MB-50.72; tudor domain, lysine-methylated P53 binding, histone binding binding; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >2equ_A PHD finger protein 20-like 1; tudor domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3qii_A PHD finger protein 20; tudor domain, structural genomics, structural GE consortium, SGC, transcription regulator; 2.30A {Homo sapiens} | Back alignment and structure |
|---|
| >1mhn_A SurviVal motor neuron protein; SMN, SMA, spinal muscular atrophy, RNA binding protein; 1.80A {Homo sapiens} SCOP: b.34.9.1 PDB: 4a4e_A* 4a4g_A* | Back alignment and structure |
|---|
| >2eqj_A Metal-response element-binding transcription factor 2; structure genomics,tudor domain, zinc-regulated factor 1, ZIRF1; NMR {Mus musculus} | Back alignment and structure |
|---|
| >1ssf_A Transformation related protein 53 binding protein 1; tudor domains, tandem, SH3-like fold, beta barrel, alpha- helix, cell cycle; NMR {Mus musculus} SCOP: b.34.9.1 b.34.9.1 | Back alignment and structure |
|---|
| >2ldm_A Uncharacterized protein; PHF20, tudor domain, epigenetics, methylated P53, transcript factor, transcription-protein binding complex; HET: M2L; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >4a4f_A SurviVal of motor neuron-related-splicing factor; RNA binding protein; HET: 2MR; NMR {Homo sapiens} PDB: 4a4h_A* | Back alignment and structure |
|---|
| >3s6w_A Tudor domain-containing protein 3; methylated arginine recognize, ISO-propanol, transcri; 1.78A {Homo sapiens} PDB: 3pmt_A* | Back alignment and structure |
|---|
| >1znw_A Guanylate kinase, GMP kinase; ATP:GMP-phosphotransferase, TR; 2.10A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1znx_A* 1zny_A* 1znz_A* 1s4q_A 1z8f_A | Back alignment and structure |
|---|
| >1g5v_A SurviVal motor neuron protein 1; mRNA processing, translation; NMR {Homo sapiens} SCOP: b.34.9.1 | Back alignment and structure |
|---|
| >3tif_A Uncharacterized ABC transporter ATP-binding prote; nucleotide-binding domain, ABC transporter ATPase; HET: ADP; 1.80A {Methanocaldococcus jannaschii dsm 2661ORGANISM_TAXID} PDB: 1l2t_A* 1f3o_A* | Back alignment and structure |
|---|
| >2pcj_A ABC transporter, lipoprotein-releasing system ATP-binding protein; structural genomics; 1.70A {Aquifex aeolicus} PDB: 2pcl_A | Back alignment and structure |
|---|
| >3tr0_A Guanylate kinase, GMP kinase; purines, pyrimidines, nucleosides, nucleotides, transferase; HET: 5GP; 1.85A {Coxiella burnetii} | Back alignment and structure |
|---|
| >2m0o_A PHD finger protein 1; tudor domain, H3K36ME3 binding, peptide binding protein; HET: M3L; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2d9t_A Tudor domain-containing protein 3; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: b.34.9.1 | Back alignment and structure |
|---|
| >1ye8_A Protein THEP1, hypothetical UPF0334 kinase-like protein AQ_1292; mixed alpha-beta protein, rossman fold, signaling protein, transferase; 1.40A {Aquifex aeolicus} SCOP: c.37.1.11 | Back alignment and structure |
|---|
| >2olj_A Amino acid ABC transporter; ABC domain, ATPase, hydrolase; HET: ADP; 2.05A {Geobacillus stearothermophilus} PDB: 2olk_A* 2ouk_A 2q0h_A* 3c4j_A* 3c41_J* | Back alignment and structure |
|---|
| >1vpl_A ABC transporter, ATP-binding protein; TM0544, structural GENO joint center for structural genomics, JCSG, protein structu initiative, PSI; 2.10A {Thermotoga maritima} SCOP: c.37.1.12 | Back alignment and structure |
|---|
| >2onk_A Molybdate/tungstate ABC transporter, ATP-binding protein; membrane protein; 3.10A {Archaeoglobus fulgidus} SCOP: c.37.1.12 | Back alignment and structure |
|---|
| >1b0u_A Histidine permease; ABC transporter, transport protein; HET: ATP; 1.50A {Salmonella typhimurium} SCOP: c.37.1.12 | Back alignment and structure |
|---|
| >1sgw_A Putative ABC transporter; structural genomics, P protein structure initiative, southeast collaboratory for S genomics, secsg; 1.70A {Pyrococcus furiosus} SCOP: c.37.1.12 | Back alignment and structure |
|---|
| >1ji0_A ABC transporter; ATP binding protein, structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; HET: ATP; 2.00A {Thermotoga maritima} SCOP: c.37.1.12 | Back alignment and structure |
|---|
| >2zu0_C Probable ATP-dependent transporter SUFC; iron-sulfur cluster, ABC-ATPase, ATP-binding, cytoplasm, nucleotide-binding; HET: MES; 2.20A {Escherichia coli} PDB: 2d3w_A | Back alignment and structure |
|---|
| >2cbz_A Multidrug resistance-associated protein 1; ABC proteins, MRP1/ABCC1, nucleotide-binding domain, ATP- binding, hydrolysis, transport; HET: ATP; 1.5A {Homo sapiens} | Back alignment and structure |
|---|
| >3gfo_A Cobalt import ATP-binding protein CBIO 1; structural genomics, cell membrane, cobalt transport, hydrolase, ION transport; 2.30A {Clostridium perfringens atcc 13124} | Back alignment and structure |
|---|
| >2qi9_C Vitamin B12 import ATP-binding protein BTUD; inner membrane, membrane, transmembrane, transport, ATP- binding, hydrolase, nucleotide-binding, periplasm; HET: 1PE; 2.60A {Escherichia coli} PDB: 1l7v_C* 4dbl_C | Back alignment and structure |
|---|
| >2jeo_A Uridine-cytidine kinase 1; UCK, transferase, ATP-binding, nucleoside kinase, nucleotide-binding; 2.50A {Homo sapiens} PDB: 2uvq_A* | Back alignment and structure |
|---|
| >2yz2_A Putative ABC transporter ATP-binding protein TM_0; cobalt transport, TM02 hydrolase, inner membrane, membrane, nucleotide-binding; 2.30A {Thermotoga maritima} | Back alignment and structure |
|---|
| >1htw_A HI0065; nucleotide-binding fold, structural genomics, structure 2 function project, S2F, unknown function; HET: ADP; 1.70A {Haemophilus influenzae} SCOP: c.37.1.18 PDB: 1fl9_A | Back alignment and structure |
|---|
| >2d2e_A SUFC protein; ABC-ATPase, SUF protein, 310-helix, riken structural genomics/proteomics initiative, RSGI, structural genomics, binding; 1.70A {Thermus thermophilus} PDB: 2d2f_A* | Back alignment and structure |
|---|
| >2pze_A Cystic fibrosis transmembrane conductance regulat; NBD, ABC transporter, CFTR, hydrolase; HET: ATP; 1.70A {Homo sapiens} PDB: 2pzg_A* 2pzf_A* 1ckx_A 1cky_A 1ckw_A 1ckz_A | Back alignment and structure |
|---|
| >1mv5_A LMRA, multidrug resistance ABC transporter ATP-binding and permease protein; asymmetric dimer, tetramer, P-glycoprotein; HET: ATP ADP; 3.10A {Lactococcus lactis} SCOP: c.37.1.12 | Back alignment and structure |
|---|
| >4gp7_A Metallophosphoesterase; polynucleotide kinase phosphatase, RNA repair, transferase; HET: ATP CIT; 2.00A {Clostridium thermocellum} PDB: 4gp6_A* | Back alignment and structure |
|---|
| >1g6h_A High-affinity branched-chain amino acid transport ATP-binding protein; beta-core domain; HET: ADP; 1.60A {Methanocaldococcus jannaschii} SCOP: c.37.1.12 PDB: 1gaj_A 1g9x_A* | Back alignment and structure |
|---|
| >1zp6_A Hypothetical protein ATU3015; alpha-beta protein., structural genomics, PSI, protein struc initiative; 3.20A {Agrobacterium tumefaciens str} SCOP: c.37.1.25 | Back alignment and structure |
|---|
| >2ixe_A Antigen peptide transporter 1; ABC ATPase, hydrolase; HET: ATP; 2.0A {Rattus norvegicus} PDB: 2ixg_A* 2ixf_A* 1jj7_A* | Back alignment and structure |
|---|
| >2ff7_A Alpha-hemolysin translocation ATP-binding protein HLYB; ABC-transporter, transport protein; HET: ADP; 1.60A {Escherichia coli} SCOP: c.37.1.12 PDB: 2ffb_A* 2fgk_A* 2ffa_A* 2fgj_A* 2pmk_A* 3b5j_A* 1mt0_A 1xef_A* | Back alignment and structure |
|---|
| >2ihy_A ABC transporter, ATP-binding protein; ATPase, ABC cassette, hydrolase; HET: MSE; 1.90A {Staphylococcus aureus} | Back alignment and structure |
|---|
| >3kta_A Chromosome segregation protein SMC; structural maintenance of chromosomes, ABC ATPase, CFTR adenylate kinase, AP5A, transferase; HET: AP5; 1.63A {Pyrococcus furiosus} PDB: 1xex_A* 1xew_X* | Back alignment and structure |
|---|
| >2nq2_C Hypothetical ABC transporter ATP-binding protein HI1470; putative iron chelatin ABC transporter, nucleotide binding domain; 2.40A {Haemophilus influenzae} | Back alignment and structure |
|---|
| >3pnw_C Tudor domain-containing protein 3; FAB, structural genomics consortium, antibody, SGC, protein immune system complex; 2.05A {Homo sapiens} | Back alignment and structure |
|---|
| >4g1u_C Hemin import ATP-binding protein HMUV; membrane transporter, type II ABC importer, HMUT, plasma MEM transport protein-hydrolase complex; 3.01A {Yersinia pestis} | Back alignment and structure |
|---|
| >3fvq_A Fe(3+) IONS import ATP-binding protein FBPC; nucleotide binding domain, ABC motor domain, ferric iron TRA ATP-binding, cell inner membrane; HET: ATP; 1.90A {Neisseria gonorrhoeae} | Back alignment and structure |
|---|
| >2ghi_A Transport protein; multidrug resistance protein, MDR, structural genomics, structural genomics consortium, SGC; 2.20A {Plasmodium yoelii yoelii str} | Back alignment and structure |
|---|
| >3asz_A Uridine kinase; cytidine phosphorylation, transferase; HET: C5P; 2.25A {Thermus thermophilus} PDB: 3asy_A* | Back alignment and structure |
|---|
| >2bdt_A BH3686; alpha-beta protein, structural genomics, PSI, protein struct initiative, northeast structural genomics consortium, NESG, function; 2.40A {Bacillus halodurans} SCOP: c.37.1.25 | Back alignment and structure |
|---|
| >2pjz_A Hypothetical protein ST1066; ATP binding protein, structural genomics, NPPSFA; 1.90A {Sulfolobus tokodaii} | Back alignment and structure |
|---|
| >1z6g_A Guanylate kinase; structural genomics, SGC, structural genom consortium, transferase; HET: EPE; 2.18A {Plasmodium falciparum} | Back alignment and structure |
|---|
| >1s96_A Guanylate kinase, GMP kinase; E.coli, dimer, SAD, transferase; 2.00A {Escherichia coli} SCOP: c.37.1.1 PDB: 2an9_A* 2anb_A* 2anc_A 2f3r_A* 2f3t_A* | Back alignment and structure |
|---|
| >3b85_A Phosphate starvation-inducible protein; PHOH2, ATPase, PFAM: PF02562, ST genomics, PSI-2, protein structure initiative; 2.35A {Corynebacterium glutamicum atcc 13032} | Back alignment and structure |
|---|
| >2bbs_A Cystic fibrosis transmembrane conductance regulator; ATP binding cassette, transport protein; HET: ATP; 2.05A {Homo sapiens} PDB: 2bbt_A* 1xmi_A* 1xmj_A* 2bbo_A* 3si7_A* 1r0w_A 1q3h_A 1r0x_A* 1r0y_A* 1r0z_A* 1r10_A* 1xf9_A* 1xfa_A* | Back alignment and structure |
|---|
| >3lnc_A Guanylate kinase, GMP kinase; ALS collaborative crystallography, emerald biostructures, ATP-binding, cytoplasm, nucleotide-binding; HET: 5GP; 1.95A {Anaplasma phagocytophilum} | Back alignment and structure |
|---|
| >4hcz_A PHD finger protein 1; protein-peptide complex, tudor, histone binding, H3K36ME3, N nucleus, transcription; HET: M3L; 1.85A {Homo sapiens} | Back alignment and structure |
|---|
| >2yyz_A Sugar ABC transporter, ATP-binding protein; sugar transport, alpha and beta proteins (A/B) TM0421, structural genomics, NPPSFA; 2.11A {Thermotoga maritima} | Back alignment and structure |
|---|
| >4eun_A Thermoresistant glucokinase; putative sugar kinase, enzyme function initiative, EFI, STRU genomics, transferase; 1.60A {Janibacter SP} | Back alignment and structure |
|---|
| >1lvg_A Guanylate kinase, GMP kinase; transferase; HET: ADP 5GP; 2.10A {Mus musculus} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >1z47_A CYSA, putative ABC-transporter ATP-binding protein; alpha/beta motif, beta sandwich, ligand binding protein; 1.90A {Alicyclobacillus acidocaldarius} | Back alignment and structure |
|---|
| >3d31_A Sulfate/molybdate ABC transporter, ATP-binding protein; ATP-binding, nucleotide-binding, membrane, transmembrane, transport protein; 3.00A {Methanosarcina acetivorans} SCOP: b.40.6.3 c.37.1.12 | Back alignment and structure |
|---|
| >2it1_A 362AA long hypothetical maltose/maltodextrin transport ATP-binding protein; structural genomics, NPPSFA; 1.94A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >1v43_A Sugar-binding transport ATP-binding protein; ATPase, active transport, sugar uptake and regulation, transport protein; 2.20A {Pyrococcus horikoshii} SCOP: b.40.6.3 b.40.6.3 c.37.1.12 PDB: 1vci_A* | Back alignment and structure |
|---|
| >3rlf_A Maltose/maltodextrin import ATP-binding protein M; integral membrane protein, ATPase, ABC transporter, membrane transmembrane; HET: UMQ MAL PGV ANP; 2.20A {Escherichia coli} PDB: 1q1e_A 1q12_A* 2awo_A* 3fh6_A 3puv_A* 3puw_A* 3pux_A* 3puy_A* 3puz_A* 3pv0_A* 2awn_A* 2r6g_A* 1q1b_A | Back alignment and structure |
|---|
| >1f2t_A RAD50 ABC-ATPase; DNA double-strand break repair, replication; 1.60A {Pyrococcus furiosus} SCOP: c.37.1.12 PDB: 1f2u_A* 1us8_A* | Back alignment and structure |
|---|
| >4a74_A DNA repair and recombination protein RADA; hydrolase, recombinase; HET: DNA ANP; 1.48A {Pyrococcus furiosus} PDB: 4a6x_A* 4a6p_A* 4a7o_A* | Back alignment and structure |
|---|
| >3c8u_A Fructokinase; YP_612366.1, putative fructose transport system kinase, STRU genomics, joint center for structural genomics, JCSG; 1.95A {Silicibacter SP} | Back alignment and structure |
|---|
| >3tui_C Methionine import ATP-binding protein METN; ABC-transporter, type I ABC type importer, methionine uptake transporter, membrane protein; HET: ADP; 2.90A {Escherichia coli} PDB: 3tuj_C 3tuz_C* 3dhw_C | Back alignment and structure |
|---|
| >1g29_1 MALK, maltose transport protein MALK; ATPase, active transport, maltose uptake and regulation, sugar binding protein; 1.90A {Thermococcus litoralis} SCOP: b.40.6.3 b.40.6.3 c.37.1.12 PDB: 2d62_A | Back alignment and structure |
|---|
| >1kag_A SKI, shikimate kinase I; transferase, structural genomics, PSI, protein structure initiative; 2.05A {Escherichia coli} SCOP: c.37.1.2 | Back alignment and structure |
|---|
| >1kgd_A CASK, peripheral plasma membrane CASK; maguk, guanylate kinase like domain, protein binding; 1.31A {Homo sapiens} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >1oxx_K GLCV, glucose, ABC transporter, ATP binding protein; ABC-ATPase, ATP-binding cassette, ATPase, transport protein; 1.45A {Sulfolobus solfataricus} SCOP: b.40.6.3 c.37.1.12 PDB: 1oxs_C 1oxt_A 1oxu_A* 1oxv_A* | Back alignment and structure |
|---|
| >2eyu_A Twitching motility protein PILT; pilus retraction motor, C-terminal domain PILT, protein transport; 1.87A {Aquifex aeolicus} | Back alignment and structure |
|---|
| >2w0m_A SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus solfataricus P2} | Back alignment and structure |
|---|
| >3gd7_A Fusion complex of cystic fibrosis transmembrane conductance regulator, residues 1193-1427...; CFTR, ABC transporter, nucleotide binding domain, NBD; HET: B44; 2.70A {Homo sapiens} | Back alignment and structure |
|---|
| >2j41_A Guanylate kinase; GMP, GMK, transferase, ATP-binding, nucleotide- binding; HET: 5GP; 1.9A {Staphylococcus aureus} | Back alignment and structure |
|---|
| >2i3b_A HCR-ntpase, human cancer-related ntpase; AAA, rossmann, hydrolase; NMR {Homo sapiens} SCOP: c.37.1.11 | Back alignment and structure |
|---|
| >3qks_A DNA double-strand break repair RAD50 ATPase; RECA-like fold, coiled-coils, ATPase, exonuclease, endonucle binding, DNA binding; HET: DNA; 2.10A {Pyrococcus furiosus} PDB: 3qkr_A* | Back alignment and structure |
|---|
| >1knq_A Gluconate kinase; ALFA/beta structure, transferase; 2.00A {Escherichia coli} SCOP: c.37.1.17 PDB: 1ko1_A 1ko4_A 1ko5_A* 1ko8_A* 1kof_A* | Back alignment and structure |
|---|
| >3tau_A Guanylate kinase, GMP kinase; structural genomics, center for structural genomics of infec diseases, csgid, putative guanylate kinase; HET: MSE; 2.05A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >2bbw_A Adenylate kinase 4, AK4; nucleotide kinase, nucleotide binding, human, structura genomics, structural genomics consortium, SGC, transferase; HET: GP5; 2.05A {Homo sapiens} PDB: 2ar7_A* 3ndp_A | Back alignment and structure |
|---|
| >2xk0_A Polycomb protein PCL; transcription, aromatic CAGE; NMR {Drosophila melanogaster} | Back alignment and structure |
|---|
| >3qf7_A RAD50; ABC-ATPase, ATPase, hydrolase; HET: ANP; 1.90A {Thermotoga maritima} PDB: 3qg5_A 3tho_A* | Back alignment and structure |
|---|
| >1nlf_A Regulatory protein REPA; replicative DNA helicase structural changes, replication; 1.95A {Escherichia coli} SCOP: c.37.1.11 PDB: 1g8y_A 1olo_A | Back alignment and structure |
|---|
| >3ec2_A DNA replication protein DNAC; helicase loader, replication initiation factor, ATP-binding, nucleotide-binding; HET: DNA ADP; 2.70A {Aquifex aeolicus} PDB: 3ecc_A* | Back alignment and structure |
|---|
| >1tf7_A KAIC; homohexamer, hexamer, circadian clock protein; HET: ATP; 2.80A {Synechococcus SP} SCOP: c.37.1.11 c.37.1.11 PDB: 3s1a_A* 1u9i_A* 2gbl_A* 3dvl_A* 3k0a_A* 3k09_A* 3jzm_A* 3k0e_A* 4dug_A* 3ua2_A* 3k0c_A* 3k0f_A* | Back alignment and structure |
|---|
| >3uie_A Adenylyl-sulfate kinase 1, chloroplastic; rossmann fold, transferase-transferase complex; HET: ADX ANP; 1.79A {Arabidopsis thaliana} SCOP: c.37.1.0 PDB: 4fxp_A* | Back alignment and structure |
|---|
| >3aez_A Pantothenate kinase; transferase, homodimer, COA biosynthesis, nucleotide binding binding, cytoplasm, nucleotide-binding; HET: GDP PAZ; 2.20A {Mycobacterium tuberculosis} PDB: 2ges_A* 2geu_A* 2gev_A* 2zs7_A* 2zs8_A* 2zs9_A* 2zsa_A* 2zsb_A* 2zsd_A* 2zse_A* 2zsf_A* 2get_A* 3af0_A* 3af1_A* 3af2_A* 3af3_A* 3af4_A* 3avp_A* 3avo_A* 3avq_A* | Back alignment and structure |
|---|
| >1nij_A Hypothetical protein YJIA; structural genomics, P-loop protein, GTP binding, structure function project, S2F, unknown function; 2.00A {Escherichia coli} SCOP: c.37.1.10 d.237.1.1 | Back alignment and structure |
|---|
| >3jvv_A Twitching mobility protein; hexameric P-loop ATPase, secretion ATPase, ATP-binding, FIMB nucleotide-binding, transport; HET: ACP CIT; 2.60A {Pseudomonas aeruginosa} PDB: 3jvu_A* | Back alignment and structure |
|---|
| >1sq5_A Pantothenate kinase; P-loop, transferase; HET: PAU ADP; 2.20A {Escherichia coli} SCOP: c.37.1.6 PDB: 1esm_A* 1esn_A* | Back alignment and structure |
|---|
| >3nh6_A ATP-binding cassette SUB-family B member 6, mitoc; ABC-transporter, ABCB6, nucleotide binding domain, heme BIOS transport protein; 2.00A {Homo sapiens} PDB: 3nh9_A* 3nha_A* 3nhb_A* | Back alignment and structure |
|---|
| >1cr0_A DNA primase/helicase; RECA-type protein fold, transferase; HET: DNA; 2.30A {Enterobacteria phage T7} SCOP: c.37.1.11 PDB: 1cr1_A* 1cr2_A* 1cr4_A* 1e0j_A* 1e0k_A* | Back alignment and structure |
|---|
| >2if2_A Dephospho-COA kinase; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium, NESG; 3.00A {Aquifex aeolicus} | Back alignment and structure |
|---|
| >4aby_A DNA repair protein RECN; hydrolase, double strand break repair, ATPase, nucleotide binding domain; HET: DNA; 3.00A {Deinococcus radiodurans} | Back alignment and structure |
|---|
| >1p9r_A General secretion pathway protein E; bacterial type II secretion system cytoplasmic protein - GSPE, putative ATPase/ ATP binding protein; 2.50A {Vibrio cholerae} SCOP: c.37.1.11 PDB: 1p9w_A* | Back alignment and structure |
|---|
| >2v9p_A Replication protein E1; AAA+ molecular motor, DNA replication, DNA translocation, nucleotide-binding, DNA-binding; 3.00A {Bovine papillomavirus type 1} PDB: 2gxa_A* | Back alignment and structure |
|---|
| >1jjv_A Dephospho-COA kinase; P-loop nucleotide-binding fold, structure 2 function project, S2F, structural genomics, transferase; HET: ATP; 2.00A {Haemophilus influenzae} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >3ozx_A RNAse L inhibitor; ATP binding cassette protein, hydrolase, translation; HET: ADP; 2.05A {Sulfolobus solfataricus} | Back alignment and structure |
|---|
| >1rz3_A Hypothetical protein rbstp0775; MCSG, structural genomics, PSI, protein structure initiative; 1.90A {Geobacillus stearothermophilus} SCOP: c.37.1.6 | Back alignment and structure |
|---|
| >2kjq_A DNAA-related protein; solution structure, NESG, structural genomics, PSI-2, protei structure initiative; NMR {Neisseria meningitidis serogroup B} | Back alignment and structure |
|---|
| >3auy_A DNA double-strand break repair RAD50 ATPase; DNA repair, ABC transporter ATPase domain-like; HET: DNA ADP; 2.70A {Methanocaldococcus jannaschii} PDB: 3aux_A* 3av0_B* | Back alignment and structure |
|---|
| >3fdr_A Tudor and KH domain-containing protein; TDRD2, structural genomics, structural genomics consortium, SGC, alternative splicing, RNA-binding; 1.75A {Homo sapiens} SCOP: b.34.9.1 | Back alignment and structure |
|---|
| >3euj_A Chromosome partition protein MUKB, linker; MUKB, MUKE, chromosome condensation, condensin, SMC, N subunit, ABC-type ATPase, WHD, ATP-binding; HET: AGS; 3.10A {Haemophilus ducreyi} PDB: 3euk_A* | Back alignment and structure |
|---|
| >3vaa_A Shikimate kinase, SK; structural genomics, center for structural genomics of infec diseases, csgid, metal binding, transferase; 1.70A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >2e5p_A Protein PHF1, PHD finger protein 1; tudor domain, PHF1 protein, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3sop_A Neuronal-specific septin-3; hydrolase; HET: GDP; 2.88A {Homo sapiens} | Back alignment and structure |
|---|
| >3qkt_A DNA double-strand break repair RAD50 ATPase; RECA-like fold, coiled-coils, ATP binding, DNA bindi MRE11, replication; HET: DNA ANP; 1.90A {Pyrococcus furiosus} PDB: 3qku_A* 1ii8_A 3qks_B* 3qkr_B* 1ii8_B | Back alignment and structure |
|---|
| >2yhs_A FTSY, cell division protein FTSY; cell cycle, protein targeting, simibi class GTPase, GTP-BIND membrane, nucleotide-binding; 1.60A {Escherichia coli} PDB: 2qy9_A 2xxa_B* 1fts_A | Back alignment and structure |
|---|
| >3t61_A Gluconokinase; PSI-biology, structural genomics, protein structure initiati YORK structural genomics research consortium, nysgrc; 2.20A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >2pez_A Bifunctional 3'-phosphoadenosine 5'- phosphosulfate synthetase 1 (PAPS synthetase...; NMP-kinase fold, protein in complex with nucleic acid; HET: GGZ DAT; 1.40A {Homo sapiens} PDB: 2pey_A* 2ax4_A* | Back alignment and structure |
|---|
| >4e22_A Cytidylate kinase; P-loop, CMP/ATP binding, transferase; 2.32A {Yersinia pseudotuberculosis} | Back alignment and structure |
|---|
| >1n0w_A DNA repair protein RAD51 homolog 1; DNA repair, homologous recombination, breast cancer susceptibility, RECA-like ATPase, protein complex; HET: DNA MSE; 1.70A {Homo sapiens} SCOP: c.37.1.11 | Back alignment and structure |
|---|
| >2iw3_A Elongation factor 3A; acetylation, ATP-binding, protein biosynthesis, nucleotide-binding, phosphorylation, RNA- binding, rRNA-binding; HET: ADP; 2.4A {Saccharomyces cerevisiae} PDB: 2iwh_A* 2ix3_A 2ix8_A | Back alignment and structure |
|---|
| >3b9q_A Chloroplast SRP receptor homolog, alpha subunit CPFTSY; protein translocation, GTP-binding, nucleotide-binding, protein transport; 1.75A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >3ney_A 55 kDa erythrocyte membrane protein; structural genomics consortium, SGC, 55 kDa erythrocyte MEMB protein; 2.26A {Homo sapiens} SCOP: c.37.1.0 | Back alignment and structure |
|---|
| >1yqt_A RNAse L inhibitor; ATP-binding cassette, ribosome biogenesis, hydrolyase/translation complex; HET: ADP; 1.90A {Pyrococcus furiosus} | Back alignment and structure |
|---|
| >2eqk_A Tudor domain-containing protein 4; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ewv_A Twitching motility protein PILT; pilus retraction motor, ATPase, hexameric PILT, protein TRAN; HET: ADP; 2.80A {Aquifex aeolicus} PDB: 2eww_A* 2gsz_A* | Back alignment and structure |
|---|
| >2e5q_A PHD finger protein 19; tudor domain, isoform B, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2gza_A Type IV secretion system protein VIRB11; ATPase, hydrolase; 2.60A {Brucella suis} | Back alignment and structure |
|---|
| >2cvh_A DNA repair and recombination protein RADB; filament formation, homologous recombination, ATPase domain, hyperthermophIle; HET: DNA; 2.20A {Thermococcus kodakarensis} PDB: 2cvf_A* | Back alignment and structure |
|---|
| >2npi_A Protein CLP1; CLP1-PCF11 complex, ATP binding, ternary complex, transcript; HET: ATP; 2.95A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2pt7_A CAG-ALFA; ATPase, protein-protein complex, type IV secretion, hydrolas binding complex; 2.40A {Helicobacter pylori} SCOP: c.37.1.11 PDB: 1nly_A* 1nlz_A 1opx_A* 1g6o_A | Back alignment and structure |
|---|
| >1cke_A CK, MSSA, protein (cytidine monophosphate kinase); nucleotide monophosphate kinase,, transferase; 1.75A {Escherichia coli} SCOP: c.37.1.1 PDB: 1kdo_A* 1kdp_A* 1kdr_A* 1kdt_A* 2cmk_A* 2fem_A 2feo_A* | Back alignment and structure |
|---|
| >1e69_A Chromosome segregation SMC protein; structural maintenance of chromosomes, coiled coil; 3.1A {Thermotoga maritima} SCOP: c.37.1.12 | Back alignment and structure |
|---|
| >2o5v_A DNA replication and repair protein RECF; ABC ATPase, walker A motif, P-loop, signature motif, replication/recombination complex; HET: DNA; 1.61A {Deinococcus radiodurans} | Back alignment and structure |
|---|
| >2vp4_A Deoxynucleoside kinase; ATP-binding, DNA synthesis, phosphoprotein, feedback inhibition, deoxyribonucleoside kinase, salvage pathway; HET: DCP; 2.20A {Drosophila melanogaster} SCOP: c.37.1.1 PDB: 1j90_A* 2jj8_A* 2vp2_A* 1oe0_A* 2vp5_A* 2vp6_A* 2vp9_A* 2vpp_A* 2vqs_A* 2vp0_A* 1ot3_A* 2jcs_A* 1zm7_A* 1zmx_A* | Back alignment and structure |
|---|
| >3bk7_A ABC transporter ATP-binding protein; ABC ATPase, iron-sulfur cluster, adenosine diphosphate, nucleotide-binding; HET: ADP; 2.80A {Pyrococcus abyssi} PDB: 3j15_B* | Back alignment and structure |
|---|
| >1rj9_A FTSY, signal recognition protein; SRP-GTPase domain, heterodimer, nucleotide twinning, protein complex, protein transport; HET: GCP; 1.90A {Thermus aquaticus} SCOP: a.24.13.1 c.37.1.10 PDB: 2q9c_A* 2q9b_A* 2q9a_A* 1okk_D* 2xkv_D 2iyl_D* 2cnw_D* 2j7p_D* | Back alignment and structure |
|---|
| >3e70_C DPA, signal recognition particle receptor; FTSY, SRP-GTPase, protein-targeting, transport protein; HET: GDP; 1.97A {Pyrococcus furiosus} PDB: 3dmd_B 3dm9_B* | Back alignment and structure |
|---|
| >1w1w_A Structural maintenance of chromosome 1; cohesin, chromosome segregation, cell adhesion, kleisin, MIT cell cycle; HET: ATG; 2.90A {Saccharomyces cerevisiae} SCOP: c.37.1.12 | Back alignment and structure |
|---|
| >1lw7_A Transcriptional regulator NADR; NMN, NMN adenylyl transferase, ribosylnicotinamide KINA transferase; HET: NAD; 2.90A {Haemophilus influenzae} SCOP: c.26.1.3 c.37.1.1 | Back alignment and structure |
|---|
| >2og2_A Putative signal recognition particle receptor; nucleotide-binding, protein transport; 2.00A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >1yqt_A RNAse L inhibitor; ATP-binding cassette, ribosome biogenesis, hydrolyase/translation complex; HET: ADP; 1.90A {Pyrococcus furiosus} | Back alignment and structure |
|---|
| >3j16_B RLI1P; ribosome recycling, translation, eukarya, ribosome; HET: ATP; 7.20A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3tqc_A Pantothenate kinase; biosynthesis of cofactors, prosthetic groups, carriers, TRAN; HET: ADP; 2.30A {Coxiella burnetii} | Back alignment and structure |
|---|
| >2dr3_A UPF0273 protein PH0284; RECA superfamily ATPase, hexamer, structural genomics; HET: ADP; 2.00A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >3bk7_A ABC transporter ATP-binding protein; ABC ATPase, iron-sulfur cluster, adenosine diphosphate, nucleotide-binding; HET: ADP; 2.80A {Pyrococcus abyssi} PDB: 3j15_B* | Back alignment and structure |
|---|
| >2qt1_A Nicotinamide riboside kinase 1; non-protein kinase, NAD+, NRK1, nicotinic acid riboside kinase activity, NAD biosynthesis; HET: NNR; 1.32A {Homo sapiens} PDB: 2qsy_A* 2qsz_A* 2qt0_A* 2p0e_A* 2qg6_A* 2ql6_A* | Back alignment and structure |
|---|
| >2x8a_A Nuclear valosin-containing protein-like; nuclear protein; 2.60A {Homo sapiens} | Back alignment and structure |
|---|
| >2qor_A Guanylate kinase; phosphotransferase, purine metabolism, structural genomics, structural genomics of pathogenic protozoa consortium; HET: 5GP POP; 1.80A {Plasmodium vivax} | Back alignment and structure |
|---|
| >2oap_1 GSPE-2, type II secretion system protein; hexameric ATPase, hydrolase; HET: ANP; 2.95A {Archaeoglobus fulgidus} PDB: 2oaq_1 | Back alignment and structure |
|---|
| >1pzn_A RAD51, DNA repair and recombination protein RAD51, RADA; heptameric ring, heptamer, ring, oligomer, RAD51 polymerizat motif; HET: DNA; 2.85A {Pyrococcus furiosus} SCOP: a.60.4.1 c.37.1.11 | Back alignment and structure |
|---|
| >3cm0_A Adenylate kinase; ATP-binding, cytoplasm, nucleotide biosynthesis, nucleotide-binding, transferase, structural genomics; 1.80A {Thermus thermophilus} | Back alignment and structure |
|---|
| >3ozx_A RNAse L inhibitor; ATP binding cassette protein, hydrolase, translation; HET: ADP; 2.05A {Sulfolobus solfataricus} | Back alignment and structure |
|---|
| >2ze6_A Isopentenyl transferase; crown GALL tumor, cytokinin biosynthesis; HET: DST AMP; 2.10A {Agrobacterium tumefaciens} PDB: 2ze5_A* 2ze7_A* 2ze8_A | Back alignment and structure |
|---|
| >2qm8_A GTPase/ATPase; G protein, G3E, metallochaperone, chaperone; HET: MSE; 1.70A {Methylobacterium extorquens} SCOP: c.37.1.10 PDB: 2qm7_A* | Back alignment and structure |
|---|
| >3b5x_A Lipid A export ATP-binding/permease protein MSBA; ABC transporter, lipid flippase, hydrolase, inner membrane, lipid transport, membrane; 5.50A {Vibrio cholerae} | Back alignment and structure |
|---|
| >2diq_A Tudor and KH domain-containing protein; tudor domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.34.9.1 | Back alignment and structure |
|---|
| >1qhl_A Protein (cell division protein MUKB); SMC, chromosome partitioning; 2.20A {Escherichia coli} SCOP: c.37.1.12 | Back alignment and structure |
|---|
| >3j16_B RLI1P; ribosome recycling, translation, eukarya, ribosome; HET: ATP; 7.20A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3kb2_A SPBC2 prophage-derived uncharacterized protein YORR; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; HET: G3D; 2.20A {Bacillus subtilis} SCOP: c.37.1.1 PDB: 2axp_A* | Back alignment and structure |
|---|
| >1ly1_A Polynucleotide kinase; PNK, phosphatase, transferase; 2.00A {Enterobacteria phage T4} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >2yvu_A Probable adenylyl-sulfate kinase; transferase, structural genomics, NPPSFA, national P protein structural and functional analyses; 2.10A {Aeropyrum pernix} | Back alignment and structure |
|---|
| >3b60_A Lipid A export ATP-binding/permease protein MSBA; ABC transporter, lipid flippase, hydrolase, inner membrane, lipid transport, membrane; HET: ANP; 3.70A {Salmonella typhimurium} SCOP: c.37.1.12 f.37.1.1 PDB: 3b5y_A* 3b5z_A* 3b5w_A | Back alignment and structure |
|---|
| >4a82_A Cystic fibrosis transmembrane conductance regulat; CFTR, ION channel, transport protein, casse protein; 2.00A {Homo sapiens} PDB: 2onj_A* 2hyd_A | Back alignment and structure |
|---|
| >3qf4_B Uncharacterized ABC transporter ATP-binding prote TM_0288; multidrug transporter, transport protein; HET: ANP; 2.90A {Thermotoga maritima} | Back alignment and structure |
|---|
| >2iw3_A Elongation factor 3A; acetylation, ATP-binding, protein biosynthesis, nucleotide-binding, phosphorylation, RNA- binding, rRNA-binding; HET: ADP; 2.4A {Saccharomyces cerevisiae} PDB: 2iwh_A* 2ix3_A 2ix8_A | Back alignment and structure |
|---|
| >1tq4_A IIGP1, interferon-inducible GTPase; interferon gamma, dimer, immunology, signaling protein; HET: GDP; 1.95A {Mus musculus} SCOP: c.37.1.8 PDB: 1tqd_A* 1tq6_A* 1tpz_A* 1tq2_A* | Back alignment and structure |
|---|
| >1ixz_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 2.20A {Thermus thermophilus} SCOP: c.37.1.20 PDB: 1iy0_A* 1iy1_A* | Back alignment and structure |
|---|
| >2obl_A ESCN; ATPase, hydrolase; 1.80A {Escherichia coli O127} PDB: 2obm_A* | Back alignment and structure |
|---|
| >3ux8_A Excinuclease ABC, A subunit; UVRA, nucleotide excision repair, DNA repair, ABC ATPase, DN binding protein; HET: ADP; 2.10A {Geobacillus} | Back alignment and structure |
|---|
| >1in4_A RUVB, holliday junction DNA helicase RUVB; AAA+-class ATPase, winged-helix domain, ATP hydrolysis, walker A, walker B, sensor 1, sensor 2; HET: ADP; 1.60A {Thermotoga maritima} SCOP: a.4.5.11 c.37.1.20 PDB: 1in5_A* 1in6_A* 1in8_A* 1in7_A* 1j7k_A* | Back alignment and structure |
|---|
| >1vma_A Cell division protein FTSY; TM0570, structural genomics, JCS protein structure initiative, PSI, joint center for structu genomics; HET: CIT; 1.60A {Thermotoga maritima} SCOP: a.24.13.1 c.37.1.10 | Back alignment and structure |
|---|
| >1svm_A Large T antigen; AAA+ fold, viral protein; HET: ATP; 1.94A {Simian virus 40} SCOP: c.37.1.20 PDB: 1svl_A* 1svo_A 1n25_A 2h1l_A | Back alignment and structure |
|---|
| >3lw7_A Adenylate kinase related protein (ADKA-like); AMP, PSI, MCSG, structural genomics, midwest center for structural genomics; HET: AMP; 2.30A {Sulfolobus solfataricus} PDB: 3h0k_A | Back alignment and structure |
|---|
| >1zu4_A FTSY; GTPase, signal recognition particle, SRP, receptor, protein transport; 1.95A {Mycoplasma mycoides} PDB: 1zu5_A | Back alignment and structure |
|---|
| >2qag_B Septin-6, protein NEDD5; cell cycle, cell division, GTP-binding, nucleotide-binding, phosphorylation, acetylation, alternative splicing, coiled coil; HET: GDP GTP; 4.00A {Homo sapiens} | Back alignment and structure |
|---|
| >1via_A Shikimate kinase; structural genomics, transferase; HET: MSE; 1.57A {Campylobacter jejuni} SCOP: c.37.1.2 | Back alignment and structure |
|---|
| >2yv5_A YJEQ protein; hydrolase, GTPase, permutation, structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: GDP; 1.90A {Aquifex aeolicus} | Back alignment and structure |
|---|
| >3lda_A DNA repair protein RAD51; DNA binding protein, ATP-binding, DNA damage, DNA recombinat repair, nucleotide-binding; HET: DNA; 2.50A {Saccharomyces cerevisiae} PDB: 1szp_A* | Back alignment and structure |
|---|
| >3pih_A Uvrabc system protein A; hydrolase, ABC ATPase, DNA repair, nucleotide excision repai hydrolase-DNA complex; HET: DNA; 2.90A {Thermotoga maritima} | Back alignment and structure |
|---|
| >4eaq_A DTMP kinase, thymidylate kinase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, MTBI, transferase; HET: ATM; 1.85A {Staphylococcus aureus subsp} PDB: 4dwj_A* 4f4i_A | Back alignment and structure |
|---|
| >2rhm_A Putative kinase; P-loop containing nucleoside triphosphate hydrolases fold, S genomics, joint center for structural genomics, JCSG; HET: MSE; 1.70A {Chloroflexus aurantiacus} | Back alignment and structure |
|---|
| >1iy2_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 3.20A {Thermus thermophilus} SCOP: c.37.1.20 | Back alignment and structure |
|---|
| >1m7g_A Adenylylsulfate kinase; APS kinase, transferase, sulfate Met nucleotide 2 kinase; HET: AV2 ADX ADP; 1.43A {Penicillium chrysogenum} SCOP: c.37.1.4 PDB: 1d6j_A* 1m7h_A* 3cr7_A* | Back alignment and structure |
|---|
| >3cr8_A Sulfate adenylyltranferase, adenylylsulfate kinase; APS kinase, transferase, sulfate metabolism, nucleotide 2 kinase; 2.95A {Thiobacillus denitrificans} | Back alignment and structure |
|---|
| >1qhx_A CPT, protein (chloramphenicol phosphotransferase); kinase, antibiotic resistance, phosphorylation, mononucleoti binding fold; HET: ATP; 2.50A {Streptomyces venezuelae} SCOP: c.37.1.3 PDB: 1grr_A* 1grq_A 1qhs_A* 1qhn_A* 1qhy_A* | Back alignment and structure |
|---|
| >3ux8_A Excinuclease ABC, A subunit; UVRA, nucleotide excision repair, DNA repair, ABC ATPase, DN binding protein; HET: ADP; 2.10A {Geobacillus} | Back alignment and structure |
|---|
| >3qf4_A ABC transporter, ATP-binding protein; multidrug transporter, transport protein; HET: ANP; 2.90A {Thermotoga maritima} | Back alignment and structure |
|---|
| >2p5t_B PEZT; postsegregational killing system, phosphoryltransferase, HEL helix motif, transcription regulator; 3.20A {Streptococcus pneumoniae} | Back alignment and structure |
|---|
| >1gvn_B Zeta; postsegregational killing system, plasmid; 1.95A {Streptococcus pyogenes} SCOP: c.37.1.21 PDB: 3q8x_B* | Back alignment and structure |
|---|
| >1oix_A RAS-related protein RAB-11A; small G protein, intracellular trafficking, GTP-binding, lipoprotein, prenylation, protein transport; HET: GDP; 1.7A {Homo sapiens} SCOP: c.37.1.8 PDB: 1oiw_A* 1oiv_A* 3rwo_B* 3rwm_B* | Back alignment and structure |
|---|
| >1y63_A LMAJ004144AAA protein; structural genomics, protein structure initiative, PSI, SGPP structural genomics of pathogenic protozoa consortium; HET: ADP; 1.70A {Leishmania major} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >2dpy_A FLII, flagellum-specific ATP synthase; beta barrel, alpha-beta structure, hydrolase; HET: ADP; 2.40A {Salmonella typhimurium} | Back alignment and structure |
|---|
| >1vht_A Dephospho-COA kinase; structural genomics, transferase; HET: BA3; 1.59A {Escherichia coli} SCOP: c.37.1.1 PDB: 1vhl_A* 1viy_A 1t3h_A 1n3b_A | Back alignment and structure |
|---|
| >1tf7_A KAIC; homohexamer, hexamer, circadian clock protein; HET: ATP; 2.80A {Synechococcus SP} SCOP: c.37.1.11 c.37.1.11 PDB: 3s1a_A* 1u9i_A* 2gbl_A* 3dvl_A* 3k0a_A* 3k09_A* 3jzm_A* 3k0e_A* 4dug_A* 3ua2_A* 3k0c_A* 3k0f_A* | Back alignment and structure |
|---|
| >4ad8_A DNA repair protein RECN; DNA binding protein, ATPase domain; HET: DNA; 4.00A {Deinococcus radiodurans} | Back alignment and structure |
|---|
| >2px0_A Flagellar biosynthesis protein FLHF; SRP GTPase, flagellum, protein transport, biosynthetic protein; HET: GNP; 3.00A {Bacillus subtilis} PDB: 2px3_A* 3syn_A* | Back alignment and structure |
|---|
| >1ls1_A Signal recognition particle protein; FFH, SRP54, SRP, GTPase, ultrahigh resolution, protein transport; 1.10A {Thermus aquaticus} SCOP: a.24.13.1 c.37.1.10 PDB: 1jpn_B* 1jpj_A* 1ry1_U* 2j45_A* 1o87_A* 2c04_A* 2j46_A* 1rj9_B* 2c03_A* 2j7p_A* 1okk_A* 2cnw_A* 1ng1_A* 2xkv_A 3ng1_A 1ffh_A 2ng1_A* | Back alignment and structure |
|---|
| >3nwj_A ATSK2; P loop, shikimate, nucleoside monophosphate kinase, shikimat ATP binding, chloroplast, transferase; 2.35A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >2orw_A Thymidine kinase; TMTK, TP4A, transferase; HET: 4TA; 1.50A {Thermotoga maritima} PDB: 2qpo_A 2qq0_A* 2qqe_A* | Back alignment and structure |
|---|
| >1kht_A Adenylate kinase; phosphotransferase, signaling protein, transferase; HET: AMP; 2.50A {Methanococcus voltae} SCOP: c.37.1.1 PDB: 3h86_B* 1ki9_A | Back alignment and structure |
|---|
| >2f9l_A RAB11B, member RAS oncogene family; RAB11B GTPase, vesicle transport, hydrolase; HET: GDP; 1.55A {Homo sapiens} SCOP: c.37.1.8 PDB: 2f9m_A* 1yzk_A* 2hv8_A* 2gzd_A* 2gzh_A* 2d7c_A* 3bfk_A* | Back alignment and structure |
|---|
| >1tev_A UMP-CMP kinase; ploop, NMP binding region, LID region, conformational changes, transferase; 2.10A {Homo sapiens} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >1u0l_A Probable GTPase ENGC; permutation, OB-fold, zinc-finger, structural genomics, BSGC structure funded by NIH, protein structure initiative, PSI; HET: GDP; 2.80A {Thermotoga maritima} SCOP: b.40.4.5 c.37.1.8 | Back alignment and structure |
|---|
| >3hr8_A Protein RECA; alpha and beta proteins (A/B, A+B), ATP-binding, cytoplasm, damage, DNA recombination, DNA repair, DNA-binding; 1.95A {Thermotoga maritima} | Back alignment and structure |
|---|
| >2vli_A Antibiotic resistance protein; transferase, tunicamycin, phosphotransferase; 1.95A {Deinococcus radiodurans} | Back alignment and structure |
|---|
| >1q3t_A Cytidylate kinase; nucleotide monophosphate kinase, CMP kinase, transferase; NMR {Streptococcus pneumoniae} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >1ex7_A Guanylate kinase; substrate-induced FIT, domain movement, GMP, ATP, substrate specificity, X-RAY diffraction, transferase; HET: 5GP; 1.90A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 1ex6_A* 1gky_A* 3sqk_A 4f4j_A | Back alignment and structure |
|---|
| >2rcn_A Probable GTPase ENGC; YJEQ, circularly permuted, GTP-binding, hydrolase, nucleotide-binding; HET: GDP; 2.25A {Salmonella typhimurium} PDB: 2ykr_W 4a2i_V | Back alignment and structure |
|---|
| >2f1r_A Molybdopterin-guanine dinucleotide biosynthesis protein B (MOBB); structural genomics, PSI, protein structure initiative; 2.10A {Archaeoglobus fulgidus} | Back alignment and structure |
|---|
| >2r6f_A Excinuclease ABC subunit A; UVRA, nucleotide excision repair, DNA repair, ABC ATPase, at cassette, DNA damage, DNA excision; HET: ADP; 3.20A {Geobacillus stearothermophilus} PDB: 3uwx_A | Back alignment and structure |
|---|
| >1np6_A Molybdopterin-guanine dinucleotide biosynthesis protein B; mixed alpha-beta fold, elongated beta-sheet, walker A motif, P-loop structural motif; 1.90A {Escherichia coli} SCOP: c.37.1.10 PDB: 1p9n_A | Back alignment and structure |
|---|
| >1sxj_E Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 | Back alignment and structure |
|---|
| >3iij_A Coilin-interacting nuclear ATPase protein; alpha and beta proteins (A/B), protein binding, transferase, phosphotransferase; HET: ADP; 1.76A {Homo sapiens} SCOP: c.37.1.1 PDB: 3iik_A 3iil_A* 3iim_A* 1rkb_A | Back alignment and structure |
|---|
| >3szr_A Interferon-induced GTP-binding protein MX1; interferon-induced antiviral GTPase, membrane associated, PR binding; 3.50A {Homo sapiens} PDB: 3zys_B | Back alignment and structure |
|---|
| >2c95_A Adenylate kinase 1; transferase, AP4A, nucleotide kinase, transferase ATP-bindi; HET: B4P; 1.71A {Homo sapiens} PDB: 1z83_A* 3adk_A | Back alignment and structure |
|---|
| >1uf9_A TT1252 protein; P-loop, nucleotide binding domain, structural genomics, riken structural genomics/proteomics initiative, RSGI; HET: ATP; 2.80A {Thermus thermophilus} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >2jaq_A Deoxyguanosine kinase; transferase, deoxyribonucleoside kinase; HET: DCP; 2.3A {Mycoplasma mycoides subsp} PDB: 2jat_A* 2jas_A* | Back alignment and structure |
|---|
| >2vf7_A UVRA2, excinuclease ABC, subunit A.; DNA-binding protein, nucleotide-binding, zinc-binding domain, SOS response, metal-binding; HET: ADP; 2.30A {Deinococcus radiodurans} PDB: 2vf8_A* | Back alignment and structure |
|---|
| >1lv7_A FTSH; alpha/beta domain, four helix bundle, hydrolase; 1.50A {Escherichia coli} SCOP: c.37.1.20 | Back alignment and structure |
|---|
| >2qnr_A Septin-2, protein NEDD5; structural genomics consortium, SGC, mitosis, GDP, C cycle, cell division, GTP-binding, nucleotide-binding; HET: GDP; 2.60A {Homo sapiens} PDB: 2qa5_A* 3ftq_A* | Back alignment and structure |
|---|
| >1qf9_A UMP/CMP kinase, protein (uridylmonophosphate/cytidylmonophosphate kinase); nucleoside monophosphate kinase, NMP kinase; HET: ADP C5P; 1.70A {Dictyostelium discoideum} SCOP: c.37.1.1 PDB: 1uke_A* 2ukd_A* 3ukd_A* 4ukd_A* 5ukd_A* | Back alignment and structure |
|---|
| >3bos_A Putative DNA replication factor; P-loop containing nucleoside triphosphate hydrolases, struct genomics; HET: MSE CDP; 1.75A {Shewanella amazonensis} PDB: 3sc3_A | Back alignment and structure |
|---|
| >1pui_A ENGB, probable GTP-binding protein ENGB; structural genomics, nysgxrc T16, GTPase, PSI, protein structure initiative; 2.00A {Escherichia coli} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >1gtv_A TMK, thymidylate kinase; transferase, transferase (ATP:TMP phosphotransferase); HET: TYD TMP; 1.55A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1g3u_A* 1gsi_A* 1mrn_A* 1mrs_A* 1n5i_A* 1n5j_A* 1n5k_A* 1n5l_A* 1w2g_A* 1w2h_A* | Back alignment and structure |
|---|
| >1nks_A Adenylate kinase; thermophilic, transferase; HET: AMP ADP; 2.57A {Sulfolobus acidocaldarius} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >3dlm_A Histone-lysine N-methyltransferase setdb1; setdb1_human, structural genomics, structural genomics consortium, SGC, alternative splicing; 1.77A {Homo sapiens} | Back alignment and structure |
|---|
| >3ake_A Cytidylate kinase; CMP kinase, CMP complex, open conformation, nucleotide metab transferase; HET: C5P; 1.50A {Thermus thermophilus} PDB: 3akc_A* 3akd_A* | Back alignment and structure |
|---|
| >2zr9_A Protein RECA, recombinase A; recombination, RECA mutants, DNA-repair, ATP-binding, DNA DA recombination, DNA repair, DNA-binding; HET: DTP; 2.50A {Mycobacterium smegmatis str} PDB: 2zr0_A* 2zra_A* 2zrb_A 2zrm_A* 1ubc_A* 1ubf_A* 1ubg_A* 1ube_A* 2g88_A* 2odw_A* 2oe2_A 2oep_A* 2oes_A 2ofo_A 2zr7_A 2odn_A* 2zrn_A 2zro_A* 2zrp_A* 2zre_A* ... | Back alignment and structure |
|---|
| >3r20_A Cytidylate kinase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, ADP, DCMP, D transferase; 2.00A {Mycobacterium smegmatis} SCOP: c.37.1.0 PDB: 3r8c_A 4die_A* | Back alignment and structure |
|---|
| >2plr_A DTMP kinase, probable thymidylate kinase; TMP-binding, ATP-binding, structural GEN NPPSFA; HET: 1PE PGE EPE PG4; 1.60A {Sulfolobus tokodaii} | Back alignment and structure |
|---|
| >1t9h_A YLOQ, probable GTPase ENGC; N-terminal beta-barrel domain with oligonucleotide binding fold, central GTP binding domain; 1.60A {Bacillus subtilis} SCOP: b.40.4.5 c.37.1.8 | Back alignment and structure |
|---|
| >2w58_A DNAI, primosome component (helicase loader); ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.50A {Geobacillus kaustophilus HTA426} | Back alignment and structure |
|---|
| >3a4m_A L-seryl-tRNA(SEC) kinase; P-loop motif, walker A motif, ATP binding motif, ATP- binding, nucleotide-binding, transferase; HET: ADP; 1.79A {Methanocaldococcus jannaschii} PDB: 3a4l_A* 3a4n_A 3am1_A* 3add_A* 3adc_A* 3adb_A* | Back alignment and structure |
|---|
| >1e6c_A Shikimate kinase; phosphoryl transfer, ADP, shikimate pathway, P-loop protein, transferase; 1.8A {Erwinia chrysanthemi} SCOP: c.37.1.2 PDB: 1shk_A 2shk_A* | Back alignment and structure |
|---|
| >1zd8_A GTP:AMP phosphotransferase mitochondrial; ATP:AMP phosphotransferase, myokinase, structural genomics, structural genomics consortium, SGC; 1.48A {Homo sapiens} PDB: 2ak3_A* | Back alignment and structure |
|---|
| >1ukz_A Uridylate kinase; transferase; HET: ADP AMP; 1.90A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 1uky_A* | Back alignment and structure |
|---|
| >1njg_A DNA polymerase III subunit gamma; rossman-like fold, AAA+ ATPase domains, sensor 1, sensor 2, transferase; HET: DNA; 2.20A {Escherichia coli} SCOP: c.37.1.20 PDB: 1njf_A* | Back alignment and structure |
|---|
| >3trf_A Shikimate kinase, SK; amino acid biosynthesis, transferase; 2.60A {Coxiella burnetii} | Back alignment and structure |
|---|
| >2wwf_A Thymidilate kinase, putative; transferase, malaria; HET: TMP ADP; 1.89A {Plasmodium falciparum} PDB: 2wwg_A* 2wwh_A* 2wwi_A* | Back alignment and structure |
|---|
| >2ro0_A Histone acetyltransferase ESA1; HAT, chromodomain, tudor domain, RNA binding, activator, chromatin regulator, transcription; NMR {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1odf_A YGR205W, hypothetical 33.3 kDa protein in ADE3-Ser2 intergenic region; yeast protein, ATP binding protein; 2.25A {Saccharomyces cerevisiae} SCOP: c.37.1.6 | Back alignment and structure |
|---|
| >2wac_A CG7008-PA; unknown function, tudor, beta-barrel, nuclease domain, tudor P100, SND1, methylated arginine, SDMA, splicing; 2.10A {Drosophila melanogaster} | Back alignment and structure |
|---|
| >1ltq_A Polynucleotide kinase; phosphatase, alpha/beta, P-loop, transferase; HET: ADP; 2.33A {Enterobacteria phage T4} SCOP: c.108.1.9 c.37.1.1 PDB: 1rc8_A* 1rpz_A* 1rrc_A* 2ia5_A | Back alignment and structure |
|---|
| >2bwj_A Adenylate kinase 5; phosphoryl transfer reaction, transferase; HET: AMP; 2.3A {Homo sapiens} | Back alignment and structure |
|---|
| >1nn5_A Similar to deoxythymidylate kinase (thymidylate K; P-loop, D4TMP, transferase; HET: 2DT ANP; 1.50A {Homo sapiens} SCOP: c.37.1.1 PDB: 1e2e_A* 1e2d_A* 1e2g_A* 1e2q_A* 1e99_A* 1e9a_A* 1e9b_A* 1nmx_A* 1nmz_A* 1nn0_A* 1nn1_A* 1e2f_A* 1nn3_A* 2xx3_A* 1e9c_A* 1e9d_A* 1e9e_A* 1e98_A* 1nmy_A* 1e9f_A* | Back alignment and structure |
|---|
| >2www_A Methylmalonic aciduria type A protein, mitochondrial; transport protein, nucleotide-binding; HET: GDP 2PE; 2.64A {Homo sapiens} | Back alignment and structure |
|---|
| >2v54_A DTMP kinase, thymidylate kinase; nucleotide biosynthesis, ATP-binding, nucleotide-binding, poxvirus, transferase; HET: TYD POP; 2.4A {Vaccinia virus copenhagen} PDB: 2w0s_A* | Back alignment and structure |
|---|
| >2xb4_A Adenylate kinase; ATP-binding, nucleotide-binding, transferase; HET: SRT; 1.80A {Desulfovibrio gigas} PDB: 3l0s_A* 3l0p_A* | Back alignment and structure |
|---|
| >3cf0_A Transitional endoplasmic reticulum ATPase; AAA, P97/VCP, ERAD, CDC48, ATP-binding, lipid-binding, nucle binding, nucleus, phosphoprotein, transport; HET: ADP; 3.00A {Mus musculus} | Back alignment and structure |
|---|
| >1sxj_C Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 | Back alignment and structure |
|---|
| >1fnn_A CDC6P, cell division control protein 6; ORC1, AAA protein, DNA replication initation factor, cell cycle control factor; HET: ADP; 2.00A {Pyrobaculum aerophilum} SCOP: a.4.5.11 c.37.1.20 | Back alignment and structure |
|---|
| >2eko_A Histone acetyltransferase htatip; chromo domain, histone tail, chromatin organization modifier, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3ntk_A Maternal protein tudor; tudor domain, OB-fold, GERM cell formation, transcription; 1.80A {Drosophila melanogaster} PDB: 3nth_A* 3nti_A* | Back alignment and structure |
|---|
| >1wgs_A MYST histone acetyltransferase 1; tudor domain, MYST family, struct genomics, riken structural genomics/proteomics initiative; NMR {Mus musculus} SCOP: b.34.13.3 | Back alignment and structure |
|---|
| >2qag_C Septin-7; cell cycle, cell division, GTP-binding, nucleotide-binding, phosphorylation, acetylation, alternative splicing, coiled coil; HET: GDP GTP; 4.00A {Homo sapiens} | Back alignment and structure |
|---|
| >2iyv_A Shikimate kinase, SK; transferase, aromatic amino acid biosynthesis, P-loop kinase, metal- binding, shikimate pathway; HET: ADP; 1.35A {Mycobacterium tuberculosis} SCOP: c.37.1.2 PDB: 2iyr_A* 2iyq_A* 2iyt_A 2iyu_A* 2iys_A* 2iyw_A* 2iyx_A* 2iyy_A* 2iyz_A* 2g1k_A* 1l4y_A* 1u8a_A* 1we2_A* 1zyu_A* 2dfn_A* 2dft_A* 2g1j_A 1l4u_A* 3baf_A* | Back alignment and structure |
|---|
| >2b8t_A Thymidine kinase; deoxyribonucleoside kinase, zinc-binding domain, TK1, UU-TK, transferase; HET: THM; 2.00A {Ureaplasma parvum} SCOP: c.37.1.24 g.39.1.14 PDB: 2uz3_A* | Back alignment and structure |
|---|
| >2qby_A CDC6 homolog 1, cell division control protein 6 homolog 1; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} | Back alignment and structure |
|---|
| >2pbr_A DTMP kinase, thymidylate kinase; transferase, nucleotide biosynthesis, TMP-binding, A binding, structural genomics, NPPSFA; 1.96A {Aquifex aeolicus} | Back alignment and structure |
|---|
| >2p67_A LAO/AO transport system kinase; ARGK, structural GEN PSI-2, protein structure initiative, NEW YORK SGX research for structural genomics; 1.80A {Escherichia coli} SCOP: c.37.1.10 | Back alignment and structure |
|---|
| >2pt5_A Shikimate kinase, SK; aromatic amino acid biosynthesis, P-loop kinase, SHI kinase, shikimate pathway; 2.10A {Aquifex aeolicus} | Back alignment and structure |
|---|
| >2cdn_A Adenylate kinase; phosphoryl transfer, associative mechanism, ATP-binding, nucleotide biosynthesis, nucleotide-binding, transferase; HET: ADP; 1.9A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1p4s_A | Back alignment and structure |
|---|
| >1zak_A Adenylate kinase; ATP:AMP-phosphotransferase, transferase; HET: AP5; 3.50A {Zea mays} SCOP: c.37.1.1 g.41.2.1 | Back alignment and structure |
|---|
| >3zvl_A Bifunctional polynucleotide phosphatase/kinase; hydrolase-transferase complex, base excision repair, BER, non-homologous END-joining, NHEJ; 1.65A {Mus musculus} PDB: 3zvm_A* 3zvn_A* 1yj5_A 3u7e_B* 3u7f_B* 3u7h_B* 3u7g_A* | Back alignment and structure |
|---|
| >3fb4_A Adenylate kinase; psychrophIle, phosphotransferase, ATP-binding, nucleotide-binding, transferase; HET: AP5; 2.00A {Marinibacillus marinus} | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 1122 | ||||
| d1wb9a1 | 297 | a.113.1.1 (A:270-566) DNA repair protein MutS, dom | 2e-41 | |
| d1ewqa1 | 275 | a.113.1.1 (A:267-541) DNA repair protein MutS, dom | 3e-36 | |
| d1wb9a4 | 115 | d.75.2.1 (A:2-116) DNA repair protein MutS, domain | 7e-28 | |
| d1ewqa4 | 120 | d.75.2.1 (A:1-120) DNA repair protein MutS, domain | 8e-27 | |
| d1wb9a2 | 234 | c.37.1.12 (A:567-800) DNA repair protein MutS, the | 4e-23 | |
| d1ewqa2 | 224 | c.37.1.12 (A:542-765) DNA repair protein MutS, the | 3e-19 | |
| d1wb9a3 | 153 | c.55.6.1 (A:117-269) DNA repair protein MutS, doma | 2e-04 |
| >d1wb9a1 a.113.1.1 (A:270-566) DNA repair protein MutS, domain III {Escherichia coli [TaxId: 562]} Length = 297 | Back information, alignment and structure |
|---|
class: All alpha proteins fold: DNA repair protein MutS, domain III superfamily: DNA repair protein MutS, domain III family: DNA repair protein MutS, domain III domain: DNA repair protein MutS, domain III species: Escherichia coli [TaxId: 562]
Score = 152 bits (384), Expect = 2e-41
Identities = 72/322 (22%), Positives = 125/322 (38%), Gaps = 29/322 (9%)
Query: 650 DAPALENLEVFENSRSGDSSGTLYAQLNHCVTAFGKRLLRTWLARPLYNSGLIRERQDAV 709
DA NLE+ +N G + TL + L+ VT G R+L+ WL P+ ++ ++ ERQ +
Sbjct: 1 DAATRRNLEITQNLA-GGAENTLASVLDCTVTPMGSRMLKRWLHMPVRDTRVLLERQQTI 59
Query: 710 AGLRGVNQPFALEFRKALSRLPDMERLLARLFASSEANGRNSNKVVLYEDAAKKQLQEFI 769
L Q F + L ++ D+ER+LARL A A R+
Sbjct: 60 GAL----QDFTAGLQPVLRQVGDLERILARL-ALRTARPRD------------------- 95
Query: 770 SALHGCELMDQACSSLGAILENTESRQLHHILTPGKGLPAIVSILKHFKDAFDWVEANNS 829
L Q L A LE +S + + + +L+ V +
Sbjct: 96 --LARMRHAFQQLPELRAQLETVDSAPVQALREKMGEFAELRDLLERAIIDTPPVLVRDG 153
Query: 830 GRIIPHGGVDMDYDSACKKVKEIEASLTKHLKEQRKLLGDTSITYVTIGKDLYLLEVPES 889
G I G + + D L + +R+ G ++ Y +++
Sbjct: 154 GVIAS--GYNEELDEWRALADGATDYLERLEVRERERTGLDTLKVGFNAVHGYYIQISRG 211
Query: 890 LRGSVPRDYELRSSKKGFFRYWTPNIKKLLGELSQAESEKESALKSILQRLIGQFCEHHN 949
P +Y R + K RY P +K+ ++ ++ + + K + + L H
Sbjct: 212 QSHLAPINYMRRQTLKNAERYIIPELKEYEDKVLTSKGKALALEKQLYEELFDLLLPHLE 271
Query: 950 KWRQMVAATAELDALISLAIAS 971
+Q +A AELD L++LA +
Sbjct: 272 ALQQSASALAELDVLVNLAERA 293
|
| >d1ewqa1 a.113.1.1 (A:267-541) DNA repair protein MutS, domain III {Thermus aquaticus [TaxId: 271]} Length = 275 | Back information, alignment and structure |
|---|
| >d1wb9a4 d.75.2.1 (A:2-116) DNA repair protein MutS, domain I {Escherichia coli [TaxId: 562]} Length = 115 | Back information, alignment and structure |
|---|
| >d1ewqa4 d.75.2.1 (A:1-120) DNA repair protein MutS, domain I {Thermus aquaticus [TaxId: 271]} Length = 120 | Back information, alignment and structure |
|---|
| >d1wb9a2 c.37.1.12 (A:567-800) DNA repair protein MutS, the C-terminal domain {Escherichia coli [TaxId: 562]} Length = 234 | Back information, alignment and structure |
|---|
| >d1ewqa2 c.37.1.12 (A:542-765) DNA repair protein MutS, the C-terminal domain {Thermus aquaticus [TaxId: 271]} Length = 224 | Back information, alignment and structure |
|---|
| >d1wb9a3 c.55.6.1 (A:117-269) DNA repair protein MutS, domain II {Escherichia coli [TaxId: 562]} Length = 153 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 1122 | |||
| d1wb9a1 | 297 | DNA repair protein MutS, domain III {Escherichia c | 100.0 | |
| d1ewqa1 | 275 | DNA repair protein MutS, domain III {Thermus aquat | 100.0 | |
| d1wb9a2 | 234 | DNA repair protein MutS, the C-terminal domain {Es | 100.0 | |
| d1ewqa2 | 224 | DNA repair protein MutS, the C-terminal domain {Th | 100.0 | |
| d1wb9a4 | 115 | DNA repair protein MutS, domain I {Escherichia col | 100.0 | |
| d1ewqa4 | 120 | DNA repair protein MutS, domain I {Thermus aquatic | 100.0 | |
| d1ewqa3 | 146 | DNA repair protein MutS, domain II {Thermus aquati | 99.53 | |
| d1wb9a3 | 153 | DNA repair protein MutS, domain II {Escherichia co | 99.5 | |
| d2diga1 | 55 | Lamin-b receptor {Human (Homo sapiens) [TaxId: 960 | 97.08 | |
| d2d9ta1 | 60 | Tudor domain-containing protein 3, TDRD3 {Mouse (M | 96.72 | |
| d1ye8a1 | 178 | Hypothetical kinase-like protein Aq_1292 {Aquifex | 96.39 | |
| d1mhna_ | 59 | Survival motor neuron protein 1, smn {Human (Homo | 96.29 | |
| d1sgwa_ | 200 | Putative ABC transporter PF0895 {Pyrococcus furios | 95.76 | |
| d2i3ba1 | 189 | Cancer-related NTPase, C1orf57 {Human (Homo sapien | 95.27 | |
| d2awna2 | 232 | Maltose transport protein MalK, N-terminal domain | 95.25 | |
| d2onka1 | 240 | Molybdate/tungstate import ATP-binding protein Wtp | 95.24 | |
| d1v43a3 | 239 | Hypothetical protein PH0022, N-terminal domain {Py | 95.2 | |
| d2g3ra1 | 53 | p53-binding protein 1, 53BP1 {Human (Homo sapiens) | 95.14 | |
| d3dhwc1 | 240 | Methionine import ATP-binding protein MetN {Escher | 95.01 | |
| d1g2912 | 240 | Maltose transport protein MalK, N-terminal domain | 94.84 | |
| d1l2ta_ | 230 | MJ0796 {Archaeon Methanococcus jannaschii [TaxId: | 94.83 | |
| d1ji0a_ | 240 | Branched chain aminoacid ABC transporter {Thermoto | 94.75 | |
| d1oxxk2 | 242 | Glucose transport protein GlcV, N-terminal domain | 94.66 | |
| d3d31a2 | 229 | Sulfate/molybdate ABC transporter, ATP-binding pro | 94.57 | |
| d1g6ha_ | 254 | MJ1267 {Archaeon Methanococcus jannaschii [TaxId: | 94.3 | |
| d1r0wa_ | 281 | Cystic fibrosis transmembrane conductance regulato | 94.19 | |
| g1xew.1 | 329 | Smc head domain {Pyrococcus furiosus [TaxId: 2261] | 94.14 | |
| d1jj7a_ | 251 | Peptide transporter Tap1, C-terminal ABC domain {H | 93.94 | |
| d1mv5a_ | 242 | Multidrug resistance ABC transporter LmrA, C-termi | 93.81 | |
| d1b0ua_ | 258 | ATP-binding subunit of the histidine permease {Sal | 93.77 | |
| d1np6a_ | 170 | Molybdopterin-guanine dinucleotide biosynthesis pr | 93.76 | |
| d1vpla_ | 238 | Putative ABC transporter TM0544 {Thermotoga mariti | 93.76 | |
| d1l7vc_ | 231 | ABC transporter involved in vitamin B12 uptake, Bt | 93.62 | |
| g1f2t.1 | 292 | Rad50 {Archaeon Pyrococcus furiosus [TaxId: 2261]} | 93.59 | |
| d2pmka1 | 241 | Haemolysin B ATP-binding protein {Escherichia coli | 93.54 | |
| g1ii8.1 | 369 | Rad50 {Archaeon Pyrococcus furiosus [TaxId: 2261]} | 93.2 | |
| d1e69a_ | 308 | Smc head domain {Thermotoga maritima [TaxId: 2336] | 93.14 | |
| d2bdta1 | 176 | Hypothetical protein BH3686 {Bacillus halodurans [ | 93.13 | |
| d1qhla_ | 222 | Cell division protein MukB {Escherichia coli [TaxI | 93.06 | |
| d1ly1a_ | 152 | Polynucleotide kinase, kinase domain {Bacteriophag | 93.06 | |
| d3b60a1 | 253 | Multidrug resistance ABC transporter MsbA, C-termi | 93.04 | |
| d1knqa_ | 171 | Gluconate kinase {Escherichia coli [TaxId: 562]} | 93.0 | |
| d1qhxa_ | 178 | Chloramphenicol phosphotransferase {Streptomyces v | 92.53 | |
| d1khta_ | 190 | Adenylate kinase {Archaeon Methanococcus voltae [T | 91.93 | |
| d1w1wa_ | 427 | Smc head domain {Baker's yeast (Saccharomyces cere | 91.8 | |
| d1zp6a1 | 176 | Hypothetical protein Atu3015 {Agrobacterium tumefa | 91.77 | |
| d2diqa1 | 97 | Tudor and KH domain-containing protein TDRKH {Huma | 91.67 | |
| d1znwa1 | 182 | Guanylate kinase {Mycobacterium tuberculosis [TaxI | 91.39 | |
| d1kaga_ | 169 | Shikimate kinase (AroK) {Escherichia coli [TaxId: | 91.35 | |
| d2hyda1 | 255 | Putative multidrug export ATP-binding/permease pro | 91.34 | |
| d1lw7a2 | 192 | Transcriptional regulator NadR, ribosylnicotinamid | 91.33 | |
| d1nksa_ | 194 | Adenylate kinase {Archaeon Sulfolobus acidocaldari | 91.13 | |
| d1yj5a2 | 172 | 5' polynucleotide kinase-3' phosphatase, C-termina | 90.21 | |
| d1xjca_ | 165 | Molybdopterin-guanine dinucleotide biosynthesis pr | 89.57 | |
| d1y63a_ | 174 | Probable kinase LmjF30.1890 {Leishmania major [Tax | 89.01 | |
| d2hqxa1 | 90 | P100 co-activator, SND1 {Human (Homo sapiens) [Tax | 88.36 | |
| d1rkba_ | 173 | Adenylate kinase {Human (Homo sapiens), isoenzyme | 88.11 | |
| d1yrba1 | 244 | ATP(GTP)-binding protein PAB0955 {Pyrococcus abyss | 87.92 | |
| d1gkya_ | 186 | Guanylate kinase {Baker's yeast (Saccharomyces cer | 87.71 | |
| d1lvga_ | 190 | Guanylate kinase {Mouse (Mus musculus) [TaxId: 100 | 87.38 | |
| d1jjva_ | 205 | Dephospho-CoA kinase {Haemophilus influenzae [TaxI | 87.11 | |
| d1m8pa3 | 183 | ATP sulfurylase C-terminal domain {Fungus (Penicil | 87.0 | |
| d1iqpa2 | 231 | Replication factor C {Archaeon Pyrococcus furiosus | 86.89 | |
| d1vhta_ | 208 | Dephospho-CoA kinase {Escherichia coli [TaxId: 562 | 86.66 | |
| d1sxja2 | 253 | Replication factor C1 {Baker's yeast (Saccharomyce | 85.81 | |
| d1uf9a_ | 191 | Dephospho-CoA kinase {Thermus thermophilus [TaxId: | 85.69 | |
| d1kgda_ | 178 | Guanylate kinase-like domain of Cask {Human (Homo | 85.24 | |
| d1e6ca_ | 170 | Shikimate kinase (AroK) {Erwinia chrysanthemi [Tax | 85.22 | |
| d1s96a_ | 205 | Guanylate kinase {Escherichia coli [TaxId: 562]} | 84.17 | |
| d1sxjd2 | 237 | Replication factor C2 {Baker's yeast (Saccharomyce | 84.05 | |
| d1rz3a_ | 198 | Hypothetical protein rbstp0775 {Bacillus stearothe | 83.96 | |
| d1wgsa_ | 133 | Probable histone acetyltransferase MYST1 {Mouse (M | 83.89 | |
| d1gvnb_ | 273 | Plasmid maintenance system epsilon/zeta, toxin zet | 82.97 | |
| d1sxje2 | 252 | Replication factor C5 {Baker's yeast (Saccharomyce | 82.17 | |
| d1viaa_ | 161 | Shikimate kinase (AroK) {Campylobacter jejuni [Tax | 81.18 | |
| d1tf7a1 | 242 | Circadian clock protein KaiC {Synechococcus sp. st | 80.8 | |
| d1n0wa_ | 242 | DNA repair protein Rad51, catalytic domain {Human | 80.38 | |
| d3adka_ | 194 | Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} | 80.28 | |
| d1x6va3 | 195 | Adenosine-5'phosphosulfate kinase (APS kinase) {Hu | 80.1 | |
| d2iyva1 | 165 | Shikimate kinase (AroK) {Mycobacterium tuberculosi | 80.01 |
| >d1wb9a1 a.113.1.1 (A:270-566) DNA repair protein MutS, domain III {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
class: All alpha proteins fold: DNA repair protein MutS, domain III superfamily: DNA repair protein MutS, domain III family: DNA repair protein MutS, domain III domain: DNA repair protein MutS, domain III species: Escherichia coli [TaxId: 562]
Probab=100.00 E-value=5.9e-38 Score=350.09 Aligned_cols=295 Identities=21% Similarity=0.281 Sum_probs=234.6
Q ss_pred CHHHHHhcCCcccCCCCCCcccHHhHhhhcCChHHHHHHHHhhhccCCCHHHHHHHHHHHHHHHcCChhhHHHHHHhcCC
Q 001212 650 DAPALENLEVFENSRSGDSSGTLYAQLNHCVTAFGKRLLRTWLARPLYNSGLIRERQDAVAGLRGVNQPFALEFRKALSR 729 (1122)
Q Consensus 650 D~~Tl~nLEI~~n~~~g~~~gSL~~~Ln~c~T~~GkRlLr~Wl~~PL~d~~~I~~R~daVe~L~~~~~~~~~~lr~~Lk~ 729 (1122)
|++|++||||++|. .|+.+||||++||+|+|+||+|+||+||++|++|+++|++|||+|++|.. ....+|..|++
T Consensus 1 D~~T~~nLEl~~~~-~g~~~~SL~~~ln~c~T~~GkRlLr~wLl~Pl~d~~~I~~R~d~Ve~l~~----~~~~l~~~L~~ 75 (297)
T d1wb9a1 1 DAATRRNLEITQNL-AGGAENTLASVLDCTVTPMGSRMLKRWLHMPVRDTRVLLERQQTIGALQD----FTAGLQPVLRQ 75 (297)
T ss_dssp CHHHHHHTTSSSCT-TSCSTTSHHHHHCCCSSHHHHHHHHHHHHSCBCCHHHHHHHHHHHHHTGG----GHHHHHHHHHT
T ss_pred CHhHHHHhCcCcCC-CCCCCCcHHHHHcCCCCcHHHHHHHHHHhCccCCHHHHHHHHHHHHHHHH----hHHHHHHHHhc
Confidence 89999999999988 46678999999999999999999999999999999999999999999974 36689999999
Q ss_pred CCcHHHHHHHHhccccccCCCCccchhhHHHHHHHHHHHHHHHhhhHHHHHHHHHHHHHHhhcChhhHHhhhcCCCCchh
Q 001212 730 LPDMERLLARLFASSEANGRNSNKVVLYEDAAKKQLQEFISALHGCELMDQACSSLGAILENTESRQLHHILTPGKGLPA 809 (1122)
Q Consensus 730 lpDleRll~ri~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~L~~~~~~~~~~~~l~~~l~~~~s~~l~~l~~~~~~~~~ 809 (1122)
+||++|++.++..+... ...+..+...+..+..+..... ................+.
T Consensus 76 l~Dierl~~k~~~~~~~---------------~~~~~~~~~~~~~~~~~~~~~~-------~~~~~~~~~~~~~~~~~~- 132 (297)
T d1wb9a1 76 VGDLERILARLALRTAR---------------PRDLARMRHAFQQLPELRAQLE-------TVDSAPVQALREKMGEFA- 132 (297)
T ss_dssp TCSHHHHHHHHHHTCCC---------------HHHHHHHHHHHTTHHHHHHHHH-------SCCCHHHHHHHHHHCCCH-
T ss_pred cchHHHHHHHHHHHhhc---------------hhHHHHHHHHHHhhhhHHHHhh-------hccchhhhhhhccccchh-
Confidence 99999999999754311 1234444444444433322211 111111111111111222
Q ss_pred HHHHHHHHHhhhchH-hhcCCCCeeeCCCCChhHHHHHHHHHHHHHHHHHHHHHHHHHhcCCCceEEEecCceEEEEecc
Q 001212 810 IVSILKHFKDAFDWV-EANNSGRIIPHGGVDMDYDSACKKVKEIEASLTKHLKEQRKLLGDTSITYVTIGKDLYLLEVPE 888 (1122)
Q Consensus 810 l~~~l~~i~~~~d~~-~~~~~g~ii~~~G~d~elD~~~~~~~~i~~~L~~~l~~~~~~l~~~~i~y~~~~~~~y~ieV~~ 888 (1122)
.+.+.+...++.. ........++++|+++++|.+++.+.+++..+.++..+.+..++...+++......||+++++.
T Consensus 133 --~~~~~i~~~i~~~~~~~~~~~~~i~~g~~~~ld~l~~~~~~~~~~l~~l~~~~~~~~~~~~~~~~~~~~~g~~~~~~~ 210 (297)
T d1wb9a1 133 --ELRDLLERAIIDTPPVLVRDGGVIASGYNEELDEWRALADGATDYLERLEVRERERTGLDTLKVGFNAVHGYYIQISR 210 (297)
T ss_dssp --HHHHHHHHHBCSSCCSCSTTCCCBCTTSCHHHHHHHHHHHHHHHHHHHHHHHHHHHHTCTTCEEEEETTTEEEEEEEH
T ss_pred --hHHHHHHHHHhccChhhhccCCeeCCCCCchHHHHHHHHHHHHHHHHHHHHHHHHHcCCCcceEEEeeccceeeeecc
Confidence 3333444455321 1112222345999999999999999999999999988888888888788888888999999998
Q ss_pred cccCCCCCcEEEeeeecceEEEecchHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhhhHHHHHHHHHHHHHhHHHHH
Q 001212 889 SLRGSVPRDYELRSSKKGFFRYWTPNIKKLLGELSQAESEKESALKSILQRLIGQFCEHHNKWRQMVAATAELDALISLA 968 (1122)
Q Consensus 889 ~~~~~vp~~~~~~ss~k~~~rf~t~el~~l~~~l~~~~~~~~~~~~~il~~l~~~~~~~~~~l~~~~~~ia~LD~L~SlA 968 (1122)
.....+|.+|...+.+++..+|+|+++.+++.++.++++++...+..++.+++..+.+|.+.|..+++++|+||||+|||
T Consensus 211 ~~~~~~~~~~~~~~~~~~~~~~~t~~l~~l~~~l~~~~~~i~~~~~~~~~~l~~~~~~~~~~l~~~~~~iaeLD~l~S~A 290 (297)
T d1wb9a1 211 GQSHLAPINYMRRQTLKNAERYIIPELKEYEDKVLTSKGKALALEKQLYEELFDLLLPHLEALQQSASALAELDVLVNLA 290 (297)
T ss_dssp HHHTTSCTTCEEEEECSSEEEEECHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHGGGHHHHHHHHHHHHHHHHHHHHH
T ss_pred cccccccchhhhhhhcccceeeccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence 88888999999999999999999999999999999999999999999999999999999999999999999999999999
Q ss_pred HHhhhc
Q 001212 969 IASDFY 974 (1122)
Q Consensus 969 ~~a~~~ 974 (1122)
.+|..+
T Consensus 291 ~~A~~~ 296 (297)
T d1wb9a1 291 ERAYTL 296 (297)
T ss_dssp HHHHHT
T ss_pred HHHHhc
Confidence 999864
|
| >d1ewqa1 a.113.1.1 (A:267-541) DNA repair protein MutS, domain III {Thermus aquaticus [TaxId: 271]} | Back information, alignment and structure |
|---|
| >d1wb9a2 c.37.1.12 (A:567-800) DNA repair protein MutS, the C-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1ewqa2 c.37.1.12 (A:542-765) DNA repair protein MutS, the C-terminal domain {Thermus aquaticus [TaxId: 271]} | Back information, alignment and structure |
|---|
| >d1wb9a4 d.75.2.1 (A:2-116) DNA repair protein MutS, domain I {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1ewqa4 d.75.2.1 (A:1-120) DNA repair protein MutS, domain I {Thermus aquaticus [TaxId: 271]} | Back information, alignment and structure |
|---|
| >d1ewqa3 c.55.6.1 (A:121-266) DNA repair protein MutS, domain II {Thermus aquaticus [TaxId: 271]} | Back information, alignment and structure |
|---|
| >d1wb9a3 c.55.6.1 (A:117-269) DNA repair protein MutS, domain II {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2diga1 b.34.9.1 (A:8-62) Lamin-b receptor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2d9ta1 b.34.9.1 (A:8-67) Tudor domain-containing protein 3, TDRD3 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1ye8a1 c.37.1.11 (A:1-178) Hypothetical kinase-like protein Aq_1292 {Aquifex aeolicus [TaxId: 63363]} | Back information, alignment and structure |
|---|
| >d1mhna_ b.34.9.1 (A:) Survival motor neuron protein 1, smn {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1sgwa_ c.37.1.12 (A:) Putative ABC transporter PF0895 {Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d2i3ba1 c.37.1.11 (A:1-189) Cancer-related NTPase, C1orf57 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2awna2 c.37.1.12 (A:4-235) Maltose transport protein MalK, N-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2onka1 c.37.1.12 (A:1-240) Molybdate/tungstate import ATP-binding protein WtpC (ModC) {Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d1v43a3 c.37.1.12 (A:7-245) Hypothetical protein PH0022, N-terminal domain {Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d2g3ra1 b.34.9.1 (A:1485-1537) p53-binding protein 1, 53BP1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d3dhwc1 c.37.1.12 (C:1-240) Methionine import ATP-binding protein MetN {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1g2912 c.37.1.12 (1:1-240) Maltose transport protein MalK, N-terminal domain {Archaeon Thermococcus litoralis [TaxId: 2265]} | Back information, alignment and structure |
|---|
| >d1l2ta_ c.37.1.12 (A:) MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d1ji0a_ c.37.1.12 (A:) Branched chain aminoacid ABC transporter {Thermotoga maritima, TM1139 [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1oxxk2 c.37.1.12 (K:1-242) Glucose transport protein GlcV, N-terminal domain {Archaeon Sulfolobus solfataricus [TaxId: 2287]} | Back information, alignment and structure |
|---|
| >d3d31a2 c.37.1.12 (A:1-229) Sulfate/molybdate ABC transporter, ATP-binding protein {Methanosarcina acetivorans [TaxId: 2214]} | Back information, alignment and structure |
|---|
| >d1g6ha_ c.37.1.12 (A:) MJ1267 {Archaeon Methanococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d1r0wa_ c.37.1.12 (A:) Cystic fibrosis transmembrane conductance regulator, CFTR, nucleotide-binding domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1jj7a_ c.37.1.12 (A:) Peptide transporter Tap1, C-terminal ABC domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1mv5a_ c.37.1.12 (A:) Multidrug resistance ABC transporter LmrA, C-terminal domain {Lactococcus lactis [TaxId: 1358]} | Back information, alignment and structure |
|---|
| >d1b0ua_ c.37.1.12 (A:) ATP-binding subunit of the histidine permease {Salmonella typhimurium [TaxId: 90371]} | Back information, alignment and structure |
|---|
| >d1np6a_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1vpla_ c.37.1.12 (A:) Putative ABC transporter TM0544 {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1l7vc_ c.37.1.12 (C:) ABC transporter involved in vitamin B12 uptake, BtuD {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2pmka1 c.37.1.12 (A:467-707) Haemolysin B ATP-binding protein {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1e69a_ c.37.1.12 (A:) Smc head domain {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d2bdta1 c.37.1.25 (A:1-176) Hypothetical protein BH3686 {Bacillus halodurans [TaxId: 86665]} | Back information, alignment and structure |
|---|
| >d1qhla_ c.37.1.12 (A:) Cell division protein MukB {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1ly1a_ c.37.1.1 (A:) Polynucleotide kinase, kinase domain {Bacteriophage T4 [TaxId: 10665]} | Back information, alignment and structure |
|---|
| >d3b60a1 c.37.1.12 (A:329-581) Multidrug resistance ABC transporter MsbA, C-terminal domain {Salmonella typhimurium [TaxId: 90371]} | Back information, alignment and structure |
|---|
| >d1knqa_ c.37.1.17 (A:) Gluconate kinase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1qhxa_ c.37.1.3 (A:) Chloramphenicol phosphotransferase {Streptomyces venezuelae [TaxId: 54571]} | Back information, alignment and structure |
|---|
| >d1khta_ c.37.1.1 (A:) Adenylate kinase {Archaeon Methanococcus voltae [TaxId: 2188]} | Back information, alignment and structure |
|---|
| >d1w1wa_ c.37.1.12 (A:) Smc head domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1zp6a1 c.37.1.25 (A:6-181) Hypothetical protein Atu3015 {Agrobacterium tumefaciens [TaxId: 358]} | Back information, alignment and structure |
|---|
| >d2diqa1 b.34.9.1 (A:8-104) Tudor and KH domain-containing protein TDRKH {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1znwa1 c.37.1.1 (A:20-201) Guanylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1kaga_ c.37.1.2 (A:) Shikimate kinase (AroK) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2hyda1 c.37.1.12 (A:324-578) Putative multidrug export ATP-binding/permease protein SAV1866 {Staphylococcus aureus [TaxId: 1280]} | Back information, alignment and structure |
|---|
| >d1lw7a2 c.37.1.1 (A:220-411) Transcriptional regulator NadR, ribosylnicotinamide kinase domain {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1nksa_ c.37.1.1 (A:) Adenylate kinase {Archaeon Sulfolobus acidocaldarius [TaxId: 2285]} | Back information, alignment and structure |
|---|
| >d1yj5a2 c.37.1.1 (A:351-522) 5' polynucleotide kinase-3' phosphatase, C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1xjca_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1y63a_ c.37.1.1 (A:) Probable kinase LmjF30.1890 {Leishmania major [TaxId: 5664]} | Back information, alignment and structure |
|---|
| >d2hqxa1 b.34.9.1 (A:8-97) P100 co-activator, SND1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1rkba_ c.37.1.1 (A:) Adenylate kinase {Human (Homo sapiens), isoenzyme 6 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1yrba1 c.37.1.10 (A:1-244) ATP(GTP)-binding protein PAB0955 {Pyrococcus abyssi [TaxId: 29292]} | Back information, alignment and structure |
|---|
| >d1gkya_ c.37.1.1 (A:) Guanylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1lvga_ c.37.1.1 (A:) Guanylate kinase {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1jjva_ c.37.1.1 (A:) Dephospho-CoA kinase {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1m8pa3 c.37.1.15 (A:391-573) ATP sulfurylase C-terminal domain {Fungus (Penicillium chrysogenum) [TaxId: 5076]} | Back information, alignment and structure |
|---|
| >d1iqpa2 c.37.1.20 (A:2-232) Replication factor C {Archaeon Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d1vhta_ c.37.1.1 (A:) Dephospho-CoA kinase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1sxja2 c.37.1.20 (A:295-547) Replication factor C1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1uf9a_ c.37.1.1 (A:) Dephospho-CoA kinase {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1kgda_ c.37.1.1 (A:) Guanylate kinase-like domain of Cask {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1e6ca_ c.37.1.2 (A:) Shikimate kinase (AroK) {Erwinia chrysanthemi [TaxId: 556]} | Back information, alignment and structure |
|---|
| >d1s96a_ c.37.1.1 (A:) Guanylate kinase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1sxjd2 c.37.1.20 (D:26-262) Replication factor C2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1rz3a_ c.37.1.6 (A:) Hypothetical protein rbstp0775 {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1wgsa_ b.34.13.3 (A:) Probable histone acetyltransferase MYST1 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1gvnb_ c.37.1.21 (B:) Plasmid maintenance system epsilon/zeta, toxin zeta subunit {Streptococcus pyogenes [TaxId: 1314]} | Back information, alignment and structure |
|---|
| >d1sxje2 c.37.1.20 (E:4-255) Replication factor C5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1viaa_ c.37.1.2 (A:) Shikimate kinase (AroK) {Campylobacter jejuni [TaxId: 197]} | Back information, alignment and structure |
|---|
| >d1tf7a1 c.37.1.11 (A:14-255) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} | Back information, alignment and structure |
|---|
| >d1n0wa_ c.37.1.11 (A:) DNA repair protein Rad51, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d3adka_ c.37.1.1 (A:) Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d1x6va3 c.37.1.4 (A:34-228) Adenosine-5'phosphosulfate kinase (APS kinase) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2iyva1 c.37.1.2 (A:2-166) Shikimate kinase (AroK) {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|