Citrus Sinensis ID: 001244
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 1116 | ||||||
| 359479902 | 1258 | PREDICTED: uncharacterized protein LOC10 | 0.968 | 0.859 | 0.723 | 0.0 | |
| 297743865 | 1287 | unnamed protein product [Vitis vinifera] | 0.969 | 0.840 | 0.707 | 0.0 | |
| 449436513 | 1270 | PREDICTED: uncharacterized protein LOC10 | 0.968 | 0.851 | 0.673 | 0.0 | |
| 224131154 | 1231 | predicted protein [Populus trichocarpa] | 0.887 | 0.804 | 0.724 | 0.0 | |
| 356536729 | 1250 | PREDICTED: uncharacterized protein LOC10 | 0.940 | 0.84 | 0.686 | 0.0 | |
| 356536727 | 1247 | PREDICTED: uncharacterized protein LOC10 | 0.957 | 0.857 | 0.678 | 0.0 | |
| 224064434 | 1223 | predicted protein [Populus trichocarpa] | 0.901 | 0.822 | 0.707 | 0.0 | |
| 356502858 | 1235 | PREDICTED: uncharacterized protein LOC10 | 0.965 | 0.872 | 0.662 | 0.0 | |
| 357442557 | 1242 | Katanin p60 ATPase-containing subunit A- | 0.979 | 0.880 | 0.646 | 0.0 | |
| 356502860 | 1334 | PREDICTED: uncharacterized protein LOC10 | 0.859 | 0.718 | 0.719 | 0.0 |
| >gi|359479902|ref|XP_002267361.2| PREDICTED: uncharacterized protein LOC100260666 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
Score = 1539 bits (3985), Expect = 0.0, Method: Compositional matrix adjust.
Identities = 800/1106 (72%), Positives = 910/1106 (82%), Gaps = 25/1106 (2%)
Query: 27 KRSKATDAPPSTGDMPVAPPSEA---ASKSGSESREPELRSSDLDLTDDAKPADV----- 78
KRSK+ + S+ ++P P EA A +SGSE + + SD TD +K +D
Sbjct: 27 KRSKSQETASSSSEVPGPLPEEALCQAKESGSEHIDQAPQPSDPPRTDTSKASDACDVIA 86
Query: 79 -DKSVDADVEADALV--SPPTPGETAVDAEKSKAVGVVFNGRVKKRATKLGKVGSRIPWA 135
+KS +A E +ALV SP ++AV EKSK+V VV N R +KR+ K + + W
Sbjct: 87 KEKSTEAVAEGEALVAASPLPLVDSAVGGEKSKSVAVVSN-RGRKRSVK---SNATVAWG 142
Query: 136 RLISQCSQNSHLSMTGAVFTVGHNRQCDLYLKDPSISKNLCRLRRIENGGPSGALLEITG 195
+L+SQCSQ H + G +FT+G +R +L L+DPSIS LCRLR IE GG S LLEITG
Sbjct: 143 KLLSQCSQYPHQPLCGPLFTIGQSRASNLSLRDPSISNTLCRLRHIERGGASVVLLEITG 202
Query: 196 GKGEVEVNGNVHPKDSQVVLRGGDELVFSPSGKHSYIFQQLSDDTLAAPGIHPPMSILEA 255
GKG V+VNG +H K S +++ GGDELVFS SG+ +YIFQQ + D LAAP I +SILEA
Sbjct: 203 GKGVVQVNGKIHQKSSTLIISGGDELVFSASGQPAYIFQQFTSDNLAAPVIPSSVSILEA 262
Query: 256 QSAPLKTMHIEARSGDPSAVAGASILASLSNIQKDLSLIPPPTKAGVDAQN-SEIASLAS 314
QSAP+K +H+EARSGDPSAVAGASILASLSN++KDLSL+PPP K+G D Q +E+ +
Sbjct: 263 QSAPVKGIHVEARSGDPSAVAGASILASLSNLRKDLSLLPPP-KSGEDVQQGTEMTT--P 319
Query: 315 GCDGPEDRIPDVDMKDATSNNDDAGSSSRGKTVVPQSDAANENPNLDSIGLDACVDAEIG 374
C + IPD DMKDA NND AG SSR KT VP S+AANEN NL SIGLDAC D EIG
Sbjct: 320 PCGASDSCIPDADMKDA-ENNDVAGVSSREKTDVPSSEAANENLNLQSIGLDACTDTEIG 378
Query: 375 KIPGATYELRPLLRMLAGSSSPDFDISGGISKILDEQREIRELLKDSDRPTVLISARRQA 434
K+PGATYELRPLLRMLAGSSS DFD+SG ISKIL+EQREIRE+LKD + P L S RRQA
Sbjct: 379 KVPGATYELRPLLRMLAGSSSSDFDLSGSISKILEEQREIREILKDLEPPMALTSTRRQA 438
Query: 435 FKDSLQEGILGPENIEVSFESFPYYLSDITKNVLIASTYVHLKCNNFAKYASDLPTMCPR 494
FKDSLQEGIL ++IEVSFESFPYYLSD TKNVLI STY+HL FAKY DL ++CPR
Sbjct: 439 FKDSLQEGILSSDDIEVSFESFPYYLSDTTKNVLITSTYIHLMHIKFAKYTMDLSSVCPR 498
Query: 495 ILLSGPAGSEIYQETLAKALAKHFSARLLIVDSLLLPGGSS-KEADSVKESSRTEKASMF 553
ILLSGPAGSEIYQETL KALAKHF+ARLLIVDSLLLPGGS+ K+ D VKE++R E+AS+F
Sbjct: 499 ILLSGPAGSEIYQETLTKALAKHFTARLLIVDSLLLPGGSTPKDPDPVKENTRGERASIF 558
Query: 554 AKRAA---LLQHRKPTSSVEADITGGTAVGSQALPKPEISTASSKNYTFKKGDRVKFVGN 610
AKRAA +LQH+KP SSVEADITG + V S+ALPK E STA+SKNY FK G VKFVG
Sbjct: 559 AKRAAQAAVLQHKKPASSVEADITGASTVSSRALPKQETSTATSKNYIFKAG-IVKFVGP 617
Query: 611 VTSGTTVQPTLRGPGIGFRGRVILPFEDNDFSKIGVRFDRSIPEGNNLGGFCEDDHGFFC 670
SG + P LRGP G+RG+V+L FE+N SKIGVRFDRSIPEGN+LGG CEDDHGFFC
Sbjct: 618 PPSGFSPMPPLRGPTNGYRGKVLLAFEENGSSKIGVRFDRSIPEGNDLGGLCEDDHGFFC 677
Query: 671 TASSLRLDSSLGDEVDKLAINELFEVALNESKSSPLIVFVKDIEKSLTGNNDAYGALKSK 730
A LRLDSS D+VDKLA+NELFEVA NESKSSPLI+F+KDIEKS+ GN +AY
Sbjct: 678 PADLLRLDSSSSDDVDKLALNELFEVASNESKSSPLILFIKDIEKSIVGNPEAYXXXXXX 737
Query: 731 LENLPSNVVVIGSHTQLDSRKEKSHPGGLLFTKFGSNQTALLDLAFPDNFSRLHDRSKET 790
L+NLP N+V+IGSHTQ+DSRKEKSHPGGLLFTKFGSNQTALLDLAFPDNF RLHDRSKET
Sbjct: 738 LDNLPENIVIIGSHTQMDSRKEKSHPGGLLFTKFGSNQTALLDLAFPDNFGRLHDRSKET 797
Query: 791 PKALKQISRLFPNKVTIQLPQDEALLSDWKQQLERDVETLKGQSNIISIRSVLSRNGLDC 850
PK +KQ++RLFPNKV IQLPQDE+LL DWKQQL+RD ETLK Q+NI++IRSVL+RNGLDC
Sbjct: 798 PKTMKQLTRLFPNKVMIQLPQDESLLLDWKQQLDRDGETLKAQANIVNIRSVLNRNGLDC 857
Query: 851 VDLESLCIKDQTLTTEGVEKIVGWALSHHFMHCSEAPGKDAKLKISTESIMYGLNILQGI 910
DLE+L IKDQ+L ++GV+K+VGWALS+HFMHCS+A +D+KL IS+ESI YGLN+LQGI
Sbjct: 858 PDLETLSIKDQSLASDGVDKLVGWALSYHFMHCSDASVRDSKLLISSESISYGLNLLQGI 917
Query: 911 QSESKSLKKSLKDVVTENEFEKKLLADVIPPSDIGVTFDDIGALENVKDTLKELVMLPLQ 970
QSESKSLKKSLKDVVTENEFEKKLL+DVIPPSDIGVTFDDIGALENVKDTLKELVMLPLQ
Sbjct: 918 QSESKSLKKSLKDVVTENEFEKKLLSDVIPPSDIGVTFDDIGALENVKDTLKELVMLPLQ 977
Query: 971 RPELFCKGQLTKPCKGILLFGPPGTGKTMLAKAVATEAGANFINISMSSITSKWFGEGEK 1030
RPELFCKGQLTKPCKGILLFGPPGTGKTMLAKAVATEAGANFINISMSSITSKWFGEGEK
Sbjct: 978 RPELFCKGQLTKPCKGILLFGPPGTGKTMLAKAVATEAGANFINISMSSITSKWFGEGEK 1037
Query: 1031 YVKAVFSLASKIAPSVVFVDEVDSMLGRRENPGEHEAMRKMKNEFMVNWDGLRTKDKERV 1090
YVKAVFSLASKIAPSVVFVDEVDSMLGRRENPGEHEAMRKMKNEFMVNWDGLRTKDKERV
Sbjct: 1038 YVKAVFSLASKIAPSVVFVDEVDSMLGRRENPGEHEAMRKMKNEFMVNWDGLRTKDKERV 1097
Query: 1091 LVLAATNRPFDLDEAVVRRLPRRTCV 1116
LVLAATNRPFDLDEAV+RRLPRR V
Sbjct: 1098 LVLAATNRPFDLDEAVIRRLPRRLMV 1123
|
Source: Vitis vinifera Species: Vitis vinifera Genus: Vitis Family: Vitaceae Order: Vitales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|297743865|emb|CBI36835.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|449436513|ref|XP_004136037.1| PREDICTED: uncharacterized protein LOC101211144 [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|224131154|ref|XP_002321014.1| predicted protein [Populus trichocarpa] gi|222861787|gb|EEE99329.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|356536729|ref|XP_003536888.1| PREDICTED: uncharacterized protein LOC100794932 [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|356536727|ref|XP_003536887.1| PREDICTED: uncharacterized protein LOC100794406 [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|224064434|ref|XP_002301474.1| predicted protein [Populus trichocarpa] gi|222843200|gb|EEE80747.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|356502858|ref|XP_003520232.1| PREDICTED: uncharacterized protein LOC100800938 [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|357442557|ref|XP_003591556.1| Katanin p60 ATPase-containing subunit A-like protein [Medicago truncatula] gi|355480604|gb|AES61807.1| Katanin p60 ATPase-containing subunit A-like protein [Medicago truncatula] | Back alignment and taxonomy information |
|---|
| >gi|356502860|ref|XP_003520233.1| PREDICTED: uncharacterized protein LOC100801477 [Glycine max] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 1116 | ||||||
| TAIR|locus:2133298 | 1265 | AT4G02480 [Arabidopsis thalian | 0.946 | 0.834 | 0.629 | 0.0 | |
| TAIR|locus:2126783 | 1122 | AT4G24860 [Arabidopsis thalian | 0.297 | 0.295 | 0.661 | 3.9e-185 | |
| TAIR|locus:2132922 | 830 | AT4G28000 [Arabidopsis thalian | 0.172 | 0.232 | 0.675 | 5.4e-115 | |
| TAIR|locus:2031005 | 1003 | AT1G50140 [Arabidopsis thalian | 0.380 | 0.423 | 0.412 | 2.1e-101 | |
| TAIR|locus:2024522 | 829 | DAA1 "DUO1-activated ATPase 1" | 0.391 | 0.527 | 0.400 | 1.2e-94 | |
| TAIR|locus:4010714050 | 829 | AT5G52882 [Arabidopsis thalian | 0.390 | 0.525 | 0.406 | 6e-91 | |
| TAIR|locus:2137777 | 398 | AT4G27680 [Arabidopsis thalian | 0.168 | 0.472 | 0.576 | 7.1e-54 | |
| TAIR|locus:2168646 | 403 | AT5G53540 [Arabidopsis thalian | 0.168 | 0.466 | 0.560 | 1.1e-52 | |
| ASPGD|ASPL0000064167 | 410 | AN7047 [Emericella nidulans (t | 0.168 | 0.458 | 0.517 | 5.9e-48 | |
| UNIPROTKB|G4MSN3 | 424 | MGG_07075 "ATPase family AAA d | 0.164 | 0.433 | 0.5 | 1.8e-47 |
| TAIR|locus:2133298 AT4G02480 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 3313 (1171.3 bits), Expect = 0., Sum P(2) = 0.
Identities = 692/1099 (62%), Positives = 817/1099 (74%)
Query: 37 STGDMPVAPPSEAASKSGSESREPELRSSDLDLTDDAKPA---DV---DKS--VDADVEA 88
S ++P+ A S GSES EPEL SSD D KP DV + S DA+ E
Sbjct: 56 SASEVPIENQGPA-SDPGSESGEPELGSSDPQAMDAEKPVVTTDVPVMENSPETDANPEV 114
Query: 89 DALVSPPTPGETAVDAEKSKAVGVVFNGRVKKRATKLGKVGSRIPWARLISQCSQNSHLS 148
+ L +P GE DA+KSKA KKRA K PWA+L+SQ SQN H
Sbjct: 115 EVLATPTVAGEAVADADKSKAA--------KKRALKA-------PWAKLLSQYSQNPHRV 159
Query: 149 MTGAVFTVGHNRQCDLYLKDPSISKNLCRLRRIENGGPSGALLEITXXXXXXXXXXXXHP 208
+ G VFTVG R CDL ++D ++ LC L++ E+GGPS A LEI +
Sbjct: 160 IRGPVFTVGR-RGCDLSIRDQAMPSTLCELKQSEHGGPSVASLEILGNGVIVHVNGKCYQ 218
Query: 209 KDSQVVLRGGDELVFSPSGKHSYIFQQLSDDTLAAPGIHPPMSILEAQSAPLKTMHIEAR 268
K + V LRGGDE++FS +GKH+YIFQ + D+ LAAP +SI EA+ APLK +H+E R
Sbjct: 219 KSTCVHLRGGDEVIFSLNGKHAYIFQPVKDENLAAPDRASSLSICEARGAPLKGVHVETR 278
Query: 269 SGD---PSAVAGASILASLSNIQKDLSLIPPPTKAGVDAQNSEIASLASGCDGPEDRIPD 325
+GD S V GASILASLS + + L+PP KAG QN + + S + D I D
Sbjct: 279 AGDVDGASDVDGASILASLSKL-RSFHLLPPIAKAGKRQQNPAVPVVPSSFN---DCISD 334
Query: 326 VDMKDATSNNDDAGSSSRGKTVVPQSDA-ANENPNLDSIGLDACVDAEIGKIPGATYELR 384
DM DA SNND A +S K + ANEN N+D GLD +A+ G +P A YE+R
Sbjct: 335 TDMNDADSNNDHAAVASVEKIAAASTPGTANENLNVDGSGLDPFQEADGGNVPAAGYEIR 394
Query: 385 PLLRMLAGSSSPDFDISGGISKILDEQREIRELLKDSDRPTVLISARRQAFKDSLQEGIL 444
P++ +L SSS FDI G IS++LDE+RE++E L++ D + IS RRQAFKDSL+ G+L
Sbjct: 395 PIVHLLGESSS--FDIRGSISRLLDERREVKEFLREFDLSST-ISTRRQAFKDSLRGGVL 451
Query: 445 GPENIEVSFESFPYYLSDITKNVLIASTYVHLKCNN-FAKYASDLPTMCPRILLSGPAGS 503
+NI++SFE+FPYYLS TK VL+ S YVH+ + +A +A+DL T CPRILLSGP+GS
Sbjct: 452 NAQNIDISFENFPYYLSATTKGVLMISMYVHMNGGSKYANFATDLTTACPRILLSGPSGS 511
Query: 504 EIYQETLAKALAKHFSARLLIVDSLLLPGGS-SKEADSVKESSRTEKASMFAKRAA---- 558
EIYQE LAKALAK F A+L+IVDSLLLPGGS ++EA+S KE SR E+ SM AKRA
Sbjct: 512 EIYQEMLAKALAKQFGAKLMIVDSLLLPGGSPAREAESSKEGSRRERLSMLAKRAVQAAQ 571
Query: 559 LLQHRKPTSSVEADITGGTAVGSQALPKPEISTASSKNYTFKKGDRVKFVGNVTSG-TTV 617
+LQH+KPTSSV+ADITGG+ + SQALPK E+STA+SK+YTFK GDRVKFVG S +++
Sbjct: 572 VLQHKKPTSSVDADITGGSTLSSQALPKQEVSTATSKSYTFKAGDRVKFVGPSASAISSL 631
Query: 618 QPTLRGPGIGFRGRVILPFEDNDFSKIGVRFDRSIPEGNNLGGFCEDDHGFFCTASSLRL 677
Q LRGP IG +G+V L FEDN SKIG+RFDR + +GN+LGG CE+DHGFFC ASSLRL
Sbjct: 632 QGQLRGPAIGSQGKVALAFEDNCASKIGIRFDRPVQDGNDLGGLCEEDHGFFCAASSLRL 691
Query: 678 DSSLGDEVDKLAINELFEVALNESKSSPLIVFVKDIEKSLTGNNDAYGALKSKLENLPSN 737
+ S D+ DKLA+NE+FEVAL+ES+ LI+F+KDIEKSL GN+D Y LKSKLE LP N
Sbjct: 692 EGSSSDDADKLAVNEIFEVALSESEGGSLILFLKDIEKSLVGNSDVYATLKSKLETLPEN 751
Query: 738 VVVIGSHTQLDSRKEKSHPGGLLFTKFGSNQTALLDLAFPDNFSRLHDRSKETPKALKQI 797
+VVI S TQLDSRKEKSHPGG LFTKFG NQTALLDLAFPDNF +LHDRSKETPK++KQI
Sbjct: 752 IVVIASQTQLDSRKEKSHPGGFLFTKFGGNQTALLDLAFPDNFGKLHDRSKETPKSMKQI 811
Query: 798 SRLFPNKVTIQLPQDEALLSDWKQQLERDVETLKGQSNIISIRSVLSRNGLDCVDLESLC 857
+RLFPNK+ IQLPQ+EALLSDWK++L+RD E LK Q+NI SI +VL++N LDC DL +LC
Sbjct: 812 TRLFPNKIAIQLPQEEALLSDWKEKLDRDTEILKVQANITSILAVLAKNKLDCPDLGTLC 871
Query: 858 IKDQTLTTEGVEKIVGWALSHHFMHCSEAPGKDAKLKISTESIMYGLNILQGIQXXXXXX 917
IKDQTL +E VEK+VGWA HH M C+E KD KL IS ESI YGL L IQ
Sbjct: 872 IKDQTLPSESVEKVVGWAFGHHLMICTEPIVKDNKLVISAESISYGLQTLHDIQNENKSL 931
Query: 918 XXXXXDVVTENEFEKKLLADVIPPSDIGVTFDDIGALENVKDTLKELVMLPLQRPELFCK 977
DVVTENEFEKKLL+DVIPPSDIGV+FDDIGALENVK+TLKELVMLPLQRPELF K
Sbjct: 932 KKSLKDVVTENEFEKKLLSDVIPPSDIGVSFDDIGALENVKETLKELVMLPLQRPELFDK 991
Query: 978 GQLTKPCKGILLFGPPGTGKTMLAKAVATEAGANFINISMSSITSKWFGEGEKYVKAVFS 1037
GQLTKP KGILLFGPPGTGKTMLAKAVATEAGANFINISMSSITSKWFGEGEKYVKAVFS
Sbjct: 992 GQLTKPTKGILLFGPPGTGKTMLAKAVATEAGANFINISMSSITSKWFGEGEKYVKAVFS 1051
Query: 1038 LASKIAPSVVFVDEVDSMLGRRENPGEHEAMRKMKNEFMVNWDGLRTKDKERVLVLAATN 1097
LASKIAPSV+FVDEVDSMLGRRENPGEHEAMRKMKNEFMVNWDGLRTKD+ERVLVLAATN
Sbjct: 1052 LASKIAPSVIFVDEVDSMLGRRENPGEHEAMRKMKNEFMVNWDGLRTKDRERVLVLAATN 1111
Query: 1098 RPFDLDEAVVRRLPRRTCV 1116
RPFDLDEAV+RRLPRR V
Sbjct: 1112 RPFDLDEAVIRRLPRRLMV 1130
|
|
| TAIR|locus:2126783 AT4G24860 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2132922 AT4G28000 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2031005 AT1G50140 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2024522 DAA1 "DUO1-activated ATPase 1" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:4010714050 AT5G52882 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2137777 AT4G27680 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2168646 AT5G53540 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| ASPGD|ASPL0000064167 AN7047 [Emericella nidulans (taxid:162425)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|G4MSN3 MGG_07075 "ATPase family AAA domain-containing protein 1" [Magnaporthe oryzae 70-15 (taxid:242507)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
| GSVIVG00027975001 | SubName- Full=Chromosome chr7 scaffold_42, whole genome shotgun sequence; (1146 aa) | |||||||
(Vitis vinifera) | ||||||||
| Sorry, there are no predicted associations at the current settings. |
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 1116 | |||
| COG0464 | 494 | COG0464, SpoVK, ATPases of the AAA+ class [Posttra | 7e-57 | |
| pfam00004 | 131 | pfam00004, AAA, ATPase family associated with vari | 8e-45 | |
| PRK03992 | 389 | PRK03992, PRK03992, proteasome-activating nucleoti | 6e-41 | |
| COG1222 | 406 | COG1222, RPT1, ATP-dependent 26S proteasome regula | 2e-40 | |
| TIGR01243 | 733 | TIGR01243, CDC48, AAA family ATPase, CDC48 subfami | 9e-38 | |
| TIGR01242 | 364 | TIGR01242, 26Sp45, 26S proteasome subunit P45 fami | 3e-37 | |
| TIGR01243 | 733 | TIGR01243, CDC48, AAA family ATPase, CDC48 subfami | 2e-36 | |
| PTZ00454 | 398 | PTZ00454, PTZ00454, 26S protease regulatory subuni | 3e-32 | |
| PTZ00361 | 438 | PTZ00361, PTZ00361, 26 proteosome regulatory subun | 1e-31 | |
| TIGR01241 | 495 | TIGR01241, FtsH_fam, ATP-dependent metalloprotease | 7e-30 | |
| CHL00176 | 638 | CHL00176, ftsH, cell division protein; Validated | 6e-28 | |
| COG1223 | 368 | COG1223, COG1223, Predicted ATPase (AAA+ superfami | 7e-25 | |
| PRK10733 | 644 | PRK10733, hflB, ATP-dependent metalloprotease; Rev | 5e-24 | |
| cd00009 | 151 | cd00009, AAA, The AAA+ (ATPases Associated with a | 9e-23 | |
| TIGR03689 | 512 | TIGR03689, pup_AAA, proteasome ATPase | 1e-22 | |
| COG0465 | 596 | COG0465, HflB, ATP-dependent Zn proteases [Posttra | 2e-22 | |
| smart00382 | 148 | smart00382, AAA, ATPases associated with a variety | 8e-16 | |
| COG0464 | 494 | COG0464, SpoVK, ATPases of the AAA+ class [Posttra | 1e-15 | |
| CHL00195 | 489 | CHL00195, ycf46, Ycf46; Provisional | 6e-11 | |
| PRK13342 | 413 | PRK13342, PRK13342, recombination factor protein R | 1e-07 | |
| cd00060 | 102 | cd00060, FHA, Forkhead associated domain (FHA); fo | 2e-06 | |
| COG0714 | 329 | COG0714, COG0714, MoxR-like ATPases [General funct | 3e-06 | |
| COG1224 | 450 | COG1224, TIP49, DNA helicase TIP49, TBP-interactin | 7e-06 | |
| COG2256 | 436 | COG2256, MGS1, ATPase related to the helicase subu | 9e-06 | |
| pfam07724 | 168 | pfam07724, AAA_2, AAA domain (Cdc48 subfamily) | 1e-04 | |
| pfam00498 | 67 | pfam00498, FHA, FHA domain | 1e-04 | |
| PRK00080 | 328 | PRK00080, ruvB, Holliday junction DNA helicase Ruv | 1e-04 | |
| COG2255 | 332 | COG2255, RuvB, Holliday junction resolvasome, heli | 2e-04 | |
| pfam05496 | 231 | pfam05496, RuvB_N, Holliday junction DNA helicase | 0.001 | |
| PHA02544 | 316 | PHA02544, 44, clamp loader, small subunit; Provisi | 0.001 | |
| pfam06068 | 395 | pfam06068, TIP49, TIP49 C-terminus | 0.002 | |
| PRK04195 | 482 | PRK04195, PRK04195, replication factor C large sub | 0.002 | |
| pfam01078 | 207 | pfam01078, Mg_chelatase, Magnesium chelatase, subu | 0.002 | |
| COG0466 | 782 | COG0466, Lon, ATP-dependent Lon protease, bacteria | 0.002 | |
| TIGR00763 | 775 | TIGR00763, lon, ATP-dependent protease La | 0.003 | |
| pfam13207 | 114 | pfam13207, AAA_17, AAA domain | 0.004 |
| >gnl|CDD|223540 COG0464, SpoVK, ATPases of the AAA+ class [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
Score = 205 bits (522), Expect = 7e-57
Identities = 93/208 (44%), Positives = 129/208 (62%), Gaps = 12/208 (5%)
Query: 913 ESKSLKKSLKDVVTENEFEKKLLADVIPPSDIG-----VTFDDIGALENVKDTLKELVML 967
VTE++FE+ L V+P + VT DDIG LE K+ LKE +
Sbjct: 202 RRAIDLVGEYIGVTEDDFEE-ALKKVLPSRGVLFEDEDVTLDDIGGLEEAKEELKEAIET 260
Query: 968 PLQRPELFCKGQLTKPCKGILLFGPPGTGKTMLAKAVATEAGANFINISMSSITSKWFGE 1027
PL+RPELF K L +P KG+LL+GPPGTGKT+LAKAVA E+ + FI++ S + SKW GE
Sbjct: 261 PLKRPELFRKLGL-RPPKGVLLYGPPGTGKTLLAKAVALESRSRFISVKGSELLSKWVGE 319
Query: 1028 GEKYVKAVFSLASKIAPSVVFVDEVDSMLGRRENPGEHEAMRKMKNEFMVNWDGLRTKDK 1087
EK ++ +F A K+APS++F+DE+DS+ R P E + R++ + + DG+ +
Sbjct: 320 SEKNIRELFEKARKLAPSIIFIDEIDSLASGR-GPSEDGSGRRVVGQLLTELDGI--EKA 376
Query: 1088 ERVLVLAATNRPFDLDEAVVR--RLPRR 1113
E VLV+AATNRP DLD A++R R R
Sbjct: 377 EGVLVIAATNRPDDLDPALLRPGRFDRL 404
|
Length = 494 |
| >gnl|CDD|215649 pfam00004, AAA, ATPase family associated with various cellular activities (AAA) | Back alignment and domain information |
|---|
| >gnl|CDD|179699 PRK03992, PRK03992, proteasome-activating nucleotidase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|224143 COG1222, RPT1, ATP-dependent 26S proteasome regulatory subunit [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >gnl|CDD|233328 TIGR01243, CDC48, AAA family ATPase, CDC48 subfamily | Back alignment and domain information |
|---|
| >gnl|CDD|130309 TIGR01242, 26Sp45, 26S proteasome subunit P45 family | Back alignment and domain information |
|---|
| >gnl|CDD|233328 TIGR01243, CDC48, AAA family ATPase, CDC48 subfamily | Back alignment and domain information |
|---|
| >gnl|CDD|240423 PTZ00454, PTZ00454, 26S protease regulatory subunit 6B-like protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|185575 PTZ00361, PTZ00361, 26 proteosome regulatory subunit 4-like protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|233327 TIGR01241, FtsH_fam, ATP-dependent metalloprotease FtsH | Back alignment and domain information |
|---|
| >gnl|CDD|214386 CHL00176, ftsH, cell division protein; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|224144 COG1223, COG1223, Predicted ATPase (AAA+ superfamily) [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|182683 PRK10733, hflB, ATP-dependent metalloprotease; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|99707 cd00009, AAA, The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold | Back alignment and domain information |
|---|
| >gnl|CDD|200312 TIGR03689, pup_AAA, proteasome ATPase | Back alignment and domain information |
|---|
| >gnl|CDD|223541 COG0465, HflB, ATP-dependent Zn proteases [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >gnl|CDD|214640 smart00382, AAA, ATPases associated with a variety of cellular activities | Back alignment and domain information |
|---|
| >gnl|CDD|223540 COG0464, SpoVK, ATPases of the AAA+ class [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >gnl|CDD|177094 CHL00195, ycf46, Ycf46; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237355 PRK13342, PRK13342, recombination factor protein RarA; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|238017 cd00060, FHA, Forkhead associated domain (FHA); found in eukaryotic and prokaryotic proteins | Back alignment and domain information |
|---|
| >gnl|CDD|223786 COG0714, COG0714, MoxR-like ATPases [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|224145 COG1224, TIP49, DNA helicase TIP49, TBP-interacting protein [Transcription] | Back alignment and domain information |
|---|
| >gnl|CDD|225165 COG2256, MGS1, ATPase related to the helicase subunit of the Holliday junction resolvase [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >gnl|CDD|219536 pfam07724, AAA_2, AAA domain (Cdc48 subfamily) | Back alignment and domain information |
|---|
| >gnl|CDD|215951 pfam00498, FHA, FHA domain | Back alignment and domain information |
|---|
| >gnl|CDD|234619 PRK00080, ruvB, Holliday junction DNA helicase RuvB; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|225164 COG2255, RuvB, Holliday junction resolvasome, helicase subunit [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >gnl|CDD|203260 pfam05496, RuvB_N, Holliday junction DNA helicase ruvB N-terminus | Back alignment and domain information |
|---|
| >gnl|CDD|222866 PHA02544, 44, clamp loader, small subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|147949 pfam06068, TIP49, TIP49 C-terminus | Back alignment and domain information |
|---|
| >gnl|CDD|235250 PRK04195, PRK04195, replication factor C large subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|144608 pfam01078, Mg_chelatase, Magnesium chelatase, subunit ChlI | Back alignment and domain information |
|---|
| >gnl|CDD|223542 COG0466, Lon, ATP-dependent Lon protease, bacterial type [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >gnl|CDD|233119 TIGR00763, lon, ATP-dependent protease La | Back alignment and domain information |
|---|
| >gnl|CDD|221983 pfam13207, AAA_17, AAA domain | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 1116 | |||
| KOG0733 | 802 | consensus Nuclear AAA ATPase (VCP subfamily) [Post | 100.0 | |
| KOG0730 | 693 | consensus AAA+-type ATPase [Posttranslational modi | 100.0 | |
| KOG0736 | 953 | consensus Peroxisome assembly factor 2 containing | 100.0 | |
| TIGR01243 | 733 | CDC48 AAA family ATPase, CDC48 subfamily. This sub | 100.0 | |
| KOG0741 | 744 | consensus AAA+-type ATPase [Posttranslational modi | 100.0 | |
| KOG0737 | 386 | consensus AAA+-type ATPase [Posttranslational modi | 100.0 | |
| KOG0735 | 952 | consensus AAA+-type ATPase [Posttranslational modi | 100.0 | |
| COG0464 | 494 | SpoVK ATPases of the AAA+ class [Posttranslational | 100.0 | |
| COG1222 | 406 | RPT1 ATP-dependent 26S proteasome regulatory subun | 100.0 | |
| KOG0738 | 491 | consensus AAA+-type ATPase [Posttranslational modi | 100.0 | |
| KOG0739 | 439 | consensus AAA+-type ATPase [Posttranslational modi | 100.0 | |
| KOG0733 | 802 | consensus Nuclear AAA ATPase (VCP subfamily) [Post | 99.97 | |
| KOG0734 | 752 | consensus AAA+-type ATPase containing the peptidas | 99.96 | |
| CHL00195 | 489 | ycf46 Ycf46; Provisional | 99.95 | |
| KOG0727 | 408 | consensus 26S proteasome regulatory complex, ATPas | 99.95 | |
| KOG0732 | 1080 | consensus AAA+-type ATPase containing the bromodom | 99.94 | |
| KOG0728 | 404 | consensus 26S proteasome regulatory complex, ATPas | 99.94 | |
| COG1223 | 368 | Predicted ATPase (AAA+ superfamily) [General funct | 99.94 | |
| KOG0740 | 428 | consensus AAA+-type ATPase [Posttranslational modi | 99.94 | |
| KOG0731 | 774 | consensus AAA+-type ATPase containing the peptidas | 99.94 | |
| KOG0726 | 440 | consensus 26S proteasome regulatory complex, ATPas | 99.93 | |
| KOG0729 | 435 | consensus 26S proteasome regulatory complex, ATPas | 99.93 | |
| KOG0652 | 424 | consensus 26S proteasome regulatory complex, ATPas | 99.93 | |
| COG1223 | 368 | Predicted ATPase (AAA+ superfamily) [General funct | 99.93 | |
| COG1222 | 406 | RPT1 ATP-dependent 26S proteasome regulatory subun | 99.91 | |
| TIGR03689 | 512 | pup_AAA proteasome ATPase. In the Actinobacteria, | 99.91 | |
| PTZ00454 | 398 | 26S protease regulatory subunit 6B-like protein; P | 99.91 | |
| KOG0651 | 388 | consensus 26S proteasome regulatory complex, ATPas | 99.91 | |
| COG0465 | 596 | HflB ATP-dependent Zn proteases [Posttranslational | 99.91 | |
| PRK11034 | 758 | clpA ATP-dependent Clp protease ATP-binding subuni | 99.91 | |
| PRK03992 | 389 | proteasome-activating nucleotidase; Provisional | 99.9 | |
| PLN00020 | 413 | ribulose bisphosphate carboxylase/oxygenase activa | 99.9 | |
| TIGR02639 | 731 | ClpA ATP-dependent Clp protease ATP-binding subuni | 99.9 | |
| TIGR01241 | 495 | FtsH_fam ATP-dependent metalloprotease FtsH. HflB( | 99.89 | |
| PTZ00361 | 438 | 26 proteosome regulatory subunit 4-like protein; P | 99.88 | |
| KOG0732 | 1080 | consensus AAA+-type ATPase containing the bromodom | 99.88 | |
| KOG0737 | 386 | consensus AAA+-type ATPase [Posttranslational modi | 99.87 | |
| KOG0738 | 491 | consensus AAA+-type ATPase [Posttranslational modi | 99.87 | |
| KOG0730 | 693 | consensus AAA+-type ATPase [Posttranslational modi | 99.86 | |
| TIGR01242 | 364 | 26Sp45 26S proteasome subunit P45 family. Many pro | 99.86 | |
| CHL00176 | 638 | ftsH cell division protein; Validated | 99.85 | |
| COG0542 | 786 | clpA ATP-binding subunits of Clp protease and DnaK | 99.85 | |
| TIGR03345 | 852 | VI_ClpV1 type VI secretion ATPase, ClpV1 family. M | 99.84 | |
| TIGR01243 | 733 | CDC48 AAA family ATPase, CDC48 subfamily. This sub | 99.83 | |
| CHL00095 | 821 | clpC Clp protease ATP binding subunit | 99.83 | |
| CHL00206 | 2281 | ycf2 Ycf2; Provisional | 99.82 | |
| KOG0734 | 752 | consensus AAA+-type ATPase containing the peptidas | 99.82 | |
| TIGR03346 | 852 | chaperone_ClpB ATP-dependent chaperone ClpB. Membe | 99.82 | |
| PF00004 | 132 | AAA: ATPase family associated with various cellula | 99.81 | |
| KOG0741 | 744 | consensus AAA+-type ATPase [Posttranslational modi | 99.81 | |
| PRK10733 | 644 | hflB ATP-dependent metalloprotease; Reviewed | 99.8 | |
| PRK10865 | 857 | protein disaggregation chaperone; Provisional | 99.79 | |
| COG0464 | 494 | SpoVK ATPases of the AAA+ class [Posttranslational | 99.77 | |
| KOG0736 | 953 | consensus Peroxisome assembly factor 2 containing | 99.75 | |
| KOG0739 | 439 | consensus AAA+-type ATPase [Posttranslational modi | 99.75 | |
| KOG0731 | 774 | consensus AAA+-type ATPase containing the peptidas | 99.74 | |
| CHL00195 | 489 | ycf46 Ycf46; Provisional | 99.73 | |
| CHL00206 | 2281 | ycf2 Ycf2; Provisional | 99.71 | |
| KOG0744 | 423 | consensus AAA+-type ATPase [Posttranslational modi | 99.69 | |
| PTZ00454 | 398 | 26S protease regulatory subunit 6B-like protein; P | 99.68 | |
| KOG0726 | 440 | consensus 26S proteasome regulatory complex, ATPas | 99.68 | |
| COG0465 | 596 | HflB ATP-dependent Zn proteases [Posttranslational | 99.67 | |
| PRK03992 | 389 | proteasome-activating nucleotidase; Provisional | 99.66 | |
| TIGR01241 | 495 | FtsH_fam ATP-dependent metalloprotease FtsH. HflB( | 99.64 | |
| CHL00181 | 287 | cbbX CbbX; Provisional | 99.62 | |
| KOG0743 | 457 | consensus AAA+-type ATPase [Posttranslational modi | 99.62 | |
| TIGR02881 | 261 | spore_V_K stage V sporulation protein K. Members o | 99.62 | |
| KOG0728 | 404 | consensus 26S proteasome regulatory complex, ATPas | 99.61 | |
| KOG0727 | 408 | consensus 26S proteasome regulatory complex, ATPas | 99.61 | |
| TIGR02880 | 284 | cbbX_cfxQ probable Rubsico expression protein CbbX | 99.61 | |
| KOG0652 | 424 | consensus 26S proteasome regulatory complex, ATPas | 99.61 | |
| CHL00176 | 638 | ftsH cell division protein; Validated | 99.6 | |
| PTZ00361 | 438 | 26 proteosome regulatory subunit 4-like protein; P | 99.59 | |
| KOG0740 | 428 | consensus AAA+-type ATPase [Posttranslational modi | 99.59 | |
| KOG0729 | 435 | consensus 26S proteasome regulatory complex, ATPas | 99.56 | |
| KOG0735 | 952 | consensus AAA+-type ATPase [Posttranslational modi | 99.56 | |
| PRK10733 | 644 | hflB ATP-dependent metalloprotease; Reviewed | 99.52 | |
| TIGR03689 | 512 | pup_AAA proteasome ATPase. In the Actinobacteria, | 99.5 | |
| TIGR01242 | 364 | 26Sp45 26S proteasome subunit P45 family. Many pro | 99.49 | |
| TIGR02639 | 731 | ClpA ATP-dependent Clp protease ATP-binding subuni | 99.47 | |
| KOG0742 | 630 | consensus AAA+-type ATPase [Posttranslational modi | 99.47 | |
| PLN00020 | 413 | ribulose bisphosphate carboxylase/oxygenase activa | 99.47 | |
| PF05496 | 233 | RuvB_N: Holliday junction DNA helicase ruvB N-term | 99.45 | |
| TIGR00763 | 775 | lon ATP-dependent protease La. This protein is ind | 99.44 | |
| COG2256 | 436 | MGS1 ATPase related to the helicase subunit of the | 99.43 | |
| PRK11034 | 758 | clpA ATP-dependent Clp protease ATP-binding subuni | 99.37 | |
| KOG0651 | 388 | consensus 26S proteasome regulatory complex, ATPas | 99.36 | |
| PRK10865 | 857 | protein disaggregation chaperone; Provisional | 99.34 | |
| CHL00095 | 821 | clpC Clp protease ATP binding subunit | 99.31 | |
| TIGR03345 | 852 | VI_ClpV1 type VI secretion ATPase, ClpV1 family. M | 99.31 | |
| TIGR00390 | 441 | hslU ATP-dependent protease HslVU, ATPase subunit. | 99.27 | |
| TIGR00635 | 305 | ruvB Holliday junction DNA helicase, RuvB subunit. | 99.27 | |
| TIGR03346 | 852 | chaperone_ClpB ATP-dependent chaperone ClpB. Membe | 99.27 | |
| PRK05201 | 443 | hslU ATP-dependent protease ATP-binding subunit Hs | 99.27 | |
| COG2204 | 464 | AtoC Response regulator containing CheY-like recei | 99.25 | |
| PRK00080 | 328 | ruvB Holliday junction DNA helicase RuvB; Reviewed | 99.25 | |
| cd00009 | 151 | AAA The AAA+ (ATPases Associated with a wide varie | 99.24 | |
| KOG2004 | 906 | consensus Mitochondrial ATP-dependent protease PIM | 99.23 | |
| PRK05342 | 412 | clpX ATP-dependent protease ATP-binding subunit Cl | 99.23 | |
| COG0466 | 782 | Lon ATP-dependent Lon protease, bacterial type [Po | 99.22 | |
| KOG1051 | 898 | consensus Chaperone HSP104 and related ATP-depende | 99.22 | |
| COG2255 | 332 | RuvB Holliday junction resolvasome, helicase subun | 99.22 | |
| PRK14956 | 484 | DNA polymerase III subunits gamma and tau; Provisi | 99.17 | |
| PRK12323 | 700 | DNA polymerase III subunits gamma and tau; Provisi | 99.15 | |
| PRK10787 | 784 | DNA-binding ATP-dependent protease La; Provisional | 99.15 | |
| KOG2028 | 554 | consensus ATPase related to the helicase subunit o | 99.14 | |
| PRK07003 | 830 | DNA polymerase III subunits gamma and tau; Validat | 99.13 | |
| PRK14962 | 472 | DNA polymerase III subunits gamma and tau; Provisi | 99.13 | |
| PF00498 | 68 | FHA: FHA domain; InterPro: IPR000253 The forkhead- | 99.12 | |
| TIGR00382 | 413 | clpX endopeptidase Clp ATP-binding regulatory subu | 99.11 | |
| KOG0615 | 475 | consensus Serine/threonine protein kinase Chk2 and | 99.11 | |
| PRK13342 | 413 | recombination factor protein RarA; Reviewed | 99.11 | |
| PHA02544 | 316 | 44 clamp loader, small subunit; Provisional | 99.1 | |
| COG3829 | 560 | RocR Transcriptional regulator containing PAS, AAA | 99.1 | |
| PRK04195 | 482 | replication factor C large subunit; Provisional | 99.08 | |
| cd00060 | 102 | FHA Forkhead associated domain (FHA); found in euk | 99.06 | |
| PRK07940 | 394 | DNA polymerase III subunit delta'; Validated | 99.05 | |
| smart00382 | 148 | AAA ATPases associated with a variety of cellular | 99.05 | |
| PRK14960 | 702 | DNA polymerase III subunits gamma and tau; Provisi | 99.05 | |
| TIGR02902 | 531 | spore_lonB ATP-dependent protease LonB. Members of | 99.04 | |
| PF07728 | 139 | AAA_5: AAA domain (dynein-related subfamily); Inte | 99.04 | |
| COG3604 | 550 | FhlA Transcriptional regulator containing GAF, AAA | 99.03 | |
| PRK14949 | 944 | DNA polymerase III subunits gamma and tau; Provisi | 99.03 | |
| PF07724 | 171 | AAA_2: AAA domain (Cdc48 subfamily); InterPro: IPR | 99.03 | |
| PLN03025 | 319 | replication factor C subunit; Provisional | 99.02 | |
| PRK07994 | 647 | DNA polymerase III subunits gamma and tau; Validat | 99.02 | |
| PRK14958 | 509 | DNA polymerase III subunits gamma and tau; Provisi | 99.02 | |
| PF05673 | 249 | DUF815: Protein of unknown function (DUF815); Inte | 99.02 | |
| PF00158 | 168 | Sigma54_activat: Sigma-54 interaction domain; Inte | 99.0 | |
| PRK14961 | 363 | DNA polymerase III subunits gamma and tau; Provisi | 98.99 | |
| PRK08691 | 709 | DNA polymerase III subunits gamma and tau; Validat | 98.96 | |
| TIGR02640 | 262 | gas_vesic_GvpN gas vesicle protein GvpN. Members o | 98.96 | |
| PRK11331 | 459 | 5-methylcytosine-specific restriction enzyme subun | 98.95 | |
| PRK07764 | 824 | DNA polymerase III subunits gamma and tau; Validat | 98.95 | |
| PRK06645 | 507 | DNA polymerase III subunits gamma and tau; Validat | 98.95 | |
| PRK14964 | 491 | DNA polymerase III subunits gamma and tau; Provisi | 98.95 | |
| KOG0989 | 346 | consensus Replication factor C, subunit RFC4 [Repl | 98.94 | |
| KOG0742 | 630 | consensus AAA+-type ATPase [Posttranslational modi | 98.94 | |
| PRK14952 | 584 | DNA polymerase III subunits gamma and tau; Provisi | 98.93 | |
| PRK05563 | 559 | DNA polymerase III subunits gamma and tau; Validat | 98.93 | |
| PRK14963 | 504 | DNA polymerase III subunits gamma and tau; Provisi | 98.92 | |
| PRK14969 | 527 | DNA polymerase III subunits gamma and tau; Provisi | 98.92 | |
| PRK14951 | 618 | DNA polymerase III subunits gamma and tau; Provisi | 98.91 | |
| PRK14959 | 624 | DNA polymerase III subunits gamma and tau; Provisi | 98.9 | |
| PHA02244 | 383 | ATPase-like protein | 98.9 | |
| PRK12402 | 337 | replication factor C small subunit 2; Reviewed | 98.89 | |
| PRK14957 | 546 | DNA polymerase III subunits gamma and tau; Provisi | 98.89 | |
| PRK13407 | 334 | bchI magnesium chelatase subunit I; Provisional | 98.89 | |
| CHL00081 | 350 | chlI Mg-protoporyphyrin IX chelatase | 98.87 | |
| TIGR02928 | 365 | orc1/cdc6 family replication initiation protein. M | 98.87 | |
| COG0714 | 329 | MoxR-like ATPases [General function prediction onl | 98.87 | |
| TIGR02397 | 355 | dnaX_nterm DNA polymerase III, subunit gamma and t | 98.87 | |
| TIGR03420 | 226 | DnaA_homol_Hda DnaA regulatory inactivator Hda. Me | 98.86 | |
| PRK14965 | 576 | DNA polymerase III subunits gamma and tau; Provisi | 98.86 | |
| PRK00149 | 450 | dnaA chromosomal replication initiation protein; R | 98.86 | |
| PRK05896 | 605 | DNA polymerase III subunits gamma and tau; Validat | 98.86 | |
| PRK06305 | 451 | DNA polymerase III subunits gamma and tau; Validat | 98.85 | |
| TIGR01650 | 327 | PD_CobS cobaltochelatase, CobS subunit. This model | 98.84 | |
| PRK07133 | 725 | DNA polymerase III subunits gamma and tau; Validat | 98.82 | |
| PRK14970 | 367 | DNA polymerase III subunits gamma and tau; Provisi | 98.82 | |
| PRK00411 | 394 | cdc6 cell division control protein 6; Reviewed | 98.82 | |
| PRK13341 | 725 | recombination factor protein RarA/unknown domain f | 98.81 | |
| PRK14948 | 620 | DNA polymerase III subunits gamma and tau; Provisi | 98.81 | |
| PF07726 | 131 | AAA_3: ATPase family associated with various cellu | 98.8 | |
| PRK06647 | 563 | DNA polymerase III subunits gamma and tau; Validat | 98.8 | |
| PF01078 | 206 | Mg_chelatase: Magnesium chelatase, subunit ChlI; I | 98.79 | |
| PRK08903 | 227 | DnaA regulatory inactivator Hda; Validated | 98.79 | |
| PRK12377 | 248 | putative replication protein; Provisional | 98.79 | |
| COG1219 | 408 | ClpX ATP-dependent protease Clp, ATPase subunit [P | 98.78 | |
| TIGR02442 | 633 | Cob-chelat-sub cobaltochelatase subunit. A number | 98.78 | |
| COG0542 | 786 | clpA ATP-binding subunits of Clp protease and DnaK | 98.78 | |
| PRK09111 | 598 | DNA polymerase III subunits gamma and tau; Validat | 98.76 | |
| PRK14955 | 397 | DNA polymerase III subunits gamma and tau; Provisi | 98.76 | |
| PRK14953 | 486 | DNA polymerase III subunits gamma and tau; Provisi | 98.75 | |
| TIGR02903 | 615 | spore_lon_C ATP-dependent protease, Lon family. Me | 98.75 | |
| PF00004 | 132 | AAA: ATPase family associated with various cellula | 98.75 | |
| TIGR00362 | 405 | DnaA chromosomal replication initiator protein Dna | 98.75 | |
| PRK08116 | 268 | hypothetical protein; Validated | 98.74 | |
| KOG0745 | 564 | consensus Putative ATP-dependent Clp-type protease | 98.74 | |
| PRK07952 | 244 | DNA replication protein DnaC; Validated | 98.74 | |
| PRK08084 | 235 | DNA replication initiation factor; Provisional | 98.73 | |
| PRK14088 | 440 | dnaA chromosomal replication initiation protein; P | 98.71 | |
| PRK06893 | 229 | DNA replication initiation factor; Validated | 98.71 | |
| TIGR02030 | 337 | BchI-ChlI magnesium chelatase ATPase subunit I. Th | 98.71 | |
| PTZ00112 | 1164 | origin recognition complex 1 protein; Provisional | 98.7 | |
| PRK14950 | 585 | DNA polymerase III subunits gamma and tau; Provisi | 98.7 | |
| PRK14086 | 617 | dnaA chromosomal replication initiation protein; P | 98.69 | |
| PRK00440 | 319 | rfc replication factor C small subunit; Reviewed | 98.68 | |
| PRK14954 | 620 | DNA polymerase III subunits gamma and tau; Provisi | 98.68 | |
| PRK15424 | 538 | propionate catabolism operon regulatory protein Pr | 98.67 | |
| PRK08451 | 535 | DNA polymerase III subunits gamma and tau; Validat | 98.66 | |
| PRK11608 | 326 | pspF phage shock protein operon transcriptional ac | 98.65 | |
| TIGR02974 | 329 | phageshock_pspF psp operon transcriptional activat | 98.63 | |
| COG2812 | 515 | DnaX DNA polymerase III, gamma/tau subunits [DNA r | 98.63 | |
| KOG0744 | 423 | consensus AAA+-type ATPase [Posttranslational modi | 98.63 | |
| PRK08727 | 233 | hypothetical protein; Validated | 98.63 | |
| COG2607 | 287 | Predicted ATPase (AAA+ superfamily) [General funct | 98.62 | |
| PRK12422 | 445 | chromosomal replication initiation protein; Provis | 98.62 | |
| KOG0991 | 333 | consensus Replication factor C, subunit RFC2 [Repl | 98.62 | |
| PRK14971 | 614 | DNA polymerase III subunits gamma and tau; Provisi | 98.6 | |
| TIGR02329 | 526 | propionate_PrpR propionate catabolism operon regul | 98.6 | |
| PRK05642 | 234 | DNA replication initiation factor; Validated | 98.6 | |
| smart00350 | 509 | MCM minichromosome maintenance proteins. | 98.59 | |
| COG1221 | 403 | PspF Transcriptional regulators containing an AAA- | 98.58 | |
| PRK13531 | 498 | regulatory ATPase RavA; Provisional | 98.58 | |
| PRK08181 | 269 | transposase; Validated | 98.56 | |
| PF00308 | 219 | Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013 | 98.56 | |
| COG0470 | 325 | HolB ATPase involved in DNA replication [DNA repli | 98.54 | |
| PRK07471 | 365 | DNA polymerase III subunit delta'; Validated | 98.53 | |
| TIGR01817 | 534 | nifA Nif-specific regulatory protein. This model r | 98.52 | |
| PRK05564 | 313 | DNA polymerase III subunit delta'; Validated | 98.51 | |
| PRK11388 | 638 | DNA-binding transcriptional regulator DhaR; Provis | 98.51 | |
| PRK05022 | 509 | anaerobic nitric oxide reductase transcription reg | 98.51 | |
| PRK15429 | 686 | formate hydrogenlyase transcriptional activator Fh | 98.5 | |
| TIGR00678 | 188 | holB DNA polymerase III, delta' subunit. At positi | 98.5 | |
| TIGR03354 | 396 | VI_FHA type VI secretion system FHA domain protein | 98.5 | |
| PRK06620 | 214 | hypothetical protein; Validated | 98.48 | |
| PRK09112 | 351 | DNA polymerase III subunit delta'; Validated | 98.48 | |
| PRK10820 | 520 | DNA-binding transcriptional regulator TyrR; Provis | 98.48 | |
| TIGR00368 | 499 | Mg chelatase-related protein. The N-terminal end m | 98.47 | |
| PRK06835 | 329 | DNA replication protein DnaC; Validated | 98.47 | |
| PRK14087 | 450 | dnaA chromosomal replication initiation protein; P | 98.46 | |
| KOG1969 | 877 | consensus DNA replication checkpoint protein CHL12 | 98.45 | |
| PF01695 | 178 | IstB_IS21: IstB-like ATP binding protein; InterPro | 98.45 | |
| PTZ00111 | 915 | DNA replication licensing factor MCM4; Provisional | 98.45 | |
| COG1239 | 423 | ChlI Mg-chelatase subunit ChlI [Coenzyme metabolis | 98.43 | |
| TIGR02031 | 589 | BchD-ChlD magnesium chelatase ATPase subunit D. Th | 98.38 | |
| COG1484 | 254 | DnaC DNA replication protein [DNA replication, rec | 98.38 | |
| PRK06526 | 254 | transposase; Provisional | 98.37 | |
| PF13177 | 162 | DNA_pol3_delta2: DNA polymerase III, delta subunit | 98.37 | |
| PRK08939 | 306 | primosomal protein DnaI; Reviewed | 98.37 | |
| TIGR02915 | 445 | PEP_resp_reg putative PEP-CTERM system response re | 98.35 | |
| smart00763 | 361 | AAA_PrkA PrkA AAA domain. This is a family of PrkA | 98.35 | |
| PRK06921 | 266 | hypothetical protein; Provisional | 98.33 | |
| PRK08058 | 329 | DNA polymerase III subunit delta'; Validated | 98.32 | |
| COG1474 | 366 | CDC6 Cdc6-related protein, AAA superfamily ATPase | 98.28 | |
| PF14532 | 138 | Sigma54_activ_2: Sigma-54 interaction domain; PDB: | 98.28 | |
| PRK10923 | 469 | glnG nitrogen regulation protein NR(I); Provisiona | 98.27 | |
| PRK05707 | 328 | DNA polymerase III subunit delta'; Validated | 98.25 | |
| PRK07399 | 314 | DNA polymerase III subunit delta'; Validated | 98.25 | |
| PRK09183 | 259 | transposase/IS protein; Provisional | 98.23 | |
| PRK11361 | 457 | acetoacetate metabolism regulatory protein AtoC; P | 98.21 | |
| COG0593 | 408 | DnaA ATPase involved in DNA replication initiation | 98.2 | |
| PRK09862 | 506 | putative ATP-dependent protease; Provisional | 98.17 | |
| TIGR02881 | 261 | spore_V_K stage V sporulation protein K. Members o | 98.16 | |
| TIGR00764 | 608 | lon_rel lon-related putative ATP-dependent proteas | 98.13 | |
| PF13401 | 131 | AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S | 98.1 | |
| PRK09087 | 226 | hypothetical protein; Validated | 98.09 | |
| COG0606 | 490 | Predicted ATPase with chaperone activity [Posttran | 98.08 | |
| PRK15115 | 444 | response regulator GlrR; Provisional | 98.08 | |
| TIGR00602 | 637 | rad24 checkpoint protein rad24. This family is bas | 98.07 | |
| KOG0990 | 360 | consensus Replication factor C, subunit RFC5 [Repl | 98.07 | |
| CHL00181 | 287 | cbbX CbbX; Provisional | 98.06 | |
| smart00240 | 52 | FHA Forkhead associated domain. Found in eukaryoti | 98.06 | |
| PF13173 | 128 | AAA_14: AAA domain | 98.05 | |
| PLN02927 | 668 | antheraxanthin epoxidase/zeaxanthin epoxidase | 98.04 | |
| cd01120 | 165 | RecA-like_NTPases RecA-like NTPases. This family i | 98.03 | |
| TIGR01818 | 463 | ntrC nitrogen regulation protein NR(I). This model | 98.01 | |
| PRK06871 | 325 | DNA polymerase III subunit delta'; Validated | 97.96 | |
| PRK06964 | 342 | DNA polymerase III subunit delta'; Validated | 97.94 | |
| TIGR00763 | 775 | lon ATP-dependent protease La. This protein is ind | 97.94 | |
| PRK07993 | 334 | DNA polymerase III subunit delta'; Validated | 97.92 | |
| PRK04132 | 846 | replication factor C small subunit; Provisional | 97.92 | |
| COG3283 | 511 | TyrR Transcriptional regulator of aromatic amino a | 97.88 | |
| PRK10365 | 441 | transcriptional regulatory protein ZraR; Provision | 97.87 | |
| COG1224 | 450 | TIP49 DNA helicase TIP49, TBP-interacting protein | 97.84 | |
| COG1716 | 191 | FOG: FHA domain [Signal transduction mechanisms] | 97.84 | |
| TIGR02880 | 284 | cbbX_cfxQ probable Rubsico expression protein CbbX | 97.83 | |
| PRK08769 | 319 | DNA polymerase III subunit delta'; Validated | 97.8 | |
| PRK05342 | 412 | clpX ATP-dependent protease ATP-binding subunit Cl | 97.8 | |
| PF05621 | 302 | TniB: Bacterial TniB protein; InterPro: IPR008868 | 97.78 | |
| PRK06090 | 319 | DNA polymerase III subunit delta'; Validated | 97.78 | |
| COG1220 | 444 | HslU ATP-dependent protease HslVU (ClpYQ), ATPase | 97.77 | |
| PF06068 | 398 | TIP49: TIP49 C-terminus; InterPro: IPR010339 This | 97.75 | |
| PRK13765 | 637 | ATP-dependent protease Lon; Provisional | 97.74 | |
| KOG0478 | 804 | consensus DNA replication licensing factor, MCM4 c | 97.71 | |
| PF01637 | 234 | Arch_ATPase: Archaeal ATPase; InterPro: IPR011579 | 97.68 | |
| PRK13406 | 584 | bchD magnesium chelatase subunit D; Provisional | 97.67 | |
| PRK08699 | 325 | DNA polymerase III subunit delta'; Validated | 97.67 | |
| COG1241 | 682 | MCM2 Predicted ATPase involved in replication cont | 97.67 | |
| TIGR00382 | 413 | clpX endopeptidase Clp ATP-binding regulatory subu | 97.6 | |
| COG3284 | 606 | AcoR Transcriptional activator of acetoin/glycerol | 97.59 | |
| PRK00080 | 328 | ruvB Holliday junction DNA helicase RuvB; Reviewed | 97.58 | |
| PF03969 | 362 | AFG1_ATPase: AFG1-like ATPase; InterPro: IPR005654 | 97.56 | |
| TIGR02237 | 209 | recomb_radB DNA repair and recombination protein R | 97.54 | |
| PF03215 | 519 | Rad17: Rad17 cell cycle checkpoint protein | 97.53 | |
| PF00493 | 331 | MCM: MCM2/3/5 family This family extends the MCM d | 97.52 | |
| PHA00729 | 226 | NTP-binding motif containing protein | 97.5 | |
| TIGR01618 | 220 | phage_P_loop phage nucleotide-binding protein. Thi | 97.5 | |
| KOG1881 | 793 | consensus Anion exchanger adaptor protein Kanadapt | 97.5 | |
| cd01124 | 187 | KaiC KaiC is a circadian clock protein primarily f | 97.49 | |
| COG1219 | 408 | ClpX ATP-dependent protease Clp, ATPase subunit [P | 97.47 | |
| KOG2170 | 344 | consensus ATPase of the AAA+ superfamily [General | 97.39 | |
| PF00910 | 107 | RNA_helicase: RNA helicase; InterPro: IPR000605 He | 97.38 | |
| PRK05917 | 290 | DNA polymerase III subunit delta'; Validated | 97.36 | |
| PF12774 | 231 | AAA_6: Hydrolytic ATP binding site of dynein motor | 97.36 | |
| PRK11823 | 446 | DNA repair protein RadA; Provisional | 97.29 | |
| TIGR03015 | 269 | pepcterm_ATPase putative secretion ATPase, PEP-CTE | 97.29 | |
| PF05673 | 249 | DUF815: Protein of unknown function (DUF815); Inte | 97.28 | |
| cd01121 | 372 | Sms Sms (bacterial radA) DNA repair protein. This | 97.26 | |
| TIGR02928 | 365 | orc1/cdc6 family replication initiation protein. M | 97.26 | |
| KOG1514 | 767 | consensus Origin recognition complex, subunit 1, a | 97.22 | |
| COG1618 | 179 | Predicted nucleotide kinase [Nucleotide transport | 97.22 | |
| PF12775 | 272 | AAA_7: P-loop containing dynein motor region D3; P | 97.22 | |
| PF05729 | 166 | NACHT: NACHT domain | 97.21 | |
| PF13207 | 121 | AAA_17: AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6 | 97.19 | |
| KOG0477 | 854 | consensus DNA replication licensing factor, MCM2 c | 97.17 | |
| KOG1970 | 634 | consensus Checkpoint RAD17-RFC complex, RAD17/RAD2 | 97.15 | |
| PRK09361 | 225 | radB DNA repair and recombination protein RadB; Pr | 97.15 | |
| KOG0482 | 721 | consensus DNA replication licensing factor, MCM7 c | 97.14 | |
| COG3456 | 430 | Predicted component of the type VI protein secreti | 97.14 | |
| PRK00411 | 394 | cdc6 cell division control protein 6; Reviewed | 97.14 | |
| TIGR02688 | 449 | conserved hypothetical protein TIGR02688. Members | 97.11 | |
| PF05707 | 193 | Zot: Zonular occludens toxin (Zot); InterPro: IPR0 | 97.11 | |
| PRK08533 | 230 | flagellar accessory protein FlaH; Reviewed | 97.11 | |
| PRK14962 | 472 | DNA polymerase III subunits gamma and tau; Provisi | 97.1 | |
| KOG0479 | 818 | consensus DNA replication licensing factor, MCM3 c | 97.1 | |
| KOG1051 | 898 | consensus Chaperone HSP104 and related ATP-depende | 97.09 | |
| PRK08118 | 167 | topology modulation protein; Reviewed | 97.09 | |
| PRK00771 | 437 | signal recognition particle protein Srp54; Provisi | 97.08 | |
| PRK00149 | 450 | dnaA chromosomal replication initiation protein; R | 97.08 | |
| KOG2035 | 351 | consensus Replication factor C, subunit RFC3 [Cell | 97.07 | |
| TIGR02012 | 321 | tigrfam_recA protein RecA. This model describes or | 97.06 | |
| ) proteins. It has been suggested that torsins play a role in effectively managing protein folding and that possible breakdown in a neuroprotective mechanism that is, in part, mediated by torsins may be responsible for the neuronal dysfunction associated with dystonia [].; GO: 0005524 ATP binding, 0051085 chaperone mediated protein folding requiring cofactor" target="_blank" href="http://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=PF06309">PF06309 | 127 | Torsin: Torsin; InterPro: IPR010448 This family co | 97.05 | |
| PRK07261 | 171 | topology modulation protein; Provisional | 97.04 | |
| cd00983 | 325 | recA RecA is a bacterial enzyme which has roles in | 97.0 | |
| KOG0481 | 729 | consensus DNA replication licensing factor, MCM5 c | 97.0 | |
| PRK05818 | 261 | DNA polymerase III subunit delta'; Validated | 96.99 | |
| PHA02624 | 647 | large T antigen; Provisional | 96.98 | |
| PF03266 | 168 | NTPase_1: NTPase; InterPro: IPR004948 This entry r | 96.97 | |
| TIGR00635 | 305 | ruvB Holliday junction DNA helicase, RuvB subunit. | 96.94 | |
| PRK00131 | 175 | aroK shikimate kinase; Reviewed | 96.93 | |
| cd01129 | 264 | PulE-GspE PulE/GspE The type II secretory pathway | 96.92 | |
| PRK12723 | 388 | flagellar biosynthesis regulator FlhF; Provisional | 96.91 | |
| COG3854 | 308 | SpoIIIAA ncharacterized protein conserved in bacte | 96.89 | |
| KOG2227 | 529 | consensus Pre-initiation complex, subunit CDC6, AA | 96.87 | |
| KOG1942 | 456 | consensus DNA helicase, TBP-interacting protein [R | 96.86 | |
| PRK15455 | 644 | PrkA family serine protein kinase; Provisional | 96.86 | |
| KOG2228 | 408 | consensus Origin recognition complex, subunit 4 [R | 96.85 | |
| PRK14722 | 374 | flhF flagellar biosynthesis regulator FlhF; Provis | 96.83 | |
| PF13604 | 196 | AAA_30: AAA domain; PDB: 1W36_G 3K70_G 3UPU_B 3GPL | 96.82 | |
| cd01394 | 218 | radB RadB. The archaeal protein radB shares simila | 96.8 | |
| PF00931 | 287 | NB-ARC: NB-ARC domain; InterPro: IPR002182 This is | 96.79 | |
| PRK13342 | 413 | recombination factor protein RarA; Reviewed | 96.78 | |
| KOG0745 | 564 | consensus Putative ATP-dependent Clp-type protease | 96.78 | |
| COG4650 | 531 | RtcR Sigma54-dependent transcription regulator con | 96.77 | |
| KOG0480 | 764 | consensus DNA replication licensing factor, MCM6 c | 96.77 | |
| PRK04296 | 190 | thymidine kinase; Provisional | 96.76 | |
| PRK14086 | 617 | dnaA chromosomal replication initiation protein; P | 96.76 | |
| PRK13407 | 334 | bchI magnesium chelatase subunit I; Provisional | 96.75 | |
| PRK14974 | 336 | cell division protein FtsY; Provisional | 96.74 | |
| PF13191 | 185 | AAA_16: AAA ATPase domain; PDB: 2V1U_A. | 96.71 | |
| cd01131 | 198 | PilT Pilus retraction ATPase PilT. PilT is a nucle | 96.71 | |
| PRK07276 | 290 | DNA polymerase III subunit delta'; Validated | 96.71 | |
| cd03283 | 199 | ABC_MutS-like MutS-like homolog in eukaryotes. The | 96.7 | |
| TIGR00390 | 441 | hslU ATP-dependent protease HslVU, ATPase subunit. | 96.67 | |
| PRK06067 | 234 | flagellar accessory protein FlaH; Validated | 96.66 | |
| PRK05800 | 170 | cobU adenosylcobinamide kinase/adenosylcobinamide- | 96.66 | |
| PRK13695 | 174 | putative NTPase; Provisional | 96.65 | |
| PRK10536 | 262 | hypothetical protein; Provisional | 96.65 | |
| PF13671 | 143 | AAA_33: AAA domain; PDB: 1LTQ_A 2IA5_K 1RC8_A 1LY1 | 96.64 | |
| PRK11331 | 459 | 5-methylcytosine-specific restriction enzyme subun | 96.64 | |
| PRK03839 | 180 | putative kinase; Provisional | 96.63 | |
| PRK13947 | 171 | shikimate kinase; Provisional | 96.63 | |
| TIGR03877 | 237 | thermo_KaiC_1 KaiC domain protein, Ph0284 family. | 96.59 | |
| TIGR02858 | 270 | spore_III_AA stage III sporulation protein AA. Mem | 96.58 | |
| cd00046 | 144 | DEXDc DEAD-like helicases superfamily. A diverse f | 96.58 | |
| TIGR00416 | 454 | sms DNA repair protein RadA. The gene protuct code | 96.57 | |
| TIGR00362 | 405 | DnaA chromosomal replication initiator protein Dna | 96.57 | |
| cd01122 | 271 | GP4d_helicase GP4d_helicase is a homohexameric 5'- | 96.52 | |
| cd00464 | 154 | SK Shikimate kinase (SK) is the fifth enzyme in th | 96.52 | |
| cd01128 | 249 | rho_factor Transcription termination factor rho is | 96.51 | |
| PRK12726 | 407 | flagellar biosynthesis regulator FlhF; Provisional | 96.51 | |
| PRK07132 | 299 | DNA polymerase III subunit delta'; Validated | 96.49 | |
| PRK10787 | 784 | DNA-binding ATP-dependent protease La; Provisional | 96.49 | |
| PRK00625 | 173 | shikimate kinase; Provisional | 96.49 | |
| PRK09376 | 416 | rho transcription termination factor Rho; Provisio | 96.47 | |
| PHA02544 | 316 | 44 clamp loader, small subunit; Provisional | 96.46 | |
| PRK07764 | 824 | DNA polymerase III subunits gamma and tau; Validat | 96.45 | |
| cd01393 | 226 | recA_like RecA is a bacterial enzyme which has rol | 96.45 | |
| PRK11889 | 436 | flhF flagellar biosynthesis regulator FlhF; Provis | 96.45 | |
| KOG3347 | 176 | consensus Predicted nucleotide kinase/nuclear prot | 96.43 | |
| PRK14532 | 188 | adenylate kinase; Provisional | 96.4 | |
| PF00437 | 270 | T2SE: Type II/IV secretion system protein; InterPr | 96.37 | |
| COG2256 | 436 | MGS1 ATPase related to the helicase subunit of the | 96.37 | |
| PRK06217 | 183 | hypothetical protein; Validated | 96.36 | |
| PRK09354 | 349 | recA recombinase A; Provisional | 96.35 | |
| cd00544 | 169 | CobU Adenosylcobinamide kinase / adenosylcobinamid | 96.35 | |
| COG5271 | 4600 | MDN1 AAA ATPase containing von Willebrand factor t | 96.32 | |
| PRK04195 | 482 | replication factor C large subunit; Provisional | 96.32 | |
| PRK10436 | 462 | hypothetical protein; Provisional | 96.3 | |
| TIGR01359 | 183 | UMP_CMP_kin_fam UMP-CMP kinase family. This subfam | 96.29 | |
| PRK14088 | 440 | dnaA chromosomal replication initiation protein; P | 96.29 | |
| PRK06645 | 507 | DNA polymerase III subunits gamma and tau; Validat | 96.28 | |
| PRK13949 | 169 | shikimate kinase; Provisional | 96.28 | |
| cd00984 | 242 | DnaB_C DnaB helicase C terminal domain. The hexame | 96.27 | |
| TIGR02525 | 372 | plasmid_TraJ plasmid transfer ATPase TraJ. Members | 96.25 | |
| COG1485 | 367 | Predicted ATPase [General function prediction only | 96.25 | |
| cd01123 | 235 | Rad51_DMC1_radA Rad51_DMC1_radA,B. This group of r | 96.23 | |
| PF00448 | 196 | SRP54: SRP54-type protein, GTPase domain; InterPro | 96.22 | |
| PRK06762 | 166 | hypothetical protein; Provisional | 96.2 | |
| cd01428 | 194 | ADK Adenylate kinase (ADK) catalyzes the reversibl | 96.19 | |
| TIGR01425 | 429 | SRP54_euk signal recognition particle protein SRP5 | 96.19 | |
| COG4619 | 223 | ABC-type uncharacterized transport system, ATPase | 96.19 | |
| PRK07003 | 830 | DNA polymerase III subunits gamma and tau; Validat | 96.18 | |
| PRK10416 | 318 | signal recognition particle-docking protein FtsY; | 96.18 | |
| PF06745 | 226 | KaiC: KaiC; InterPro: IPR014774 This entry represe | 96.18 | |
| cd02020 | 147 | CMPK Cytidine monophosphate kinase (CMPK) catalyze | 96.18 | |
| cd03280 | 200 | ABC_MutS2 MutS2 homologs in bacteria and eukaryote | 96.17 | |
| TIGR02538 | 564 | type_IV_pilB type IV-A pilus assembly ATPase PilB. | 96.17 | |
| TIGR03878 | 259 | thermo_KaiC_2 KaiC domain protein, AF_0795 family. | 96.17 | |
| TIGR02533 | 486 | type_II_gspE general secretory pathway protein E. | 96.14 | |
| TIGR01420 | 343 | pilT_fam pilus retraction protein PilT. This model | 96.14 | |
| PRK14531 | 183 | adenylate kinase; Provisional | 96.14 | |
| PF13479 | 213 | AAA_24: AAA domain | 96.09 | |
| PLN03210 | 1153 | Resistant to P. syringae 6; Provisional | 96.09 | |
| PRK13948 | 182 | shikimate kinase; Provisional | 96.08 | |
| cd02021 | 150 | GntK Gluconate kinase (GntK) catalyzes the phospho | 96.08 | |
| cd03281 | 213 | ABC_MSH5_euk MutS5 homolog in eukaryotes. The MutS | 96.05 | |
| PRK05973 | 237 | replicative DNA helicase; Provisional | 96.03 | |
| cd03243 | 202 | ABC_MutS_homologs The MutS protein initiates DNA m | 96.02 | |
| PRK14530 | 215 | adenylate kinase; Provisional | 96.01 | |
| COG0563 | 178 | Adk Adenylate kinase and related kinases [Nucleoti | 96.0 | |
| COG2804 | 500 | PulE Type II secretory pathway, ATPase PulE/Tfp pi | 96.0 | |
| TIGR00064 | 272 | ftsY signal recognition particle-docking protein F | 95.99 | |
| TIGR02782 | 299 | TrbB_P P-type conjugative transfer ATPase TrbB. Th | 95.95 | |
| TIGR01313 | 163 | therm_gnt_kin carbohydrate kinase, thermoresistant | 95.94 | |
| TIGR03880 | 224 | KaiC_arch_3 KaiC domain protein, AF_0351 family. T | 95.93 | |
| PRK03731 | 171 | aroL shikimate kinase II; Reviewed | 95.92 | |
| PRK12323 | 700 | DNA polymerase III subunits gamma and tau; Provisi | 95.92 | |
| PLN03025 | 319 | replication factor C subunit; Provisional | 95.91 | |
| PRK13531 | 498 | regulatory ATPase RavA; Provisional | 95.9 | |
| PRK12724 | 432 | flagellar biosynthesis regulator FlhF; Provisional | 95.9 | |
| PTZ00088 | 229 | adenylate kinase 1; Provisional | 95.89 | |
| PRK05201 | 443 | hslU ATP-dependent protease ATP-binding subunit Hs | 95.89 | |
| PRK14959 | 624 | DNA polymerase III subunits gamma and tau; Provisi | 95.86 | |
| PRK14528 | 186 | adenylate kinase; Provisional | 95.85 | |
| PRK13764 | 602 | ATPase; Provisional | 95.85 | |
| COG1373 | 398 | Predicted ATPase (AAA+ superfamily) [General funct | 95.85 | |
| PHA02774 | 613 | E1; Provisional | 95.84 | |
| smart00534 | 185 | MUTSac ATPase domain of DNA mismatch repair MUTS f | 95.84 | |
| PRK14956 | 484 | DNA polymerase III subunits gamma and tau; Provisi | 95.83 | |
| cd00227 | 175 | CPT Chloramphenicol (Cm) phosphotransferase (CPT). | 95.83 | |
| COG0703 | 172 | AroK Shikimate kinase [Amino acid transport and me | 95.82 | |
| TIGR03881 | 229 | KaiC_arch_4 KaiC domain protein, PAE1156 family. M | 95.81 | |
| PRK04328 | 249 | hypothetical protein; Provisional | 95.81 | |
| TIGR03574 | 249 | selen_PSTK L-seryl-tRNA(Sec) kinase, archaeal. Mem | 95.79 | |
| PRK02496 | 184 | adk adenylate kinase; Provisional | 95.79 | |
| PRK14961 | 363 | DNA polymerase III subunits gamma and tau; Provisi | 95.78 | |
| TIGR02397 | 355 | dnaX_nterm DNA polymerase III, subunit gamma and t | 95.77 | |
| PRK13900 | 332 | type IV secretion system ATPase VirB11; Provisiona | 95.74 | |
| PRK12422 | 445 | chromosomal replication initiation protein; Provis | 95.73 | |
| KOG1968 | 871 | consensus Replication factor C, subunit RFC1 (larg | 95.73 | |
| PRK14948 | 620 | DNA polymerase III subunits gamma and tau; Provisi | 95.71 | |
| PRK13946 | 184 | shikimate kinase; Provisional | 95.7 | |
| PF09848 | 352 | DUF2075: Uncharacterized conserved protein (DUF207 | 95.7 | |
| PRK05057 | 172 | aroK shikimate kinase I; Reviewed | 95.69 | |
| COG4088 | 261 | Predicted nucleotide kinase [Nucleotide transport | 95.69 | |
| PRK06547 | 172 | hypothetical protein; Provisional | 95.68 | |
| PRK09519 | 790 | recA DNA recombination protein RecA; Reviewed | 95.67 | |
| PRK08154 | 309 | anaerobic benzoate catabolism transcriptional regu | 95.65 | |
| cd01130 | 186 | VirB11-like_ATPase Type IV secretory pathway compo | 95.64 | |
| TIGR01360 | 188 | aden_kin_iso1 adenylate kinase, isozyme 1 subfamil | 95.64 | |
| smart00487 | 201 | DEXDc DEAD-like helicases superfamily. | 95.64 | |
| PRK14963 | 504 | DNA polymerase III subunits gamma and tau; Provisi | 95.63 | |
| KOG2383 | 467 | consensus Predicted ATPase [General function predi | 95.61 | |
| PRK05563 | 559 | DNA polymerase III subunits gamma and tau; Validat | 95.59 | |
| PRK14960 | 702 | DNA polymerase III subunits gamma and tau; Provisi | 95.59 | |
| PRK00279 | 215 | adk adenylate kinase; Reviewed | 95.57 | |
| cd03227 | 162 | ABC_Class2 ABC-type Class 2 contains systems invol | 95.55 | |
| PRK04301 | 317 | radA DNA repair and recombination protein RadA; Va | 95.53 | |
| TIGR01448 | 720 | recD_rel helicase, putative, RecD/TraA family. Thi | 95.52 | |
| cd02027 | 149 | APSK Adenosine 5'-phosphosulfate kinase (APSK) cat | 95.51 | |
| cd03115 | 173 | SRP The signal recognition particle (SRP) mediates | 95.5 | |
| PRK12402 | 337 | replication factor C small subunit 2; Reviewed | 95.5 | |
| TIGR01351 | 210 | adk adenylate kinases. Adenylate kinase (EC 2.7.4. | 95.5 | |
| PLN02200 | 234 | adenylate kinase family protein | 95.47 | |
| cd00267 | 157 | ABC_ATPase ABC (ATP-binding cassette) transporter | 95.46 | |
| COG1102 | 179 | Cmk Cytidylate kinase [Nucleotide transport and me | 95.46 | |
| PRK14952 | 584 | DNA polymerase III subunits gamma and tau; Provisi | 95.45 | |
| PF02562 | 205 | PhoH: PhoH-like protein; InterPro: IPR003714 PhoH | 95.44 | |
| PRK06893 | 229 | DNA replication initiation factor; Validated | 95.41 | |
| PRK06731 | 270 | flhF flagellar biosynthesis regulator FlhF; Valida | 95.37 | |
| COG1066 | 456 | Sms Predicted ATP-dependent serine protease [Postt | 95.36 | |
| cd03216 | 163 | ABC_Carb_Monos_I This family represents the domain | 95.36 | |
| PRK14964 | 491 | DNA polymerase III subunits gamma and tau; Provisi | 95.36 | |
| PRK14965 | 576 | DNA polymerase III subunits gamma and tau; Provisi | 95.35 | |
| PRK04040 | 188 | adenylate kinase; Provisional | 95.34 | |
| PF13481 | 193 | AAA_25: AAA domain; PDB: 1G8Y_J 1OLO_A 1NLF_C. | 95.33 | |
| PF06414 | 199 | Zeta_toxin: Zeta toxin; InterPro: IPR010488 This e | 95.33 | |
| TIGR02655 | 484 | circ_KaiC circadian clock protein KaiC. Members of | 95.32 | |
| TIGR02788 | 308 | VirB11 P-type DNA transfer ATPase VirB11. The VirB | 95.32 | |
| PF04665 | 241 | Pox_A32: Poxvirus A32 protein; InterPro: IPR006758 | 95.32 | |
| TIGR03499 | 282 | FlhF flagellar biosynthetic protein FlhF. | 95.3 | |
| PF13238 | 129 | AAA_18: AAA domain; PDB: 3IIK_A 3IIJ_A 3IIL_A 1RKB | 95.29 | |
| PF14516 | 331 | AAA_35: AAA-like domain | 95.28 | |
| TIGR02236 | 310 | recomb_radA DNA repair and recombination protein R | 95.23 | |
| cd02019 | 69 | NK Nucleoside/nucleotide kinase (NK) is a protein | 95.2 | |
| COG1936 | 180 | Predicted nucleotide kinase (related to CMP and AM | 95.19 | |
| PRK13851 | 344 | type IV secretion system protein VirB11; Provision | 95.19 |
| >KOG0733 consensus Nuclear AAA ATPase (VCP subfamily) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
Probab=100.00 E-value=9e-58 Score=524.93 Aligned_cols=441 Identities=32% Similarity=0.461 Sum_probs=352.1
Q ss_pred CCcccccccccccccchhHHHHHHhhhhhhccccccccccCCCCCCCCceeeeCCCCchHHHHHHHHHHHhhcCCeEEEE
Q 001244 446 PENIEVSFESFPYYLSDITKNVLIASTYVHLKCNNFAKYASDLPTMCPRILLSGPAGSEIYQETLAKALAKHFSARLLIV 525 (1116)
Q Consensus 446 ~~~i~vsf~~FPYylse~tk~~L~~~~~~hLk~~~~~k~~~~L~~~~~~ILLsGp~gsE~Yqe~LaKALA~~f~a~LL~l 525 (1116)
....+|+|.++... +.|-.-|..-.. |++|+++..|+--.+ ++.+||.|||| ++++|||.|+|.++++|+|-+
T Consensus 182 ~~~snv~f~diGG~--d~~~~el~~li~-~i~~Pe~~~~lGv~P--prGvLlHGPPG--CGKT~lA~AiAgel~vPf~~i 254 (802)
T KOG0733|consen 182 FPESNVSFSDIGGL--DKTLAELCELII-HIKHPEVFSSLGVRP--PRGVLLHGPPG--CGKTSLANAIAGELGVPFLSI 254 (802)
T ss_pred CCCCCcchhhccCh--HHHHHHHHHHHH-HhcCchhHhhcCCCC--CCceeeeCCCC--ccHHHHHHHHhhhcCCceEee
Confidence 45668999999998 777777766554 899999988776665 47899999999 999999999999999999988
Q ss_pred ecccCCCCCCccccccccchhhhhhhHHHHHHHhhhccCCCCccccccccccccccCCCCCCcccccccCcccccCCCce
Q 001244 526 DSLLLPGGSSKEADSVKESSRTEKASMFAKRAALLQHRKPTSSVEADITGGTAVGSQALPKPEISTASSKNYTFKKGDRV 605 (1116)
Q Consensus 526 Ds~~l~g~~~ke~~~~~~~~~~e~~s~~~k~s~~~~~~~p~~~~~~~~~g~~~~~~~~~~~~~~~~~~~~~~~~~~gdrv 605 (1116)
-.+.+.+|.+-|
T Consensus 255 sApeivSGvSGE-------------------------------------------------------------------- 266 (802)
T KOG0733|consen 255 SAPEIVSGVSGE-------------------------------------------------------------------- 266 (802)
T ss_pred cchhhhcccCcc--------------------------------------------------------------------
Confidence 877766643311
Q ss_pred eeeccCCCCcccCCCCCCCCCcccceeeeccccCCCCceeeeecCCCCCCCCCCCCcCCCCCcccccccccccCCCcchh
Q 001244 606 KFVGNVTSGTTVQPTLRGPGIGFRGRVILPFEDNDFSKIGVRFDRSIPEGNNLGGFCEDDHGFFCTASSLRLDSSLGDEV 685 (1116)
Q Consensus 606 ~~vg~~~~~~~~~~~~~~p~~g~~g~v~l~~e~n~~~kvgV~Fd~~~~~~~~l~~~c~~~~~~~~~~~~~~~d~s~~~~~ 685 (1116)
T Consensus 267 -------------------------------------------------------------------------------- 266 (802)
T KOG0733|consen 267 -------------------------------------------------------------------------------- 266 (802)
T ss_pred --------------------------------------------------------------------------------
Confidence
Q ss_pred hHHHHHHHHHHHHhhcCCCCeEEEEcchhhhhcC---------ChhhHHHHHHHHhcCC------CCEEEEeeccCCCcc
Q 001244 686 DKLAINELFEVALNESKSSPLIVFVKDIEKSLTG---------NNDAYGALKSKLENLP------SNVVVIGSHTQLDSR 750 (1116)
Q Consensus 686 ~~~~i~~L~evl~~esk~~P~ILfidDie~~l~~---------~~e~~~~lk~~Le~L~------g~VviIgS~~~~d~~ 750 (1116)
.+-.|++||+-+.+ ..||||||||||. |+. ..+++.-|.+-|+.|. .+|+|||+||+||+
T Consensus 267 SEkkiRelF~~A~~---~aPcivFiDeIDA-I~pkRe~aqreMErRiVaQLlt~mD~l~~~~~~g~~VlVIgATnRPDs- 341 (802)
T KOG0733|consen 267 SEKKIRELFDQAKS---NAPCIVFIDEIDA-ITPKREEAQREMERRIVAQLLTSMDELSNEKTKGDPVLVIGATNRPDS- 341 (802)
T ss_pred cHHHHHHHHHHHhc---cCCeEEEeecccc-cccchhhHHHHHHHHHHHHHHHhhhcccccccCCCCeEEEecCCCCcc-
Confidence 12267888888888 9999999999999 772 2567778888888883 38999999999999
Q ss_pred cccCCCCCceeeccCCcchhhccccCCCcccccccccCcchHHHhhhhccccccccccCCchHHHHH--HHHHHHhhchh
Q 001244 751 KEKSHPGGLLFTKFGSNQTALLDLAFPDNFSRLHDRSKETPKALKQISRLFPNKVTIQLPQDEALLS--DWKQQLERDVE 828 (1116)
Q Consensus 751 ~~~~~~~~~~~~~~~~~~~~~lD~a~p~~~~~~~~~~~~~~k~~~~i~klFpn~I~I~~P~DEa~LR--Rfe~qle~~Lp 828 (1116)
||+| +.| ||++++.+..|
T Consensus 342 ---------------------lDpa---------------------------------------LRRaGRFdrEI~l~vP 361 (802)
T KOG0733|consen 342 ---------------------LDPA---------------------------------------LRRAGRFDREICLGVP 361 (802)
T ss_pred ---------------------cCHH---------------------------------------HhccccccceeeecCC
Confidence 8875 333 77777777777
Q ss_pred hhhcccchhhhhhh-hhcCCCCCCCchhhhccccccchhhHHHHHHHhhhccccccccCCCCC-cccc---------ccc
Q 001244 829 TLKGQSNIISIRSV-LSRNGLDCVDLESLCIKDQTLTTEGVEKIVGWALSHHFMHCSEAPGKD-AKLK---------IST 897 (1116)
Q Consensus 829 dlk~R~nIl~Iht~-l~~~~lecvDLeeLai~dk~LsgadIEkIV~sAaS~aL~r~~~~i~~d-~KLv---------IS~ 897 (1116)
+...|..|+++.-. |+-.+ ..|+..||.+|-||-|+|+..||..|...++.|..++.... .+.. +..
T Consensus 362 ~e~aR~~IL~~~~~~lrl~g--~~d~~qlA~lTPGfVGADL~AL~~~Aa~vAikR~ld~~~~p~~~~~~~ed~~~~~~~~ 439 (802)
T KOG0733|consen 362 SETAREEILRIICRGLRLSG--DFDFKQLAKLTPGFVGADLMALCREAAFVAIKRILDQSSSPLTKVPISEDSSNKDAEE 439 (802)
T ss_pred chHHHHHHHHHHHhhCCCCC--CcCHHHHHhcCCCccchhHHHHHHHHHHHHHHHHhhcccCccccCCccccccCCCccc
Confidence 77777788777654 44443 78999999999999999999999999999999876633210 1111 111
Q ss_pred c--hhh------------hhHHHHHhhhhhhhhhhhhhh--hccChhHHHHHHhcCCCCCC--------CCCCCcccccC
Q 001244 898 E--SIM------------YGLNILQGIQSESKSLKKSLK--DVVTENEFEKKLLADVIPPS--------DIGVTFDDIGA 953 (1116)
Q Consensus 898 E--SLk------------vglsdFq~alne~K~L~~~lk--~~v~~~e~e~~ll~~iIp~~--------e~~vtfddIgG 953 (1116)
+ +|+ ..+.++ .++...++..... -.+.-++|+..+.. |.|. -++++|+|||+
T Consensus 440 d~S~i~~~~~~~~~~~ld~v~~~~--i~~~~d~~S~E~~~~L~i~~eDF~~Al~~--iQPSakREGF~tVPdVtW~dIGa 515 (802)
T KOG0733|consen 440 DQSSIKITSNAERPLELDRVVQDA--ILNNPDPLSKELLEGLSIKFEDFEEALSK--IQPSAKREGFATVPDVTWDDIGA 515 (802)
T ss_pred hhhhhhcCCcccccccHHHHHHHH--HHhCCCCcChHHhccceecHHHHHHHHHh--cCcchhcccceecCCCChhhccc
Confidence 1 122 111111 1122222221111 12456678776631 1111 14899999999
Q ss_pred cHHHHHHHHHHHHccccChhhhhcCCCCCCCeEEEEECCCCCchHHHHHHHHHHhCCeeeEEeccccccccccchHHHHH
Q 001244 954 LENVKDTLKELVMLPLQRPELFCKGQLTKPCKGILLFGPPGTGKTMLAKAVATEAGANFINISMSSITSKWFGEGEKYVK 1033 (1116)
Q Consensus 954 ldevk~~L~e~V~lpl~~pelf~~~~l~~p~~gILL~GPPGTGKT~LArAIA~elg~pfI~Is~seL~sk~~GesEk~Ir 1033 (1116)
+++++.+|..+|.+|.++|+.|...|+.. +.||||+||||||||.||+|+|++.|++|+.|..++|+++|+|++|+.++
T Consensus 516 L~~vR~eL~~aI~~PiK~pd~~k~lGi~~-PsGvLL~GPPGCGKTLlAKAVANEag~NFisVKGPELlNkYVGESErAVR 594 (802)
T KOG0733|consen 516 LEEVRLELNMAILAPIKRPDLFKALGIDA-PSGVLLCGPPGCGKTLLAKAVANEAGANFISVKGPELLNKYVGESERAVR 594 (802)
T ss_pred HHHHHHHHHHHHhhhccCHHHHHHhCCCC-CCceEEeCCCCccHHHHHHHHhhhccCceEeecCHHHHHHHhhhHHHHHH
Confidence 99999999999999999999999999765 58999999999999999999999999999999999999999999999999
Q ss_pred HHHHHHhcCCCeEEEEccccccccCCCCCchhHHHHHHHHHHHHHhcCCCcCCCCCEEEEEEeCCCCCCcHHHHh--hcC
Q 001244 1034 AVFSLASKIAPSVVFVDEVDSMLGRRENPGEHEAMRKMKNEFMVNWDGLRTKDKERVLVLAATNRPFDLDEAVVR--RLP 1111 (1116)
Q Consensus 1034 ~lF~~A~k~sPsIIfIDEID~Llg~R~~~~~~~~lr~IlneLL~~Ldgl~~k~~~kVLVIaTTNrp~~LD~ALlR--RF~ 1111 (1116)
++|+.|+.++||||||||||.|.++|+..+ .....+++|+||++|||+.. +.+|+||||||||+.||+|++| ||+
T Consensus 595 ~vFqRAR~saPCVIFFDEiDaL~p~R~~~~-s~~s~RvvNqLLtElDGl~~--R~gV~viaATNRPDiIDpAiLRPGRlD 671 (802)
T KOG0733|consen 595 QVFQRARASAPCVIFFDEIDALVPRRSDEG-SSVSSRVVNQLLTELDGLEE--RRGVYVIAATNRPDIIDPAILRPGRLD 671 (802)
T ss_pred HHHHHhhcCCCeEEEecchhhcCcccCCCC-chhHHHHHHHHHHHhccccc--ccceEEEeecCCCcccchhhcCCCccC
Confidence 999999999999999999999999987744 66778999999999999964 6789999999999999999999 999
Q ss_pred CeEEC
Q 001244 1112 RRTCV 1116 (1116)
Q Consensus 1112 r~I~V 1116 (1116)
+.+||
T Consensus 672 k~LyV 676 (802)
T KOG0733|consen 672 KLLYV 676 (802)
T ss_pred ceeee
Confidence 99986
|
|
| >KOG0730 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0736 consensus Peroxisome assembly factor 2 containing the AAA+-type ATPase domain [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >TIGR01243 CDC48 AAA family ATPase, CDC48 subfamily | Back alignment and domain information |
|---|
| >KOG0741 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0737 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0735 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >COG0464 SpoVK ATPases of the AAA+ class [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >COG1222 RPT1 ATP-dependent 26S proteasome regulatory subunit [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0738 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0739 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0733 consensus Nuclear AAA ATPase (VCP subfamily) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0734 consensus AAA+-type ATPase containing the peptidase M41 domain [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >CHL00195 ycf46 Ycf46; Provisional | Back alignment and domain information |
|---|
| >KOG0727 consensus 26S proteasome regulatory complex, ATPase RPT3 [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0732 consensus AAA+-type ATPase containing the bromodomain [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0728 consensus 26S proteasome regulatory complex, ATPase RPT6 [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >COG1223 Predicted ATPase (AAA+ superfamily) [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0740 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0731 consensus AAA+-type ATPase containing the peptidase M41 domain [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0726 consensus 26S proteasome regulatory complex, ATPase RPT2 [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0729 consensus 26S proteasome regulatory complex, ATPase RPT1 [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0652 consensus 26S proteasome regulatory complex, ATPase RPT5 [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >COG1223 Predicted ATPase (AAA+ superfamily) [General function prediction only] | Back alignment and domain information |
|---|
| >COG1222 RPT1 ATP-dependent 26S proteasome regulatory subunit [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >TIGR03689 pup_AAA proteasome ATPase | Back alignment and domain information |
|---|
| >PTZ00454 26S protease regulatory subunit 6B-like protein; Provisional | Back alignment and domain information |
|---|
| >KOG0651 consensus 26S proteasome regulatory complex, ATPase RPT4 [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >COG0465 HflB ATP-dependent Zn proteases [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK11034 clpA ATP-dependent Clp protease ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK03992 proteasome-activating nucleotidase; Provisional | Back alignment and domain information |
|---|
| >PLN00020 ribulose bisphosphate carboxylase/oxygenase activase -RuBisCO activase (RCA); Provisional | Back alignment and domain information |
|---|
| >TIGR02639 ClpA ATP-dependent Clp protease ATP-binding subunit clpA | Back alignment and domain information |
|---|
| >TIGR01241 FtsH_fam ATP-dependent metalloprotease FtsH | Back alignment and domain information |
|---|
| >PTZ00361 26 proteosome regulatory subunit 4-like protein; Provisional | Back alignment and domain information |
|---|
| >KOG0732 consensus AAA+-type ATPase containing the bromodomain [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0737 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0738 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0730 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >TIGR01242 26Sp45 26S proteasome subunit P45 family | Back alignment and domain information |
|---|
| >CHL00176 ftsH cell division protein; Validated | Back alignment and domain information |
|---|
| >COG0542 clpA ATP-binding subunits of Clp protease and DnaK/DnaJ chaperones [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >TIGR03345 VI_ClpV1 type VI secretion ATPase, ClpV1 family | Back alignment and domain information |
|---|
| >TIGR01243 CDC48 AAA family ATPase, CDC48 subfamily | Back alignment and domain information |
|---|
| >CHL00095 clpC Clp protease ATP binding subunit | Back alignment and domain information |
|---|
| >CHL00206 ycf2 Ycf2; Provisional | Back alignment and domain information |
|---|
| >KOG0734 consensus AAA+-type ATPase containing the peptidase M41 domain [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >TIGR03346 chaperone_ClpB ATP-dependent chaperone ClpB | Back alignment and domain information |
|---|
| >PF00004 AAA: ATPase family associated with various cellular activities (AAA); InterPro: IPR003959 AAA ATPases (ATPases Associated with diverse cellular Activities) form a large protein family and play a number of roles in the cell including cell-cycle regulation, protein proteolysis and disaggregation, organelle biogenesis and intracellular transport | Back alignment and domain information |
|---|
| >KOG0741 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK10733 hflB ATP-dependent metalloprotease; Reviewed | Back alignment and domain information |
|---|
| >PRK10865 protein disaggregation chaperone; Provisional | Back alignment and domain information |
|---|
| >COG0464 SpoVK ATPases of the AAA+ class [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0736 consensus Peroxisome assembly factor 2 containing the AAA+-type ATPase domain [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0739 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0731 consensus AAA+-type ATPase containing the peptidase M41 domain [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >CHL00195 ycf46 Ycf46; Provisional | Back alignment and domain information |
|---|
| >CHL00206 ycf2 Ycf2; Provisional | Back alignment and domain information |
|---|
| >KOG0744 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PTZ00454 26S protease regulatory subunit 6B-like protein; Provisional | Back alignment and domain information |
|---|
| >KOG0726 consensus 26S proteasome regulatory complex, ATPase RPT2 [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >COG0465 HflB ATP-dependent Zn proteases [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK03992 proteasome-activating nucleotidase; Provisional | Back alignment and domain information |
|---|
| >TIGR01241 FtsH_fam ATP-dependent metalloprotease FtsH | Back alignment and domain information |
|---|
| >CHL00181 cbbX CbbX; Provisional | Back alignment and domain information |
|---|
| >KOG0743 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >TIGR02881 spore_V_K stage V sporulation protein K | Back alignment and domain information |
|---|
| >KOG0728 consensus 26S proteasome regulatory complex, ATPase RPT6 [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0727 consensus 26S proteasome regulatory complex, ATPase RPT3 [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >TIGR02880 cbbX_cfxQ probable Rubsico expression protein CbbX | Back alignment and domain information |
|---|
| >KOG0652 consensus 26S proteasome regulatory complex, ATPase RPT5 [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >CHL00176 ftsH cell division protein; Validated | Back alignment and domain information |
|---|
| >PTZ00361 26 proteosome regulatory subunit 4-like protein; Provisional | Back alignment and domain information |
|---|
| >KOG0740 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0729 consensus 26S proteasome regulatory complex, ATPase RPT1 [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0735 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK10733 hflB ATP-dependent metalloprotease; Reviewed | Back alignment and domain information |
|---|
| >TIGR03689 pup_AAA proteasome ATPase | Back alignment and domain information |
|---|
| >TIGR01242 26Sp45 26S proteasome subunit P45 family | Back alignment and domain information |
|---|
| >TIGR02639 ClpA ATP-dependent Clp protease ATP-binding subunit clpA | Back alignment and domain information |
|---|
| >KOG0742 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PLN00020 ribulose bisphosphate carboxylase/oxygenase activase -RuBisCO activase (RCA); Provisional | Back alignment and domain information |
|---|
| >PF05496 RuvB_N: Holliday junction DNA helicase ruvB N-terminus; InterPro: IPR008824 The RuvB protein makes up part of the RuvABC revolvasome which catalyses the resolution of Holliday junctions that arise during genetic recombination and DNA repair | Back alignment and domain information |
|---|
| >TIGR00763 lon ATP-dependent protease La | Back alignment and domain information |
|---|
| >COG2256 MGS1 ATPase related to the helicase subunit of the Holliday junction resolvase [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PRK11034 clpA ATP-dependent Clp protease ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >KOG0651 consensus 26S proteasome regulatory complex, ATPase RPT4 [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK10865 protein disaggregation chaperone; Provisional | Back alignment and domain information |
|---|
| >CHL00095 clpC Clp protease ATP binding subunit | Back alignment and domain information |
|---|
| >TIGR03345 VI_ClpV1 type VI secretion ATPase, ClpV1 family | Back alignment and domain information |
|---|
| >TIGR00390 hslU ATP-dependent protease HslVU, ATPase subunit | Back alignment and domain information |
|---|
| >TIGR00635 ruvB Holliday junction DNA helicase, RuvB subunit | Back alignment and domain information |
|---|
| >TIGR03346 chaperone_ClpB ATP-dependent chaperone ClpB | Back alignment and domain information |
|---|
| >PRK05201 hslU ATP-dependent protease ATP-binding subunit HslU; Provisional | Back alignment and domain information |
|---|
| >COG2204 AtoC Response regulator containing CheY-like receiver, AAA-type ATPase, and DNA-binding domains [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PRK00080 ruvB Holliday junction DNA helicase RuvB; Reviewed | Back alignment and domain information |
|---|
| >cd00009 AAA The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold | Back alignment and domain information |
|---|
| >KOG2004 consensus Mitochondrial ATP-dependent protease PIM1/LON [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK05342 clpX ATP-dependent protease ATP-binding subunit ClpX; Provisional | Back alignment and domain information |
|---|
| >COG0466 Lon ATP-dependent Lon protease, bacterial type [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG1051 consensus Chaperone HSP104 and related ATP-dependent Clp proteases [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >COG2255 RuvB Holliday junction resolvasome, helicase subunit [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PRK14956 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK12323 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK10787 DNA-binding ATP-dependent protease La; Provisional | Back alignment and domain information |
|---|
| >KOG2028 consensus ATPase related to the helicase subunit of the Holliday junction resolvase [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >PRK07003 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >PRK14962 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PF00498 FHA: FHA domain; InterPro: IPR000253 The forkhead-associated (FHA) domain [] is a phosphopeptide recognition domain found in many regulatory proteins | Back alignment and domain information |
|---|
| >TIGR00382 clpX endopeptidase Clp ATP-binding regulatory subunit (clpX) | Back alignment and domain information |
|---|
| >KOG0615 consensus Serine/threonine protein kinase Chk2 and related proteins [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >PRK13342 recombination factor protein RarA; Reviewed | Back alignment and domain information |
|---|
| >PHA02544 44 clamp loader, small subunit; Provisional | Back alignment and domain information |
|---|
| >COG3829 RocR Transcriptional regulator containing PAS, AAA-type ATPase, and DNA-binding domains [Transcription / Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PRK04195 replication factor C large subunit; Provisional | Back alignment and domain information |
|---|
| >cd00060 FHA Forkhead associated domain (FHA); found in eukaryotic and prokaryotic proteins | Back alignment and domain information |
|---|
| >PRK07940 DNA polymerase III subunit delta'; Validated | Back alignment and domain information |
|---|
| >smart00382 AAA ATPases associated with a variety of cellular activities | Back alignment and domain information |
|---|
| >PRK14960 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >TIGR02902 spore_lonB ATP-dependent protease LonB | Back alignment and domain information |
|---|
| >PF07728 AAA_5: AAA domain (dynein-related subfamily); InterPro: IPR011704 The ATPases Associated to a variety of cellular Activities (AAA) are a family distinguished by a highly conserved module of 230 amino acids [] | Back alignment and domain information |
|---|
| >COG3604 FhlA Transcriptional regulator containing GAF, AAA-type ATPase, and DNA binding domains [Transcription / Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PRK14949 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PF07724 AAA_2: AAA domain (Cdc48 subfamily); InterPro: IPR013093 ATPases Associated to a variety of cellular Activities (AAA) are a family distinguished by a highly conserved module of 230 amino acids [] | Back alignment and domain information |
|---|
| >PLN03025 replication factor C subunit; Provisional | Back alignment and domain information |
|---|
| >PRK07994 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >PRK14958 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PF05673 DUF815: Protein of unknown function (DUF815); InterPro: IPR008533 This domain consists of several bacterial proteins of unknown function | Back alignment and domain information |
|---|
| >PF00158 Sigma54_activat: Sigma-54 interaction domain; InterPro: IPR002078 Some bacterial regulatory proteins activate the expression of genes from promoters recognised by core RNA polymerase associated with the alternative sigma-54 factor | Back alignment and domain information |
|---|
| >PRK14961 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK08691 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >TIGR02640 gas_vesic_GvpN gas vesicle protein GvpN | Back alignment and domain information |
|---|
| >PRK11331 5-methylcytosine-specific restriction enzyme subunit McrB; Provisional | Back alignment and domain information |
|---|
| >PRK07764 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >PRK06645 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >PRK14964 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >KOG0989 consensus Replication factor C, subunit RFC4 [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >KOG0742 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK14952 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK05563 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >PRK14963 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK14969 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK14951 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK14959 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PHA02244 ATPase-like protein | Back alignment and domain information |
|---|
| >PRK12402 replication factor C small subunit 2; Reviewed | Back alignment and domain information |
|---|
| >PRK14957 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK13407 bchI magnesium chelatase subunit I; Provisional | Back alignment and domain information |
|---|
| >CHL00081 chlI Mg-protoporyphyrin IX chelatase | Back alignment and domain information |
|---|
| >TIGR02928 orc1/cdc6 family replication initiation protein | Back alignment and domain information |
|---|
| >COG0714 MoxR-like ATPases [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR02397 dnaX_nterm DNA polymerase III, subunit gamma and tau | Back alignment and domain information |
|---|
| >TIGR03420 DnaA_homol_Hda DnaA regulatory inactivator Hda | Back alignment and domain information |
|---|
| >PRK14965 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK00149 dnaA chromosomal replication initiation protein; Reviewed | Back alignment and domain information |
|---|
| >PRK05896 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >PRK06305 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >TIGR01650 PD_CobS cobaltochelatase, CobS subunit | Back alignment and domain information |
|---|
| >PRK07133 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >PRK14970 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK00411 cdc6 cell division control protein 6; Reviewed | Back alignment and domain information |
|---|
| >PRK13341 recombination factor protein RarA/unknown domain fusion protein; Reviewed | Back alignment and domain information |
|---|
| >PRK14948 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PF07726 AAA_3: ATPase family associated with various cellular activities (AAA); InterPro: IPR011703 This entry includes some of the AAA proteins not detected by the IPR003959 from INTERPRO model | Back alignment and domain information |
|---|
| >PRK06647 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >PF01078 Mg_chelatase: Magnesium chelatase, subunit ChlI; InterPro: IPR000523 Magnesium-chelatase is a three-component enzyme that catalyses the insertion of Mg2+ into protoporphyrin IX | Back alignment and domain information |
|---|
| >PRK08903 DnaA regulatory inactivator Hda; Validated | Back alignment and domain information |
|---|
| >PRK12377 putative replication protein; Provisional | Back alignment and domain information |
|---|
| >COG1219 ClpX ATP-dependent protease Clp, ATPase subunit [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >TIGR02442 Cob-chelat-sub cobaltochelatase subunit | Back alignment and domain information |
|---|
| >COG0542 clpA ATP-binding subunits of Clp protease and DnaK/DnaJ chaperones [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK09111 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >PRK14955 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK14953 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >TIGR02903 spore_lon_C ATP-dependent protease, Lon family | Back alignment and domain information |
|---|
| >PF00004 AAA: ATPase family associated with various cellular activities (AAA); InterPro: IPR003959 AAA ATPases (ATPases Associated with diverse cellular Activities) form a large protein family and play a number of roles in the cell including cell-cycle regulation, protein proteolysis and disaggregation, organelle biogenesis and intracellular transport | Back alignment and domain information |
|---|
| >TIGR00362 DnaA chromosomal replication initiator protein DnaA | Back alignment and domain information |
|---|
| >PRK08116 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >KOG0745 consensus Putative ATP-dependent Clp-type protease (AAA+ ATPase superfamily) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK07952 DNA replication protein DnaC; Validated | Back alignment and domain information |
|---|
| >PRK08084 DNA replication initiation factor; Provisional | Back alignment and domain information |
|---|
| >PRK14088 dnaA chromosomal replication initiation protein; Provisional | Back alignment and domain information |
|---|
| >PRK06893 DNA replication initiation factor; Validated | Back alignment and domain information |
|---|
| >TIGR02030 BchI-ChlI magnesium chelatase ATPase subunit I | Back alignment and domain information |
|---|
| >PTZ00112 origin recognition complex 1 protein; Provisional | Back alignment and domain information |
|---|
| >PRK14950 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK14086 dnaA chromosomal replication initiation protein; Provisional | Back alignment and domain information |
|---|
| >PRK00440 rfc replication factor C small subunit; Reviewed | Back alignment and domain information |
|---|
| >PRK14954 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK15424 propionate catabolism operon regulatory protein PrpR; Provisional | Back alignment and domain information |
|---|
| >PRK08451 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >PRK11608 pspF phage shock protein operon transcriptional activator; Provisional | Back alignment and domain information |
|---|
| >TIGR02974 phageshock_pspF psp operon transcriptional activator PspF | Back alignment and domain information |
|---|
| >COG2812 DnaX DNA polymerase III, gamma/tau subunits [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >KOG0744 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK08727 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >COG2607 Predicted ATPase (AAA+ superfamily) [General function prediction only] | Back alignment and domain information |
|---|
| >PRK12422 chromosomal replication initiation protein; Provisional | Back alignment and domain information |
|---|
| >KOG0991 consensus Replication factor C, subunit RFC2 [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >PRK14971 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >TIGR02329 propionate_PrpR propionate catabolism operon regulatory protein PrpR | Back alignment and domain information |
|---|
| >PRK05642 DNA replication initiation factor; Validated | Back alignment and domain information |
|---|
| >smart00350 MCM minichromosome maintenance proteins | Back alignment and domain information |
|---|
| >COG1221 PspF Transcriptional regulators containing an AAA-type ATPase domain and a DNA-binding domain [Transcription / Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PRK13531 regulatory ATPase RavA; Provisional | Back alignment and domain information |
|---|
| >PRK08181 transposase; Validated | Back alignment and domain information |
|---|
| >PF00308 Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013317 This entry represents the central domain of bacterial DnaA proteins [, , ] that play an important role in initiating and regulating chromosomal replication | Back alignment and domain information |
|---|
| >COG0470 HolB ATPase involved in DNA replication [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PRK07471 DNA polymerase III subunit delta'; Validated | Back alignment and domain information |
|---|
| >TIGR01817 nifA Nif-specific regulatory protein | Back alignment and domain information |
|---|
| >PRK05564 DNA polymerase III subunit delta'; Validated | Back alignment and domain information |
|---|
| >PRK11388 DNA-binding transcriptional regulator DhaR; Provisional | Back alignment and domain information |
|---|
| >PRK05022 anaerobic nitric oxide reductase transcription regulator; Provisional | Back alignment and domain information |
|---|
| >PRK15429 formate hydrogenlyase transcriptional activator FhlA; Provisional | Back alignment and domain information |
|---|
| >TIGR00678 holB DNA polymerase III, delta' subunit | Back alignment and domain information |
|---|
| >TIGR03354 VI_FHA type VI secretion system FHA domain protein | Back alignment and domain information |
|---|
| >PRK06620 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >PRK09112 DNA polymerase III subunit delta'; Validated | Back alignment and domain information |
|---|
| >PRK10820 DNA-binding transcriptional regulator TyrR; Provisional | Back alignment and domain information |
|---|
| >TIGR00368 Mg chelatase-related protein | Back alignment and domain information |
|---|
| >PRK06835 DNA replication protein DnaC; Validated | Back alignment and domain information |
|---|
| >PRK14087 dnaA chromosomal replication initiation protein; Provisional | Back alignment and domain information |
|---|
| >KOG1969 consensus DNA replication checkpoint protein CHL12/CTF18 [Cell cycle control, cell division, chromosome partitioning; Replication, recombination and repair] | Back alignment and domain information |
|---|
| >PF01695 IstB_IS21: IstB-like ATP binding protein; InterPro: IPR002611 Proteins in this entry contain an ATP/GTP binding P-loop motif | Back alignment and domain information |
|---|
| >PTZ00111 DNA replication licensing factor MCM4; Provisional | Back alignment and domain information |
|---|
| >COG1239 ChlI Mg-chelatase subunit ChlI [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >TIGR02031 BchD-ChlD magnesium chelatase ATPase subunit D | Back alignment and domain information |
|---|
| >COG1484 DnaC DNA replication protein [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PRK06526 transposase; Provisional | Back alignment and domain information |
|---|
| >PF13177 DNA_pol3_delta2: DNA polymerase III, delta subunit; PDB: 1NJF_B 3GLG_G 1XXH_I 1NJG_A 3GLF_B 3GLI_G 1IQP_E 2GNO_A 1SXJ_E 1A5T_A | Back alignment and domain information |
|---|
| >PRK08939 primosomal protein DnaI; Reviewed | Back alignment and domain information |
|---|
| >TIGR02915 PEP_resp_reg putative PEP-CTERM system response regulator | Back alignment and domain information |
|---|
| >smart00763 AAA_PrkA PrkA AAA domain | Back alignment and domain information |
|---|
| >PRK06921 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK08058 DNA polymerase III subunit delta'; Validated | Back alignment and domain information |
|---|
| >COG1474 CDC6 Cdc6-related protein, AAA superfamily ATPase [DNA replication, recombination, and repair / Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF14532 Sigma54_activ_2: Sigma-54 interaction domain; PDB: 3CO5_B 3N70_H | Back alignment and domain information |
|---|
| >PRK10923 glnG nitrogen regulation protein NR(I); Provisional | Back alignment and domain information |
|---|
| >PRK05707 DNA polymerase III subunit delta'; Validated | Back alignment and domain information |
|---|
| >PRK07399 DNA polymerase III subunit delta'; Validated | Back alignment and domain information |
|---|
| >PRK09183 transposase/IS protein; Provisional | Back alignment and domain information |
|---|
| >PRK11361 acetoacetate metabolism regulatory protein AtoC; Provisional | Back alignment and domain information |
|---|
| >COG0593 DnaA ATPase involved in DNA replication initiation [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PRK09862 putative ATP-dependent protease; Provisional | Back alignment and domain information |
|---|
| >TIGR02881 spore_V_K stage V sporulation protein K | Back alignment and domain information |
|---|
| >TIGR00764 lon_rel lon-related putative ATP-dependent protease | Back alignment and domain information |
|---|
| >PF13401 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S_B | Back alignment and domain information |
|---|
| >PRK09087 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >COG0606 Predicted ATPase with chaperone activity [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK15115 response regulator GlrR; Provisional | Back alignment and domain information |
|---|
| >TIGR00602 rad24 checkpoint protein rad24 | Back alignment and domain information |
|---|
| >KOG0990 consensus Replication factor C, subunit RFC5 [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >CHL00181 cbbX CbbX; Provisional | Back alignment and domain information |
|---|
| >smart00240 FHA Forkhead associated domain | Back alignment and domain information |
|---|
| >PF13173 AAA_14: AAA domain | Back alignment and domain information |
|---|
| >PLN02927 antheraxanthin epoxidase/zeaxanthin epoxidase | Back alignment and domain information |
|---|
| >cd01120 RecA-like_NTPases RecA-like NTPases | Back alignment and domain information |
|---|
| >TIGR01818 ntrC nitrogen regulation protein NR(I) | Back alignment and domain information |
|---|
| >PRK06871 DNA polymerase III subunit delta'; Validated | Back alignment and domain information |
|---|
| >PRK06964 DNA polymerase III subunit delta'; Validated | Back alignment and domain information |
|---|
| >TIGR00763 lon ATP-dependent protease La | Back alignment and domain information |
|---|
| >PRK07993 DNA polymerase III subunit delta'; Validated | Back alignment and domain information |
|---|
| >PRK04132 replication factor C small subunit; Provisional | Back alignment and domain information |
|---|
| >COG3283 TyrR Transcriptional regulator of aromatic amino acids metabolism [Transcription / Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PRK10365 transcriptional regulatory protein ZraR; Provisional | Back alignment and domain information |
|---|
| >COG1224 TIP49 DNA helicase TIP49, TBP-interacting protein [Transcription] | Back alignment and domain information |
|---|
| >COG1716 FOG: FHA domain [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >TIGR02880 cbbX_cfxQ probable Rubsico expression protein CbbX | Back alignment and domain information |
|---|
| >PRK08769 DNA polymerase III subunit delta'; Validated | Back alignment and domain information |
|---|
| >PRK05342 clpX ATP-dependent protease ATP-binding subunit ClpX; Provisional | Back alignment and domain information |
|---|
| >PF05621 TniB: Bacterial TniB protein; InterPro: IPR008868 This family consists of several bacterial TniB NTP-binding proteins | Back alignment and domain information |
|---|
| >PRK06090 DNA polymerase III subunit delta'; Validated | Back alignment and domain information |
|---|
| >COG1220 HslU ATP-dependent protease HslVU (ClpYQ), ATPase subunit [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF06068 TIP49: TIP49 C-terminus; InterPro: IPR010339 This family consists of the C-terminal region of several eukaryotic and archaeal RuvB-like 1 (Pontin or TIP49a) and RuvB-like 2 (Reptin or TIP49b) proteins | Back alignment and domain information |
|---|
| >PRK13765 ATP-dependent protease Lon; Provisional | Back alignment and domain information |
|---|
| >KOG0478 consensus DNA replication licensing factor, MCM4 component [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >PF01637 Arch_ATPase: Archaeal ATPase; InterPro: IPR011579 This domain has been found in a number of bacterial and archaeal proteins, all of which contain a conserved P-loop motif that is involved in binding ATP | Back alignment and domain information |
|---|
| >PRK13406 bchD magnesium chelatase subunit D; Provisional | Back alignment and domain information |
|---|
| >PRK08699 DNA polymerase III subunit delta'; Validated | Back alignment and domain information |
|---|
| >COG1241 MCM2 Predicted ATPase involved in replication control, Cdc46/Mcm family [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >TIGR00382 clpX endopeptidase Clp ATP-binding regulatory subunit (clpX) | Back alignment and domain information |
|---|
| >COG3284 AcoR Transcriptional activator of acetoin/glycerol metabolism [Secondary metabolites biosynthesis, transport, and catabolism / Transcription] | Back alignment and domain information |
|---|
| >PRK00080 ruvB Holliday junction DNA helicase RuvB; Reviewed | Back alignment and domain information |
|---|
| >PF03969 AFG1_ATPase: AFG1-like ATPase; InterPro: IPR005654 ATPase family gene 1 (AFG1) ATPase is a 377 amino acid putative protein with an ATPase motif typical of the protein family including SEC18p PAS1, CDC48-VCP and TBP | Back alignment and domain information |
|---|
| >TIGR02237 recomb_radB DNA repair and recombination protein RadB | Back alignment and domain information |
|---|
| >PF03215 Rad17: Rad17 cell cycle checkpoint protein | Back alignment and domain information |
|---|
| >PF00493 MCM: MCM2/3/5 family This family extends the MCM domain of Prosite | Back alignment and domain information |
|---|
| >PHA00729 NTP-binding motif containing protein | Back alignment and domain information |
|---|
| >TIGR01618 phage_P_loop phage nucleotide-binding protein | Back alignment and domain information |
|---|
| >KOG1881 consensus Anion exchanger adaptor protein Kanadaptin, contains FHA domain [General function prediction only] | Back alignment and domain information |
|---|
| >cd01124 KaiC KaiC is a circadian clock protein primarily found in cyanobacteria KaiC is a RecA-like ATPase, having both Walker A and Walker B motifs | Back alignment and domain information |
|---|
| >COG1219 ClpX ATP-dependent protease Clp, ATPase subunit [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG2170 consensus ATPase of the AAA+ superfamily [General function prediction only] | Back alignment and domain information |
|---|
| >PF00910 RNA_helicase: RNA helicase; InterPro: IPR000605 Helicases have been classified in 5 superfamilies (SF1-SF5) | Back alignment and domain information |
|---|
| >PRK05917 DNA polymerase III subunit delta'; Validated | Back alignment and domain information |
|---|
| >PF12774 AAA_6: Hydrolytic ATP binding site of dynein motor region D1; PDB: 3VKH_A 3VKG_A 4AKI_A 4AI6_B 4AKH_A 4AKG_A 3QMZ_A | Back alignment and domain information |
|---|
| >PRK11823 DNA repair protein RadA; Provisional | Back alignment and domain information |
|---|
| >TIGR03015 pepcterm_ATPase putative secretion ATPase, PEP-CTERM locus subfamily | Back alignment and domain information |
|---|
| >PF05673 DUF815: Protein of unknown function (DUF815); InterPro: IPR008533 This domain consists of several bacterial proteins of unknown function | Back alignment and domain information |
|---|
| >cd01121 Sms Sms (bacterial radA) DNA repair protein | Back alignment and domain information |
|---|
| >TIGR02928 orc1/cdc6 family replication initiation protein | Back alignment and domain information |
|---|
| >KOG1514 consensus Origin recognition complex, subunit 1, and related proteins [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >COG1618 Predicted nucleotide kinase [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >PF12775 AAA_7: P-loop containing dynein motor region D3; PDB: 4AKI_A 4AI6_B 4AKH_A 4AKG_A 3QMZ_A 3VKH_A 3VKG_A | Back alignment and domain information |
|---|
| >PF05729 NACHT: NACHT domain | Back alignment and domain information |
|---|
| >PF13207 AAA_17: AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6_G 2QT1_A 2QSZ_A 2QSY_A 2QT0_A 2QG6_A 2P0E_A | Back alignment and domain information |
|---|
| >KOG0477 consensus DNA replication licensing factor, MCM2 component [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >KOG1970 consensus Checkpoint RAD17-RFC complex, RAD17/RAD24 component [Cell cycle control, cell division, chromosome partitioning; Replication, recombination and repair] | Back alignment and domain information |
|---|
| >PRK09361 radB DNA repair and recombination protein RadB; Provisional | Back alignment and domain information |
|---|
| >KOG0482 consensus DNA replication licensing factor, MCM7 component [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >COG3456 Predicted component of the type VI protein secretion system, contains a FHA domain [Intracellular trafficking, secretion, and vesicular transport; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PRK00411 cdc6 cell division control protein 6; Reviewed | Back alignment and domain information |
|---|
| >TIGR02688 conserved hypothetical protein TIGR02688 | Back alignment and domain information |
|---|
| >PF05707 Zot: Zonular occludens toxin (Zot); InterPro: IPR008900 This entry consists of bacterial and viral proteins which are very similar to the Zonular occludens toxin (Zot) | Back alignment and domain information |
|---|
| >PRK08533 flagellar accessory protein FlaH; Reviewed | Back alignment and domain information |
|---|
| >PRK14962 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >KOG0479 consensus DNA replication licensing factor, MCM3 component [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >KOG1051 consensus Chaperone HSP104 and related ATP-dependent Clp proteases [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK08118 topology modulation protein; Reviewed | Back alignment and domain information |
|---|
| >PRK00771 signal recognition particle protein Srp54; Provisional | Back alignment and domain information |
|---|
| >PRK00149 dnaA chromosomal replication initiation protein; Reviewed | Back alignment and domain information |
|---|
| >KOG2035 consensus Replication factor C, subunit RFC3 [Cell cycle control, cell division, chromosome partitioning; Replication, recombination and repair] | Back alignment and domain information |
|---|
| >TIGR02012 tigrfam_recA protein RecA | Back alignment and domain information |
|---|
| >PF06309 Torsin: Torsin; InterPro: IPR010448 This family consists of several eukaryotic torsin proteins | Back alignment and domain information |
|---|
| >PRK07261 topology modulation protein; Provisional | Back alignment and domain information |
|---|
| >cd00983 recA RecA is a bacterial enzyme which has roles in homologous recombination, DNA repair, and the induction of the SOS response | Back alignment and domain information |
|---|
| >KOG0481 consensus DNA replication licensing factor, MCM5 component [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >PRK05818 DNA polymerase III subunit delta'; Validated | Back alignment and domain information |
|---|
| >PHA02624 large T antigen; Provisional | Back alignment and domain information |
|---|
| >PF03266 NTPase_1: NTPase; InterPro: IPR004948 This entry represents a family of nucleoside-triphosphatases which have activity towards ATP, GTP, CTP, TTP and UTP and may hydrolyse nucleoside diphosphates with lower efficiency [] | Back alignment and domain information |
|---|
| >TIGR00635 ruvB Holliday junction DNA helicase, RuvB subunit | Back alignment and domain information |
|---|
| >PRK00131 aroK shikimate kinase; Reviewed | Back alignment and domain information |
|---|
| >cd01129 PulE-GspE PulE/GspE The type II secretory pathway is the main terminal branch of the general secretory pathway (GSP) | Back alignment and domain information |
|---|
| >PRK12723 flagellar biosynthesis regulator FlhF; Provisional | Back alignment and domain information |
|---|
| >COG3854 SpoIIIAA ncharacterized protein conserved in bacteria [Function unknown] | Back alignment and domain information |
|---|
| >KOG2227 consensus Pre-initiation complex, subunit CDC6, AAA+ superfamily ATPase [Replication, recombination and repair; Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >KOG1942 consensus DNA helicase, TBP-interacting protein [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >PRK15455 PrkA family serine protein kinase; Provisional | Back alignment and domain information |
|---|
| >KOG2228 consensus Origin recognition complex, subunit 4 [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >PRK14722 flhF flagellar biosynthesis regulator FlhF; Provisional | Back alignment and domain information |
|---|
| >PF13604 AAA_30: AAA domain; PDB: 1W36_G 3K70_G 3UPU_B 3GPL_A 3E1S_A 3GP8_A | Back alignment and domain information |
|---|
| >cd01394 radB RadB | Back alignment and domain information |
|---|
| >PF00931 NB-ARC: NB-ARC domain; InterPro: IPR002182 This is the NB-ARC domain, a novel signalling motif found in bacteria and eukaryotes, shared by plant resistance gene products and regulators of cell death in animals [] | Back alignment and domain information |
|---|
| >PRK13342 recombination factor protein RarA; Reviewed | Back alignment and domain information |
|---|
| >KOG0745 consensus Putative ATP-dependent Clp-type protease (AAA+ ATPase superfamily) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >COG4650 RtcR Sigma54-dependent transcription regulator containing an AAA-type ATPase domain and a DNA-binding domain [Transcription / Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0480 consensus DNA replication licensing factor, MCM6 component [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >PRK04296 thymidine kinase; Provisional | Back alignment and domain information |
|---|
| >PRK14086 dnaA chromosomal replication initiation protein; Provisional | Back alignment and domain information |
|---|
| >PRK13407 bchI magnesium chelatase subunit I; Provisional | Back alignment and domain information |
|---|
| >PRK14974 cell division protein FtsY; Provisional | Back alignment and domain information |
|---|
| >PF13191 AAA_16: AAA ATPase domain; PDB: 2V1U_A | Back alignment and domain information |
|---|
| >cd01131 PilT Pilus retraction ATPase PilT | Back alignment and domain information |
|---|
| >PRK07276 DNA polymerase III subunit delta'; Validated | Back alignment and domain information |
|---|
| >cd03283 ABC_MutS-like MutS-like homolog in eukaryotes | Back alignment and domain information |
|---|
| >TIGR00390 hslU ATP-dependent protease HslVU, ATPase subunit | Back alignment and domain information |
|---|
| >PRK06067 flagellar accessory protein FlaH; Validated | Back alignment and domain information |
|---|
| >PRK05800 cobU adenosylcobinamide kinase/adenosylcobinamide-phosphate guanylyltransferase; Validated | Back alignment and domain information |
|---|
| >PRK13695 putative NTPase; Provisional | Back alignment and domain information |
|---|
| >PRK10536 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PF13671 AAA_33: AAA domain; PDB: 1LTQ_A 2IA5_K 1RC8_A 1LY1_A 1RRC_A 1RPZ_A 3ZVM_A 1YJ5_A 3ZVL_A 3U7E_B | Back alignment and domain information |
|---|
| >PRK11331 5-methylcytosine-specific restriction enzyme subunit McrB; Provisional | Back alignment and domain information |
|---|
| >PRK03839 putative kinase; Provisional | Back alignment and domain information |
|---|
| >PRK13947 shikimate kinase; Provisional | Back alignment and domain information |
|---|
| >TIGR03877 thermo_KaiC_1 KaiC domain protein, Ph0284 family | Back alignment and domain information |
|---|
| >TIGR02858 spore_III_AA stage III sporulation protein AA | Back alignment and domain information |
|---|
| >cd00046 DEXDc DEAD-like helicases superfamily | Back alignment and domain information |
|---|
| >TIGR00416 sms DNA repair protein RadA | Back alignment and domain information |
|---|
| >TIGR00362 DnaA chromosomal replication initiator protein DnaA | Back alignment and domain information |
|---|
| >cd01122 GP4d_helicase GP4d_helicase is a homohexameric 5'-3' helicases | Back alignment and domain information |
|---|
| >cd00464 SK Shikimate kinase (SK) is the fifth enzyme in the shikimate pathway, a seven-step biosynthetic pathway which converts erythrose-4-phosphate to chorismic acid, found in bacteria, fungi and plants | Back alignment and domain information |
|---|
| >cd01128 rho_factor Transcription termination factor rho is a bacterial ATP-dependent RNA/DNA helicase | Back alignment and domain information |
|---|
| >PRK12726 flagellar biosynthesis regulator FlhF; Provisional | Back alignment and domain information |
|---|
| >PRK07132 DNA polymerase III subunit delta'; Validated | Back alignment and domain information |
|---|
| >PRK10787 DNA-binding ATP-dependent protease La; Provisional | Back alignment and domain information |
|---|
| >PRK00625 shikimate kinase; Provisional | Back alignment and domain information |
|---|
| >PRK09376 rho transcription termination factor Rho; Provisional | Back alignment and domain information |
|---|
| >PHA02544 44 clamp loader, small subunit; Provisional | Back alignment and domain information |
|---|
| >PRK07764 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >cd01393 recA_like RecA is a bacterial enzyme which has roles in homologous recombination, DNA repair, and the induction of the SOS response | Back alignment and domain information |
|---|
| >PRK11889 flhF flagellar biosynthesis regulator FlhF; Provisional | Back alignment and domain information |
|---|
| >KOG3347 consensus Predicted nucleotide kinase/nuclear protein involved oxidative stress response [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >PRK14532 adenylate kinase; Provisional | Back alignment and domain information |
|---|
| >PF00437 T2SE: Type II/IV secretion system protein; InterPro: IPR001482 A number of bacterial proteins, some of which are involved in a general secretion pathway (GSP) for the export of proteins (also called the type II pathway) belong to this group [, ] | Back alignment and domain information |
|---|
| >COG2256 MGS1 ATPase related to the helicase subunit of the Holliday junction resolvase [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PRK06217 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >PRK09354 recA recombinase A; Provisional | Back alignment and domain information |
|---|
| >cd00544 CobU Adenosylcobinamide kinase / adenosylcobinamide phosphate guanyltransferase (CobU) | Back alignment and domain information |
|---|
| >COG5271 MDN1 AAA ATPase containing von Willebrand factor type A (vWA) domain [General function prediction only] | Back alignment and domain information |
|---|
| >PRK04195 replication factor C large subunit; Provisional | Back alignment and domain information |
|---|
| >PRK10436 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >TIGR01359 UMP_CMP_kin_fam UMP-CMP kinase family | Back alignment and domain information |
|---|
| >PRK14088 dnaA chromosomal replication initiation protein; Provisional | Back alignment and domain information |
|---|
| >PRK06645 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >PRK13949 shikimate kinase; Provisional | Back alignment and domain information |
|---|
| >cd00984 DnaB_C DnaB helicase C terminal domain | Back alignment and domain information |
|---|
| >TIGR02525 plasmid_TraJ plasmid transfer ATPase TraJ | Back alignment and domain information |
|---|
| >COG1485 Predicted ATPase [General function prediction only] | Back alignment and domain information |
|---|
| >cd01123 Rad51_DMC1_radA Rad51_DMC1_radA,B | Back alignment and domain information |
|---|
| >PF00448 SRP54: SRP54-type protein, GTPase domain; InterPro: IPR000897 The signal recognition particle (SRP) is a multimeric protein, which along with its conjugate receptor (SR), is involved in targeting secretory proteins to the rough endoplasmic reticulum (RER) membrane in eukaryotes, or to the plasma membrane in prokaryotes [, ] | Back alignment and domain information |
|---|
| >PRK06762 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >cd01428 ADK Adenylate kinase (ADK) catalyzes the reversible phosphoryl transfer from adenosine triphosphates (ATP) to adenosine monophosphates (AMP) and to yield adenosine diphosphates (ADP) | Back alignment and domain information |
|---|
| >TIGR01425 SRP54_euk signal recognition particle protein SRP54 | Back alignment and domain information |
|---|
| >COG4619 ABC-type uncharacterized transport system, ATPase component [General function prediction only] | Back alignment and domain information |
|---|
| >PRK07003 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >PRK10416 signal recognition particle-docking protein FtsY; Provisional | Back alignment and domain information |
|---|
| >PF06745 KaiC: KaiC; InterPro: IPR014774 This entry represents a domain within bacterial and archaeal proteins, most of which are hypothetical | Back alignment and domain information |
|---|
| >cd02020 CMPK Cytidine monophosphate kinase (CMPK) catalyzes the reversible phosphorylation of cytidine monophosphate (CMP) to produce cytidine diphosphate (CDP), using ATP as the preferred phosphoryl donor | Back alignment and domain information |
|---|
| >cd03280 ABC_MutS2 MutS2 homologs in bacteria and eukaryotes | Back alignment and domain information |
|---|
| >TIGR02538 type_IV_pilB type IV-A pilus assembly ATPase PilB | Back alignment and domain information |
|---|
| >TIGR03878 thermo_KaiC_2 KaiC domain protein, AF_0795 family | Back alignment and domain information |
|---|
| >TIGR02533 type_II_gspE general secretory pathway protein E | Back alignment and domain information |
|---|
| >TIGR01420 pilT_fam pilus retraction protein PilT | Back alignment and domain information |
|---|
| >PRK14531 adenylate kinase; Provisional | Back alignment and domain information |
|---|
| >PF13479 AAA_24: AAA domain | Back alignment and domain information |
|---|
| >PLN03210 Resistant to P | Back alignment and domain information |
|---|
| >PRK13948 shikimate kinase; Provisional | Back alignment and domain information |
|---|
| >cd02021 GntK Gluconate kinase (GntK) catalyzes the phosphoryl transfer from ATP to gluconate | Back alignment and domain information |
|---|
| >cd03281 ABC_MSH5_euk MutS5 homolog in eukaryotes | Back alignment and domain information |
|---|
| >PRK05973 replicative DNA helicase; Provisional | Back alignment and domain information |
|---|
| >cd03243 ABC_MutS_homologs The MutS protein initiates DNA mismatch repair by recognizing mispaired and unpaired bases embedded in duplex DNA and activating endo- and exonucleases to remove the mismatch | Back alignment and domain information |
|---|
| >PRK14530 adenylate kinase; Provisional | Back alignment and domain information |
|---|
| >COG0563 Adk Adenylate kinase and related kinases [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >COG2804 PulE Type II secretory pathway, ATPase PulE/Tfp pilus assembly pathway, ATPase PilB [Cell motility and secretion / Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >TIGR00064 ftsY signal recognition particle-docking protein FtsY | Back alignment and domain information |
|---|
| >TIGR02782 TrbB_P P-type conjugative transfer ATPase TrbB | Back alignment and domain information |
|---|
| >TIGR01313 therm_gnt_kin carbohydrate kinase, thermoresistant glucokinase family | Back alignment and domain information |
|---|
| >TIGR03880 KaiC_arch_3 KaiC domain protein, AF_0351 family | Back alignment and domain information |
|---|
| >PRK03731 aroL shikimate kinase II; Reviewed | Back alignment and domain information |
|---|
| >PRK12323 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PLN03025 replication factor C subunit; Provisional | Back alignment and domain information |
|---|
| >PRK13531 regulatory ATPase RavA; Provisional | Back alignment and domain information |
|---|
| >PRK12724 flagellar biosynthesis regulator FlhF; Provisional | Back alignment and domain information |
|---|
| >PTZ00088 adenylate kinase 1; Provisional | Back alignment and domain information |
|---|
| >PRK05201 hslU ATP-dependent protease ATP-binding subunit HslU; Provisional | Back alignment and domain information |
|---|
| >PRK14959 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK14528 adenylate kinase; Provisional | Back alignment and domain information |
|---|
| >PRK13764 ATPase; Provisional | Back alignment and domain information |
|---|
| >COG1373 Predicted ATPase (AAA+ superfamily) [General function prediction only] | Back alignment and domain information |
|---|
| >PHA02774 E1; Provisional | Back alignment and domain information |
|---|
| >smart00534 MUTSac ATPase domain of DNA mismatch repair MUTS family | Back alignment and domain information |
|---|
| >PRK14956 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >cd00227 CPT Chloramphenicol (Cm) phosphotransferase (CPT) | Back alignment and domain information |
|---|
| >COG0703 AroK Shikimate kinase [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR03881 KaiC_arch_4 KaiC domain protein, PAE1156 family | Back alignment and domain information |
|---|
| >PRK04328 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >TIGR03574 selen_PSTK L-seryl-tRNA(Sec) kinase, archaeal | Back alignment and domain information |
|---|
| >PRK02496 adk adenylate kinase; Provisional | Back alignment and domain information |
|---|
| >PRK14961 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >TIGR02397 dnaX_nterm DNA polymerase III, subunit gamma and tau | Back alignment and domain information |
|---|
| >PRK13900 type IV secretion system ATPase VirB11; Provisional | Back alignment and domain information |
|---|
| >PRK12422 chromosomal replication initiation protein; Provisional | Back alignment and domain information |
|---|
| >KOG1968 consensus Replication factor C, subunit RFC1 (large subunit) [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >PRK14948 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK13946 shikimate kinase; Provisional | Back alignment and domain information |
|---|
| >PF09848 DUF2075: Uncharacterized conserved protein (DUF2075); InterPro: IPR018647 This domain, found in putative ATP/GTP binding proteins, has no known function | Back alignment and domain information |
|---|
| >PRK05057 aroK shikimate kinase I; Reviewed | Back alignment and domain information |
|---|
| >COG4088 Predicted nucleotide kinase [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >PRK06547 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK09519 recA DNA recombination protein RecA; Reviewed | Back alignment and domain information |
|---|
| >PRK08154 anaerobic benzoate catabolism transcriptional regulator; Reviewed | Back alignment and domain information |
|---|
| >cd01130 VirB11-like_ATPase Type IV secretory pathway component VirB11, and related ATPases | Back alignment and domain information |
|---|
| >TIGR01360 aden_kin_iso1 adenylate kinase, isozyme 1 subfamily | Back alignment and domain information |
|---|
| >smart00487 DEXDc DEAD-like helicases superfamily | Back alignment and domain information |
|---|
| >PRK14963 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >KOG2383 consensus Predicted ATPase [General function prediction only] | Back alignment and domain information |
|---|
| >PRK05563 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >PRK14960 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK00279 adk adenylate kinase; Reviewed | Back alignment and domain information |
|---|
| >cd03227 ABC_Class2 ABC-type Class 2 contains systems involved in cellular processes other than transport | Back alignment and domain information |
|---|
| >PRK04301 radA DNA repair and recombination protein RadA; Validated | Back alignment and domain information |
|---|
| >TIGR01448 recD_rel helicase, putative, RecD/TraA family | Back alignment and domain information |
|---|
| >cd02027 APSK Adenosine 5'-phosphosulfate kinase (APSK) catalyzes the phosphorylation of adenosine 5'-phosphosulfate to form 3'-phosphoadenosine 5'-phosphosulfate (PAPS) | Back alignment and domain information |
|---|
| >cd03115 SRP The signal recognition particle (SRP) mediates the transport to or across the plasma membrane in bacteria and the endoplasmic reticulum in eukaryotes | Back alignment and domain information |
|---|
| >PRK12402 replication factor C small subunit 2; Reviewed | Back alignment and domain information |
|---|
| >TIGR01351 adk adenylate kinases | Back alignment and domain information |
|---|
| >PLN02200 adenylate kinase family protein | Back alignment and domain information |
|---|
| >cd00267 ABC_ATPase ABC (ATP-binding cassette) transporter nucleotide-binding domain; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules | Back alignment and domain information |
|---|
| >COG1102 Cmk Cytidylate kinase [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >PRK14952 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PF02562 PhoH: PhoH-like protein; InterPro: IPR003714 PhoH is a cytoplasmic protein and predicted ATPase that is induced by phosphate starvation and belongings to the phosphate regulon (pho) in Escherichia coli [] | Back alignment and domain information |
|---|
| >PRK06893 DNA replication initiation factor; Validated | Back alignment and domain information |
|---|
| >PRK06731 flhF flagellar biosynthesis regulator FlhF; Validated | Back alignment and domain information |
|---|
| >COG1066 Sms Predicted ATP-dependent serine protease [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >cd03216 ABC_Carb_Monos_I This family represents the domain I of the carbohydrate uptake proteins that transport only monosaccharides (Monos) | Back alignment and domain information |
|---|
| >PRK14964 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK14965 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK04040 adenylate kinase; Provisional | Back alignment and domain information |
|---|
| >PF13481 AAA_25: AAA domain; PDB: 1G8Y_J 1OLO_A 1NLF_C | Back alignment and domain information |
|---|
| >PF06414 Zeta_toxin: Zeta toxin; InterPro: IPR010488 This entry represents a domain originally identified in bacterial zeta toxin proteins, where it comprises the whole protein [] | Back alignment and domain information |
|---|
| >TIGR02655 circ_KaiC circadian clock protein KaiC | Back alignment and domain information |
|---|
| >TIGR02788 VirB11 P-type DNA transfer ATPase VirB11 | Back alignment and domain information |
|---|
| >PF04665 Pox_A32: Poxvirus A32 protein; InterPro: IPR006758 This entry contains uncharacterised proteins belonging to the B354L family which include the pox virus A32 protein | Back alignment and domain information |
|---|
| >TIGR03499 FlhF flagellar biosynthetic protein FlhF | Back alignment and domain information |
|---|
| >PF13238 AAA_18: AAA domain; PDB: 3IIK_A 3IIJ_A 3IIL_A 1RKB_A 3IIM_A 2AXP_A 3KB2_A 1KHT_A 1NKS_A 3H86_C | Back alignment and domain information |
|---|
| >PF14516 AAA_35: AAA-like domain | Back alignment and domain information |
|---|
| >TIGR02236 recomb_radA DNA repair and recombination protein RadA | Back alignment and domain information |
|---|
| >cd02019 NK Nucleoside/nucleotide kinase (NK) is a protein superfamily consisting of multiple families of enzymes that share structural similarity and are functionally related to the catalysis of the reversible phosphate group transfer from nucleoside triphosphates to nucleosides/nucleotides, nucleoside monophosphates, or sugars | Back alignment and domain information |
|---|
| >COG1936 Predicted nucleotide kinase (related to CMP and AMP kinases) [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >PRK13851 type IV secretion system protein VirB11; Provisional | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 1116 | ||||
| 3vfd_A | 389 | Human Spastin Aaa Domain Length = 389 | 2e-49 | ||
| 3d8b_A | 357 | Crystal Structure Of Human Fidgetin-Like Protein 1 | 3e-46 | ||
| 3b9p_A | 297 | Spastin Length = 297 | 2e-43 | ||
| 2qp9_X | 355 | Crystal Structure Of S.Cerevisiae Vps4 Length = 355 | 3e-41 | ||
| 2rko_A | 331 | Crystal Structure Of The Vps4p-Dimer Length = 331 | 5e-41 | ||
| 3eih_A | 340 | Crystal Structure Of S.Cerevisiae Vps4 In The Prese | 9e-41 | ||
| 3eie_A | 322 | Crystal Structure Of S.Cerevisiae Vps4 In The So4-B | 1e-40 | ||
| 2zam_A | 444 | Crystal Structure Of Mouse Skd1VPS4B APO-Form Lengt | 2e-39 | ||
| 1xwi_A | 322 | Crystal Structure Of Vps4b Length = 322 | 7e-39 | ||
| 3cf1_A | 806 | Structure Of P97VCP IN COMPLEX WITH ADPADP.ALFX Len | 3e-32 | ||
| 1r7r_A | 816 | The Crystal Structure Of Murine P97VCP AT 3.6A Leng | 3e-32 | ||
| 3cf0_A | 301 | Structure Of D2 Subdomain Of P97VCP IN COMPLEX WITH | 4e-32 | ||
| 3h4m_A | 285 | Aaa Atpase Domain Of The Proteasome- Activating Nuc | 4e-31 | ||
| 4b4t_L | 437 | Near-Atomic Resolution Structural Model Of The Yeas | 6e-30 | ||
| 3hu3_A | 489 | Structure Of P97 N-D1 R155h Mutant In Complex With | 1e-29 | ||
| 3hu2_A | 489 | Structure Of P97 N-D1 R86a Mutant In Complex With A | 1e-29 | ||
| 3hu1_A | 489 | Structure Of P97 N-D1 R95g Mutant In Complex With A | 1e-29 | ||
| 2x8a_A | 274 | Human Nuclear Valosin Containing Protein Like (Nvl) | 1e-29 | ||
| 1e32_A | 458 | Structure Of The N-Terminal Domain And The D1 Aaa D | 2e-29 | ||
| 4b4t_K | 428 | Near-Atomic Resolution Structural Model Of The Yeas | 4e-28 | ||
| 4b4t_I | 437 | Near-Atomic Resolution Structural Model Of The Yeas | 3e-27 | ||
| 4b4t_M | 434 | Near-Atomic Resolution Structural Model Of The Yeas | 5e-27 | ||
| 4b4t_J | 405 | Near-Atomic Resolution Structural Model Of The Yeas | 2e-26 | ||
| 2ce7_A | 476 | Edta Treated Length = 476 | 3e-25 | ||
| 4b4t_H | 467 | Near-Atomic Resolution Structural Model Of The Yeas | 6e-25 | ||
| 3kds_E | 465 | Apo-ftsh Crystal Structure Length = 465 | 1e-24 | ||
| 1lv7_A | 257 | Crystal Structure Of The Aaa Domain Of Ftsh Length | 5e-23 | ||
| 2r62_A | 268 | Crystal Structure Of Helicobacter Pylori Atp Depend | 6e-22 | ||
| 2qz4_A | 262 | Human Paraplegin, Aaa Domain In Complex With Adp Le | 8e-21 | ||
| 1iy2_A | 278 | Crystal Structure Of The Ftsh Atpase Domain From Th | 6e-19 | ||
| 1ixz_A | 254 | Crystal Structure Of The Ftsh Atpase Domain From Th | 8e-19 | ||
| 4eiw_A | 508 | Whole Cytosolic Region Of Atp-Dependent Metalloprot | 1e-18 | ||
| 2dhr_A | 499 | Whole Cytosolic Region Of Atp-Dependent Metalloprot | 1e-18 | ||
| 3m6a_A | 543 | Crystal Structure Of Bacillus Subtilis Lon C-Termin | 4e-06 |
| >pdb|3VFD|A Chain A, Human Spastin Aaa Domain Length = 389 | Back alignment and structure |
|
| >pdb|3D8B|A Chain A, Crystal Structure Of Human Fidgetin-Like Protein 1 In Complex With Adp Length = 357 | Back alignment and structure |
| >pdb|3B9P|A Chain A, Spastin Length = 297 | Back alignment and structure |
| >pdb|2QP9|X Chain X, Crystal Structure Of S.Cerevisiae Vps4 Length = 355 | Back alignment and structure |
| >pdb|2RKO|A Chain A, Crystal Structure Of The Vps4p-Dimer Length = 331 | Back alignment and structure |
| >pdb|3EIH|A Chain A, Crystal Structure Of S.Cerevisiae Vps4 In The Presence Of Atpgammas Length = 340 | Back alignment and structure |
| >pdb|3EIE|A Chain A, Crystal Structure Of S.Cerevisiae Vps4 In The So4-Bound State Length = 322 | Back alignment and structure |
| >pdb|2ZAM|A Chain A, Crystal Structure Of Mouse Skd1VPS4B APO-Form Length = 444 | Back alignment and structure |
| >pdb|1XWI|A Chain A, Crystal Structure Of Vps4b Length = 322 | Back alignment and structure |
| >pdb|3CF1|A Chain A, Structure Of P97VCP IN COMPLEX WITH ADPADP.ALFX Length = 806 | Back alignment and structure |
| >pdb|1R7R|A Chain A, The Crystal Structure Of Murine P97VCP AT 3.6A Length = 816 | Back alignment and structure |
| >pdb|3CF0|A Chain A, Structure Of D2 Subdomain Of P97VCP IN COMPLEX WITH ADP Length = 301 | Back alignment and structure |
| >pdb|3H4M|A Chain A, Aaa Atpase Domain Of The Proteasome- Activating Nucleotidase Length = 285 | Back alignment and structure |
| >pdb|4B4T|L Chain L, Near-Atomic Resolution Structural Model Of The Yeast 26s Proteasome Length = 437 | Back alignment and structure |
| >pdb|3HU3|A Chain A, Structure Of P97 N-D1 R155h Mutant In Complex With Atpgs Length = 489 | Back alignment and structure |
| >pdb|3HU2|A Chain A, Structure Of P97 N-D1 R86a Mutant In Complex With Atpgs Length = 489 | Back alignment and structure |
| >pdb|3HU1|A Chain A, Structure Of P97 N-D1 R95g Mutant In Complex With Atpgs Length = 489 | Back alignment and structure |
| >pdb|2X8A|A Chain A, Human Nuclear Valosin Containing Protein Like (Nvl), C- Terminal Aaa-Atpase Domain Length = 274 | Back alignment and structure |
| >pdb|1E32|A Chain A, Structure Of The N-Terminal Domain And The D1 Aaa Domain Of Membrane Fusion Atpase P97 Length = 458 | Back alignment and structure |
| >pdb|4B4T|K Chain K, Near-Atomic Resolution Structural Model Of The Yeast 26s Proteasome Length = 428 | Back alignment and structure |
| >pdb|4B4T|I Chain I, Near-Atomic Resolution Structural Model Of The Yeast 26s Proteasome Length = 437 | Back alignment and structure |
| >pdb|4B4T|M Chain M, Near-Atomic Resolution Structural Model Of The Yeast 26s Proteasome Length = 434 | Back alignment and structure |
| >pdb|4B4T|J Chain J, Near-Atomic Resolution Structural Model Of The Yeast 26s Proteasome Length = 405 | Back alignment and structure |
| >pdb|2CE7|A Chain A, Edta Treated Length = 476 | Back alignment and structure |
| >pdb|4B4T|H Chain H, Near-Atomic Resolution Structural Model Of The Yeast 26s Proteasome Length = 467 | Back alignment and structure |
| >pdb|3KDS|E Chain E, Apo-ftsh Crystal Structure Length = 465 | Back alignment and structure |
| >pdb|1LV7|A Chain A, Crystal Structure Of The Aaa Domain Of Ftsh Length = 257 | Back alignment and structure |
| >pdb|2R62|A Chain A, Crystal Structure Of Helicobacter Pylori Atp Dependent Protease, Ftsh Length = 268 | Back alignment and structure |
| >pdb|2QZ4|A Chain A, Human Paraplegin, Aaa Domain In Complex With Adp Length = 262 | Back alignment and structure |
| >pdb|1IY2|A Chain A, Crystal Structure Of The Ftsh Atpase Domain From Thermus Thermophilus Length = 278 | Back alignment and structure |
| >pdb|1IXZ|A Chain A, Crystal Structure Of The Ftsh Atpase Domain From Thermus Thermophilus Length = 254 | Back alignment and structure |
| >pdb|4EIW|A Chain A, Whole Cytosolic Region Of Atp-Dependent Metalloprotease Ftsh (G399l) Length = 508 | Back alignment and structure |
| >pdb|2DHR|A Chain A, Whole Cytosolic Region Of Atp-Dependent Metalloprotease Ftsh (G399l) Length = 499 | Back alignment and structure |
| >pdb|3M6A|A Chain A, Crystal Structure Of Bacillus Subtilis Lon C-Terminal Domain Length = 543 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 1116 | |||
| 3b9p_A | 297 | CG5977-PA, isoform A; AAA ATPase, ATP-binding, nuc | 9e-99 | |
| 3vfd_A | 389 | Spastin; ATPase, microtubule severing, hydrolase; | 1e-97 | |
| 3d8b_A | 357 | Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, s | 1e-93 | |
| 3eie_A | 322 | Vacuolar protein sorting-associated protein 4; AAA | 6e-90 | |
| 1xwi_A | 322 | SKD1 protein; VPS4B, AAA ATPase, protein transport | 3e-88 | |
| 2qp9_X | 355 | Vacuolar protein sorting-associated protein 4; ATP | 5e-83 | |
| 2zan_A | 444 | Vacuolar protein sorting-associating protein 4B; S | 2e-79 | |
| 3cf0_A | 301 | Transitional endoplasmic reticulum ATPase; AAA, P9 | 3e-53 | |
| 2x8a_A | 274 | Nuclear valosin-containing protein-like; nuclear p | 2e-52 | |
| 3h4m_A | 285 | Proteasome-activating nucleotidase; ATPase, PAN, A | 7e-51 | |
| 1ypw_A | 806 | Transitional endoplasmic reticulum ATPase; AAA, P9 | 3e-49 | |
| 1ypw_A | 806 | Transitional endoplasmic reticulum ATPase; AAA, P9 | 2e-42 | |
| 3hu3_A | 489 | Transitional endoplasmic reticulum ATPase; VCP, tr | 1e-46 | |
| 1d2n_A | 272 | N-ethylmaleimide-sensitive fusion protein; hexamer | 7e-39 | |
| 3t15_A | 293 | Ribulose bisphosphate carboxylase/oxygenase activ | 3e-38 | |
| 1ixz_A | 254 | ATP-dependent metalloprotease FTSH; AAA domain fol | 6e-31 | |
| 1lv7_A | 257 | FTSH; alpha/beta domain, four helix bundle, hydrol | 1e-30 | |
| 2r62_A | 268 | Cell division protease FTSH homolog; ATPase domain | 2e-30 | |
| 1iy2_A | 278 | ATP-dependent metalloprotease FTSH; AAA domain fol | 3e-30 | |
| 2qz4_A | 262 | Paraplegin; AAA+, SPG7, protease, ADP, structural | 4e-30 | |
| 2ce7_A | 476 | Cell division protein FTSH; metalloprotease; HET: | 1e-24 | |
| 2dhr_A | 499 | FTSH; AAA+ protein, hexameric Zn metalloprotease, | 2e-24 | |
| 1lgp_A | 116 | Cell cycle checkpoint protein CHFR; FHA, tungstate | 3e-18 | |
| 1gxc_A | 149 | CHK2, CDS1, serine/threonine-protein kinase CHK2; | 1e-16 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 8e-15 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 4e-12 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 1e-11 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 1e-08 | |
| 3i6u_A | 419 | CDS1, serine/threonine-protein kinase CHK2; Ser/Th | 2e-09 | |
| 3syl_A | 309 | Protein CBBX; photosynthesis, rubisco activase, AA | 2e-09 | |
| 3pvs_A | 447 | Replication-associated recombination protein A; ma | 5e-09 | |
| 2c9o_A | 456 | RUVB-like 1; hexameric helicase, AAA+-ATPase, ATP- | 1e-08 | |
| 1sxj_A | 516 | Activator 1 95 kDa subunit; clamp loader, processi | 4e-08 | |
| 2jqj_A | 151 | DNA damage response protein kinase DUN1; protein/p | 1e-06 | |
| 3pie_A | 1155 | 5'->3' exoribonuclease (XRN1); beta berrel, tudor | 2e-06 | |
| 2chg_A | 226 | Replication factor C small subunit; DNA-binding pr | 3e-05 | |
| 2chq_A | 319 | Replication factor C small subunit; DNA-binding pr | 7e-05 | |
| 1qu5_A | 182 | Protein kinase SPK1; FHA, RAD53, transferase; NMR | 8e-05 | |
| 1dmz_A | 158 | Protein (protein kinase SPK1); beta-sandwich, anti | 9e-05 | |
| 1iqp_A | 327 | RFCS; clamp loader, extended AAA-ATPase domain, co | 1e-04 | |
| 2qgz_A | 308 | Helicase loader, putative primosome component; str | 1e-04 | |
| 3ec2_A | 180 | DNA replication protein DNAC; helicase loader, rep | 1e-04 | |
| 3hx1_A | 131 | SLR1951 protein; P74513_SYNY3, adenylate cyclase-l | 1e-04 | |
| 1r21_A | 128 | Antigen KI-67; beta sandwich, cell cycle; NMR {Hom | 2e-04 | |
| 3pfi_A | 338 | Holliday junction ATP-dependent DNA helicase RUVB; | 3e-04 | |
| 1in4_A | 334 | RUVB, holliday junction DNA helicase RUVB; AAA+-cl | 3e-04 | |
| 1hqc_A | 324 | RUVB; extended AAA-ATPase domain, complex with nuc | 4e-04 | |
| 3m6a_A | 543 | ATP-dependent protease LA 1; alpha, beta, ATP-bind | 5e-04 |
| >3b9p_A CG5977-PA, isoform A; AAA ATPase, ATP-binding, nucleotide-binding, hydrolase; 2.70A {Drosophila melanogaster} Length = 297 | Back alignment and structure |
|---|
Score = 313 bits (805), Expect = 9e-99
Identities = 94/183 (51%), Positives = 129/183 (70%), Gaps = 4/183 (2%)
Query: 932 KKLLADVIPPSDIGVTFDDIGALENVKDTLKELVMLPLQRPELFCKGQLTKPCKGILLFG 991
+L+ D I V + DI + K L+E+V+LP RPELF L P KG+LLFG
Sbjct: 4 VQLILDEIVEGGAKVEWTDIAGQDVAKQALQEMVILPSVRPELFTG--LRAPAKGLLLFG 61
Query: 992 PPGTGKTMLAKAVATEAGANFINISMSSITSKWFGEGEKYVKAVFSLASKIAPSVVFVDE 1051
PPG GKT+LA+AVATE A F+NIS +S+TSK+ G+GEK V+A+F++A + PS++F+DE
Sbjct: 62 PPGNGKTLLARAVATECSATFLNISAASLTSKYVGDGEKLVRALFAVARHMQPSIIFIDE 121
Query: 1052 VDSMLGRRENPGEHEAMRKMKNEFMVNWDGLRT-KDKERVLVLAATNRPFDLDEAVVRRL 1110
VDS+L R + EHEA R++K EF+V +DGL D +R++VLAATNRP +LDEA +RR
Sbjct: 122 VDSLLSERSS-SEHEASRRLKTEFLVEFDGLPGNPDGDRIVVLAATNRPQELDEAALRRF 180
Query: 1111 PRR 1113
+R
Sbjct: 181 TKR 183
|
| >3vfd_A Spastin; ATPase, microtubule severing, hydrolase; 3.30A {Homo sapiens} Length = 389 | Back alignment and structure |
|---|
| >3d8b_A Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, structural genomics consortium, ATP- hydrolase, magnesium, metal-binding, nucleotide-binding; HET: ADP; 2.00A {Homo sapiens} Length = 357 | Back alignment and structure |
|---|
| >3eie_A Vacuolar protein sorting-associated protein 4; AAA ATPase, ATP-binding cassette, ATP-binding, endosome, MEM nucleotide-binding; 2.70A {Saccharomyces cerevisiae} PDB: 3eih_A* 2rko_A 3mhv_C Length = 322 | Back alignment and structure |
|---|
| >1xwi_A SKD1 protein; VPS4B, AAA ATPase, protein transport; 2.80A {Homo sapiens} Length = 322 | Back alignment and structure |
|---|
| >2qp9_X Vacuolar protein sorting-associated protein 4; ATPase domain, beta domain, C-terminal helix, ATP-binding, E nucleotide-binding; 2.90A {Saccharomyces cerevisiae} PDB: 2qpa_A* Length = 355 | Back alignment and structure |
|---|
| >2zan_A Vacuolar protein sorting-associating protein 4B; SKD1, VPS4B, AAA ATPase, ATP-binding, coiled coil, membrane, nucleotide-binding, phosphorylation; HET: ATP; 3.00A {Mus musculus} PDB: 2zam_A* 2zao_A* 2jqh_A 2jqk_A 1wr0_A 2jq9_A 2k3w_A 1yxr_A Length = 444 | Back alignment and structure |
|---|
| >3cf0_A Transitional endoplasmic reticulum ATPase; AAA, P97/VCP, ERAD, CDC48, ATP-binding, lipid-binding, nucle binding, nucleus, phosphoprotein, transport; HET: ADP; 3.00A {Mus musculus} Length = 301 | Back alignment and structure |
|---|
| >2x8a_A Nuclear valosin-containing protein-like; nuclear protein; 2.60A {Homo sapiens} Length = 274 | Back alignment and structure |
|---|
| >3h4m_A Proteasome-activating nucleotidase; ATPase, PAN, ATP-binding, nucleotide-binding, HY; HET: ADP; 3.11A {Methanocaldococcus jannaschii} Length = 285 | Back alignment and structure |
|---|
| >3hu3_A Transitional endoplasmic reticulum ATPase; VCP, transport protein; HET: AGS; 2.20A {Homo sapiens} PDB: 3hu2_A* 3hu1_A* 1e32_A* 1s3s_A* 2pjh_B Length = 489 | Back alignment and structure |
|---|
| >1d2n_A N-ethylmaleimide-sensitive fusion protein; hexamerization domain, ATPase, transport; HET: ANP; 1.75A {Cricetulus griseus} SCOP: c.37.1.20 PDB: 1nsf_A* Length = 272 | Back alignment and structure |
|---|
| >3t15_A Ribulose bisphosphate carboxylase/oxygenase activ chloroplastic; photosynthesis, rubisco activase, AAA+ protein; 2.95A {Nicotiana tabacum} PDB: 3zw6_A Length = 293 | Back alignment and structure |
|---|
| >1ixz_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 2.20A {Thermus thermophilus} SCOP: c.37.1.20 PDB: 1iy0_A* 1iy1_A* Length = 254 | Back alignment and structure |
|---|
| >1lv7_A FTSH; alpha/beta domain, four helix bundle, hydrolase; 1.50A {Escherichia coli} SCOP: c.37.1.20 Length = 257 | Back alignment and structure |
|---|
| >2r62_A Cell division protease FTSH homolog; ATPase domain, ATP-binding, cell CELL division, hydrolase, membrane, metal-binding; 3.30A {Helicobacter pylori} PDB: 2r65_A* Length = 268 | Back alignment and structure |
|---|
| >1iy2_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 3.20A {Thermus thermophilus} SCOP: c.37.1.20 Length = 278 | Back alignment and structure |
|---|
| >2qz4_A Paraplegin; AAA+, SPG7, protease, ADP, structural genomics, structural G consortium, SGC, ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.22A {Homo sapiens} Length = 262 | Back alignment and structure |
|---|
| >2ce7_A Cell division protein FTSH; metalloprotease; HET: ADP; 2.44A {Thermotoga maritima} SCOP: a.269.1.1 c.37.1.20 PDB: 2cea_A* 3kds_E* Length = 476 | Back alignment and structure |
|---|
| >2dhr_A FTSH; AAA+ protein, hexameric Zn metalloprotease, hydrolase; HET: ADP; 3.90A {Thermus thermophilus} Length = 499 | Back alignment and structure |
|---|
| >1lgp_A Cell cycle checkpoint protein CHFR; FHA, tungstate, domain swapping; 2.00A {Homo sapiens} SCOP: b.26.1.2 PDB: 1lgq_A Length = 116 | Back alignment and structure |
|---|
| >1gxc_A CHK2, CDS1, serine/threonine-protein kinase CHK2; phosphoprotein-binding domain, checkpoint kinase, transferase; HET: TPO; 2.7A {Homo sapiens} SCOP: b.26.1.2 Length = 149 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >3i6u_A CDS1, serine/threonine-protein kinase CHK2; Ser/Thr protein kinase, FHA domain, ATP-binding, cell cycle, mutation, LI-fraumeni syndrome, magnesium; 3.00A {Homo sapiens} PDB: 3i6w_A Length = 419 | Back alignment and structure |
|---|
| >3syl_A Protein CBBX; photosynthesis, rubisco activase, AAA+ protein, calvin cycle chaperone; 3.00A {Rhodobacter sphaeroides} PDB: 3syk_A 3zuh_A* Length = 309 | Back alignment and structure |
|---|
| >3pvs_A Replication-associated recombination protein A; maintenance of genome stability Pro recombination; 2.50A {Escherichia coli} Length = 447 | Back alignment and structure |
|---|
| >2c9o_A RUVB-like 1; hexameric helicase, AAA+-ATPase, ATP-binding, chromatin regulator, growth regulation, hydrolase, nuclear protein, DNA recombination; HET: ADP; 2.2A {Homo sapiens} PDB: 2xsz_A* Length = 456 | Back alignment and structure |
|---|
| >1sxj_A Activator 1 95 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Length = 516 | Back alignment and structure |
|---|
| >2jqj_A DNA damage response protein kinase DUN1; protein/phosphopeptide, cell cycle; HET: DNA; NMR {Saccharomyces cerevisiae} PDB: 2jql_A* Length = 151 | Back alignment and structure |
|---|
| >3pie_A 5'->3' exoribonuclease (XRN1); beta berrel, tudor domain, chromo domain, mRNA turnover, RRN processing, RNA binding, DNA binding; 2.90A {Kluyveromyces lactis} PDB: 3pif_A Length = 1155 | Back alignment and structure |
|---|
| >2chg_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATPase, ATP-binding, nucleotide-binding; HET: ANP; 2.1A {Archaeoglobus fulgidus} Length = 226 | Back alignment and structure |
|---|
| >2chq_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATP ATP-binding, nucleotide-binding; HET: ANP; 3.5A {Archaeoglobus fulgidus} PDB: 2chv_A Length = 319 | Back alignment and structure |
|---|
| >1qu5_A Protein kinase SPK1; FHA, RAD53, transferase; NMR {Saccharomyces cerevisiae} SCOP: b.26.1.2 Length = 182 | Back alignment and structure |
|---|
| >1dmz_A Protein (protein kinase SPK1); beta-sandwich, antiparallel beta-sheets, transferase; NMR {Saccharomyces cerevisiae} SCOP: b.26.1.2 PDB: 1fhq_A 1fhr_A* 1j4k_A* 1j4l_A* 1k2m_A* 1k2n_A* Length = 158 | Back alignment and structure |
|---|
| >1iqp_A RFCS; clamp loader, extended AAA-ATPase domain, complex with ADP, replication; HET: ADP; 2.80A {Pyrococcus furiosus} SCOP: a.80.1.1 c.37.1.20 Length = 327 | Back alignment and structure |
|---|
| >2qgz_A Helicase loader, putative primosome component; structural genomics, PSI-2, protein structure initiative; 2.40A {Streptococcus pyogenes serotype M3} Length = 308 | Back alignment and structure |
|---|
| >3ec2_A DNA replication protein DNAC; helicase loader, replication initiation factor, ATP-binding, nucleotide-binding; HET: DNA ADP; 2.70A {Aquifex aeolicus} PDB: 3ecc_A* Length = 180 | Back alignment and structure |
|---|
| >3hx1_A SLR1951 protein; P74513_SYNY3, adenylate cyclase-like protein, NESG, structural genomics, PSI-2, protein structure initiative; 2.50A {Synechocystis SP} Length = 131 | Back alignment and structure |
|---|
| >1r21_A Antigen KI-67; beta sandwich, cell cycle; NMR {Homo sapiens} SCOP: b.26.1.2 PDB: 2aff_A* Length = 128 | Back alignment and structure |
|---|
| >3pfi_A Holliday junction ATP-dependent DNA helicase RUVB; probable holliday junction DNA helicase; HET: ADP; 2.69A {Campylobacter jejuni subsp} Length = 338 | Back alignment and structure |
|---|
| >1in4_A RUVB, holliday junction DNA helicase RUVB; AAA+-class ATPase, winged-helix domain, ATP hydrolysis, walker A, walker B, sensor 1, sensor 2; HET: ADP; 1.60A {Thermotoga maritima} SCOP: a.4.5.11 c.37.1.20 PDB: 1in5_A* 1in6_A* 1in8_A* 1in7_A* 1j7k_A* Length = 334 | Back alignment and structure |
|---|
| >1hqc_A RUVB; extended AAA-ATPase domain, complex with nucleotide, hydrolase; HET: ADE; 3.20A {Thermus thermophilus} SCOP: a.4.5.11 c.37.1.20 PDB: 1ixs_B* 1ixr_C* Length = 324 | Back alignment and structure |
|---|
| >3m6a_A ATP-dependent protease LA 1; alpha, beta, ATP-binding, hydrolase, nucleotide-binding, Pro serine protease, stress response; HET: ADP; 3.40A {Bacillus subtilis} PDB: 1x37_A Length = 543 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 1116 | |||
| 3cf2_A | 806 | TER ATPase, transitional endoplasmic reticulum ATP | 100.0 | |
| 1ypw_A | 806 | Transitional endoplasmic reticulum ATPase; AAA, P9 | 100.0 | |
| 4b4t_J | 405 | 26S protease regulatory subunit 8 homolog; hydrola | 99.98 | |
| 4b4t_I | 437 | 26S protease regulatory subunit 4 homolog; hydrola | 99.97 | |
| 4b4t_H | 467 | 26S protease regulatory subunit 7 homolog; hydrola | 99.97 | |
| 4b4t_M | 434 | 26S protease regulatory subunit 6A; hydrolase, AAA | 99.97 | |
| 4b4t_L | 437 | 26S protease subunit RPT4; hydrolase, AAA-atpases, | 99.97 | |
| 4b4t_K | 428 | 26S protease regulatory subunit 6B homolog; hydrol | 99.97 | |
| 3cf2_A | 806 | TER ATPase, transitional endoplasmic reticulum ATP | 99.94 | |
| 1xwi_A | 322 | SKD1 protein; VPS4B, AAA ATPase, protein transport | 99.93 | |
| 3eie_A | 322 | Vacuolar protein sorting-associated protein 4; AAA | 99.91 | |
| 2qp9_X | 355 | Vacuolar protein sorting-associated protein 4; ATP | 99.9 | |
| 4b4t_J | 405 | 26S protease regulatory subunit 8 homolog; hydrola | 99.9 | |
| 2zan_A | 444 | Vacuolar protein sorting-associating protein 4B; S | 99.89 | |
| 4b4t_I | 437 | 26S protease regulatory subunit 4 homolog; hydrola | 99.89 | |
| 3cf0_A | 301 | Transitional endoplasmic reticulum ATPase; AAA, P9 | 99.89 | |
| 2x8a_A | 274 | Nuclear valosin-containing protein-like; nuclear p | 99.88 | |
| 4b4t_H | 467 | 26S protease regulatory subunit 7 homolog; hydrola | 99.88 | |
| 3d8b_A | 357 | Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, s | 99.88 | |
| 4b4t_L | 437 | 26S protease subunit RPT4; hydrolase, AAA-atpases, | 99.88 | |
| 3vfd_A | 389 | Spastin; ATPase, microtubule severing, hydrolase; | 99.87 | |
| 3b9p_A | 297 | CG5977-PA, isoform A; AAA ATPase, ATP-binding, nuc | 99.87 | |
| 4b4t_K | 428 | 26S protease regulatory subunit 6B homolog; hydrol | 99.87 | |
| 3pxi_A | 758 | Negative regulator of genetic competence CLPC/MEC; | 99.87 | |
| 4b4t_M | 434 | 26S protease regulatory subunit 6A; hydrolase, AAA | 99.86 | |
| 1r6b_X | 758 | CLPA protein; AAA+, N-terminal domain, CLPS, cryst | 99.86 | |
| 3h4m_A | 285 | Proteasome-activating nucleotidase; ATPase, PAN, A | 99.86 | |
| 2ce7_A | 476 | Cell division protein FTSH; metalloprotease; HET: | 99.86 | |
| 1lv7_A | 257 | FTSH; alpha/beta domain, four helix bundle, hydrol | 99.86 | |
| 2qz4_A | 262 | Paraplegin; AAA+, SPG7, protease, ADP, structural | 99.85 | |
| 3hu3_A | 489 | Transitional endoplasmic reticulum ATPase; VCP, tr | 99.85 | |
| 1qvr_A | 854 | CLPB protein; coiled coil, AAA ATPase, chaperone; | 99.81 | |
| 2dhr_A | 499 | FTSH; AAA+ protein, hexameric Zn metalloprotease, | 99.8 | |
| 3t15_A | 293 | Ribulose bisphosphate carboxylase/oxygenase activ | 99.79 | |
| 2r62_A | 268 | Cell division protease FTSH homolog; ATPase domain | 99.79 | |
| 1ixz_A | 254 | ATP-dependent metalloprotease FTSH; AAA domain fol | 99.78 | |
| 1ypw_A | 806 | Transitional endoplasmic reticulum ATPase; AAA, P9 | 99.75 | |
| 1iy2_A | 278 | ATP-dependent metalloprotease FTSH; AAA domain fol | 99.75 | |
| 1gxc_A | 149 | CHK2, CDS1, serine/threonine-protein kinase CHK2; | 99.73 | |
| 2c9o_A | 456 | RUVB-like 1; hexameric helicase, AAA+-ATPase, ATP- | 99.69 | |
| 1lgp_A | 116 | Cell cycle checkpoint protein CHFR; FHA, tungstate | 99.68 | |
| 1xwi_A | 322 | SKD1 protein; VPS4B, AAA ATPase, protein transport | 99.67 | |
| 2qp9_X | 355 | Vacuolar protein sorting-associated protein 4; ATP | 99.62 | |
| 3eie_A | 322 | Vacuolar protein sorting-associated protein 4; AAA | 99.61 | |
| 2zan_A | 444 | Vacuolar protein sorting-associating protein 4B; S | 99.59 | |
| 3syl_A | 309 | Protein CBBX; photosynthesis, rubisco activase, AA | 99.59 | |
| 1g41_A | 444 | Heat shock protein HSLU; AAA-ATPase, CLPY, ATP-dep | 99.59 | |
| 1d2n_A | 272 | N-ethylmaleimide-sensitive fusion protein; hexamer | 99.58 | |
| 1ofh_A | 310 | ATP-dependent HSL protease ATP-binding subunit HSL | 99.57 | |
| 3hu3_A | 489 | Transitional endoplasmic reticulum ATPase; VCP, tr | 99.55 | |
| 2p65_A | 187 | Hypothetical protein PF08_0063; CLPB, malaria, str | 99.54 | |
| 2x8a_A | 274 | Nuclear valosin-containing protein-like; nuclear p | 99.54 | |
| 3cf0_A | 301 | Transitional endoplasmic reticulum ATPase; AAA, P9 | 99.53 | |
| 3hws_A | 363 | ATP-dependent CLP protease ATP-binding subunit CL; | 99.53 | |
| 1jbk_A | 195 | CLPB protein; beta barrel, chaperone; 1.80A {Esche | 99.51 | |
| 2jqj_A | 151 | DNA damage response protein kinase DUN1; protein/p | 99.5 | |
| 1g6g_A | 127 | Protein kinase RAD53; beta-sandwich, phosphopeptid | 99.5 | |
| 3h4m_A | 285 | Proteasome-activating nucleotidase; ATPase, PAN, A | 99.49 | |
| 2ce7_A | 476 | Cell division protein FTSH; metalloprotease; HET: | 99.49 | |
| 3b9p_A | 297 | CG5977-PA, isoform A; AAA ATPase, ATP-binding, nuc | 99.48 | |
| 3i6u_A | 419 | CDS1, serine/threonine-protein kinase CHK2; Ser/Th | 99.46 | |
| 3pfi_A | 338 | Holliday junction ATP-dependent DNA helicase RUVB; | 99.46 | |
| 3m6a_A | 543 | ATP-dependent protease LA 1; alpha, beta, ATP-bind | 99.46 | |
| 3d8b_A | 357 | Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, s | 99.46 | |
| 1lv7_A | 257 | FTSH; alpha/beta domain, four helix bundle, hydrol | 99.46 | |
| 3vfd_A | 389 | Spastin; ATPase, microtubule severing, hydrolase; | 99.45 | |
| 2qz4_A | 262 | Paraplegin; AAA+, SPG7, protease, ADP, structural | 99.44 | |
| 1um8_A | 376 | ATP-dependent CLP protease ATP-binding subunit CL; | 99.43 | |
| 3uk6_A | 368 | RUVB-like 2; hexameric AAA+ ATP-ASE, DNA unwinding | 99.36 | |
| 4h87_A | 130 | Kanadaptin; FHA domain of PF00498, mRNA processing | 99.34 | |
| 2r62_A | 268 | Cell division protease FTSH homolog; ATPase domain | 99.34 | |
| 1hqc_A | 324 | RUVB; extended AAA-ATPase domain, complex with nuc | 99.33 | |
| 2dhr_A | 499 | FTSH; AAA+ protein, hexameric Zn metalloprotease, | 99.32 | |
| 3u61_B | 324 | DNA polymerase accessory protein 44; AAA+, ATP hyd | 99.32 | |
| 1r6b_X | 758 | CLPA protein; AAA+, N-terminal domain, CLPS, cryst | 99.3 | |
| 2pie_A | 138 | E3 ubiquitin-protein ligase RNF8; FHA domain, comp | 99.3 | |
| 1qvr_A | 854 | CLPB protein; coiled coil, AAA ATPase, chaperone; | 99.3 | |
| 4fcw_A | 311 | Chaperone protein CLPB; AAA domain; HET: ADP; 2.35 | 99.3 | |
| 1g3g_A | 164 | Protien kinase SPK1; FHA domain, RAD53, phosphopep | 99.3 | |
| 2chg_A | 226 | Replication factor C small subunit; DNA-binding pr | 99.29 | |
| 3n70_A | 145 | Transport activator; sigma-54, ntpase, PSI, MCSG, | 99.28 | |
| 3pxg_A | 468 | Negative regulator of genetic competence CLPC/MEC; | 99.27 | |
| 1l8q_A | 324 | Chromosomal replication initiator protein DNAA; AA | 99.27 | |
| 1g8p_A | 350 | Magnesium-chelatase 38 kDa subunit; parallel beta | 99.26 | |
| 3pvs_A | 447 | Replication-associated recombination protein A; ma | 99.25 | |
| 3va4_A | 132 | Mediator of DNA damage checkpoint protein 1; cell | 99.25 | |
| 3cmw_A | 1706 | Protein RECA, recombinase A; homologous recombinat | 99.24 | |
| 3co5_A | 143 | Putative two-component system transcriptional RES | 99.24 | |
| 3pxi_A | 758 | Negative regulator of genetic competence CLPC/MEC; | 99.22 | |
| 2v1u_A | 387 | Cell division control protein 6 homolog; DNA repli | 99.22 | |
| 2qby_B | 384 | CDC6 homolog 3, cell division control protein 6 ho | 99.21 | |
| 1qu5_A | 182 | Protein kinase SPK1; FHA, RAD53, transferase; NMR | 99.21 | |
| 3te6_A | 318 | Regulatory protein SIR3; heterochromatin, gene sil | 99.19 | |
| 1sxj_A | 516 | Activator 1 95 kDa subunit; clamp loader, processi | 99.18 | |
| 1uht_A | 118 | Expressed protein; FHA domain, beta-sandwich, anti | 99.18 | |
| 2bjv_A | 265 | PSP operon transcriptional activator; AAA, transcr | 99.18 | |
| 2r44_A | 331 | Uncharacterized protein; putative ATPase, structur | 99.18 | |
| 1ixz_A | 254 | ATP-dependent metalloprotease FTSH; AAA domain fol | 99.16 | |
| 1njg_A | 250 | DNA polymerase III subunit gamma; rossman-like fol | 99.16 | |
| 1dmz_A | 158 | Protein (protein kinase SPK1); beta-sandwich, anti | 99.15 | |
| 3po8_A | 100 | RV0020C protein, putative uncharacterized protein | 99.12 | |
| 3hx1_A | 131 | SLR1951 protein; P74513_SYNY3, adenylate cyclase-l | 99.12 | |
| 2z4s_A | 440 | Chromosomal replication initiator protein DNAA; AA | 99.12 | |
| 2chq_A | 319 | Replication factor C small subunit; DNA-binding pr | 99.11 | |
| 1r21_A | 128 | Antigen KI-67; beta sandwich, cell cycle; NMR {Hom | 99.11 | |
| 1sxj_D | 353 | Activator 1 41 kDa subunit; clamp loader, processi | 99.11 | |
| 3els_A | 158 | PRE-mRNA leakage protein 1; intrinsically unstruct | 99.1 | |
| 1ojl_A | 304 | Transcriptional regulatory protein ZRAR; response | 99.1 | |
| 2qby_A | 386 | CDC6 homolog 1, cell division control protein 6 ho | 99.09 | |
| 2xt9_B | 115 | Putative signal transduction protein GARA; lyase-s | 99.09 | |
| 3t15_A | 293 | Ribulose bisphosphate carboxylase/oxygenase activ | 99.08 | |
| 1iqp_A | 327 | RFCS; clamp loader, extended AAA-ATPase domain, co | 99.08 | |
| 1sxj_B | 323 | Activator 1 37 kDa subunit; clamp loader, processi | 99.08 | |
| 2csw_A | 145 | Ubiquitin ligase protein RNF8; 11-stranded beta sa | 99.07 | |
| 1iy2_A | 278 | ATP-dependent metalloprotease FTSH; AAA domain fol | 99.05 | |
| 2kb3_A | 143 | Oxoglutarate dehydrogenase inhibitor; forkhead-ass | 99.04 | |
| 3nbx_X | 500 | ATPase RAVA; AAA+ ATPase, alpha-beta-alpha structu | 99.04 | |
| 2c9o_A | 456 | RUVB-like 1; hexameric helicase, AAA+-ATPase, ATP- | 99.04 | |
| 2jpe_A | 140 | Nuclear inhibitor of protein phosphatase 1; FHA do | 99.04 | |
| 3bos_A | 242 | Putative DNA replication factor; P-loop containing | 99.03 | |
| 1fnn_A | 389 | CDC6P, cell division control protein 6; ORC1, AAA | 99.03 | |
| 1mzk_A | 139 | Kinase associated protein phosphatase; beta sandwi | 99.03 | |
| 1g41_A | 444 | Heat shock protein HSLU; AAA-ATPase, CLPY, ATP-dep | 99.02 | |
| 1jr3_A | 373 | DNA polymerase III subunit gamma; processivity, pr | 99.02 | |
| 2kfu_A | 162 | RV1827 PThr 22; FHA domain, phosphorylation, intra | 99.0 | |
| 3f9v_A | 595 | Minichromosome maintenance protein MCM; replicativ | 98.96 | |
| 3elv_A | 205 | PRE-mRNA leakage protein 1; intrinsically unstruct | 98.96 | |
| 3gqs_A | 106 | Adenylate cyclase-like protein; FHA domain, struct | 98.94 | |
| 4ejq_A | 154 | Kinesin-like protein KIF1A; homodimer, FHA domain, | 98.93 | |
| 3oun_A | 157 | Putative uncharacterized protein TB39.8; peptidogl | 98.92 | |
| 1sxj_E | 354 | Activator 1 40 kDa subunit; clamp loader, processi | 98.9 | |
| 1wln_A | 120 | Afadin; beta sandwich, FHA domain, structural geno | 98.9 | |
| 1sxj_C | 340 | Activator 1 40 kDa subunit; clamp loader, processi | 98.88 | |
| 3ec2_A | 180 | DNA replication protein DNAC; helicase loader, rep | 98.88 | |
| 2ff4_A | 388 | Probable regulatory protein EMBR; winged-helix, te | 98.87 | |
| 1in4_A | 334 | RUVB, holliday junction DNA helicase RUVB; AAA+-cl | 98.86 | |
| 3fm8_A | 124 | Kinesin-like protein KIF13B; kinesin, GAP, GTPase | 98.8 | |
| 1a5t_A | 334 | Delta prime, HOLB; zinc finger, DNA replication; 2 | 98.8 | |
| 3cmw_A | 1706 | Protein RECA, recombinase A; homologous recombinat | 98.79 | |
| 2gno_A | 305 | DNA polymerase III, gamma subunit-related protein; | 98.78 | |
| 2w58_A | 202 | DNAI, primosome component (helicase loader); ATP-b | 98.73 | |
| 3uv0_A | 102 | Mutator 2, isoform B; FHA, protein binding, dimeri | 98.72 | |
| 1ny5_A | 387 | Transcriptional regulator (NTRC family); AAA+ ATPa | 98.68 | |
| 2kjq_A | 149 | DNAA-related protein; solution structure, NESG, st | 98.66 | |
| 3k1j_A | 604 | LON protease, ATP-dependent protease LON; ATP-bind | 98.65 | |
| 2brf_A | 110 | Bifunctional polynucleotide phosphatase/kinase; hy | 98.61 | |
| 3kt9_A | 102 | Aprataxin; FHA domain, beta sandwich, beta sheet, | 98.61 | |
| 1yj5_C | 143 | 5' polynucleotide kinase-3' phosphatase FHA domai; | 98.56 | |
| 4akg_A | 2695 | Glutathione S-transferase class-MU 26 kDa isozyme | 98.52 | |
| 2vhj_A | 331 | Ntpase P4, P4; non- hydrolysable ATP analogue, hyd | 98.52 | |
| 3dzd_A | 368 | Transcriptional regulator (NTRC family); sigma43 a | 98.52 | |
| 1w5s_A | 412 | Origin recognition complex subunit 2 ORC2; replica | 98.49 | |
| 2qgz_A | 308 | Helicase loader, putative primosome component; str | 98.44 | |
| 3syl_A | 309 | Protein CBBX; photosynthesis, rubisco activase, AA | 98.42 | |
| 1ujx_A | 119 | Polynucleotide kinase 3'-phosphatase; DNA repair, | 98.39 | |
| 2r2a_A | 199 | Uncharacterized protein; zonular occludens toxin, | 98.29 | |
| 3f8t_A | 506 | Predicted ATPase involved in replication control, | 98.27 | |
| 4egx_A | 184 | Kinesin-like protein KIF1A; FHA domain, transport | 98.23 | |
| 1d2n_A | 272 | N-ethylmaleimide-sensitive fusion protein; hexamer | 98.23 | |
| 3uk6_A | 368 | RUVB-like 2; hexameric AAA+ ATP-ASE, DNA unwinding | 98.23 | |
| 3hws_A | 363 | ATP-dependent CLP protease ATP-binding subunit CL; | 98.21 | |
| 1ofh_A | 310 | ATP-dependent HSL protease ATP-binding subunit HSL | 98.16 | |
| 3m6a_A | 543 | ATP-dependent protease LA 1; alpha, beta, ATP-bind | 98.15 | |
| 1jbk_A | 195 | CLPB protein; beta barrel, chaperone; 1.80A {Esche | 98.07 | |
| 1um8_A | 376 | ATP-dependent CLP protease ATP-binding subunit CL; | 98.01 | |
| 3cmu_A | 2050 | Protein RECA, recombinase A; homologous recombinat | 97.97 | |
| 4akg_A | 2695 | Glutathione S-transferase class-MU 26 kDa isozyme | 97.96 | |
| 3huf_A | 325 | DNA repair and telomere maintenance protein NBS1; | 97.88 | |
| 1tue_A | 212 | Replication protein E1; helicase, replication, E1E | 97.87 | |
| 3pxg_A | 468 | Negative regulator of genetic competence CLPC/MEC; | 97.87 | |
| 2r44_A | 331 | Uncharacterized protein; putative ATPase, structur | 97.85 | |
| 1sxj_A | 516 | Activator 1 95 kDa subunit; clamp loader, processi | 97.85 | |
| 2v1u_A | 387 | Cell division control protein 6 homolog; DNA repli | 97.79 | |
| 3pfi_A | 338 | Holliday junction ATP-dependent DNA helicase RUVB; | 97.78 | |
| 3u61_B | 324 | DNA polymerase accessory protein 44; AAA+, ATP hyd | 97.78 | |
| 2p65_A | 187 | Hypothetical protein PF08_0063; CLPB, malaria, str | 97.74 | |
| 2fna_A | 357 | Conserved hypothetical protein; structural genomic | 97.74 | |
| 2qen_A | 350 | Walker-type ATPase; unknown function; HET: ADP; 2. | 97.65 | |
| 4a0e_A | 123 | YSCD, type III secretion protein; transport protei | 97.65 | |
| 1hqc_A | 324 | RUVB; extended AAA-ATPase domain, complex with nuc | 97.65 | |
| 2chg_A | 226 | Replication factor C small subunit; DNA-binding pr | 97.6 | |
| 1wv3_A | 238 | Similar to DNA segregation ATPase and related prot | 97.59 | |
| 1ye8_A | 178 | Protein THEP1, hypothetical UPF0334 kinase-like pr | 97.58 | |
| 1u0j_A | 267 | DNA replication protein; AAA+ protein, P-loop atpa | 97.54 | |
| 4fcw_A | 311 | Chaperone protein CLPB; AAA domain; HET: ADP; 2.35 | 97.48 | |
| 3vkg_A | 3245 | Dynein heavy chain, cytoplasmic; AAA+ protein, mol | 97.45 | |
| 1g8p_A | 350 | Magnesium-chelatase 38 kDa subunit; parallel beta | 97.43 | |
| 1svm_A | 377 | Large T antigen; AAA+ fold, viral protein; HET: AT | 97.43 | |
| 2z4s_A | 440 | Chromosomal replication initiator protein DNAA; AA | 97.4 | |
| 2qby_A | 386 | CDC6 homolog 1, cell division control protein 6 ho | 97.31 | |
| 2cvh_A | 220 | DNA repair and recombination protein RADB; filamen | 97.31 | |
| 3kw6_A | 78 | 26S protease regulatory subunit 8; structural geno | 97.3 | |
| 1xp8_A | 366 | RECA protein, recombinase A; recombination, radior | 97.25 | |
| 2w0m_A | 235 | SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus | 97.22 | |
| 3nbx_X | 500 | ATPase RAVA; AAA+ ATPase, alpha-beta-alpha structu | 97.2 | |
| 3te6_A | 318 | Regulatory protein SIR3; heterochromatin, gene sil | 97.17 | |
| 1njg_A | 250 | DNA polymerase III subunit gamma; rossman-like fol | 97.16 | |
| 3hr8_A | 356 | Protein RECA; alpha and beta proteins (A/B, A+B), | 97.15 | |
| 3bos_A | 242 | Putative DNA replication factor; P-loop containing | 97.12 | |
| 1n0w_A | 243 | DNA repair protein RAD51 homolog 1; DNA repair, ho | 97.11 | |
| 2krk_A | 86 | 26S protease regulatory subunit 8; structural geno | 97.1 | |
| 3pvs_A | 447 | Replication-associated recombination protein A; ma | 97.1 | |
| 2zr9_A | 349 | Protein RECA, recombinase A; recombination, RECA m | 97.07 | |
| 2qby_B | 384 | CDC6 homolog 3, cell division control protein 6 ho | 97.02 | |
| 3cmu_A | 2050 | Protein RECA, recombinase A; homologous recombinat | 97.0 | |
| 1l8q_A | 324 | Chromosomal replication initiator protein DNAA; AA | 97.0 | |
| 3vkg_A | 3245 | Dynein heavy chain, cytoplasmic; AAA+ protein, mol | 96.99 | |
| 2chq_A | 319 | Replication factor C small subunit; DNA-binding pr | 96.96 | |
| 1qhx_A | 178 | CPT, protein (chloramphenicol phosphotransferase); | 96.89 | |
| 1sxj_B | 323 | Activator 1 37 kDa subunit; clamp loader, processi | 96.85 | |
| 2orw_A | 184 | Thymidine kinase; TMTK, TP4A, transferase; HET: 4T | 96.75 | |
| 2z43_A | 324 | DNA repair and recombination protein RADA; archaea | 96.74 | |
| 1u94_A | 356 | RECA protein, recombinase A; homologous recombinat | 96.74 | |
| 3trf_A | 185 | Shikimate kinase, SK; amino acid biosynthesis, tra | 96.73 | |
| 1v5w_A | 343 | DMC1, meiotic recombination protein DMC1/LIM15 hom | 96.7 | |
| 3upu_A | 459 | ATP-dependent DNA helicase DDA; RECA-like domain, | 96.65 | |
| 1iqp_A | 327 | RFCS; clamp loader, extended AAA-ATPase domain, co | 96.58 | |
| 2ehv_A | 251 | Hypothetical protein PH0186; KAIC, RECA ATPase, un | 96.56 | |
| 2dr3_A | 247 | UPF0273 protein PH0284; RECA superfamily ATPase, h | 96.56 | |
| 3vaa_A | 199 | Shikimate kinase, SK; structural genomics, center | 96.55 | |
| 1sxj_D | 353 | Activator 1 41 kDa subunit; clamp loader, processi | 96.51 | |
| 1jr3_A | 373 | DNA polymerase III subunit gamma; processivity, pr | 96.49 | |
| 3aji_B | 83 | S6C, proteasome (prosome, macropain) 26S subunit, | 96.46 | |
| 1fnn_A | 389 | CDC6P, cell division control protein 6; ORC1, AAA | 96.44 | |
| 3kb2_A | 173 | SPBC2 prophage-derived uncharacterized protein YOR | 96.44 | |
| 3jvv_A | 356 | Twitching mobility protein; hexameric P-loop ATPas | 96.38 | |
| 3vlf_B | 88 | 26S protease regulatory subunit 7 homolog; heat re | 96.37 | |
| 4a74_A | 231 | DNA repair and recombination protein RADA; hydrola | 96.37 | |
| 3f9v_A | 595 | Minichromosome maintenance protein MCM; replicativ | 96.37 | |
| 3io5_A | 333 | Recombination and repair protein; storage dimer, i | 96.35 | |
| 2b8t_A | 223 | Thymidine kinase; deoxyribonucleoside kinase, zinc | 96.34 | |
| 3lda_A | 400 | DNA repair protein RAD51; DNA binding protein, ATP | 96.33 | |
| 1via_A | 175 | Shikimate kinase; structural genomics, transferase | 96.33 | |
| 3iij_A | 180 | Coilin-interacting nuclear ATPase protein; alpha a | 96.31 | |
| 3dm5_A | 443 | SRP54, signal recognition 54 kDa protein; protein- | 96.31 | |
| 1zuh_A | 168 | Shikimate kinase; alpha-beta protein, transferase; | 96.29 | |
| 2iyv_A | 184 | Shikimate kinase, SK; transferase, aromatic amino | 96.25 | |
| 3bh0_A | 315 | DNAB-like replicative helicase; ATPase, replicatio | 96.24 | |
| 2rhm_A | 193 | Putative kinase; P-loop containing nucleoside trip | 96.22 | |
| 1a5t_A | 334 | Delta prime, HOLB; zinc finger, DNA replication; 2 | 96.22 | |
| 1sxj_E | 354 | Activator 1 40 kDa subunit; clamp loader, processi | 96.2 | |
| 1y63_A | 184 | LMAJ004144AAA protein; structural genomics, protei | 96.19 | |
| 2p5t_B | 253 | PEZT; postsegregational killing system, phosphoryl | 96.19 | |
| 1gvn_B | 287 | Zeta; postsegregational killing system, plasmid; 1 | 96.18 | |
| 2i1q_A | 322 | DNA repair and recombination protein RADA; ATPase, | 96.16 | |
| 1aky_A | 220 | Adenylate kinase; ATP:AMP phosphotransferase, myok | 96.15 | |
| 1tev_A | 196 | UMP-CMP kinase; ploop, NMP binding region, LID reg | 96.14 | |
| 3lw7_A | 179 | Adenylate kinase related protein (ADKA-like); AMP, | 96.14 | |
| 2i3b_A | 189 | HCR-ntpase, human cancer-related ntpase; AAA, ross | 96.13 | |
| 2cdn_A | 201 | Adenylate kinase; phosphoryl transfer, associative | 96.12 | |
| 1pzn_A | 349 | RAD51, DNA repair and recombination protein RAD51, | 96.12 | |
| 1vma_A | 306 | Cell division protein FTSY; TM0570, structural gen | 96.08 | |
| 1e6c_A | 173 | Shikimate kinase; phosphoryl transfer, ADP, shikim | 96.08 | |
| 1nlf_A | 279 | Regulatory protein REPA; replicative DNA helicase | 96.07 | |
| 2ze6_A | 253 | Isopentenyl transferase; crown GALL tumor, cytokin | 96.06 | |
| 2c95_A | 196 | Adenylate kinase 1; transferase, AP4A, nucleotide | 96.06 | |
| 2r8r_A | 228 | Sensor protein; KDPD, PFAM02702, MCSG, structural | 96.04 | |
| 3a4m_A | 260 | L-seryl-tRNA(SEC) kinase; P-loop motif, walker A m | 96.04 | |
| 3e1s_A | 574 | Exodeoxyribonuclease V, subunit RECD; alpha and be | 96.03 | |
| 1kag_A | 173 | SKI, shikimate kinase I; transferase, structural g | 96.03 | |
| 2pt5_A | 168 | Shikimate kinase, SK; aromatic amino acid biosynth | 95.99 | |
| 3dl0_A | 216 | Adenylate kinase; phosphotransferase, zinc coordin | 95.94 | |
| 3cm0_A | 186 | Adenylate kinase; ATP-binding, cytoplasm, nucleoti | 95.91 | |
| 2gno_A | 305 | DNA polymerase III, gamma subunit-related protein; | 95.9 | |
| 2zts_A | 251 | Putative uncharacterized protein PH0186; KAIC like | 95.9 | |
| 1ak2_A | 233 | Adenylate kinase isoenzyme-2; nucleoside monophosp | 95.89 | |
| 2bwj_A | 199 | Adenylate kinase 5; phosphoryl transfer reaction, | 95.88 | |
| 3fb4_A | 216 | Adenylate kinase; psychrophIle, phosphotransferase | 95.88 | |
| 1kht_A | 192 | Adenylate kinase; phosphotransferase, signaling pr | 95.87 | |
| 1z6t_A | 591 | APAF-1, apoptotic protease activating factor 1; ca | 95.86 | |
| 1g5t_A | 196 | COB(I)alamin adenosyltransferase; P-loop protein, | 95.86 | |
| 1qf9_A | 194 | UMP/CMP kinase, protein (uridylmonophosphate/cytid | 95.85 | |
| 2r6a_A | 454 | DNAB helicase, replicative helicase; replication, | 95.84 | |
| 2dzn_B | 82 | 26S protease regulatory subunit 6B homolog; ankyri | 95.83 | |
| 2fz4_A | 237 | DNA repair protein RAD25; RECA-like domain, DNA da | 95.82 | |
| 2q6t_A | 444 | DNAB replication FORK helicase; hydrolase; 2.90A { | 95.81 | |
| 1ukz_A | 203 | Uridylate kinase; transferase; HET: ADP AMP; 1.90A | 95.8 | |
| 2vli_A | 183 | Antibiotic resistance protein; transferase, tunica | 95.79 | |
| 1ly1_A | 181 | Polynucleotide kinase; PNK, phosphatase, transfera | 95.79 | |
| 3t61_A | 202 | Gluconokinase; PSI-biology, structural genomics, p | 95.79 | |
| 1zd8_A | 227 | GTP:AMP phosphotransferase mitochondrial; ATP:AMP | 95.78 | |
| 2iut_A | 574 | DNA translocase FTSK; nucleotide-binding, chromoso | 95.78 | |
| 3tlx_A | 243 | Adenylate kinase 2; structural genomics, structura | 95.78 | |
| 3be4_A | 217 | Adenylate kinase; malaria, cryptosporidium parvum | 95.75 | |
| 1knq_A | 175 | Gluconate kinase; ALFA/beta structure, transferase | 95.69 | |
| 1cr0_A | 296 | DNA primase/helicase; RECA-type protein fold, tran | 95.59 | |
| 3kl4_A | 433 | SRP54, signal recognition 54 kDa protein; signal r | 95.59 | |
| 1zp6_A | 191 | Hypothetical protein ATU3015; alpha-beta protein., | 95.58 | |
| 1zak_A | 222 | Adenylate kinase; ATP:AMP-phosphotransferase, tran | 95.55 | |
| 1e4v_A | 214 | Adenylate kinase; transferase(phosphotransferase); | 95.5 | |
| 3bgw_A | 444 | DNAB-like replicative helicase; ATPase, replicatio | 95.46 | |
| 3sr0_A | 206 | Adenylate kinase; phosphoryl transfer analogue, AL | 95.44 | |
| 2pbr_A | 195 | DTMP kinase, thymidylate kinase; transferase, nucl | 95.4 | |
| 4eun_A | 200 | Thermoresistant glucokinase; putative sugar kinase | 95.39 | |
| 2pez_A | 179 | Bifunctional 3'-phosphoadenosine 5'- phosphosulfat | 95.37 | |
| 3umf_A | 217 | Adenylate kinase; rossmann fold, transferase; 2.05 | 95.32 | |
| 2jaq_A | 205 | Deoxyguanosine kinase; transferase, deoxyribonucle | 95.31 | |
| 2ga8_A | 359 | Hypothetical 39.9 kDa protein; YFR007W, YFH7, unkn | 95.27 | |
| 3b6e_A | 216 | Interferon-induced helicase C domain-containing P; | 95.13 | |
| 1nks_A | 194 | Adenylate kinase; thermophilic, transferase; HET: | 95.13 | |
| 3crm_A | 323 | TRNA delta(2)-isopentenylpyrophosphate transferase | 95.11 | |
| 3sfz_A | 1249 | APAF-1, apoptotic peptidase activating factor 1; a | 95.1 | |
| 2xb4_A | 223 | Adenylate kinase; ATP-binding, nucleotide-binding, | 95.1 | |
| 1cke_A | 227 | CK, MSSA, protein (cytidine monophosphate kinase); | 95.08 | |
| 1q57_A | 503 | DNA primase/helicase; dntpase, DNA replication, tr | 95.07 | |
| 2eyu_A | 261 | Twitching motility protein PILT; pilus retraction | 95.04 | |
| 2if2_A | 204 | Dephospho-COA kinase; alpha-beta protein, structur | 95.03 | |
| 2z0h_A | 197 | DTMP kinase, thymidylate kinase; ATP-binding, nucl | 95.03 | |
| 2v54_A | 204 | DTMP kinase, thymidylate kinase; nucleotide biosyn | 95.01 | |
| 1sxj_C | 340 | Activator 1 40 kDa subunit; clamp loader, processi | 94.97 | |
| 2ius_A | 512 | DNA translocase FTSK; nucleotide-binding, chromoso | 94.89 | |
| 1uf9_A | 203 | TT1252 protein; P-loop, nucleotide binding domain, | 94.87 | |
| 1w5s_A | 412 | Origin recognition complex subunit 2 ORC2; replica | 94.76 | |
| 3ake_A | 208 | Cytidylate kinase; CMP kinase, CMP complex, open c | 94.74 | |
| 2plr_A | 213 | DTMP kinase, probable thymidylate kinase; TMP-bind | 94.73 | |
| 2ewv_A | 372 | Twitching motility protein PILT; pilus retraction | 94.7 | |
| 3uie_A | 200 | Adenylyl-sulfate kinase 1, chloroplastic; rossmann | 94.66 | |
| 1p9r_A | 418 | General secretion pathway protein E; bacterial typ | 94.57 | |
| 2wwf_A | 212 | Thymidilate kinase, putative; transferase, malaria | 94.56 | |
| 1w36_D | 608 | RECD, exodeoxyribonuclease V alpha chain; recombin | 94.55 | |
| 2bbw_A | 246 | Adenylate kinase 4, AK4; nucleotide kinase, nucleo | 94.52 | |
| 4gp7_A | 171 | Metallophosphoesterase; polynucleotide kinase phos | 94.52 | |
| 4a1f_A | 338 | DNAB helicase, replicative DNA helicase; hydrolase | 94.47 | |
| 2grj_A | 192 | Dephospho-COA kinase; TM1387, EC 2.7.1.24, dephosp | 94.44 | |
| 1m7g_A | 211 | Adenylylsulfate kinase; APS kinase, transferase, s | 94.43 | |
| 1jjv_A | 206 | Dephospho-COA kinase; P-loop nucleotide-binding fo | 94.42 | |
| 1ex7_A | 186 | Guanylate kinase; substrate-induced FIT, domain mo | 94.41 | |
| 3r20_A | 233 | Cytidylate kinase; structural genomics, seattle st | 94.39 | |
| 1jr3_D | 343 | DNA polymerase III, delta subunit; processivity, p | 94.35 | |
| 3a8t_A | 339 | Adenylate isopentenyltransferase; rossmann fold pr | 94.35 | |
| 4e22_A | 252 | Cytidylate kinase; P-loop, CMP/ATP binding, transf | 94.35 | |
| 1nn5_A | 215 | Similar to deoxythymidylate kinase (thymidylate K; | 94.32 | |
| 1uj2_A | 252 | Uridine-cytidine kinase 2; alpha/beta mononucleoti | 94.28 | |
| 3nwj_A | 250 | ATSK2; P loop, shikimate, nucleoside monophosphate | 94.26 | |
| 2yvu_A | 186 | Probable adenylyl-sulfate kinase; transferase, str | 94.18 | |
| 1vht_A | 218 | Dephospho-COA kinase; structural genomics, transfe | 93.93 | |
| 2h92_A | 219 | Cytidylate kinase; rossmann fold, transferase; HET | 93.87 | |
| 2pt7_A | 330 | CAG-ALFA; ATPase, protein-protein complex, type IV | 93.81 | |
| 1ltq_A | 301 | Polynucleotide kinase; phosphatase, alpha/beta, P- | 93.81 | |
| 2px0_A | 296 | Flagellar biosynthesis protein FLHF; SRP GTPase, f | 93.81 | |
| 1q3t_A | 236 | Cytidylate kinase; nucleotide monophosphate kinase | 93.79 | |
| 3foz_A | 316 | TRNA delta(2)-isopentenylpyrophosphate transferas; | 93.79 | |
| 2gxq_A | 207 | Heat resistant RNA dependent ATPase; RNA helicase, | 93.72 | |
| 3zvl_A | 416 | Bifunctional polynucleotide phosphatase/kinase; hy | 93.65 | |
| 3pie_A | 1155 | 5'->3' exoribonuclease (XRN1); beta berrel, tudor | 93.64 | |
| 2qt1_A | 207 | Nicotinamide riboside kinase 1; non-protein kinase | 93.57 | |
| 2j37_W | 504 | Signal recognition particle 54 kDa protein (SRP54) | 93.48 | |
| 3ney_A | 197 | 55 kDa erythrocyte membrane protein; structural ge | 93.44 | |
| 2f6r_A | 281 | COA synthase, bifunctional coenzyme A synthase; 18 | 93.42 | |
| 4b3f_X | 646 | DNA-binding protein smubp-2; hydrolase, helicase; | 93.37 | |
| 2yhs_A | 503 | FTSY, cell division protein FTSY; cell cycle, prot | 93.35 | |
| 2a5y_B | 549 | CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis | 93.31 | |
| 3d3q_A | 340 | TRNA delta(2)-isopentenylpyrophosphate transferase | 93.27 | |
| 3llm_A | 235 | ATP-dependent RNA helicase A; alpha-beta-alpha, st | 93.25 | |
| 2qor_A | 204 | Guanylate kinase; phosphotransferase, purine metab | 93.15 | |
| 1j8m_F | 297 | SRP54, signal recognition 54 kDa protein; signalin | 93.1 | |
| 2bdt_A | 189 | BH3686; alpha-beta protein, structural genomics, P | 93.09 | |
| 3exa_A | 322 | TRNA delta(2)-isopentenylpyrophosphate transferase | 93.08 | |
| 3fdi_A | 201 | Uncharacterized protein; cytidylate kinase like pr | 93.04 | |
| 2qmh_A | 205 | HPR kinase/phosphorylase; V267F mutation, ATP-bind | 92.76 | |
| 1qde_A | 224 | EIF4A, translation initiation factor 4A; DEAD box | 92.63 | |
| 1hv8_A | 367 | Putative ATP-dependent RNA helicase MJ0669; RNA-bi | 92.62 | |
| 2axn_A | 520 | 6-phosphofructo-2-kinase/fructose-2,6- biphosphata | 92.56 | |
| 2j41_A | 207 | Guanylate kinase; GMP, GMK, transferase, ATP-bindi | 92.55 | |
| 1sky_E | 473 | F1-ATPase, F1-ATP synthase; F1FO ATP synthase, alp | 92.46 | |
| 1vec_A | 206 | ATP-dependent RNA helicase P54; DEAD-box protein, | 92.44 | |
| 1w4r_A | 195 | Thymidine kinase; type II, human, cytosolic, phosp | 92.36 | |
| 3eph_A | 409 | TRNA isopentenyltransferase; transferase, alternat | 92.36 | |
| 2oap_1 | 511 | GSPE-2, type II secretion system protein; hexameri | 92.3 | |
| 3thx_B | 918 | DNA mismatch repair protein MSH3; ABC family ATPas | 92.26 | |
| 2w58_A | 202 | DNAI, primosome component (helicase loader); ATP-b | 92.25 | |
| 3b9q_A | 302 | Chloroplast SRP receptor homolog, alpha subunit CP | 92.23 | |
| 3tau_A | 208 | Guanylate kinase, GMP kinase; structural genomics, | 92.23 | |
| 3asz_A | 211 | Uridine kinase; cytidine phosphorylation, transfer | 92.17 | |
| 1xx6_A | 191 | Thymidine kinase; NESG, northeast structural genom | 92.17 | |
| 1kgd_A | 180 | CASK, peripheral plasma membrane CASK; maguk, guan | 92.13 | |
| 3tr0_A | 205 | Guanylate kinase, GMP kinase; purines, pyrimidines | 91.97 | |
| 1tf7_A | 525 | KAIC; homohexamer, hexamer, circadian clock protei | 91.9 | |
| 3n70_A | 145 | Transport activator; sigma-54, ntpase, PSI, MCSG, | 91.72 | |
| 1rz3_A | 201 | Hypothetical protein rbstp0775; MCSG, structural g | 91.65 | |
| 2xau_A | 773 | PRE-mRNA-splicing factor ATP-dependent RNA helica; | 91.61 | |
| 1nrj_B | 218 | SR-beta, signal recognition particle receptor beta | 91.6 | |
| 2ffh_A | 425 | Protein (FFH); SRP54, signal recognition particle, | 91.59 | |
| 1zu4_A | 320 | FTSY; GTPase, signal recognition particle, SRP, re | 91.57 | |
| 3thx_A | 934 | DNA mismatch repair protein MSH2; ABC family ATPas | 91.56 | |
| 3c8u_A | 208 | Fructokinase; YP_612366.1, putative fructose trans | 91.56 | |
| 2v3c_C | 432 | SRP54, signal recognition 54 kDa protein; nucleoti | 91.46 | |
| 3e70_C | 328 | DPA, signal recognition particle receptor; FTSY, S | 91.41 | |
| 2bjv_A | 265 | PSP operon transcriptional activator; AAA, transcr | 91.4 | |
| 1t6n_A | 220 | Probable ATP-dependent RNA helicase; RECA-like fol | 91.31 | |
| 1tf7_A | 525 | KAIC; homohexamer, hexamer, circadian clock protei | 91.28 | |
| 2xxa_A | 433 | Signal recognition particle protein; protein trans | 91.26 | |
| 3hdt_A | 223 | Putative kinase; structura genomics, PSI-2, protei | 91.07 | |
| 1x6v_B | 630 | Bifunctional 3'-phosphoadenosine 5'- phosphosulfat | 90.98 | |
| 3gmt_A | 230 | Adenylate kinase; ssgcid, ATP-BIN cytoplasm, nucle | 90.93 | |
| 2pl3_A | 236 | Probable ATP-dependent RNA helicase DDX10; DEAD, s | 90.87 | |
| 3lxx_A | 239 | GTPase IMAP family member 4; structural genomics c | 90.86 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 90.84 | |
| 1ls1_A | 295 | Signal recognition particle protein; FFH, SRP54, S | 90.65 | |
| 3a00_A | 186 | Guanylate kinase, GMP kinase; domain movement, dim | 90.46 | |
| 1lvg_A | 198 | Guanylate kinase, GMP kinase; transferase; HET: AD | 90.42 | |
| 1gtv_A | 214 | TMK, thymidylate kinase; transferase, transferase | 90.38 | |
| 3tbk_A | 555 | RIG-I helicase domain; DECH helicase, ATP binding, | 90.3 | |
| 3lxw_A | 247 | GTPase IMAP family member 1; immunity, structural | 90.26 | |
| 4eaq_A | 229 | DTMP kinase, thymidylate kinase; structural genomi | 90.1 | |
| 3pey_A | 395 | ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, A | 89.98 | |
| 3iuy_A | 228 | Probable ATP-dependent RNA helicase DDX53; REC-A-l | 89.85 | |
| 2a9k_A | 187 | RAS-related protein RAL-A; bacterial ADP-ribosyltr | 89.72 | |
| 2gza_A | 361 | Type IV secretion system protein VIRB11; ATPase, h | 89.61 | |
| 2jeo_A | 245 | Uridine-cytidine kinase 1; UCK, transferase, ATP-b | 89.48 | |
| 1a7j_A | 290 | Phosphoribulokinase; transferase, calvin cycle; 2. | 89.43 | |
| 2zj8_A | 720 | DNA helicase, putative SKI2-type helicase; RECA fo | 89.3 | |
| 1htw_A | 158 | HI0065; nucleotide-binding fold, structural genomi | 89.28 | |
| 1zd9_A | 188 | ADP-ribosylation factor-like 10B; transport protei | 89.26 | |
| 1wb9_A | 800 | DNA mismatch repair protein MUTS; DNA-binding, ATP | 89.1 | |
| 1znw_A | 207 | Guanylate kinase, GMP kinase; ATP:GMP-phosphotrans | 89.05 | |
| 3ice_A | 422 | Transcription termination factor RHO; transcriptio | 89.03 | |
| 3bor_A | 237 | Human initiation factor 4A-II; translation initiat | 88.91 | |
| 1c9k_A | 180 | COBU, adenosylcobinamide kinase; alpha/beta struct | 88.77 | |
| 1p5z_B | 263 | DCK, deoxycytidine kinase; nucleoside kinase, P-lo | 88.76 | |
| 2oxc_A | 230 | Probable ATP-dependent RNA helicase DDX20; DEAD, s | 88.75 | |
| 2gj8_A | 172 | MNME, tRNA modification GTPase TRME; G-domain dime | 88.73 | |
| 1u8z_A | 168 | RAS-related protein RAL-A; GNP, GTP, GMPPNP, GPPNH | 88.6 | |
| 1r8s_A | 164 | ADP-ribosylation factor 1; protein transport/excha | 88.59 | |
| 2j9r_A | 214 | Thymidine kinase; TK1, DNK, lasso, transferase, AT | 88.49 | |
| 1wp9_A | 494 | ATP-dependent RNA helicase, putative; ATPase, DNA | 88.46 | |
| 3fht_A | 412 | ATP-dependent RNA helicase DDX19B; DBP5, DEAD-box | 88.45 | |
| 3p32_A | 355 | Probable GTPase RV1496/MT1543; structural genomics | 88.45 | |
| 1z6g_A | 218 | Guanylate kinase; structural genomics, SGC, struct | 88.42 | |
| 2bov_A | 206 | RAla, RAS-related protein RAL-A; C3BOT, exoenzyme, | 88.35 | |
| 3tqf_A | 181 | HPR(Ser) kinase; transferase, hydrolase; 2.80A {Co | 88.22 | |
| 3co5_A | 143 | Putative two-component system transcriptional RES | 88.14 | |
| 3k53_A | 271 | Ferrous iron transport protein B; GTPase fold, hel | 88.14 | |
| 1ky3_A | 182 | GTP-binding protein YPT7P; vesicular traffic, GTP | 88.03 | |
| 1odf_A | 290 | YGR205W, hypothetical 33.3 kDa protein in ADE3-Ser | 88.01 | |
| 3oiy_A | 414 | Reverse gyrase helicase domain; topoisomerase, DNA | 87.96 | |
| 3h1t_A | 590 | Type I site-specific restriction-modification syst | 87.95 | |
| 2ocp_A | 241 | DGK, deoxyguanosine kinase; protein-nucleotide com | 87.92 | |
| 1wms_A | 177 | RAB-9, RAB9, RAS-related protein RAB-9A; GTPase, p | 87.84 | |
| 1ewq_A | 765 | DNA mismatch repair protein MUTS; multiple domains | 87.78 | |
| 1m8p_A | 573 | Sulfate adenylyltransferase; rossmann fold, phosph | 87.78 | |
| 2fwr_A | 472 | DNA repair protein RAD25; DNA unwinding, XPB, DNA | 87.77 | |
| 4edh_A | 213 | DTMP kinase, thymidylate kinase; structural genomi | 87.67 | |
| 3iby_A | 256 | Ferrous iron transport protein B; G protein, G dom | 87.66 | |
| 1s96_A | 219 | Guanylate kinase, GMP kinase; E.coli, dimer, SAD, | 87.58 | |
| 2j0s_A | 410 | ATP-dependent RNA helicase DDX48; mRNA processing, | 87.47 | |
| 3pqc_A | 195 | Probable GTP-binding protein ENGB; rossmann fold, | 87.46 | |
| 2wjg_A | 188 | FEOB, ferrous iron transport protein B homolog; me | 87.44 | |
| 1xjc_A | 169 | MOBB protein homolog; structural genomics, midwest | 87.26 | |
| 3fe2_A | 242 | Probable ATP-dependent RNA helicase DDX5; DEAD, AD | 87.24 | |
| 2v9p_A | 305 | Replication protein E1; AAA+ molecular motor, DNA | 87.21 | |
| 1bif_A | 469 | 6-phosphofructo-2-kinase/ fructose-2,6-bisphospha; | 87.12 | |
| 2og2_A | 359 | Putative signal recognition particle receptor; nuc | 87.08 | |
| 1fzq_A | 181 | ADP-ribosylation factor-like protein 3; protein-GD | 87.02 | |
| 2v6i_A | 431 | RNA helicase; membrane, hydrolase, transmembrane, | 86.96 | |
| 3def_A | 262 | T7I23.11 protein; chloroplast, TOC33, GTPase, hydr | 86.94 | |
| 3ly5_A | 262 | ATP-dependent RNA helicase DDX18; alpha-beta, stru | 86.89 | |
| 3lnc_A | 231 | Guanylate kinase, GMP kinase; ALS collaborative cr | 86.84 | |
| 2qm8_A | 337 | GTPase/ATPase; G protein, G3E, metallochaperone, c | 86.8 | |
| 1sq5_A | 308 | Pantothenate kinase; P-loop, transferase; HET: PAU | 86.74 | |
| 3ber_A | 249 | Probable ATP-dependent RNA helicase DDX47; DEAD, A | 86.63 | |
| 3dkp_A | 245 | Probable ATP-dependent RNA helicase DDX52; DEAD, A | 86.6 | |
| 1z06_A | 189 | RAS-related protein RAB-33B; RAB GTPase, RAB33B GT | 86.54 | |
| 3kta_A | 182 | Chromosome segregation protein SMC; structural mai | 86.45 | |
| 2va8_A | 715 | SSO2462, SKI2-type helicase; hydrolase, DNA repair | 86.42 | |
| 3dz8_A | 191 | RAS-related protein RAB-3B; GDP, GTPase, structura | 86.31 | |
| 2wji_A | 165 | Ferrous iron transport protein B homolog; membrane | 86.25 | |
| 1xti_A | 391 | Probable ATP-dependent RNA helicase P47; alpha-bet | 86.08 | |
| 3vkw_A | 446 | Replicase large subunit; alpha/beta domain, helica | 85.97 | |
| 1rj9_A | 304 | FTSY, signal recognition protein; SRP-GTPase domai | 85.91 | |
| 3aez_A | 312 | Pantothenate kinase; transferase, homodimer, COA b | 85.8 | |
| 3eiq_A | 414 | Eukaryotic initiation factor 4A-I; PDCD4, anti-onc | 85.74 | |
| 2gk6_A | 624 | Regulator of nonsense transcripts 1; UPF1, helicas | 85.73 | |
| 2qgz_A | 308 | Helicase loader, putative primosome component; str | 85.34 | |
| 2o8b_B | 1022 | DNA mismatch repair protein MSH6; DNA damage respo | 85.32 | |
| 3tqc_A | 321 | Pantothenate kinase; biosynthesis of cofactors, pr | 85.3 | |
| 4i1u_A | 210 | Dephospho-COA kinase; structural genomics, niaid, | 85.26 | |
| 3ec2_A | 180 | DNA replication protein DNAC; helicase loader, rep | 85.21 | |
| 3v9p_A | 227 | DTMP kinase, thymidylate kinase; ssgcid, STRU geno | 85.13 | |
| 1g8f_A | 511 | Sulfate adenylyltransferase; alpha-beta protein, b | 85.12 | |
| 2dyk_A | 161 | GTP-binding protein; GTPase, ribosome-binding prot | 85.06 | |
| 3crm_A | 323 | TRNA delta(2)-isopentenylpyrophosphate transferase | 84.91 | |
| 1qhx_A | 178 | CPT, protein (chloramphenicol phosphotransferase); | 84.83 | |
| 2qtf_A | 364 | Protein HFLX, GTP-binding protein; beta-alpha-barr | 84.72 | |
| 3trf_A | 185 | Shikimate kinase, SK; amino acid biosynthesis, tra | 84.42 | |
| 2e87_A | 357 | Hypothetical protein PH1320; GTP-binding, GTPase, | 84.19 | |
| 4a2p_A | 556 | RIG-I, retinoic acid inducible protein I; hydrolas | 84.18 | |
| 3b85_A | 208 | Phosphate starvation-inducible protein; PHOH2, ATP | 84.18 | |
| 1np6_A | 174 | Molybdopterin-guanine dinucleotide biosynthesis pr | 84.17 | |
| 3fho_A | 508 | ATP-dependent RNA helicase DBP5; mRNA export, ATPa | 84.12 | |
| 2f7s_A | 217 | C25KG, RAS-related protein RAB-27B; G-protein, str | 84.11 | |
| 2cbz_A | 237 | Multidrug resistance-associated protein 1; ABC pro | 83.98 | |
| 3a1s_A | 258 | Iron(II) transport protein B; FEOB, iron transport | 83.97 | |
| 3tif_A | 235 | Uncharacterized ABC transporter ATP-binding prote; | 83.96 | |
| 1fuu_A | 394 | Yeast initiation factor 4A; IF4A, helicase, DEAD-b | 83.94 | |
| 1upt_A | 171 | ARL1, ADP-ribosylation factor-like protein 1; hydr | 83.85 | |
| 2fh5_B | 214 | SR-beta, signal recognition particle receptor beta | 83.77 | |
| 1q0u_A | 219 | Bstdead; DEAD protein, RNA binding protein; 1.85A | 83.75 | |
| 2wsm_A | 221 | Hydrogenase expression/formation protein (HYPB); m | 83.61 | |
| 2onk_A | 240 | Molybdate/tungstate ABC transporter, ATP-binding p | 83.6 |
| >3cf2_A TER ATPase, transitional endoplasmic reticulum ATPase, valosi; AAA, CDC48, ERAD, transport protein; HET: ADP ANP; 3.50A {Mus musculus} PDB: 3cf1_A* 3cf3_A* 1r7r_A* | Back alignment and structure |
|---|
Probab=100.00 E-value=1.5e-52 Score=516.82 Aligned_cols=427 Identities=27% Similarity=0.419 Sum_probs=332.4
Q ss_pred ccccccccccccchhHHHHHHhhhhhhcccccccc-ccCCCCCCCCceeeeCCCCchHHHHHHHHHHHhhcCCeEEEEec
Q 001244 449 IEVSFESFPYYLSDITKNVLIASTYVHLKCNNFAK-YASDLPTMCPRILLSGPAGSEIYQETLAKALAKHFSARLLIVDS 527 (1116)
Q Consensus 449 i~vsf~~FPYylse~tk~~L~~~~~~hLk~~~~~k-~~~~L~~~~~~ILLsGp~gsE~Yqe~LaKALA~~f~a~LL~lDs 527 (1116)
-+|+|++...+ ++.|..|.+.....|+|+++.+ ++ ...++.|||+|||| +++++||||+|++++++++.++.
T Consensus 199 ~~v~~~dIgGl--~~~~~~l~e~v~~pl~~p~~f~~~g---~~~p~GILL~GPPG--TGKT~LAraiA~elg~~~~~v~~ 271 (806)
T 3cf2_A 199 NEVGYDDIGGC--RKQLAQIKEMVELPLRHPALFKAIG---VKPPRGILLYGPPG--TGKTLIARAVANETGAFFFLING 271 (806)
T ss_dssp SSCCGGGCCSC--CTTHHHHHHHHHHHHHCCGGGTSCC---CCCCCEEEEECCTT--SCHHHHHHHHHTTTTCEEEEEEH
T ss_pred CCCChhhhcCH--HHHHHHHHHHHHHHccCHHHHhhcC---CCCCCeEEEECCCC--CCHHHHHHHHHHHhCCeEEEEEh
Confidence 36899999999 9999999999988999988753 33 24568999999999 89999999999999999999987
Q ss_pred ccCCCCCCccccccccchhhhhhhHHHHHHHhhhccCCCCccccccccccccccCCCCCCcccccccCcccccCCCceee
Q 001244 528 LLLPGGSSKEADSVKESSRTEKASMFAKRAALLQHRKPTSSVEADITGGTAVGSQALPKPEISTASSKNYTFKKGDRVKF 607 (1116)
Q Consensus 528 ~~l~g~~~ke~~~~~~~~~~e~~s~~~k~s~~~~~~~p~~~~~~~~~g~~~~~~~~~~~~~~~~~~~~~~~~~~gdrv~~ 607 (1116)
.++.+ +|
T Consensus 272 ~~l~s-------------------------------------------------------------------------k~ 278 (806)
T 3cf2_A 272 PEIMS-------------------------------------------------------------------------KL 278 (806)
T ss_dssp HHHHS-------------------------------------------------------------------------SC
T ss_pred HHhhc-------------------------------------------------------------------------cc
Confidence 55443 12
Q ss_pred eccCCCCcccCCCCCCCCCcccceeeeccccCCCCceeeeecCCCCCCCCCCCCcCCCCCcccccccccccCCCcchhhH
Q 001244 608 VGNVTSGTTVQPTLRGPGIGFRGRVILPFEDNDFSKIGVRFDRSIPEGNNLGGFCEDDHGFFCTASSLRLDSSLGDEVDK 687 (1116)
Q Consensus 608 vg~~~~~~~~~~~~~~p~~g~~g~v~l~~e~n~~~kvgV~Fd~~~~~~~~l~~~c~~~~~~~~~~~~~~~d~s~~~~~~~ 687 (1116)
+ ++.+
T Consensus 279 ~---------------------------------------------------------------------------gese 283 (806)
T 3cf2_A 279 A---------------------------------------------------------------------------GESE 283 (806)
T ss_dssp T---------------------------------------------------------------------------THHH
T ss_pred c---------------------------------------------------------------------------hHHH
Confidence 1 2233
Q ss_pred HHHHHHHHHHHhhcCCCCeEEEEcchhhhhcC--------ChhhHHHHHHHHhcCCC--CEEEEeeccCCCcccccCCCC
Q 001244 688 LAINELFEVALNESKSSPLIVFVKDIEKSLTG--------NNDAYGALKSKLENLPS--NVVVIGSHTQLDSRKEKSHPG 757 (1116)
Q Consensus 688 ~~i~~L~evl~~esk~~P~ILfidDie~~l~~--------~~e~~~~lk~~Le~L~g--~VviIgS~~~~d~~~~~~~~~ 757 (1116)
..+..+|+.+.. .+|+||||||||.+... ..++.+.|...|+.+.. +|+|||++|+++.
T Consensus 284 ~~lr~lF~~A~~---~~PsIIfIDEiDal~~~r~~~~~~~~~riv~~LL~~mdg~~~~~~V~VIaaTN~~d~-------- 352 (806)
T 3cf2_A 284 SNLRKAFEEAEK---NAPAIIFIDELDAIAPKREKTHGEVERRIVSQLLTLMDGLKQRAHVIVMAATNRPNS-------- 352 (806)
T ss_dssp HHHHHHHHHHTT---SCSEEEEEESGGGTCCTTTTCCCTTHHHHHHHHHTHHHHCCGGGCEEEEEECSSTTT--------
T ss_pred HHHHHHHHHHHH---cCCeEEEEehhcccccccCCCCChHHHHHHHHHHHHHhcccccCCEEEEEecCChhh--------
Confidence 467788887766 89999999999995431 13567778888888854 8999999998887
Q ss_pred CceeeccCCcchhhccccCCCcccccccccCcchHHHhhhhc--cccccccccCCchHHHHHHHHHHHhhchhhhhcccc
Q 001244 758 GLLFTKFGSNQTALLDLAFPDNFSRLHDRSKETPKALKQISR--LFPNKVTIQLPQDEALLSDWKQQLERDVETLKGQSN 835 (1116)
Q Consensus 758 ~~~~~~~~~~~~~~lD~a~p~~~~~~~~~~~~~~k~~~~i~k--lFpn~I~I~~P~DEa~LRRfe~qle~~Lpdlk~R~n 835 (1116)
||+| +.+ +|...|+|++|+.++|+..|+.
T Consensus 353 --------------LD~A---------------------LrR~GRFd~~I~i~~Pd~~~R~~IL~~-------------- 383 (806)
T 3cf2_A 353 --------------IDPA---------------------LRRFGRFDREVDIGIPDATGRLEILQI-------------- 383 (806)
T ss_dssp --------------SCTT---------------------TTSTTSSCEEEECCCCCHHHHHHHHHH--------------
T ss_pred --------------cCHH---------------------HhCCcccceEEecCCCCHHHHHHHHHH--------------
Confidence 7876 333 7888889999988888755543
Q ss_pred hhhhhhhhhcCCC-CCCCchhhhccccccchhhHHHHHHHhhhccccccccCCCCCcc-c-ccccchhhhhHHHHHhhhh
Q 001244 836 IISIRSVLSRNGL-DCVDLESLCIKDQTLTTEGVEKIVGWALSHHFMHCSEAPGKDAK-L-KISTESIMYGLNILQGIQS 912 (1116)
Q Consensus 836 Il~Iht~l~~~~l-ecvDLeeLai~dk~LsgadIEkIV~sAaS~aL~r~~~~i~~d~K-L-vIS~ESLkvglsdFq~aln 912 (1116)
|+. ...+ .++||+.|+..|.+|+++|+..||..|...++.|....+..... . ....+.+.+...+|..++.
T Consensus 384 ----~l~--~~~~~~dvdl~~lA~~T~GfsgaDL~~Lv~eA~~~A~~r~~~~i~~~~~~~~~e~~~~~~v~~~Df~~Al~ 457 (806)
T 3cf2_A 384 ----HTK--NMKLADDVDLEQVANETHGHVGADLAALCSEAALQAIRKKMDLIDLEDETIDAEVMNSLAVTMDDFRWALS 457 (806)
T ss_dssp ----TCS--SSEECTTCCHHHHHHHCCSCCHHHHHHHHHHHHHHHHHHHHHHGGGTCCCCSHHHHHHCEECTTHHHHHHS
T ss_pred ----Hhc--CCCCCcccCHHHHHHhcCCCCHHHHHHHHHHHHHHHHHhccccccccccccchhhhccceeeHHHHHHHHH
Confidence 321 1112 67899999999999999999999999999999876543311111 1 0111233344455555544
Q ss_pred hhhhhhhhhhhccChhHHHHHHhcCCCCCCCCCCCcccccCcHHHHHHHHHHHHccccChhhhhcCCCCCCCeEEEEECC
Q 001244 913 ESKSLKKSLKDVVTENEFEKKLLADVIPPSDIGVTFDDIGALENVKDTLKELVMLPLQRPELFCKGQLTKPCKGILLFGP 992 (1116)
Q Consensus 913 e~K~L~~~lk~~v~~~e~e~~ll~~iIp~~e~~vtfddIgGldevk~~L~e~V~lpl~~pelf~~~~l~~p~~gILL~GP 992 (1116)
+.++... .. .....+.++|++|+|++++++.|.+.+.+|+++++.|.+.+ .++++++|||||
T Consensus 458 ~~~ps~~----------------r~-~~~~~p~v~w~diggl~~~k~~l~e~v~~p~~~p~~f~~~g-~~~~~gvLl~GP 519 (806)
T 3cf2_A 458 QSNPSAL----------------RE-TVVEVPQVTWEDIGGLEDVKRELQELVQYPVEHPDKFLKFG-MTPSKGVLFYGP 519 (806)
T ss_dssp SSSCCCC----------------CC-CCCBCCCCCSTTCCSCHHHHHHHTTTTTTTTTCSGGGSSSC-CCCCSCCEEESS
T ss_pred hCCCccc----------------cc-ccccCCCCCHHHhCCHHHHHHHHHHHHHhhhhCHHHHHhcC-CCCCceEEEecC
Confidence 4332110 00 11223468999999999999999999999999999998877 456799999999
Q ss_pred CCCchHHHHHHHHHHhCCeeeEEeccccccccccchHHHHHHHHHHHhcCCCeEEEEccccccccCCCCC--chhHHHHH
Q 001244 993 PGTGKTMLAKAVATEAGANFINISMSSITSKWFGEGEKYVKAVFSLASKIAPSVVFVDEVDSMLGRRENP--GEHEAMRK 1070 (1116)
Q Consensus 993 PGTGKT~LArAIA~elg~pfI~Is~seL~sk~~GesEk~Ir~lF~~A~k~sPsIIfIDEID~Llg~R~~~--~~~~~lr~ 1070 (1116)
||||||++|+|||++++.+|+.++.++++++|+|+++++++++|..|++.+||||||||||.|++.|... ..+...++
T Consensus 520 PGtGKT~lAkaiA~e~~~~f~~v~~~~l~s~~vGese~~vr~lF~~Ar~~~P~IifiDEiDsl~~~R~~~~~~~~~~~~r 599 (806)
T 3cf2_A 520 PGCGKTLLAKAIANECQANFISIKGPELLTMWFGESEANVREIFDKARQAAPCVLFFDELDSIAKARGGNIGDGGGAADR 599 (806)
T ss_dssp TTSSHHHHHHHHHHTTTCEEEECCHHHHHTTTCSSCHHHHHHHHHHHHTTCSEEEECSCGGGCC--------------CH
T ss_pred CCCCchHHHHHHHHHhCCceEEeccchhhccccchHHHHHHHHHHHHHHcCCceeechhhhHHhhccCCCCCCCchHHHH
Confidence 9999999999999999999999999999999999999999999999999999999999999999888642 34456789
Q ss_pred HHHHHHHHhcCCCcCCCCCEEEEEEeCCCCCCcHHHHh--hcCCeEEC
Q 001244 1071 MKNEFMVNWDGLRTKDKERVLVLAATNRPFDLDEAVVR--RLPRRTCV 1116 (1116)
Q Consensus 1071 IlneLL~~Ldgl~~k~~~kVLVIaTTNrp~~LD~ALlR--RF~r~I~V 1116 (1116)
++++||.+|||+.. ..+|+||||||+|+.||+|++| ||+++|+|
T Consensus 600 v~~~lL~~mdg~~~--~~~V~vi~aTN~p~~lD~AllRpgRfd~~i~v 645 (806)
T 3cf2_A 600 VINQILTEMDGMST--KKNVFIIGATNRPDIIDPAILRPGRLDQLIYI 645 (806)
T ss_dssp HHHHHHHHHHSSCS--SSSEEEECC-CCSSSSCHHHHSTTTSCCEEEC
T ss_pred HHHHHHHHHhCCCC--CCCEEEEEeCCCchhCCHhHcCCCcceEEEEE
Confidence 99999999999975 4679999999999999999999 99999986
|
| >4b4t_J 26S protease regulatory subunit 8 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >4b4t_I 26S protease regulatory subunit 4 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >4b4t_H 26S protease regulatory subunit 7 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >4b4t_M 26S protease regulatory subunit 6A; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >4b4t_L 26S protease subunit RPT4; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >4b4t_K 26S protease regulatory subunit 6B homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3cf2_A TER ATPase, transitional endoplasmic reticulum ATPase, valosi; AAA, CDC48, ERAD, transport protein; HET: ADP ANP; 3.50A {Mus musculus} PDB: 3cf1_A* 3cf3_A* 1r7r_A* | Back alignment and structure |
|---|
| >1xwi_A SKD1 protein; VPS4B, AAA ATPase, protein transport; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >3eie_A Vacuolar protein sorting-associated protein 4; AAA ATPase, ATP-binding cassette, ATP-binding, endosome, MEM nucleotide-binding; 2.70A {Saccharomyces cerevisiae} PDB: 3eih_A* 2rko_A 3mhv_C | Back alignment and structure |
|---|
| >2qp9_X Vacuolar protein sorting-associated protein 4; ATPase domain, beta domain, C-terminal helix, ATP-binding, E nucleotide-binding; 2.90A {Saccharomyces cerevisiae} PDB: 2qpa_A* | Back alignment and structure |
|---|
| >4b4t_J 26S protease regulatory subunit 8 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2zan_A Vacuolar protein sorting-associating protein 4B; SKD1, VPS4B, AAA ATPase, ATP-binding, coiled coil, membrane, nucleotide-binding, phosphorylation; HET: ATP; 3.00A {Mus musculus} PDB: 2zam_A* 2zao_A* 2jqh_A 2jqk_A 1wr0_A 2jq9_A 2k3w_A 1yxr_A | Back alignment and structure |
|---|
| >4b4t_I 26S protease regulatory subunit 4 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3cf0_A Transitional endoplasmic reticulum ATPase; AAA, P97/VCP, ERAD, CDC48, ATP-binding, lipid-binding, nucle binding, nucleus, phosphoprotein, transport; HET: ADP; 3.00A {Mus musculus} | Back alignment and structure |
|---|
| >2x8a_A Nuclear valosin-containing protein-like; nuclear protein; 2.60A {Homo sapiens} | Back alignment and structure |
|---|
| >4b4t_H 26S protease regulatory subunit 7 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3d8b_A Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, structural genomics consortium, ATP- hydrolase, magnesium, metal-binding, nucleotide-binding; HET: ADP; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >4b4t_L 26S protease subunit RPT4; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3vfd_A Spastin; ATPase, microtubule severing, hydrolase; 3.30A {Homo sapiens} | Back alignment and structure |
|---|
| >3b9p_A CG5977-PA, isoform A; AAA ATPase, ATP-binding, nucleotide-binding, hydrolase; 2.70A {Drosophila melanogaster} | Back alignment and structure |
|---|
| >4b4t_K 26S protease regulatory subunit 6B homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3pxi_A Negative regulator of genetic competence CLPC/MEC; CLPB, proteolysis, CLPX, HSP100/CLP, AAA+ proteins, PR binding; 6.93A {Bacillus subtilis} | Back alignment and structure |
|---|
| >4b4t_M 26S protease regulatory subunit 6A; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1r6b_X CLPA protein; AAA+, N-terminal domain, CLPS, crystal, binding mechanism, hydrolase; HET: ADP; 2.25A {Escherichia coli} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 PDB: 1ksf_X* | Back alignment and structure |
|---|
| >3h4m_A Proteasome-activating nucleotidase; ATPase, PAN, ATP-binding, nucleotide-binding, HY; HET: ADP; 3.11A {Methanocaldococcus jannaschii} | Back alignment and structure |
|---|
| >2ce7_A Cell division protein FTSH; metalloprotease; HET: ADP; 2.44A {Thermotoga maritima} SCOP: a.269.1.1 c.37.1.20 PDB: 2cea_A* 3kds_E* | Back alignment and structure |
|---|
| >1lv7_A FTSH; alpha/beta domain, four helix bundle, hydrolase; 1.50A {Escherichia coli} SCOP: c.37.1.20 | Back alignment and structure |
|---|
| >2qz4_A Paraplegin; AAA+, SPG7, protease, ADP, structural genomics, structural G consortium, SGC, ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.22A {Homo sapiens} | Back alignment and structure |
|---|
| >3hu3_A Transitional endoplasmic reticulum ATPase; VCP, transport protein; HET: AGS; 2.20A {Homo sapiens} PDB: 3hu2_A* 3hu1_A* 1e32_A* 1s3s_A* | Back alignment and structure |
|---|
| >1qvr_A CLPB protein; coiled coil, AAA ATPase, chaperone; HET: ANP; 3.00A {Thermus thermophilus} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 | Back alignment and structure |
|---|
| >2dhr_A FTSH; AAA+ protein, hexameric Zn metalloprotease, hydrolase; HET: ADP; 3.90A {Thermus thermophilus} | Back alignment and structure |
|---|
| >3t15_A Ribulose bisphosphate carboxylase/oxygenase activ chloroplastic; photosynthesis, rubisco activase, AAA+ protein; 2.95A {Nicotiana tabacum} PDB: 3zw6_A | Back alignment and structure |
|---|
| >2r62_A Cell division protease FTSH homolog; ATPase domain, ATP-binding, cell CELL division, hydrolase, membrane, metal-binding; 3.30A {Helicobacter pylori} PDB: 2r65_A* | Back alignment and structure |
|---|
| >1ixz_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 2.20A {Thermus thermophilus} SCOP: c.37.1.20 PDB: 1iy0_A* 1iy1_A* | Back alignment and structure |
|---|
| >1iy2_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 3.20A {Thermus thermophilus} SCOP: c.37.1.20 | Back alignment and structure |
|---|
| >1gxc_A CHK2, CDS1, serine/threonine-protein kinase CHK2; phosphoprotein-binding domain, checkpoint kinase, transferase; HET: TPO; 2.7A {Homo sapiens} SCOP: b.26.1.2 | Back alignment and structure |
|---|
| >2c9o_A RUVB-like 1; hexameric helicase, AAA+-ATPase, ATP-binding, chromatin regulator, growth regulation, hydrolase, nuclear protein, DNA recombination; HET: ADP; 2.2A {Homo sapiens} PDB: 2xsz_A* | Back alignment and structure |
|---|
| >1lgp_A Cell cycle checkpoint protein CHFR; FHA, tungstate, domain swapping; 2.00A {Homo sapiens} SCOP: b.26.1.2 PDB: 1lgq_A | Back alignment and structure |
|---|
| >1xwi_A SKD1 protein; VPS4B, AAA ATPase, protein transport; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >2qp9_X Vacuolar protein sorting-associated protein 4; ATPase domain, beta domain, C-terminal helix, ATP-binding, E nucleotide-binding; 2.90A {Saccharomyces cerevisiae} PDB: 2qpa_A* | Back alignment and structure |
|---|
| >3eie_A Vacuolar protein sorting-associated protein 4; AAA ATPase, ATP-binding cassette, ATP-binding, endosome, MEM nucleotide-binding; 2.70A {Saccharomyces cerevisiae} PDB: 3eih_A* 2rko_A 3mhv_C | Back alignment and structure |
|---|
| >2zan_A Vacuolar protein sorting-associating protein 4B; SKD1, VPS4B, AAA ATPase, ATP-binding, coiled coil, membrane, nucleotide-binding, phosphorylation; HET: ATP; 3.00A {Mus musculus} PDB: 2zam_A* 2zao_A* 2jqh_A 2jqk_A 1wr0_A 2jq9_A 2k3w_A 1yxr_A | Back alignment and structure |
|---|
| >3syl_A Protein CBBX; photosynthesis, rubisco activase, AAA+ protein, calvin cycle chaperone; 3.00A {Rhodobacter sphaeroides} PDB: 3syk_A 3zuh_A* | Back alignment and structure |
|---|
| >1g41_A Heat shock protein HSLU; AAA-ATPase, CLPY, ATP-dependent proteolysis, chaperone; HET: ADP; 2.30A {Haemophilus influenzae} SCOP: c.37.1.20 PDB: 1g3i_A* 1im2_A* 1kyi_A* 1g4a_E* 1g4b_E 1yyf_A* 1do0_A* 1do2_A* 1e94_E* 1hqy_E* 1ht1_E* 1ht2_E* | Back alignment and structure |
|---|
| >1d2n_A N-ethylmaleimide-sensitive fusion protein; hexamerization domain, ATPase, transport; HET: ANP; 1.75A {Cricetulus griseus} SCOP: c.37.1.20 PDB: 1nsf_A* | Back alignment and structure |
|---|
| >1ofh_A ATP-dependent HSL protease ATP-binding subunit HSLU; chaperone, hydrolase, ATP-binding; HET: ADP; 2.5A {Haemophilus influenzae} SCOP: c.37.1.20 PDB: 1ofi_A* | Back alignment and structure |
|---|
| >3hu3_A Transitional endoplasmic reticulum ATPase; VCP, transport protein; HET: AGS; 2.20A {Homo sapiens} PDB: 3hu2_A* 3hu1_A* 1e32_A* 1s3s_A* | Back alignment and structure |
|---|
| >2p65_A Hypothetical protein PF08_0063; CLPB, malaria, structural genomics, structural genomics consortium, SGC, unknown function; 1.70A {Plasmodium falciparum} | Back alignment and structure |
|---|
| >2x8a_A Nuclear valosin-containing protein-like; nuclear protein; 2.60A {Homo sapiens} | Back alignment and structure |
|---|
| >3cf0_A Transitional endoplasmic reticulum ATPase; AAA, P97/VCP, ERAD, CDC48, ATP-binding, lipid-binding, nucle binding, nucleus, phosphoprotein, transport; HET: ADP; 3.00A {Mus musculus} | Back alignment and structure |
|---|
| >3hws_A ATP-dependent CLP protease ATP-binding subunit CL; CLPXP, AAA+ molecular machine, hexamer, asymmetric,, ATP-BIN chaperone, metal-binding; HET: ADP; 3.25A {Escherichia coli} PDB: 3hte_A | Back alignment and structure |
|---|
| >1jbk_A CLPB protein; beta barrel, chaperone; 1.80A {Escherichia coli} SCOP: c.37.1.20 | Back alignment and structure |
|---|
| >2jqj_A DNA damage response protein kinase DUN1; protein/phosphopeptide, cell cycle; HET: DNA; NMR {Saccharomyces cerevisiae} PDB: 2jql_A* | Back alignment and structure |
|---|
| >1g6g_A Protein kinase RAD53; beta-sandwich, phosphopeptide complex, cell cycle; HET: TPO; 1.60A {Saccharomyces cerevisiae} SCOP: b.26.1.2 | Back alignment and structure |
|---|
| >3h4m_A Proteasome-activating nucleotidase; ATPase, PAN, ATP-binding, nucleotide-binding, HY; HET: ADP; 3.11A {Methanocaldococcus jannaschii} | Back alignment and structure |
|---|
| >2ce7_A Cell division protein FTSH; metalloprotease; HET: ADP; 2.44A {Thermotoga maritima} SCOP: a.269.1.1 c.37.1.20 PDB: 2cea_A* 3kds_E* | Back alignment and structure |
|---|
| >3b9p_A CG5977-PA, isoform A; AAA ATPase, ATP-binding, nucleotide-binding, hydrolase; 2.70A {Drosophila melanogaster} | Back alignment and structure |
|---|
| >3i6u_A CDS1, serine/threonine-protein kinase CHK2; Ser/Thr protein kinase, FHA domain, ATP-binding, cell cycle, mutation, LI-fraumeni syndrome, magnesium; 3.00A {Homo sapiens} PDB: 3i6w_A | Back alignment and structure |
|---|
| >3pfi_A Holliday junction ATP-dependent DNA helicase RUVB; probable holliday junction DNA helicase; HET: ADP; 2.69A {Campylobacter jejuni subsp} | Back alignment and structure |
|---|
| >3m6a_A ATP-dependent protease LA 1; alpha, beta, ATP-binding, hydrolase, nucleotide-binding, Pro serine protease, stress response; HET: ADP; 3.40A {Bacillus subtilis} PDB: 1x37_A | Back alignment and structure |
|---|
| >3d8b_A Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, structural genomics consortium, ATP- hydrolase, magnesium, metal-binding, nucleotide-binding; HET: ADP; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >1lv7_A FTSH; alpha/beta domain, four helix bundle, hydrolase; 1.50A {Escherichia coli} SCOP: c.37.1.20 | Back alignment and structure |
|---|
| >3vfd_A Spastin; ATPase, microtubule severing, hydrolase; 3.30A {Homo sapiens} | Back alignment and structure |
|---|
| >2qz4_A Paraplegin; AAA+, SPG7, protease, ADP, structural genomics, structural G consortium, SGC, ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.22A {Homo sapiens} | Back alignment and structure |
|---|
| >1um8_A ATP-dependent CLP protease ATP-binding subunit CL; CLPP binding loop, chaperone; HET: ADP; 2.60A {Helicobacter pylori} SCOP: c.37.1.20 | Back alignment and structure |
|---|
| >3uk6_A RUVB-like 2; hexameric AAA+ ATP-ASE, DNA unwinding, hydrolase; HET: ADP; 2.95A {Homo sapiens} PDB: 2xsz_D* | Back alignment and structure |
|---|
| >4h87_A Kanadaptin; FHA domain of PF00498, mRNA processing, nucleus, structural joint center for structural genomics, JCSG, protein structu initiative; HET: SO4; 1.55A {Homo sapiens} | Back alignment and structure |
|---|
| >2r62_A Cell division protease FTSH homolog; ATPase domain, ATP-binding, cell CELL division, hydrolase, membrane, metal-binding; 3.30A {Helicobacter pylori} PDB: 2r65_A* | Back alignment and structure |
|---|
| >1hqc_A RUVB; extended AAA-ATPase domain, complex with nucleotide, hydrolase; HET: ADE; 3.20A {Thermus thermophilus} SCOP: a.4.5.11 c.37.1.20 PDB: 1ixs_B* 1ixr_C* | Back alignment and structure |
|---|
| >2dhr_A FTSH; AAA+ protein, hexameric Zn metalloprotease, hydrolase; HET: ADP; 3.90A {Thermus thermophilus} | Back alignment and structure |
|---|
| >3u61_B DNA polymerase accessory protein 44; AAA+, ATP hydrolase, clamp loader, sliding clamp, primer-TEM DNA, DNA binding protein-DNA complex; HET: DNA ADP 08T; 3.20A {Enterobacteria phage T4} PDB: 3u5z_B* 3u60_B* | Back alignment and structure |
|---|
| >1r6b_X CLPA protein; AAA+, N-terminal domain, CLPS, crystal, binding mechanism, hydrolase; HET: ADP; 2.25A {Escherichia coli} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 PDB: 1ksf_X* | Back alignment and structure |
|---|
| >2pie_A E3 ubiquitin-protein ligase RNF8; FHA domain, complex, ligase, signaling protein; HET: TPO; 1.35A {Homo sapiens} SCOP: b.26.1.2 | Back alignment and structure |
|---|
| >1qvr_A CLPB protein; coiled coil, AAA ATPase, chaperone; HET: ANP; 3.00A {Thermus thermophilus} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 | Back alignment and structure |
|---|
| >4fcw_A Chaperone protein CLPB; AAA domain; HET: ADP; 2.35A {Thermus thermophilus} PDB: 4fcv_A* 4fd2_A* 4fct_A* | Back alignment and structure |
|---|
| >1g3g_A Protien kinase SPK1; FHA domain, RAD53, phosphopeptide, phosphoprotein, transferase; NMR {Saccharomyces cerevisiae} SCOP: b.26.1.2 PDB: 1j4o_A 1j4p_A* 1j4q_A* 1k3j_A 1k3n_A* 1k3q_A* 2a0t_A* 2jqi_A* | Back alignment and structure |
|---|
| >2chg_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATPase, ATP-binding, nucleotide-binding; HET: ANP; 2.1A {Archaeoglobus fulgidus} | Back alignment and structure |
|---|
| >3n70_A Transport activator; sigma-54, ntpase, PSI, MCSG, structural genomics, center for structural genomics; 2.80A {Escherichia coli} | Back alignment and structure |
|---|
| >3pxg_A Negative regulator of genetic competence CLPC/MEC; CLPB, proteolysis, CLPX, HSP100/CLP, AAA+ proteins, PR binding; 3.65A {Bacillus subtilis} | Back alignment and structure |
|---|
| >1l8q_A Chromosomal replication initiator protein DNAA; AAA+, helix-turn-helix, nucleotide-binding, DNA binding, REP initiation, DNA binding protein; HET: ADP; 2.70A {Aquifex aeolicus} SCOP: a.4.12.2 c.37.1.20 PDB: 3r8f_A* 2hcb_A* | Back alignment and structure |
|---|
| >1g8p_A Magnesium-chelatase 38 kDa subunit; parallel beta sheet, P-loop, rossman fold, AAA+, photosynthesis, metal transport; 2.10A {Rhodobacter capsulatus} SCOP: c.37.1.20 PDB: 2x31_G | Back alignment and structure |
|---|
| >3pvs_A Replication-associated recombination protein A; maintenance of genome stability Pro recombination; 2.50A {Escherichia coli} | Back alignment and structure |
|---|
| >3va4_A Mediator of DNA damage checkpoint protein 1; cell cycle, FHA domain, DNA-damage, CHK2 and MDC1 dimerizati; HET: TPO; 1.54A {Mus musculus} PDB: 3va1_A* 3umz_A 3unm_A 3unn_A* 3uot_A* 3un0_B | Back alignment and structure |
|---|
| >3cmw_A Protein RECA, recombinase A; homologous recombination, recombination/DNA complex; HET: DNA ADP; 2.80A {Escherichia coli} PDB: 3cmt_A* 3cmx_A* 3cmv_A* | Back alignment and structure |
|---|
| >3co5_A Putative two-component system transcriptional RES regulator; structural genomics, APC89341.1; 2.40A {Neisseria gonorrhoeae} | Back alignment and structure |
|---|
| >3pxi_A Negative regulator of genetic competence CLPC/MEC; CLPB, proteolysis, CLPX, HSP100/CLP, AAA+ proteins, PR binding; 6.93A {Bacillus subtilis} | Back alignment and structure |
|---|
| >2v1u_A Cell division control protein 6 homolog; DNA replication, nucleotide-binding, replication, archaea; HET: ADP; 3.10A {Aeropyrum pernix} | Back alignment and structure |
|---|
| >2qby_B CDC6 homolog 3, cell division control protein 6 homolog 3; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} | Back alignment and structure |
|---|
| >1qu5_A Protein kinase SPK1; FHA, RAD53, transferase; NMR {Saccharomyces cerevisiae} SCOP: b.26.1.2 | Back alignment and structure |
|---|
| >3te6_A Regulatory protein SIR3; heterochromatin, gene silencing, SIR complex, HMR, HML, TELO AAA+ domain, structural, nucleus, gene RE; 2.80A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1sxj_A Activator 1 95 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 | Back alignment and structure |
|---|
| >1uht_A Expressed protein; FHA domain, beta-sandwich, antiparallel beta-sheets, phosphopeptide binding motif, structural genomics; NMR {Arabidopsis thaliana} SCOP: b.26.1.2 | Back alignment and structure |
|---|
| >2bjv_A PSP operon transcriptional activator; AAA, transcription activation, gene regulation, sigma54 activator, enhancer binding protein, PSPF; 1.7A {Escherichia coli} PDB: 2bjw_A 2c96_A* 2c98_A* 2c99_A* 2c9c_A* 2vii_A* | Back alignment and structure |
|---|
| >2r44_A Uncharacterized protein; putative ATPase, structural genomics, joint center for struc genomics, JCSG; HET: MSE PG4; 2.00A {Cytophaga hutchinsonii atcc 33406} | Back alignment and structure |
|---|
| >1ixz_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 2.20A {Thermus thermophilus} SCOP: c.37.1.20 PDB: 1iy0_A* 1iy1_A* | Back alignment and structure |
|---|
| >1njg_A DNA polymerase III subunit gamma; rossman-like fold, AAA+ ATPase domains, sensor 1, sensor 2, transferase; HET: DNA; 2.20A {Escherichia coli} SCOP: c.37.1.20 PDB: 1njf_A* | Back alignment and structure |
|---|
| >1dmz_A Protein (protein kinase SPK1); beta-sandwich, antiparallel beta-sheets, transferase; NMR {Saccharomyces cerevisiae} SCOP: b.26.1.2 PDB: 1fhq_A 1fhr_A* 1j4k_A* 1j4l_A* 1k2m_A* 1k2n_A* | Back alignment and structure |
|---|
| >3po8_A RV0020C protein, putative uncharacterized protein TB39.8; FHA domain, synthetic peptide, peptide binding protein; 1.50A {Mycobacterium tuberculosis} SCOP: b.26.1.0 PDB: 3poa_A* 2lc1_A | Back alignment and structure |
|---|
| >3hx1_A SLR1951 protein; P74513_SYNY3, adenylate cyclase-like protein, NESG, structural genomics, PSI-2, protein structure initiative; 2.50A {Synechocystis SP} | Back alignment and structure |
|---|
| >2z4s_A Chromosomal replication initiator protein DNAA; AAA+ ATPase, domain III (ATPase domain), ATP-binding, cytoplasm, DNA replication; HET: ADP; 3.00A {Thermotoga maritima} PDB: 2z4r_A* | Back alignment and structure |
|---|
| >2chq_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATP ATP-binding, nucleotide-binding; HET: ANP; 3.5A {Archaeoglobus fulgidus} PDB: 2chv_A | Back alignment and structure |
|---|
| >1r21_A Antigen KI-67; beta sandwich, cell cycle; NMR {Homo sapiens} SCOP: b.26.1.2 PDB: 2aff_A* | Back alignment and structure |
|---|
| >1sxj_D Activator 1 41 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 | Back alignment and structure |
|---|
| >3els_A PRE-mRNA leakage protein 1; intrinsically unstructured domain, forkhead-associated domai domain, PRE-mRNA retention and splicing; 1.80A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1ojl_A Transcriptional regulatory protein ZRAR; response regulator, two component system, AAA domain, NTRC family, DNA-binding; HET: ATP; 3.0A {Salmonella typhimurium} | Back alignment and structure |
|---|
| >2qby_A CDC6 homolog 1, cell division control protein 6 homolog 1; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} | Back alignment and structure |
|---|
| >2xt9_B Putative signal transduction protein GARA; lyase-signaling protein complex, KDH, KGD; HET: TPP; 2.20A {Mycobacterium smegmatis} | Back alignment and structure |
|---|
| >3t15_A Ribulose bisphosphate carboxylase/oxygenase activ chloroplastic; photosynthesis, rubisco activase, AAA+ protein; 2.95A {Nicotiana tabacum} PDB: 3zw6_A | Back alignment and structure |
|---|
| >1iqp_A RFCS; clamp loader, extended AAA-ATPase domain, complex with ADP, replication; HET: ADP; 2.80A {Pyrococcus furiosus} SCOP: a.80.1.1 c.37.1.20 | Back alignment and structure |
|---|
| >1sxj_B Activator 1 37 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 | Back alignment and structure |
|---|
| >2csw_A Ubiquitin ligase protein RNF8; 11-stranded beta sandwich, ring finger protein 8, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.26.1.2 | Back alignment and structure |
|---|
| >1iy2_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 3.20A {Thermus thermophilus} SCOP: c.37.1.20 | Back alignment and structure |
|---|
| >2kb3_A Oxoglutarate dehydrogenase inhibitor; forkhead-associated domain, kinase substrate, GARA, FHA, cytoplasm, phosphoprotein; HET: TPO; NMR {Corynebacterium glutamicum} PDB: 2kb4_A | Back alignment and structure |
|---|
| >3nbx_X ATPase RAVA; AAA+ ATPase, alpha-beta-alpha structure, rossman fold, hydro; HET: ADP; 2.91A {Escherichia coli} | Back alignment and structure |
|---|
| >2c9o_A RUVB-like 1; hexameric helicase, AAA+-ATPase, ATP-binding, chromatin regulator, growth regulation, hydrolase, nuclear protein, DNA recombination; HET: ADP; 2.2A {Homo sapiens} PDB: 2xsz_A* | Back alignment and structure |
|---|
| >2jpe_A Nuclear inhibitor of protein phosphatase 1; FHA domain, NIPP1, mRNA splicing, transcription; NMR {Mus musculus} | Back alignment and structure |
|---|
| >3bos_A Putative DNA replication factor; P-loop containing nucleoside triphosphate hydrolases, struct genomics; HET: MSE CDP; 1.75A {Shewanella amazonensis} PDB: 3sc3_A | Back alignment and structure |
|---|
| >1fnn_A CDC6P, cell division control protein 6; ORC1, AAA protein, DNA replication initation factor, cell cycle control factor; HET: ADP; 2.00A {Pyrobaculum aerophilum} SCOP: a.4.5.11 c.37.1.20 | Back alignment and structure |
|---|
| >1g41_A Heat shock protein HSLU; AAA-ATPase, CLPY, ATP-dependent proteolysis, chaperone; HET: ADP; 2.30A {Haemophilus influenzae} SCOP: c.37.1.20 PDB: 1g3i_A* 1im2_A* 1kyi_A* 1g4a_E* 1g4b_E 1yyf_A* 1do0_A* 1do2_A* 1e94_E* 1hqy_E* 1ht1_E* 1ht2_E* | Back alignment and structure |
|---|
| >1jr3_A DNA polymerase III subunit gamma; processivity, processivity clamp, clamp loader, AAA+ ATPase, transferase; HET: DNA; 2.70A {Escherichia coli} SCOP: a.80.1.1 c.37.1.20 PDB: 1xxh_B* 3glh_B* 3glf_B* 3gli_B* 3glg_B* 1xxi_B* | Back alignment and structure |
|---|
| >2kfu_A RV1827 PThr 22; FHA domain, phosphorylation, intramolecular interaction, glutamate metabolism, phosphoprotein, protein binding; HET: TPO; NMR {Mycobacterium tuberculosis} PDB: 2kkl_A | Back alignment and structure |
|---|
| >3f9v_A Minichromosome maintenance protein MCM; replicative helicase, DNA replication, MCM complex, AAA+ Pro ATP-binding, DNA-binding, helicase; 4.35A {Sulfolobus solfataricus} | Back alignment and structure |
|---|
| >3elv_A PRE-mRNA leakage protein 1; intrinsically unstructured domain, forkhead-associated domai domain, PRE-mRNA retention and splicing; 2.40A {Saccharomyces cerevisiae} PDB: 2jkd_A | Back alignment and structure |
|---|
| >3gqs_A Adenylate cyclase-like protein; FHA domain, structural genomics, PSI-2, protein structure in midwest center for structural genomics, MCSG; 2.20A {Chlamydia trachomatis} | Back alignment and structure |
|---|
| >4ejq_A Kinesin-like protein KIF1A; homodimer, FHA domain, transport protein; 1.89A {Homo sapiens} PDB: 2eh0_A 2g1l_A | Back alignment and structure |
|---|
| >3oun_A Putative uncharacterized protein TB39.8; peptidoglycan, Ser/Thr kinase, pseudokinase, FHA domain, REG phosphorylation; HET: TPO; 2.71A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >1sxj_E Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 | Back alignment and structure |
|---|
| >1wln_A Afadin; beta sandwich, FHA domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: b.26.1.2 | Back alignment and structure |
|---|
| >1sxj_C Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 | Back alignment and structure |
|---|
| >3ec2_A DNA replication protein DNAC; helicase loader, replication initiation factor, ATP-binding, nucleotide-binding; HET: DNA ADP; 2.70A {Aquifex aeolicus} PDB: 3ecc_A* | Back alignment and structure |
|---|
| >2ff4_A Probable regulatory protein EMBR; winged-helix, tetratricopeptide repeat, beta-sandwich, trans; HET: DNA TPO; 1.90A {Mycobacterium tuberculosis} SCOP: a.4.6.1 a.118.8.3 b.26.1.2 PDB: 2fez_A* | Back alignment and structure |
|---|
| >1in4_A RUVB, holliday junction DNA helicase RUVB; AAA+-class ATPase, winged-helix domain, ATP hydrolysis, walker A, walker B, sensor 1, sensor 2; HET: ADP; 1.60A {Thermotoga maritima} SCOP: a.4.5.11 c.37.1.20 PDB: 1in5_A* 1in6_A* 1in8_A* 1in7_A* 1j7k_A* | Back alignment and structure |
|---|
| >3fm8_A Kinesin-like protein KIF13B; kinesin, GAP, GTPase activation, structural genomics consort ATP-binding, cytoskeleton, microtubule, motor protein, NUCL binding; 2.30A {Homo sapiens} PDB: 3mdb_A* | Back alignment and structure |
|---|
| >1a5t_A Delta prime, HOLB; zinc finger, DNA replication; 2.20A {Escherichia coli K12} SCOP: a.80.1.1 c.37.1.20 PDB: 1jr3_E* 1xxh_E* 1xxi_E* 3glf_E* 3glg_E* 3glh_E* 3gli_E* | Back alignment and structure |
|---|
| >3cmw_A Protein RECA, recombinase A; homologous recombination, recombination/DNA complex; HET: DNA ADP; 2.80A {Escherichia coli} PDB: 3cmt_A* 3cmx_A* 3cmv_A* | Back alignment and structure |
|---|
| >2gno_A DNA polymerase III, gamma subunit-related protein; structural genomics, joint center for structural genomics, J protein structure initiative; HET: DNA; 2.00A {Thermotoga maritima} SCOP: a.80.1.1 c.37.1.20 | Back alignment and structure |
|---|
| >2w58_A DNAI, primosome component (helicase loader); ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.50A {Geobacillus kaustophilus HTA426} | Back alignment and structure |
|---|
| >3uv0_A Mutator 2, isoform B; FHA, protein binding, dimerization; 1.90A {Drosophila melanogaster} | Back alignment and structure |
|---|
| >1ny5_A Transcriptional regulator (NTRC family); AAA+ ATPase, sigma54 activator, bacterial transcription, DIM transcription; HET: ADP; 2.40A {Aquifex aeolicus} SCOP: c.23.1.1 c.37.1.20 PDB: 1ny6_A* 3m0e_A* 1zy2_A* | Back alignment and structure |
|---|
| >2kjq_A DNAA-related protein; solution structure, NESG, structural genomics, PSI-2, protei structure initiative; NMR {Neisseria meningitidis serogroup B} | Back alignment and structure |
|---|
| >3k1j_A LON protease, ATP-dependent protease LON; ATP-binding, nucleotide-binding, Pro hydrolase; HET: ADP PE8; 2.00A {Thermococcus onnurineus} | Back alignment and structure |
|---|
| >2brf_A Bifunctional polynucleotide phosphatase/kinase; hydrolase/transferase, FHA, forkhead-associated, PNKP, PNK, polynucleotide kinase 3' phosphatase; 1.40A {Homo sapiens} SCOP: b.26.1.2 PDB: 2w3o_A* 1yjm_A* | Back alignment and structure |
|---|
| >3kt9_A Aprataxin; FHA domain, beta sandwich, beta sheet, AMP hydrolase, alternative splicing, disease mutation, DNA damage, DNA repair, DNA-binding; 1.65A {Homo sapiens} SCOP: b.26.1.0 | Back alignment and structure |
|---|
| >1yj5_C 5' polynucleotide kinase-3' phosphatase FHA domai; beta sandwich, P-loop, transferase; 2.80A {Mus musculus} SCOP: b.26.1.2 | Back alignment and structure |
|---|
| >4akg_A Glutathione S-transferase class-MU 26 kDa isozyme heavy chain cytoplasmic; motor protein, AAA+ protein, ASCE protein, P-loop ntpase; HET: ATP ADP; 3.30A {Schistosoma japonicum} PDB: 4ai6_A* 4akh_A* 4aki_A* 3qmz_A | Back alignment and structure |
|---|
| >2vhj_A Ntpase P4, P4; non- hydrolysable ATP analogue, hydrolase, virus dsRNA, molecular motor, packaging ATPase, hexameric helicase; HET: ADP; 1.80A {Pseudomonas phage PHI12} PDB: 2vhq_A* 1w44_A* 1w46_A* 1w47_A* 1w48_A* 1w49_A* 1w4a_A* 1w4b_A* 1w4c_A 2vht_A* 2vhu_A* 2vhc_A* | Back alignment and structure |
|---|
| >3dzd_A Transcriptional regulator (NTRC family); sigma43 activator, AAA+ ATPase, response regulator, transcriptional activator, ATP-binding; HET: ADP; 2.40A {Aquifex aeolicus} PDB: 1zit_A 2jrl_A | Back alignment and structure |
|---|
| >1w5s_A Origin recognition complex subunit 2 ORC2; replication, CDC6, DNA replication initiation, DNA BIND protein, AAA+ ATPase; HET: ADP; 2.4A {Aeropyrum pernix} SCOP: a.4.5.11 c.37.1.20 PDB: 1w5t_A* | Back alignment and structure |
|---|
| >2qgz_A Helicase loader, putative primosome component; structural genomics, PSI-2, protein structure initiative; 2.40A {Streptococcus pyogenes serotype M3} | Back alignment and structure |
|---|
| >3syl_A Protein CBBX; photosynthesis, rubisco activase, AAA+ protein, calvin cycle chaperone; 3.00A {Rhodobacter sphaeroides} PDB: 3syk_A 3zuh_A* | Back alignment and structure |
|---|
| >1ujx_A Polynucleotide kinase 3'-phosphatase; DNA repair, FHA domain, beta-sandwich, antiparallel beta-sheets, phosphopeptide binding motif; NMR {Mus musculus} SCOP: b.26.1.2 | Back alignment and structure |
|---|
| >2r2a_A Uncharacterized protein; zonular occludens toxin, structural genomics, APC84050.2, PS protein structure initiative; HET: MSE; 1.82A {Neisseria meningitidis MC58} | Back alignment and structure |
|---|
| >3f8t_A Predicted ATPase involved in replication control, CDC46/MCM family; helicase, MCM homolog, DNA replication, ATP-binding, DNA-binding; 1.90A {Methanopyrus kandleri AV19} | Back alignment and structure |
|---|
| >4egx_A Kinesin-like protein KIF1A; FHA domain, transport protein; 2.51A {Homo sapiens} | Back alignment and structure |
|---|
| >1d2n_A N-ethylmaleimide-sensitive fusion protein; hexamerization domain, ATPase, transport; HET: ANP; 1.75A {Cricetulus griseus} SCOP: c.37.1.20 PDB: 1nsf_A* | Back alignment and structure |
|---|
| >3uk6_A RUVB-like 2; hexameric AAA+ ATP-ASE, DNA unwinding, hydrolase; HET: ADP; 2.95A {Homo sapiens} PDB: 2xsz_D* | Back alignment and structure |
|---|
| >3hws_A ATP-dependent CLP protease ATP-binding subunit CL; CLPXP, AAA+ molecular machine, hexamer, asymmetric,, ATP-BIN chaperone, metal-binding; HET: ADP; 3.25A {Escherichia coli} PDB: 3hte_A | Back alignment and structure |
|---|
| >1ofh_A ATP-dependent HSL protease ATP-binding subunit HSLU; chaperone, hydrolase, ATP-binding; HET: ADP; 2.5A {Haemophilus influenzae} SCOP: c.37.1.20 PDB: 1ofi_A* | Back alignment and structure |
|---|
| >3m6a_A ATP-dependent protease LA 1; alpha, beta, ATP-binding, hydrolase, nucleotide-binding, Pro serine protease, stress response; HET: ADP; 3.40A {Bacillus subtilis} PDB: 1x37_A | Back alignment and structure |
|---|
| >1jbk_A CLPB protein; beta barrel, chaperone; 1.80A {Escherichia coli} SCOP: c.37.1.20 | Back alignment and structure |
|---|
| >1um8_A ATP-dependent CLP protease ATP-binding subunit CL; CLPP binding loop, chaperone; HET: ADP; 2.60A {Helicobacter pylori} SCOP: c.37.1.20 | Back alignment and structure |
|---|
| >3cmu_A Protein RECA, recombinase A; homologous recombination, recombination/DNA complex; HET: DNA ADP; 4.20A {Escherichia coli} | Back alignment and structure |
|---|
| >4akg_A Glutathione S-transferase class-MU 26 kDa isozyme heavy chain cytoplasmic; motor protein, AAA+ protein, ASCE protein, P-loop ntpase; HET: ATP ADP; 3.30A {Schistosoma japonicum} PDB: 4ai6_A* 4akh_A* 4aki_A* 3qmz_A | Back alignment and structure |
|---|
| >3huf_A DNA repair and telomere maintenance protein NBS1; NBS1, FHA domain, BRCT domain, phosphoprotein binding, phosp binding, DNA repair; HET: DNA TPO; 2.15A {Schizosaccharomyces pombe} PDB: 3hue_A* 3i0m_A* 3i0n_A* | Back alignment and structure |
|---|
| >1tue_A Replication protein E1; helicase, replication, E1E2 complex, AAA+ protein; 2.10A {Human papillomavirus type 18} SCOP: c.37.1.20 | Back alignment and structure |
|---|
| >3pxg_A Negative regulator of genetic competence CLPC/MEC; CLPB, proteolysis, CLPX, HSP100/CLP, AAA+ proteins, PR binding; 3.65A {Bacillus subtilis} | Back alignment and structure |
|---|
| >2r44_A Uncharacterized protein; putative ATPase, structural genomics, joint center for struc genomics, JCSG; HET: MSE PG4; 2.00A {Cytophaga hutchinsonii atcc 33406} | Back alignment and structure |
|---|
| >1sxj_A Activator 1 95 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 | Back alignment and structure |
|---|
| >2v1u_A Cell division control protein 6 homolog; DNA replication, nucleotide-binding, replication, archaea; HET: ADP; 3.10A {Aeropyrum pernix} | Back alignment and structure |
|---|
| >3pfi_A Holliday junction ATP-dependent DNA helicase RUVB; probable holliday junction DNA helicase; HET: ADP; 2.69A {Campylobacter jejuni subsp} | Back alignment and structure |
|---|
| >3u61_B DNA polymerase accessory protein 44; AAA+, ATP hydrolase, clamp loader, sliding clamp, primer-TEM DNA, DNA binding protein-DNA complex; HET: DNA ADP 08T; 3.20A {Enterobacteria phage T4} PDB: 3u5z_B* 3u60_B* | Back alignment and structure |
|---|
| >2p65_A Hypothetical protein PF08_0063; CLPB, malaria, structural genomics, structural genomics consortium, SGC, unknown function; 1.70A {Plasmodium falciparum} | Back alignment and structure |
|---|
| >2fna_A Conserved hypothetical protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE ADP; 2.00A {Sulfolobus solfataricus} SCOP: a.4.5.11 c.37.1.20 | Back alignment and structure |
|---|
| >2qen_A Walker-type ATPase; unknown function; HET: ADP; 2.25A {Pyrococcus abyssi} | Back alignment and structure |
|---|
| >4a0e_A YSCD, type III secretion protein; transport protein, SAD phasing, type III secretion system; 2.04A {Yersinia pestis} PDB: 4d9v_A | Back alignment and structure |
|---|
| >1hqc_A RUVB; extended AAA-ATPase domain, complex with nucleotide, hydrolase; HET: ADE; 3.20A {Thermus thermophilus} SCOP: a.4.5.11 c.37.1.20 PDB: 1ixs_B* 1ixr_C* | Back alignment and structure |
|---|
| >2chg_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATPase, ATP-binding, nucleotide-binding; HET: ANP; 2.1A {Archaeoglobus fulgidus} | Back alignment and structure |
|---|
| >1wv3_A Similar to DNA segregation ATPase and related proteins; structural genomics, unknown function; 1.75A {Staphylococcus aureus subsp} SCOP: b.26.1.4 b.26.1.4 | Back alignment and structure |
|---|
| >1ye8_A Protein THEP1, hypothetical UPF0334 kinase-like protein AQ_1292; mixed alpha-beta protein, rossman fold, signaling protein, transferase; 1.40A {Aquifex aeolicus} SCOP: c.37.1.11 | Back alignment and structure |
|---|
| >1u0j_A DNA replication protein; AAA+ protein, P-loop atpases, helicase; HET: DNA ADP; 2.10A {Adeno-associated virus - 2} SCOP: c.37.1.20 PDB: 1s9h_A | Back alignment and structure |
|---|
| >4fcw_A Chaperone protein CLPB; AAA domain; HET: ADP; 2.35A {Thermus thermophilus} PDB: 4fcv_A* 4fd2_A* 4fct_A* | Back alignment and structure |
|---|
| >3vkg_A Dynein heavy chain, cytoplasmic; AAA+ protein, molecular motor, microtubles, motor protein; HET: ADP SPM; 2.81A {Dictyostelium discoideum} PDB: 3vkh_A* | Back alignment and structure |
|---|
| >1g8p_A Magnesium-chelatase 38 kDa subunit; parallel beta sheet, P-loop, rossman fold, AAA+, photosynthesis, metal transport; 2.10A {Rhodobacter capsulatus} SCOP: c.37.1.20 PDB: 2x31_G | Back alignment and structure |
|---|
| >1svm_A Large T antigen; AAA+ fold, viral protein; HET: ATP; 1.94A {Simian virus 40} SCOP: c.37.1.20 PDB: 1svl_A* 1svo_A 1n25_A 2h1l_A | Back alignment and structure |
|---|
| >2z4s_A Chromosomal replication initiator protein DNAA; AAA+ ATPase, domain III (ATPase domain), ATP-binding, cytoplasm, DNA replication; HET: ADP; 3.00A {Thermotoga maritima} PDB: 2z4r_A* | Back alignment and structure |
|---|
| >2qby_A CDC6 homolog 1, cell division control protein 6 homolog 1; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} | Back alignment and structure |
|---|
| >2cvh_A DNA repair and recombination protein RADB; filament formation, homologous recombination, ATPase domain, hyperthermophIle; HET: DNA; 2.20A {Thermococcus kodakarensis} PDB: 2cvf_A* | Back alignment and structure |
|---|
| >3kw6_A 26S protease regulatory subunit 8; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >1xp8_A RECA protein, recombinase A; recombination, radioresistance, DNA-repair, ATPase, DNA-BIND protein, DNA binding protein; HET: AGS; 2.50A {Deinococcus radiodurans} SCOP: c.37.1.11 d.48.1.1 | Back alignment and structure |
|---|
| >2w0m_A SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus solfataricus P2} | Back alignment and structure |
|---|
| >3nbx_X ATPase RAVA; AAA+ ATPase, alpha-beta-alpha structure, rossman fold, hydro; HET: ADP; 2.91A {Escherichia coli} | Back alignment and structure |
|---|
| >3te6_A Regulatory protein SIR3; heterochromatin, gene silencing, SIR complex, HMR, HML, TELO AAA+ domain, structural, nucleus, gene RE; 2.80A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1njg_A DNA polymerase III subunit gamma; rossman-like fold, AAA+ ATPase domains, sensor 1, sensor 2, transferase; HET: DNA; 2.20A {Escherichia coli} SCOP: c.37.1.20 PDB: 1njf_A* | Back alignment and structure |
|---|
| >3hr8_A Protein RECA; alpha and beta proteins (A/B, A+B), ATP-binding, cytoplasm, damage, DNA recombination, DNA repair, DNA-binding; 1.95A {Thermotoga maritima} | Back alignment and structure |
|---|
| >3bos_A Putative DNA replication factor; P-loop containing nucleoside triphosphate hydrolases, struct genomics; HET: MSE CDP; 1.75A {Shewanella amazonensis} PDB: 3sc3_A | Back alignment and structure |
|---|
| >1n0w_A DNA repair protein RAD51 homolog 1; DNA repair, homologous recombination, breast cancer susceptibility, RECA-like ATPase, protein complex; HET: DNA MSE; 1.70A {Homo sapiens} SCOP: c.37.1.11 | Back alignment and structure |
|---|
| >2krk_A 26S protease regulatory subunit 8; structural genomics, northeast structural genomics consortium (NESG), target HR3102A, PSI-2; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3pvs_A Replication-associated recombination protein A; maintenance of genome stability Pro recombination; 2.50A {Escherichia coli} | Back alignment and structure |
|---|
| >2zr9_A Protein RECA, recombinase A; recombination, RECA mutants, DNA-repair, ATP-binding, DNA DA recombination, DNA repair, DNA-binding; HET: DTP; 2.50A {Mycobacterium smegmatis str} PDB: 2zr0_A* 2zra_A* 2zrb_A 2zrm_A* 1ubc_A* 1ubf_A* 1ubg_A* 1ube_A* 2g88_A* 2odw_A* 2oe2_A 2oep_A* 2oes_A 2ofo_A 2zr7_A 2odn_A* 2zrn_A 2zro_A* 2zrp_A* 2zre_A* ... | Back alignment and structure |
|---|
| >2qby_B CDC6 homolog 3, cell division control protein 6 homolog 3; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} | Back alignment and structure |
|---|
| >3cmu_A Protein RECA, recombinase A; homologous recombination, recombination/DNA complex; HET: DNA ADP; 4.20A {Escherichia coli} | Back alignment and structure |
|---|
| >1l8q_A Chromosomal replication initiator protein DNAA; AAA+, helix-turn-helix, nucleotide-binding, DNA binding, REP initiation, DNA binding protein; HET: ADP; 2.70A {Aquifex aeolicus} SCOP: a.4.12.2 c.37.1.20 PDB: 3r8f_A* 2hcb_A* | Back alignment and structure |
|---|
| >3vkg_A Dynein heavy chain, cytoplasmic; AAA+ protein, molecular motor, microtubles, motor protein; HET: ADP SPM; 2.81A {Dictyostelium discoideum} PDB: 3vkh_A* | Back alignment and structure |
|---|
| >2chq_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATP ATP-binding, nucleotide-binding; HET: ANP; 3.5A {Archaeoglobus fulgidus} PDB: 2chv_A | Back alignment and structure |
|---|
| >1qhx_A CPT, protein (chloramphenicol phosphotransferase); kinase, antibiotic resistance, phosphorylation, mononucleoti binding fold; HET: ATP; 2.50A {Streptomyces venezuelae} SCOP: c.37.1.3 PDB: 1grr_A* 1grq_A 1qhs_A* 1qhn_A* 1qhy_A* | Back alignment and structure |
|---|
| >1sxj_B Activator 1 37 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 | Back alignment and structure |
|---|
| >2orw_A Thymidine kinase; TMTK, TP4A, transferase; HET: 4TA; 1.50A {Thermotoga maritima} PDB: 2qpo_A 2qq0_A* 2qqe_A* | Back alignment and structure |
|---|
| >2z43_A DNA repair and recombination protein RADA; archaea, filament, DNA binding, molecular SWI RECA, DMC1; HET: DNA; 1.93A {Sulfolobus solfataricus} PDB: 2bke_A* 2dfl_A* 2zub_A* 2zuc_A* 2zud_A* | Back alignment and structure |
|---|
| >1u94_A RECA protein, recombinase A; homologous recombination, ATPase, DNA repair, DNA binding protein; 1.90A {Escherichia coli} SCOP: c.37.1.11 d.48.1.1 PDB: 1u98_A 1u99_A 1xms_A* 1xmv_A* 2rec_A 2reb_A 1n03_A* 1rea_A 1aa3_A | Back alignment and structure |
|---|
| >3trf_A Shikimate kinase, SK; amino acid biosynthesis, transferase; 2.60A {Coxiella burnetii} | Back alignment and structure |
|---|
| >1v5w_A DMC1, meiotic recombination protein DMC1/LIM15 homolog; DNA-binding protein, ring protein, octamer, AAA ATPase; 3.20A {Homo sapiens} SCOP: c.37.1.11 PDB: 2zjb_A | Back alignment and structure |
|---|
| >3upu_A ATP-dependent DNA helicase DDA; RECA-like domain, SH3 domain, PIN-tower interface, coupling hydrolysis to DNA unwinding, ssDNA; 3.30A {Enterobacteria phage T4} | Back alignment and structure |
|---|
| >1iqp_A RFCS; clamp loader, extended AAA-ATPase domain, complex with ADP, replication; HET: ADP; 2.80A {Pyrococcus furiosus} SCOP: a.80.1.1 c.37.1.20 | Back alignment and structure |
|---|
| >2dr3_A UPF0273 protein PH0284; RECA superfamily ATPase, hexamer, structural genomics; HET: ADP; 2.00A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >3vaa_A Shikimate kinase, SK; structural genomics, center for structural genomics of infec diseases, csgid, metal binding, transferase; 1.70A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >1sxj_D Activator 1 41 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 | Back alignment and structure |
|---|
| >1jr3_A DNA polymerase III subunit gamma; processivity, processivity clamp, clamp loader, AAA+ ATPase, transferase; HET: DNA; 2.70A {Escherichia coli} SCOP: a.80.1.1 c.37.1.20 PDB: 1xxh_B* 3glh_B* 3glf_B* 3gli_B* 3glg_B* 1xxi_B* | Back alignment and structure |
|---|
| >3aji_B S6C, proteasome (prosome, macropain) 26S subunit, ATPA; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dwz_B* 2dvw_B* | Back alignment and structure |
|---|
| >1fnn_A CDC6P, cell division control protein 6; ORC1, AAA protein, DNA replication initation factor, cell cycle control factor; HET: ADP; 2.00A {Pyrobaculum aerophilum} SCOP: a.4.5.11 c.37.1.20 | Back alignment and structure |
|---|
| >3kb2_A SPBC2 prophage-derived uncharacterized protein YORR; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; HET: G3D; 2.20A {Bacillus subtilis} SCOP: c.37.1.1 PDB: 2axp_A* | Back alignment and structure |
|---|
| >3jvv_A Twitching mobility protein; hexameric P-loop ATPase, secretion ATPase, ATP-binding, FIMB nucleotide-binding, transport; HET: ACP CIT; 2.60A {Pseudomonas aeruginosa} PDB: 3jvu_A* | Back alignment and structure |
|---|
| >3vlf_B 26S protease regulatory subunit 7 homolog; heat repeat, chaperone, chaperone-protein binding complex; HET: DNA; 3.80A {Saccharomyces cerevisiae} PDB: 4a3v_B* | Back alignment and structure |
|---|
| >4a74_A DNA repair and recombination protein RADA; hydrolase, recombinase; HET: DNA ANP; 1.48A {Pyrococcus furiosus} PDB: 4a6x_A* 4a6p_A* 4a7o_A* | Back alignment and structure |
|---|
| >3f9v_A Minichromosome maintenance protein MCM; replicative helicase, DNA replication, MCM complex, AAA+ Pro ATP-binding, DNA-binding, helicase; 4.35A {Sulfolobus solfataricus} | Back alignment and structure |
|---|
| >3io5_A Recombination and repair protein; storage dimer, inactive conformation, RECA like core domain, binding, DNA damage, DNA recombination; 2.40A {Enterobacteria phage T4} | Back alignment and structure |
|---|
| >2b8t_A Thymidine kinase; deoxyribonucleoside kinase, zinc-binding domain, TK1, UU-TK, transferase; HET: THM; 2.00A {Ureaplasma parvum} SCOP: c.37.1.24 g.39.1.14 PDB: 2uz3_A* | Back alignment and structure |
|---|
| >3lda_A DNA repair protein RAD51; DNA binding protein, ATP-binding, DNA damage, DNA recombinat repair, nucleotide-binding; HET: DNA; 2.50A {Saccharomyces cerevisiae} PDB: 1szp_A* | Back alignment and structure |
|---|
| >1via_A Shikimate kinase; structural genomics, transferase; HET: MSE; 1.57A {Campylobacter jejuni} SCOP: c.37.1.2 | Back alignment and structure |
|---|
| >3iij_A Coilin-interacting nuclear ATPase protein; alpha and beta proteins (A/B), protein binding, transferase, phosphotransferase; HET: ADP; 1.76A {Homo sapiens} SCOP: c.37.1.1 PDB: 3iik_A 3iil_A* 3iim_A* 1rkb_A | Back alignment and structure |
|---|
| >3dm5_A SRP54, signal recognition 54 kDa protein; protein-RNA, signal recognition particle, SRP-GTPase, protein targeting, cytoplasm, GTP-binding; HET: GDP; 2.51A {Pyrococcus furiosus} | Back alignment and structure |
|---|
| >1zuh_A Shikimate kinase; alpha-beta protein, transferase; 1.80A {Helicobacter pylori} PDB: 1zui_A* 3hr7_A 3muf_A* 3mrs_A 3n2e_A* | Back alignment and structure |
|---|
| >2iyv_A Shikimate kinase, SK; transferase, aromatic amino acid biosynthesis, P-loop kinase, metal- binding, shikimate pathway; HET: ADP; 1.35A {Mycobacterium tuberculosis} SCOP: c.37.1.2 PDB: 2iyr_A* 2iyq_A* 2iyt_A 2iyu_A* 2iys_A* 2iyw_A* 2iyx_A* 2iyy_A* 2iyz_A* 2g1k_A* 1l4y_A* 1u8a_A* 1we2_A* 1zyu_A* 2dfn_A* 2dft_A* 2g1j_A 1l4u_A* 3baf_A* | Back alignment and structure |
|---|
| >3bh0_A DNAB-like replicative helicase; ATPase, replication; 2.35A {Bacillus phage SPP1} | Back alignment and structure |
|---|
| >2rhm_A Putative kinase; P-loop containing nucleoside triphosphate hydrolases fold, S genomics, joint center for structural genomics, JCSG; HET: MSE; 1.70A {Chloroflexus aurantiacus} | Back alignment and structure |
|---|
| >1a5t_A Delta prime, HOLB; zinc finger, DNA replication; 2.20A {Escherichia coli K12} SCOP: a.80.1.1 c.37.1.20 PDB: 1jr3_E* 1xxh_E* 1xxi_E* 3glf_E* 3glg_E* 3glh_E* 3gli_E* | Back alignment and structure |
|---|
| >1sxj_E Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 | Back alignment and structure |
|---|
| >1y63_A LMAJ004144AAA protein; structural genomics, protein structure initiative, PSI, SGPP structural genomics of pathogenic protozoa consortium; HET: ADP; 1.70A {Leishmania major} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >2p5t_B PEZT; postsegregational killing system, phosphoryltransferase, HEL helix motif, transcription regulator; 3.20A {Streptococcus pneumoniae} | Back alignment and structure |
|---|
| >1gvn_B Zeta; postsegregational killing system, plasmid; 1.95A {Streptococcus pyogenes} SCOP: c.37.1.21 PDB: 3q8x_B* | Back alignment and structure |
|---|
| >2i1q_A DNA repair and recombination protein RADA; ATPase, recombinase, ATP complex, calcium stimulation, RECA, DMC1; HET: DNA ANP; 1.90A {Methanococcus voltae} SCOP: a.60.4.1 c.37.1.11 PDB: 1xu4_A* 2b21_A* 2fpk_A* 2fpl_A* 2fpm_A* 1t4g_A* 3fyh_A* 2f1j_A* 2f1i_A* 2f1h_A* 3ntu_A* 3ewa_A* 3ew9_A* 3etl_A* 4dc9_A* 2gdj_A* | Back alignment and structure |
|---|
| >1aky_A Adenylate kinase; ATP:AMP phosphotransferase, myokinase, transferase (phosphotransferase); HET: AP5; 1.63A {Saccharomyces cerevisiae} SCOP: c.37.1.1 g.41.2.1 PDB: 2aky_A* 3aky_A* 1dvr_A* | Back alignment and structure |
|---|
| >1tev_A UMP-CMP kinase; ploop, NMP binding region, LID region, conformational changes, transferase; 2.10A {Homo sapiens} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >3lw7_A Adenylate kinase related protein (ADKA-like); AMP, PSI, MCSG, structural genomics, midwest center for structural genomics; HET: AMP; 2.30A {Sulfolobus solfataricus} PDB: 3h0k_A | Back alignment and structure |
|---|
| >2i3b_A HCR-ntpase, human cancer-related ntpase; AAA, rossmann, hydrolase; NMR {Homo sapiens} SCOP: c.37.1.11 | Back alignment and structure |
|---|
| >2cdn_A Adenylate kinase; phosphoryl transfer, associative mechanism, ATP-binding, nucleotide biosynthesis, nucleotide-binding, transferase; HET: ADP; 1.9A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1p4s_A | Back alignment and structure |
|---|
| >1pzn_A RAD51, DNA repair and recombination protein RAD51, RADA; heptameric ring, heptamer, ring, oligomer, RAD51 polymerizat motif; HET: DNA; 2.85A {Pyrococcus furiosus} SCOP: a.60.4.1 c.37.1.11 | Back alignment and structure |
|---|
| >1vma_A Cell division protein FTSY; TM0570, structural genomics, JCS protein structure initiative, PSI, joint center for structu genomics; HET: CIT; 1.60A {Thermotoga maritima} SCOP: a.24.13.1 c.37.1.10 | Back alignment and structure |
|---|
| >1e6c_A Shikimate kinase; phosphoryl transfer, ADP, shikimate pathway, P-loop protein, transferase; 1.8A {Erwinia chrysanthemi} SCOP: c.37.1.2 PDB: 1shk_A 2shk_A* | Back alignment and structure |
|---|
| >1nlf_A Regulatory protein REPA; replicative DNA helicase structural changes, replication; 1.95A {Escherichia coli} SCOP: c.37.1.11 PDB: 1g8y_A 1olo_A | Back alignment and structure |
|---|
| >2ze6_A Isopentenyl transferase; crown GALL tumor, cytokinin biosynthesis; HET: DST AMP; 2.10A {Agrobacterium tumefaciens} PDB: 2ze5_A* 2ze7_A* 2ze8_A | Back alignment and structure |
|---|
| >2c95_A Adenylate kinase 1; transferase, AP4A, nucleotide kinase, transferase ATP-bindi; HET: B4P; 1.71A {Homo sapiens} PDB: 1z83_A* 3adk_A | Back alignment and structure |
|---|
| >2r8r_A Sensor protein; KDPD, PFAM02702, MCSG, structural genomics, protein structure initiative, midwest center for structural genomics, kinase; 2.30A {Pseudomonas syringae PV} | Back alignment and structure |
|---|
| >3a4m_A L-seryl-tRNA(SEC) kinase; P-loop motif, walker A motif, ATP binding motif, ATP- binding, nucleotide-binding, transferase; HET: ADP; 1.79A {Methanocaldococcus jannaschii} PDB: 3a4l_A* 3a4n_A 3am1_A* 3add_A* 3adc_A* 3adb_A* | Back alignment and structure |
|---|
| >3e1s_A Exodeoxyribonuclease V, subunit RECD; alpha and beta protein, ATP-binding, nucleotide-binding, HYD; 2.20A {Deinococcus radiodurans} PDB: 3gp8_A 3gpl_A* | Back alignment and structure |
|---|
| >1kag_A SKI, shikimate kinase I; transferase, structural genomics, PSI, protein structure initiative; 2.05A {Escherichia coli} SCOP: c.37.1.2 | Back alignment and structure |
|---|
| >2pt5_A Shikimate kinase, SK; aromatic amino acid biosynthesis, P-loop kinase, SHI kinase, shikimate pathway; 2.10A {Aquifex aeolicus} | Back alignment and structure |
|---|
| >3dl0_A Adenylate kinase; phosphotransferase, zinc coordination, ATP-binding, binding, nucleotide biosynthesis, nucleotide-binding, trans; HET: AP5; 1.58A {Bacillus subtilis} PDB: 1p3j_A* 2ori_A* 2eu8_A* 2oo7_A* 2p3s_A* 2qaj_A* 2osb_A* 3dkv_A* 1zin_A* 1zio_A* 1zip_A* 1s3g_A* | Back alignment and structure |
|---|
| >3cm0_A Adenylate kinase; ATP-binding, cytoplasm, nucleotide biosynthesis, nucleotide-binding, transferase, structural genomics; 1.80A {Thermus thermophilus} | Back alignment and structure |
|---|
| >2gno_A DNA polymerase III, gamma subunit-related protein; structural genomics, joint center for structural genomics, J protein structure initiative; HET: DNA; 2.00A {Thermotoga maritima} SCOP: a.80.1.1 c.37.1.20 | Back alignment and structure |
|---|
| >2zts_A Putative uncharacterized protein PH0186; KAIC like protein, ATP-binding, nucleotide-binding, ATP- binding protein; HET: ADP; 2.07A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >1ak2_A Adenylate kinase isoenzyme-2; nucleoside monophosphate kinase, phosphotransferase; 1.92A {Bos taurus} SCOP: c.37.1.1 g.41.2.1 PDB: 2ak2_A 2c9y_A* | Back alignment and structure |
|---|
| >2bwj_A Adenylate kinase 5; phosphoryl transfer reaction, transferase; HET: AMP; 2.3A {Homo sapiens} | Back alignment and structure |
|---|
| >3fb4_A Adenylate kinase; psychrophIle, phosphotransferase, ATP-binding, nucleotide-binding, transferase; HET: AP5; 2.00A {Marinibacillus marinus} | Back alignment and structure |
|---|
| >1kht_A Adenylate kinase; phosphotransferase, signaling protein, transferase; HET: AMP; 2.50A {Methanococcus voltae} SCOP: c.37.1.1 PDB: 3h86_B* 1ki9_A | Back alignment and structure |
|---|
| >1z6t_A APAF-1, apoptotic protease activating factor 1; caspase activation, ADP, nucleotide binding, CARD, apoptosis; HET: ADP; 2.21A {Homo sapiens} | Back alignment and structure |
|---|
| >1g5t_A COB(I)alamin adenosyltransferase; P-loop protein, cobalamin biosynthesis, RECA fold; HET: ATP; 1.80A {Salmonella typhimurium} SCOP: c.37.1.11 PDB: 1g5r_A* 1g64_A* | Back alignment and structure |
|---|
| >1qf9_A UMP/CMP kinase, protein (uridylmonophosphate/cytidylmonophosphate kinase); nucleoside monophosphate kinase, NMP kinase; HET: ADP C5P; 1.70A {Dictyostelium discoideum} SCOP: c.37.1.1 PDB: 1uke_A* 2ukd_A* 3ukd_A* 4ukd_A* 5ukd_A* | Back alignment and structure |
|---|
| >2r6a_A DNAB helicase, replicative helicase; replication, DNAB; 2.90A {Geobacillus stearothermophilus} PDB: 2r6c_A 2r6d_A 2r6e_A 2vyf_A 2vye_A | Back alignment and structure |
|---|
| >2dzn_B 26S protease regulatory subunit 6B homolog; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} PDB: 2dzo_B | Back alignment and structure |
|---|
| >2fz4_A DNA repair protein RAD25; RECA-like domain, DNA damage recognition domain, DNA binding; HET: DNA; 2.40A {Archaeoglobus fulgidus} SCOP: c.37.1.19 | Back alignment and structure |
|---|
| >2q6t_A DNAB replication FORK helicase; hydrolase; 2.90A {Thermus aquaticus} | Back alignment and structure |
|---|
| >1ukz_A Uridylate kinase; transferase; HET: ADP AMP; 1.90A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 1uky_A* | Back alignment and structure |
|---|
| >2vli_A Antibiotic resistance protein; transferase, tunicamycin, phosphotransferase; 1.95A {Deinococcus radiodurans} | Back alignment and structure |
|---|
| >1ly1_A Polynucleotide kinase; PNK, phosphatase, transferase; 2.00A {Enterobacteria phage T4} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >3t61_A Gluconokinase; PSI-biology, structural genomics, protein structure initiati YORK structural genomics research consortium, nysgrc; 2.20A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >1zd8_A GTP:AMP phosphotransferase mitochondrial; ATP:AMP phosphotransferase, myokinase, structural genomics, structural genomics consortium, SGC; 1.48A {Homo sapiens} PDB: 2ak3_A* | Back alignment and structure |
|---|
| >2iut_A DNA translocase FTSK; nucleotide-binding, chromosome partition, ATP-binding, DNA- cell division, DNA translocation, KOPS, membrane; HET: DNA SAP; 2.25A {Pseudomonas aeruginosa} PDB: 2iuu_A* | Back alignment and structure |
|---|
| >3tlx_A Adenylate kinase 2; structural genomics, structural genomics consortium, SGC, RO fold, transferase, ATP binding, phosphorylation; HET: ADP ATP AMP; 2.75A {Plasmodium falciparum} | Back alignment and structure |
|---|
| >3be4_A Adenylate kinase; malaria, cryptosporidium parvum nonprotein inhibitors, nucleotide-binding, transferase; HET: AP5; 1.60A {Cryptosporidium parvum iowa II} | Back alignment and structure |
|---|
| >1knq_A Gluconate kinase; ALFA/beta structure, transferase; 2.00A {Escherichia coli} SCOP: c.37.1.17 PDB: 1ko1_A 1ko4_A 1ko5_A* 1ko8_A* 1kof_A* | Back alignment and structure |
|---|
| >1cr0_A DNA primase/helicase; RECA-type protein fold, transferase; HET: DNA; 2.30A {Enterobacteria phage T7} SCOP: c.37.1.11 PDB: 1cr1_A* 1cr2_A* 1cr4_A* 1e0j_A* 1e0k_A* | Back alignment and structure |
|---|
| >3kl4_A SRP54, signal recognition 54 kDa protein; signal recognition particle, SRP, SRP54, FFH, signal sequenc peptide; 3.50A {Sulfolobus solfataricus} PDB: 1qzx_A 1qzw_A | Back alignment and structure |
|---|
| >1zp6_A Hypothetical protein ATU3015; alpha-beta protein., structural genomics, PSI, protein struc initiative; 3.20A {Agrobacterium tumefaciens str} SCOP: c.37.1.25 | Back alignment and structure |
|---|
| >1zak_A Adenylate kinase; ATP:AMP-phosphotransferase, transferase; HET: AP5; 3.50A {Zea mays} SCOP: c.37.1.1 g.41.2.1 | Back alignment and structure |
|---|
| >1e4v_A Adenylate kinase; transferase(phosphotransferase); HET: AP5; 1.85A {Escherichia coli} SCOP: c.37.1.1 g.41.2.1 PDB: 1e4y_A* 1ake_A* 1ank_A* 2eck_A* 3hpq_A* 4ake_A 3hpr_A* | Back alignment and structure |
|---|
| >3bgw_A DNAB-like replicative helicase; ATPase, replication; 3.91A {Bacillus phage SPP1} | Back alignment and structure |
|---|
| >3sr0_A Adenylate kinase; phosphoryl transfer analogue, ALF4, transferase (phosphotran phosphoryl transfer, nucleotide-binding; HET: ADP AMP; 1.56A {Aquifex aeolicus} PDB: 2rh5_A 2rgx_A* | Back alignment and structure |
|---|
| >2pbr_A DTMP kinase, thymidylate kinase; transferase, nucleotide biosynthesis, TMP-binding, A binding, structural genomics, NPPSFA; 1.96A {Aquifex aeolicus} | Back alignment and structure |
|---|
| >4eun_A Thermoresistant glucokinase; putative sugar kinase, enzyme function initiative, EFI, STRU genomics, transferase; 1.60A {Janibacter SP} | Back alignment and structure |
|---|
| >2pez_A Bifunctional 3'-phosphoadenosine 5'- phosphosulfate synthetase 1 (PAPS synthetase...; NMP-kinase fold, protein in complex with nucleic acid; HET: GGZ DAT; 1.40A {Homo sapiens} PDB: 2pey_A* 2ax4_A* | Back alignment and structure |
|---|
| >3umf_A Adenylate kinase; rossmann fold, transferase; 2.05A {Schistosoma mansoni} | Back alignment and structure |
|---|
| >2jaq_A Deoxyguanosine kinase; transferase, deoxyribonucleoside kinase; HET: DCP; 2.3A {Mycoplasma mycoides subsp} PDB: 2jat_A* 2jas_A* | Back alignment and structure |
|---|
| >2ga8_A Hypothetical 39.9 kDa protein; YFR007W, YFH7, unknown function; HET: CME; 1.77A {Saccharomyces cerevisiae} PDB: 2gaa_A* | Back alignment and structure |
|---|
| >3b6e_A Interferon-induced helicase C domain-containing P; DECH, DEXD/H RNA-binding helicase, innate immunity, IFIH1, S genomics; 1.60A {Homo sapiens} | Back alignment and structure |
|---|
| >1nks_A Adenylate kinase; thermophilic, transferase; HET: AMP ADP; 2.57A {Sulfolobus acidocaldarius} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >3crm_A TRNA delta(2)-isopentenylpyrophosphate transferase; ATP-binding, nucleotide-binding, nucleotidyltransferase, tRNA processing; 1.90A {Pseudomonas aeruginosa} PDB: 3crq_A 3crr_A | Back alignment and structure |
|---|
| >3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* | Back alignment and structure |
|---|
| >2xb4_A Adenylate kinase; ATP-binding, nucleotide-binding, transferase; HET: SRT; 1.80A {Desulfovibrio gigas} PDB: 3l0s_A* 3l0p_A* | Back alignment and structure |
|---|
| >1cke_A CK, MSSA, protein (cytidine monophosphate kinase); nucleotide monophosphate kinase,, transferase; 1.75A {Escherichia coli} SCOP: c.37.1.1 PDB: 1kdo_A* 1kdp_A* 1kdr_A* 1kdt_A* 2cmk_A* 2fem_A 2feo_A* | Back alignment and structure |
|---|
| >1q57_A DNA primase/helicase; dntpase, DNA replication, transferase; HET: DNA; 3.45A {Enterobacteria phage T7} SCOP: c.37.1.11 e.13.1.2 | Back alignment and structure |
|---|
| >2eyu_A Twitching motility protein PILT; pilus retraction motor, C-terminal domain PILT, protein transport; 1.87A {Aquifex aeolicus} | Back alignment and structure |
|---|
| >2if2_A Dephospho-COA kinase; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium, NESG; 3.00A {Aquifex aeolicus} | Back alignment and structure |
|---|
| >2v54_A DTMP kinase, thymidylate kinase; nucleotide biosynthesis, ATP-binding, nucleotide-binding, poxvirus, transferase; HET: TYD POP; 2.4A {Vaccinia virus copenhagen} PDB: 2w0s_A* | Back alignment and structure |
|---|
| >1sxj_C Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 | Back alignment and structure |
|---|
| >2ius_A DNA translocase FTSK; nucleotide-binding, chromosome partition, ATP-binding, DNA- binding, cell division, transmembrane, inner membrane; HET: DNA; 2.7A {Escherichia coli} PDB: 2j5p_A* | Back alignment and structure |
|---|
| >1uf9_A TT1252 protein; P-loop, nucleotide binding domain, structural genomics, riken structural genomics/proteomics initiative, RSGI; HET: ATP; 2.80A {Thermus thermophilus} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >1w5s_A Origin recognition complex subunit 2 ORC2; replication, CDC6, DNA replication initiation, DNA BIND protein, AAA+ ATPase; HET: ADP; 2.4A {Aeropyrum pernix} SCOP: a.4.5.11 c.37.1.20 PDB: 1w5t_A* | Back alignment and structure |
|---|
| >3ake_A Cytidylate kinase; CMP kinase, CMP complex, open conformation, nucleotide metab transferase; HET: C5P; 1.50A {Thermus thermophilus} PDB: 3akc_A* 3akd_A* | Back alignment and structure |
|---|
| >2plr_A DTMP kinase, probable thymidylate kinase; TMP-binding, ATP-binding, structural GEN NPPSFA; HET: 1PE PGE EPE PG4; 1.60A {Sulfolobus tokodaii} | Back alignment and structure |
|---|
| >2ewv_A Twitching motility protein PILT; pilus retraction motor, ATPase, hexameric PILT, protein TRAN; HET: ADP; 2.80A {Aquifex aeolicus} PDB: 2eww_A* 2gsz_A* | Back alignment and structure |
|---|
| >3uie_A Adenylyl-sulfate kinase 1, chloroplastic; rossmann fold, transferase-transferase complex; HET: ADX ANP; 1.79A {Arabidopsis thaliana} SCOP: c.37.1.0 PDB: 4fxp_A* | Back alignment and structure |
|---|
| >1p9r_A General secretion pathway protein E; bacterial type II secretion system cytoplasmic protein - GSPE, putative ATPase/ ATP binding protein; 2.50A {Vibrio cholerae} SCOP: c.37.1.11 PDB: 1p9w_A* | Back alignment and structure |
|---|
| >2wwf_A Thymidilate kinase, putative; transferase, malaria; HET: TMP ADP; 1.89A {Plasmodium falciparum} PDB: 2wwg_A* 2wwh_A* 2wwi_A* | Back alignment and structure |
|---|
| >1w36_D RECD, exodeoxyribonuclease V alpha chain; recombination, helicase, hydrolase, DNA repair; HET: DNA; 3.1A {Escherichia coli} SCOP: c.37.1.19 c.37.1.19 PDB: 3k70_D* | Back alignment and structure |
|---|
| >2bbw_A Adenylate kinase 4, AK4; nucleotide kinase, nucleotide binding, human, structura genomics, structural genomics consortium, SGC, transferase; HET: GP5; 2.05A {Homo sapiens} PDB: 2ar7_A* 3ndp_A | Back alignment and structure |
|---|
| >4gp7_A Metallophosphoesterase; polynucleotide kinase phosphatase, RNA repair, transferase; HET: ATP CIT; 2.00A {Clostridium thermocellum} PDB: 4gp6_A* | Back alignment and structure |
|---|
| >4a1f_A DNAB helicase, replicative DNA helicase; hydrolase, DNA replication, ATPase; HET: FLC; 2.50A {Helicobacter pylori} | Back alignment and structure |
|---|
| >2grj_A Dephospho-COA kinase; TM1387, EC 2.7.1.24, dephosphocoenzyme kinase, structural genomics, joint center for structural GE JCSG; HET: ADP COD; 2.60A {Thermotoga maritima} | Back alignment and structure |
|---|
| >1m7g_A Adenylylsulfate kinase; APS kinase, transferase, sulfate Met nucleotide 2 kinase; HET: AV2 ADX ADP; 1.43A {Penicillium chrysogenum} SCOP: c.37.1.4 PDB: 1d6j_A* 1m7h_A* 3cr7_A* | Back alignment and structure |
|---|
| >1jjv_A Dephospho-COA kinase; P-loop nucleotide-binding fold, structure 2 function project, S2F, structural genomics, transferase; HET: ATP; 2.00A {Haemophilus influenzae} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >1ex7_A Guanylate kinase; substrate-induced FIT, domain movement, GMP, ATP, substrate specificity, X-RAY diffraction, transferase; HET: 5GP; 1.90A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 1ex6_A* 1gky_A* 3sqk_A 4f4j_A | Back alignment and structure |
|---|
| >3r20_A Cytidylate kinase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, ADP, DCMP, D transferase; 2.00A {Mycobacterium smegmatis} SCOP: c.37.1.0 PDB: 3r8c_A 4die_A* | Back alignment and structure |
|---|
| >1jr3_D DNA polymerase III, delta subunit; processivity, processivity clamp, clamp loader, AAA+ ATPase, transferase; HET: DNA; 2.70A {Escherichia coli} SCOP: a.80.1.1 c.37.1.20 PDB: 1jqj_C* 1xxh_A* 1xxi_A* 3glf_A* 3glg_A* 3glh_A* 3gli_A* | Back alignment and structure |
|---|
| >3a8t_A Adenylate isopentenyltransferase; rossmann fold protein; HET: ATP; 2.37A {Humulus lupulus} | Back alignment and structure |
|---|
| >4e22_A Cytidylate kinase; P-loop, CMP/ATP binding, transferase; 2.32A {Yersinia pseudotuberculosis} | Back alignment and structure |
|---|
| >1nn5_A Similar to deoxythymidylate kinase (thymidylate K; P-loop, D4TMP, transferase; HET: 2DT ANP; 1.50A {Homo sapiens} SCOP: c.37.1.1 PDB: 1e2e_A* 1e2d_A* 1e2g_A* 1e2q_A* 1e99_A* 1e9a_A* 1e9b_A* 1nmx_A* 1nmz_A* 1nn0_A* 1nn1_A* 1e2f_A* 1nn3_A* 2xx3_A* 1e9c_A* 1e9d_A* 1e9e_A* 1e98_A* 1nmy_A* 1e9f_A* | Back alignment and structure |
|---|
| >1uj2_A Uridine-cytidine kinase 2; alpha/beta mononucleotide-binding HOLD, transferase; HET: C5P ADP; 1.80A {Homo sapiens} SCOP: c.37.1.6 PDB: 1uei_A* 1uej_A* 1udw_A 1ufq_A* 1xrj_A* | Back alignment and structure |
|---|
| >3nwj_A ATSK2; P loop, shikimate, nucleoside monophosphate kinase, shikimat ATP binding, chloroplast, transferase; 2.35A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >2yvu_A Probable adenylyl-sulfate kinase; transferase, structural genomics, NPPSFA, national P protein structural and functional analyses; 2.10A {Aeropyrum pernix} | Back alignment and structure |
|---|
| >1vht_A Dephospho-COA kinase; structural genomics, transferase; HET: BA3; 1.59A {Escherichia coli} SCOP: c.37.1.1 PDB: 1vhl_A* 1viy_A 1t3h_A 1n3b_A | Back alignment and structure |
|---|
| >2h92_A Cytidylate kinase; rossmann fold, transferase; HET: C5P PG4; 2.30A {Staphylococcus aureus} | Back alignment and structure |
|---|
| >2pt7_A CAG-ALFA; ATPase, protein-protein complex, type IV secretion, hydrolas binding complex; 2.40A {Helicobacter pylori} SCOP: c.37.1.11 PDB: 1nly_A* 1nlz_A 1opx_A* 1g6o_A | Back alignment and structure |
|---|
| >1ltq_A Polynucleotide kinase; phosphatase, alpha/beta, P-loop, transferase; HET: ADP; 2.33A {Enterobacteria phage T4} SCOP: c.108.1.9 c.37.1.1 PDB: 1rc8_A* 1rpz_A* 1rrc_A* 2ia5_A | Back alignment and structure |
|---|
| >2px0_A Flagellar biosynthesis protein FLHF; SRP GTPase, flagellum, protein transport, biosynthetic protein; HET: GNP; 3.00A {Bacillus subtilis} PDB: 2px3_A* 3syn_A* | Back alignment and structure |
|---|
| >1q3t_A Cytidylate kinase; nucleotide monophosphate kinase, CMP kinase, transferase; NMR {Streptococcus pneumoniae} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >3foz_A TRNA delta(2)-isopentenylpyrophosphate transferas; nucleoside modification, isopentenyl-tRNA transferase, transferase-RNA complex; 2.50A {Escherichia coli k-12} PDB: 2zxu_A* 2zm5_A | Back alignment and structure |
|---|
| >2gxq_A Heat resistant RNA dependent ATPase; RNA helicase, atomic resolution, AMP complex, ribosome biogenesis, thermophilic, hydrolase; HET: AMP; 1.20A {Thermus thermophilus HB27} PDB: 2gxs_A* 2gxu_A 3mwj_A 3mwk_A* 3mwl_A* 3nbf_A* 3nej_A | Back alignment and structure |
|---|
| >3zvl_A Bifunctional polynucleotide phosphatase/kinase; hydrolase-transferase complex, base excision repair, BER, non-homologous END-joining, NHEJ; 1.65A {Mus musculus} PDB: 3zvm_A* 3zvn_A* 1yj5_A 3u7e_B* 3u7f_B* 3u7h_B* 3u7g_A* | Back alignment and structure |
|---|
| >3pie_A 5'->3' exoribonuclease (XRN1); beta berrel, tudor domain, chromo domain, mRNA turnover, RRN processing, RNA binding, DNA binding; 2.90A {Kluyveromyces lactis} PDB: 3pif_A | Back alignment and structure |
|---|
| >2qt1_A Nicotinamide riboside kinase 1; non-protein kinase, NAD+, NRK1, nicotinic acid riboside kinase activity, NAD biosynthesis; HET: NNR; 1.32A {Homo sapiens} PDB: 2qsy_A* 2qsz_A* 2qt0_A* 2p0e_A* 2qg6_A* 2ql6_A* | Back alignment and structure |
|---|
| >2j37_W Signal recognition particle 54 kDa protein (SRP54); ribosome, SRP, translation/RNA; 8.00A {Canis SP} PDB: 1wgw_A | Back alignment and structure |
|---|
| >3ney_A 55 kDa erythrocyte membrane protein; structural genomics consortium, SGC, 55 kDa erythrocyte MEMB protein; 2.26A {Homo sapiens} SCOP: c.37.1.0 | Back alignment and structure |
|---|
| >2f6r_A COA synthase, bifunctional coenzyme A synthase; 18044849, bifunctional coenzyme A synthase (COA synthase), S genomics; HET: ACO UNL; 1.70A {Mus musculus} | Back alignment and structure |
|---|
| >4b3f_X DNA-binding protein smubp-2; hydrolase, helicase; 2.50A {Homo sapiens} PDB: 4b3g_A | Back alignment and structure |
|---|
| >2yhs_A FTSY, cell division protein FTSY; cell cycle, protein targeting, simibi class GTPase, GTP-BIND membrane, nucleotide-binding; 1.60A {Escherichia coli} PDB: 2qy9_A 2xxa_B* 1fts_A | Back alignment and structure |
|---|
| >2a5y_B CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis elegans} SCOP: a.4.5.80 a.77.1.3 c.37.1.20 PDB: 3lqq_A* 3lqr_A* | Back alignment and structure |
|---|
| >3d3q_A TRNA delta(2)-isopentenylpyrophosphate transferase; alpha-beta protein, structural genomics, PSI-2; 2.70A {Staphylococcus epidermidis atcc 12228} | Back alignment and structure |
|---|
| >3llm_A ATP-dependent RNA helicase A; alpha-beta-alpha, structural genomics, structural genomics consortium, SGC, activator, ATP-binding, DNA-binding; HET: ADP; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >2qor_A Guanylate kinase; phosphotransferase, purine metabolism, structural genomics, structural genomics of pathogenic protozoa consortium; HET: 5GP POP; 1.80A {Plasmodium vivax} | Back alignment and structure |
|---|
| >1j8m_F SRP54, signal recognition 54 kDa protein; signaling protein; 2.00A {Acidianus ambivalens} SCOP: a.24.13.1 c.37.1.10 PDB: 1j8y_F | Back alignment and structure |
|---|
| >2bdt_A BH3686; alpha-beta protein, structural genomics, PSI, protein struct initiative, northeast structural genomics consortium, NESG, function; 2.40A {Bacillus halodurans} SCOP: c.37.1.25 | Back alignment and structure |
|---|
| >3exa_A TRNA delta(2)-isopentenylpyrophosphate transferase; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; 2.30A {Bacillus halodurans} PDB: 2qgn_A | Back alignment and structure |
|---|
| >3fdi_A Uncharacterized protein; cytidylate kinase like protein, PSI, MCSG, PRK04182 class ME structural genomics, protein structure initiative; 2.20A {Eubacterium ventriosum} | Back alignment and structure |
|---|
| >2qmh_A HPR kinase/phosphorylase; V267F mutation, ATP-binding, carbohydrate metabolism, magnesium, metal-binding, multifunctional enzyme; 2.60A {Lactobacillus casei} PDB: 1jb1_A 1kkl_A 1kkm_A* | Back alignment and structure |
|---|
| >1qde_A EIF4A, translation initiation factor 4A; DEAD box protein family, gene regulation; 2.00A {Saccharomyces cerevisiae} SCOP: c.37.1.19 PDB: 1qva_A | Back alignment and structure |
|---|
| >1hv8_A Putative ATP-dependent RNA helicase MJ0669; RNA-binding protein, ATPase, RNA binding protein; 3.00A {Methanocaldococcus jannaschii} SCOP: c.37.1.19 c.37.1.19 | Back alignment and structure |
|---|
| >2axn_A 6-phosphofructo-2-kinase/fructose-2,6- biphosphatase 3 (6PF-2-K/FRU- 2,6-P2ASE brain/placenta-type...; bifunctional enzyme, EDTA complex; HET: F6P EDT ADP; 2.10A {Homo sapiens} PDB: 2dwo_A* 2dwp_A* 2i1v_B* 3qpu_A* 3qpv_A* 3qpw_A* | Back alignment and structure |
|---|
| >2j41_A Guanylate kinase; GMP, GMK, transferase, ATP-binding, nucleotide- binding; HET: 5GP; 1.9A {Staphylococcus aureus} | Back alignment and structure |
|---|
| >1sky_E F1-ATPase, F1-ATP synthase; F1FO ATP synthase, alpha3BETA3 SUBC F1-ATPase, hydrolase; 3.20A {Bacillus SP} SCOP: a.69.1.1 b.49.1.1 c.37.1.11 | Back alignment and structure |
|---|
| >1vec_A ATP-dependent RNA helicase P54; DEAD-box protein, RNA binding protein; HET: TLA; 2.01A {Homo sapiens} SCOP: c.37.1.19 | Back alignment and structure |
|---|
| >1w4r_A Thymidine kinase; type II, human, cytosolic, phosphorylation, transferase; HET: TTP; 1.83A {Homo sapiens} PDB: 1xbt_A* 2wvj_A* 2j87_A* | Back alignment and structure |
|---|
| >3eph_A TRNA isopentenyltransferase; transferase, alternative initiation, ATP-binding, cytoplasm, mitochondrion, nucleotide-binding, nucleus; 2.95A {Saccharomyces cerevisiae} PDB: 3epj_A 3epk_A* 3epl_A* | Back alignment and structure |
|---|
| >2oap_1 GSPE-2, type II secretion system protein; hexameric ATPase, hydrolase; HET: ANP; 2.95A {Archaeoglobus fulgidus} PDB: 2oaq_1 | Back alignment and structure |
|---|
| >3thx_B DNA mismatch repair protein MSH3; ABC family ATPase, mismatch recognition, mismatched unpaired DNA binding protein-DNA complex; HET: DNA ADP; 2.70A {Homo sapiens} PDB: 3thw_B* 3thy_B* 3thz_B* | Back alignment and structure |
|---|
| >2w58_A DNAI, primosome component (helicase loader); ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.50A {Geobacillus kaustophilus HTA426} | Back alignment and structure |
|---|
| >3b9q_A Chloroplast SRP receptor homolog, alpha subunit CPFTSY; protein translocation, GTP-binding, nucleotide-binding, protein transport; 1.75A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >3tau_A Guanylate kinase, GMP kinase; structural genomics, center for structural genomics of infec diseases, csgid, putative guanylate kinase; HET: MSE; 2.05A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >3asz_A Uridine kinase; cytidine phosphorylation, transferase; HET: C5P; 2.25A {Thermus thermophilus} PDB: 3asy_A* | Back alignment and structure |
|---|
| >1xx6_A Thymidine kinase; NESG, northeast structural genomics consortium, protein STRU initiative, PSI, structural genomics, DNA synthesis; HET: ADP; 2.00A {Clostridium acetobutylicum} SCOP: c.37.1.24 g.39.1.14 | Back alignment and structure |
|---|
| >1kgd_A CASK, peripheral plasma membrane CASK; maguk, guanylate kinase like domain, protein binding; 1.31A {Homo sapiens} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >3tr0_A Guanylate kinase, GMP kinase; purines, pyrimidines, nucleosides, nucleotides, transferase; HET: 5GP; 1.85A {Coxiella burnetii} | Back alignment and structure |
|---|
| >1tf7_A KAIC; homohexamer, hexamer, circadian clock protein; HET: ATP; 2.80A {Synechococcus SP} SCOP: c.37.1.11 c.37.1.11 PDB: 3s1a_A* 1u9i_A* 2gbl_A* 3dvl_A* 3k0a_A* 3k09_A* 3jzm_A* 3k0e_A* 4dug_A* 3ua2_A* 3k0c_A* 3k0f_A* | Back alignment and structure |
|---|
| >3n70_A Transport activator; sigma-54, ntpase, PSI, MCSG, structural genomics, center for structural genomics; 2.80A {Escherichia coli} | Back alignment and structure |
|---|
| >1rz3_A Hypothetical protein rbstp0775; MCSG, structural genomics, PSI, protein structure initiative; 1.90A {Geobacillus stearothermophilus} SCOP: c.37.1.6 | Back alignment and structure |
|---|
| >2xau_A PRE-mRNA-splicing factor ATP-dependent RNA helica; hydrolase, ribosome biogenesis, ATPase, ATP-binding, OB-fold; HET: ADP; 1.90A {Saccharomyces cerevisiae} PDB: 3kx2_B* | Back alignment and structure |
|---|
| >1nrj_B SR-beta, signal recognition particle receptor beta subunit; transmembrane, endoplasmic reticulum, GTP-binding; HET: GTP; 1.70A {Saccharomyces cerevisiae} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >2ffh_A Protein (FFH); SRP54, signal recognition particle, GTPase, M domain, RNA-binding, signal sequence-binding, helix-turn-helix, protein targeting; 3.20A {Thermus aquaticus} SCOP: a.24.13.1 a.36.1.1 c.37.1.10 PDB: 2iy3_A | Back alignment and structure |
|---|
| >1zu4_A FTSY; GTPase, signal recognition particle, SRP, receptor, protein transport; 1.95A {Mycoplasma mycoides} PDB: 1zu5_A | Back alignment and structure |
|---|
| >3thx_A DNA mismatch repair protein MSH2; ABC family ATPase, mismatch recognition, mismatched unpaired DNA binding protein-DNA complex; HET: DNA ADP; 2.70A {Homo sapiens} PDB: 2o8c_A* 2o8d_A* 2o8f_A* 3thw_A* 2o8b_A* 3thy_A* 3thz_A* 2o8e_A* | Back alignment and structure |
|---|
| >3c8u_A Fructokinase; YP_612366.1, putative fructose transport system kinase, STRU genomics, joint center for structural genomics, JCSG; 1.95A {Silicibacter SP} | Back alignment and structure |
|---|
| >2v3c_C SRP54, signal recognition 54 kDa protein; nucleotide-binding, signal recognition particle, GTP-binding, RNA-binding; 2.50A {Methanocaldococcus jannaschii} PDB: 3ndb_B | Back alignment and structure |
|---|
| >3e70_C DPA, signal recognition particle receptor; FTSY, SRP-GTPase, protein-targeting, transport protein; HET: GDP; 1.97A {Pyrococcus furiosus} PDB: 3dmd_B 3dm9_B* | Back alignment and structure |
|---|
| >2bjv_A PSP operon transcriptional activator; AAA, transcription activation, gene regulation, sigma54 activator, enhancer binding protein, PSPF; 1.7A {Escherichia coli} PDB: 2bjw_A 2c96_A* 2c98_A* 2c99_A* 2c9c_A* 2vii_A* | Back alignment and structure |
|---|
| >1t6n_A Probable ATP-dependent RNA helicase; RECA-like fold, PRE-mRNA processing protein; HET: FLC; 1.94A {Homo sapiens} SCOP: c.37.1.19 | Back alignment and structure |
|---|
| >1tf7_A KAIC; homohexamer, hexamer, circadian clock protein; HET: ATP; 2.80A {Synechococcus SP} SCOP: c.37.1.11 c.37.1.11 PDB: 3s1a_A* 1u9i_A* 2gbl_A* 3dvl_A* 3k0a_A* 3k09_A* 3jzm_A* 3k0e_A* 4dug_A* 3ua2_A* 3k0c_A* 3k0f_A* | Back alignment and structure |
|---|
| >2xxa_A Signal recognition particle protein; protein transport, RNA/RNA binding protein, hydrolase, gtpas; HET: GCP; 3.94A {Escherichia coli} PDB: 2j28_9 | Back alignment and structure |
|---|
| >3hdt_A Putative kinase; structura genomics, PSI-2, protein structure initiative, midwest CENT structural genomics, MCSG; 2.79A {Clostridium symbiosum atcc 14940} | Back alignment and structure |
|---|
| >1x6v_B Bifunctional 3'-phosphoadenosine 5'- phosphosulfate synthethase 1; transferase, ATP sulfurylase, APS kinase, PAPS; HET: ADP; 1.75A {Homo sapiens} SCOP: b.122.1.3 c.26.1.5 c.37.1.4 PDB: 1xjq_B* 1xnj_B* 2qjf_A* 2ofx_A* 2ofw_A* | Back alignment and structure |
|---|
| >3gmt_A Adenylate kinase; ssgcid, ATP-BIN cytoplasm, nucleotide biosynthesis, nucleotide-BIND transferase, structural genomics; 2.10A {Burkholderia pseudomallei 1710B} | Back alignment and structure |
|---|
| >2pl3_A Probable ATP-dependent RNA helicase DDX10; DEAD, structural genomics, structural genomic consortium, SGC, hydrolase; HET: ADP; 2.15A {Homo sapiens} | Back alignment and structure |
|---|
| >3lxx_A GTPase IMAP family member 4; structural genomics consortium, SGC, coiled coil, GTP- binding, nucleotide-binding, immune system; HET: GDP; 2.15A {Homo sapiens} | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* | Back alignment and structure |
|---|
| >1ls1_A Signal recognition particle protein; FFH, SRP54, SRP, GTPase, ultrahigh resolution, protein transport; 1.10A {Thermus aquaticus} SCOP: a.24.13.1 c.37.1.10 PDB: 1jpn_B* 1jpj_A* 1ry1_U* 2j45_A* 1o87_A* 2c04_A* 2j46_A* 1rj9_B* 2c03_A* 2j7p_A* 1okk_A* 2cnw_A* 1ng1_A* 2xkv_A 3ng1_A 1ffh_A 2ng1_A* | Back alignment and structure |
|---|
| >1lvg_A Guanylate kinase, GMP kinase; transferase; HET: ADP 5GP; 2.10A {Mus musculus} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >1gtv_A TMK, thymidylate kinase; transferase, transferase (ATP:TMP phosphotransferase); HET: TYD TMP; 1.55A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1g3u_A* 1gsi_A* 1mrn_A* 1mrs_A* 1n5i_A* 1n5j_A* 1n5k_A* 1n5l_A* 1w2g_A* 1w2h_A* | Back alignment and structure |
|---|
| >3tbk_A RIG-I helicase domain; DECH helicase, ATP binding, hydrolase; HET: ANP; 2.14A {Mus musculus} | Back alignment and structure |
|---|
| >4eaq_A DTMP kinase, thymidylate kinase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, MTBI, transferase; HET: ATM; 1.85A {Staphylococcus aureus subsp} PDB: 4dwj_A* 4f4i_A | Back alignment and structure |
|---|
| >3pey_A ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, ATPase, helicase, mRNA-export, nuclear pore, hydrolase-RNA complex; HET: ADP; 1.40A {Saccharomyces cerevisiae} PDB: 3pew_A* 3pex_A* 3pez_A* 3rrm_A* 3rrn_A* 2kbe_A 3gfp_A 2kbf_A 3pev_A* 3peu_A* | Back alignment and structure |
|---|
| >3iuy_A Probable ATP-dependent RNA helicase DDX53; REC-A-like, DEAD-BOX, structural genomics, structural genomi consortium, SGC, ATP-binding, hydrolase; HET: AMP; 2.40A {Homo sapiens} | Back alignment and structure |
|---|
| >2a9k_A RAS-related protein RAL-A; bacterial ADP-ribosyltransferase, RAL, RHO, GD binding; HET: GDP NAD; 1.73A {Homo sapiens} SCOP: c.37.1.8 PDB: 2a78_A* | Back alignment and structure |
|---|
| >2gza_A Type IV secretion system protein VIRB11; ATPase, hydrolase; 2.60A {Brucella suis} | Back alignment and structure |
|---|
| >2jeo_A Uridine-cytidine kinase 1; UCK, transferase, ATP-binding, nucleoside kinase, nucleotide-binding; 2.50A {Homo sapiens} PDB: 2uvq_A* | Back alignment and structure |
|---|
| >1a7j_A Phosphoribulokinase; transferase, calvin cycle; 2.50A {Rhodobacter sphaeroides} SCOP: c.37.1.6 | Back alignment and structure |
|---|
| >2zj8_A DNA helicase, putative SKI2-type helicase; RECA fold, ATP-binding, hydrolase, nucleotide- binding; 2.00A {Pyrococcus furiosus} PDB: 2zj5_A* 2zj2_A 2zja_A* | Back alignment and structure |
|---|
| >1htw_A HI0065; nucleotide-binding fold, structural genomics, structure 2 function project, S2F, unknown function; HET: ADP; 1.70A {Haemophilus influenzae} SCOP: c.37.1.18 PDB: 1fl9_A | Back alignment and structure |
|---|
| >1zd9_A ADP-ribosylation factor-like 10B; transport protein, GDP-binding, membrane trafficking, structural genomics, structural genomics consortium, SGC; HET: GDP; 1.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 2al7_A* 2h18_A* | Back alignment and structure |
|---|
| >1wb9_A DNA mismatch repair protein MUTS; DNA-binding, ATP-binding, DNA binding, DNA repair, mismatch recognition; HET: DNA ADP; 2.10A {Escherichia coli} SCOP: a.113.1.1 c.37.1.12 c.55.6.1 d.75.2.1 PDB: 1wbb_A* 1e3m_A* 1oh5_A* 1oh6_A* 1oh7_A* 1oh8_A* 1w7a_A* 2wtu_A* 1wbd_A* 1ng9_A* 3k0s_A* | Back alignment and structure |
|---|
| >1znw_A Guanylate kinase, GMP kinase; ATP:GMP-phosphotransferase, TR; 2.10A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1znx_A* 1zny_A* 1znz_A* 1s4q_A 1z8f_A | Back alignment and structure |
|---|
| >3ice_A Transcription termination factor RHO; transcription, ATPase, hexamer, helicase, RNA, RECA, OB fold ATP-binding, hydrolase; HET: MSE ADP SPD; 2.80A {Escherichia coli k-12} PDB: 1pv4_A 1pvo_A* 1xpo_A* 1xpr_A* 1xpu_A* 2ht1_A | Back alignment and structure |
|---|
| >3bor_A Human initiation factor 4A-II; translation initiation, DEAD BOX, structural genomics, helic binding, HOST-virus interaction, hydrolase; 1.85A {Homo sapiens} PDB: 2g9n_A* | Back alignment and structure |
|---|
| >1c9k_A COBU, adenosylcobinamide kinase; alpha/beta structure rossmann fold P-loop, transferase; HET: 5GP; 2.20A {Salmonella typhimurium} SCOP: c.37.1.11 PDB: 1cbu_A | Back alignment and structure |
|---|
| >1p5z_B DCK, deoxycytidine kinase; nucleoside kinase, P-loop, ARAC, cytarabine, transferase; HET: AR3 ADP; 1.60A {Homo sapiens} SCOP: c.37.1.1 PDB: 1p60_A* 1p61_B* 1p62_B* 2a7q_A* 2qrn_A* 2qro_A* 3exk_A* 3hp1_A* 2no7_A* 2no1_A* 2no6_A* 2no0_A* 2no9_A* 2noa_A* 2zi5_A* 2zi4_A* 2zi6_A* 2zi7_B* 2zia_A* 3kfx_A* ... | Back alignment and structure |
|---|
| >2oxc_A Probable ATP-dependent RNA helicase DDX20; DEAD, structural genomics, structural genomics consortium, SGC, hydrolase; HET: ADP; 1.30A {Homo sapiens} PDB: 3b7g_A* | Back alignment and structure |
|---|
| >2gj8_A MNME, tRNA modification GTPase TRME; G-domain dimer, alpha-beta-sandwich, hydrolase; HET: GDP; 1.70A {Escherichia coli BL21} SCOP: c.37.1.8 PDB: 2gj9_A* 2gja_A* 1rfl_A | Back alignment and structure |
|---|
| >1u8z_A RAS-related protein RAL-A; GNP, GTP, GMPPNP, GPPNHP, GDP, GTPase, signaling protein; HET: GDP; 1.50A {Saguinus oedipus} SCOP: c.37.1.8 PDB: 1u8y_A* 1u90_A* 1uad_A* 1zc3_A* 1zc4_A* 2kwi_A* 2ke5_A* | Back alignment and structure |
|---|
| >1r8s_A ADP-ribosylation factor 1; protein transport/exchange factor, protein transport-exchang complex; HET: GDP; 1.46A {Bos taurus} SCOP: c.37.1.8 PDB: 1re0_A* 1s9d_A* 1u81_A* 1r8q_A* 1rrf_A* 1rrg_A* 1hur_A* 1o3y_A* 1j2j_A* 2j59_A* 1mr3_F* 2k5u_A* 3lrp_A* 3tjz_A* 3rd1_A* 2ksq_A* 2a5d_A* 2a5f_A* 2j5x_A* 1e0s_A* ... | Back alignment and structure |
|---|
| >2j9r_A Thymidine kinase; TK1, DNK, lasso, transferase, ATP-binding, deoxyribonucleoside kinase, DNA synthesis, phosphate accept nucleotide-binding; HET: THM; 2.7A {Bacillus anthracis} PDB: 2ja1_A* | Back alignment and structure |
|---|
| >1wp9_A ATP-dependent RNA helicase, putative; ATPase, DNA replication, DNA repair, DNA recombina hydrolase; 2.90A {Pyrococcus furiosus} SCOP: c.37.1.19 c.37.1.19 | Back alignment and structure |
|---|
| >3fht_A ATP-dependent RNA helicase DDX19B; DBP5, DEAD-box helicase, RNA dependent ATPase, mRNA export, nucleocytoplasmic transport, NUP214, CAN; HET: ANP; 2.20A {Homo sapiens} PDB: 3ews_A* 3g0h_A* 3fhc_B | Back alignment and structure |
|---|
| >3p32_A Probable GTPase RV1496/MT1543; structural genomics, seattle structural genomics center for infectious disease, ssgcid, MEAB, MMAA; HET: GDP PGE; 1.90A {Mycobacterium tuberculosis} PDB: 3md0_A* 4gt1_A* 3nxs_A* 3tk1_A* | Back alignment and structure |
|---|
| >1z6g_A Guanylate kinase; structural genomics, SGC, structural genom consortium, transferase; HET: EPE; 2.18A {Plasmodium falciparum} | Back alignment and structure |
|---|
| >2bov_A RAla, RAS-related protein RAL-A; C3BOT, exoenzyme, RAla, GTPase, ribosylating toxin, GTP-binding, lipoprotein, prenylation; HET: GDP; 2.66A {Homo sapiens} | Back alignment and structure |
|---|
| >3tqf_A HPR(Ser) kinase; transferase, hydrolase; 2.80A {Coxiella burnetii} | Back alignment and structure |
|---|
| >3co5_A Putative two-component system transcriptional RES regulator; structural genomics, APC89341.1; 2.40A {Neisseria gonorrhoeae} | Back alignment and structure |
|---|
| >3k53_A Ferrous iron transport protein B; GTPase fold, helical bundle, G-protein, prokaryote, GTP-BIND nucleotide-binding, metal transport; 2.70A {Pyrococcus furiosus} | Back alignment and structure |
|---|
| >1ky3_A GTP-binding protein YPT7P; vesicular traffic, GTP hydrolysis, YPT/RAB protein, endocytosis, hydrolase, endocytosis/exocytosis complex; HET: GDP; 1.35A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 1ky2_A* | Back alignment and structure |
|---|
| >1odf_A YGR205W, hypothetical 33.3 kDa protein in ADE3-Ser2 intergenic region; yeast protein, ATP binding protein; 2.25A {Saccharomyces cerevisiae} SCOP: c.37.1.6 | Back alignment and structure |
|---|
| >3oiy_A Reverse gyrase helicase domain; topoisomerase, DNA supercoiling, archaea, isomeras; 2.35A {Thermotoga maritima} PDB: 3p4y_A 3p4x_A* | Back alignment and structure |
|---|
| >3h1t_A Type I site-specific restriction-modification system, R (restriction) subunit; hydrolase, restriction enzyme HSDR, ATP-binding; 2.30A {Vibrio vulnificus} | Back alignment and structure |
|---|
| >2ocp_A DGK, deoxyguanosine kinase; protein-nucleotide complex, transferase; HET: DTP; 2.80A {Homo sapiens} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >1wms_A RAB-9, RAB9, RAS-related protein RAB-9A; GTPase, protein transport; HET: GDP; 1.25A {Homo sapiens} SCOP: c.37.1.8 PDB: 1s8f_A* 1yzl_A* 2ocb_A* | Back alignment and structure |
|---|
| >1ewq_A DNA mismatch repair protein MUTS; multiple domains of protein, mostly mixed alpha-beta structures, one domain is entirely helical; HET: DNA; 2.20A {Thermus aquaticus} SCOP: a.113.1.1 c.37.1.12 c.55.6.1 d.75.2.1 PDB: 1nne_A* 1fw6_A* 1ewr_A* | Back alignment and structure |
|---|
| >1m8p_A Sulfate adenylyltransferase; rossmann fold, phosphosulfate binding, T-state; HET: PPS; 2.60A {Penicillium chrysogenum} SCOP: b.122.1.3 c.26.1.5 c.37.1.15 PDB: 1i2d_A* | Back alignment and structure |
|---|
| >2fwr_A DNA repair protein RAD25; DNA unwinding, XPB, DNA binding protein; HET: DNA; 2.60A {Archaeoglobus fulgidus} SCOP: c.37.1.19 c.37.1.19 PDB: 2fzl_A* | Back alignment and structure |
|---|
| >4edh_A DTMP kinase, thymidylate kinase; structural genomics, PSI-biology; HET: TMP ADP; 1.32A {Pseudomonas aeruginosa PAO1} PDB: 4e5u_A* 4esh_A* 4gmd_A* 3uwk_A* 3uwo_A* 3uxm_A* | Back alignment and structure |
|---|
| >3iby_A Ferrous iron transport protein B; G protein, G domain, iron uptake, cell inner membrane, cell GTP-binding, ION transport, membrane; 2.50A {Legionella pneumophila} | Back alignment and structure |
|---|
| >1s96_A Guanylate kinase, GMP kinase; E.coli, dimer, SAD, transferase; 2.00A {Escherichia coli} SCOP: c.37.1.1 PDB: 2an9_A* 2anb_A* 2anc_A 2f3r_A* 2f3t_A* | Back alignment and structure |
|---|
| >2j0s_A ATP-dependent RNA helicase DDX48; mRNA processing, phosphorylation, rRNA processing, mRNA splicing, mRNA transport; HET: ANP; 2.21A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 2j0q_A* 2hyi_C* 3ex7_C* 2xb2_A* 2hxy_A 2j0u_A 2j0u_B 2zu6_A | Back alignment and structure |
|---|
| >3pqc_A Probable GTP-binding protein ENGB; rossmann fold, GTPase, cell cycle, hydrolase; HET: GDP; 1.90A {Thermotoga maritima} PDB: 3pr1_A | Back alignment and structure |
|---|
| >2wjg_A FEOB, ferrous iron transport protein B homolog; membrane G-proteins, cell membrane, ION transport, transmembrane; HET: GDP; 2.20A {Methanocaldococcus jannaschii} | Back alignment and structure |
|---|
| >1xjc_A MOBB protein homolog; structural genomics, midwest center for structural GEN PSI, protein structure initiative, MCSG; 2.10A {Geobacillus stearothermophilus} SCOP: c.37.1.10 | Back alignment and structure |
|---|
| >3fe2_A Probable ATP-dependent RNA helicase DDX5; DEAD, ADP, ATP-binding, hydrolase, nucleotide- RNA-binding, methylation, mRNA processing, mRNA S nucleus; HET: ADP; 2.60A {Homo sapiens} PDB: 4a4d_A | Back alignment and structure |
|---|
| >2v9p_A Replication protein E1; AAA+ molecular motor, DNA replication, DNA translocation, nucleotide-binding, DNA-binding; 3.00A {Bovine papillomavirus type 1} PDB: 2gxa_A* | Back alignment and structure |
|---|
| >1bif_A 6-phosphofructo-2-kinase/ fructose-2,6-bisphospha; transferase (phospho), phosphatase, hydrolase (phosp glycolysis, bifunctional enzyme; HET: AGS; 2.00A {Rattus norvegicus} SCOP: c.37.1.7 c.60.1.4 PDB: 3bif_A* 2bif_A* 1k6m_A* 1c80_A* 1c7z_A* 1c81_A* 1tip_A* 1fbt_A | Back alignment and structure |
|---|
| >2og2_A Putative signal recognition particle receptor; nucleotide-binding, protein transport; 2.00A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >1fzq_A ADP-ribosylation factor-like protein 3; protein-GDP complex without magnesium, ARF family, RAS superfamily, G-domain, signaling protein; HET: MES GDP; 1.70A {Mus musculus} SCOP: c.37.1.8 PDB: 3bh7_A* 3bh6_A* | Back alignment and structure |
|---|
| >2v6i_A RNA helicase; membrane, hydrolase, transmembrane, RNA replication, viral replication, nucleotide-binding; 2.10A {Kokobera virus} PDB: 2v6j_A | Back alignment and structure |
|---|
| >3def_A T7I23.11 protein; chloroplast, TOC33, GTPase, hydrolase; HET: GDP; 1.96A {Arabidopsis thaliana} PDB: 3bb3_A* 3bb4_A* 2j3e_A* | Back alignment and structure |
|---|
| >3ly5_A ATP-dependent RNA helicase DDX18; alpha-beta, structural genomics, structural genomics consort ATP-binding, hydrolase, nucleotide-binding, RNA-B; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >3lnc_A Guanylate kinase, GMP kinase; ALS collaborative crystallography, emerald biostructures, ATP-binding, cytoplasm, nucleotide-binding; HET: 5GP; 1.95A {Anaplasma phagocytophilum} | Back alignment and structure |
|---|
| >2qm8_A GTPase/ATPase; G protein, G3E, metallochaperone, chaperone; HET: MSE; 1.70A {Methylobacterium extorquens} SCOP: c.37.1.10 PDB: 2qm7_A* | Back alignment and structure |
|---|
| >1sq5_A Pantothenate kinase; P-loop, transferase; HET: PAU ADP; 2.20A {Escherichia coli} SCOP: c.37.1.6 PDB: 1esm_A* 1esn_A* | Back alignment and structure |
|---|
| >3ber_A Probable ATP-dependent RNA helicase DDX47; DEAD, AMP, structural genomics, structural GEN consortium, SGC, ATP-binding, hydrolase; HET: AMP PGE; 1.40A {Homo sapiens} | Back alignment and structure |
|---|
| >3dkp_A Probable ATP-dependent RNA helicase DDX52; DEAD, ADP, structural genomics, structural GEN consortium, SGC, rRNA, ATP-binding, hydrolase; HET: ADP; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >1z06_A RAS-related protein RAB-33B; RAB GTPase, RAB33B GTPase, vesicular trafficking, protein transport; HET: GNP; 1.81A {Mus musculus} SCOP: c.37.1.8 PDB: 2g77_B* | Back alignment and structure |
|---|
| >3kta_A Chromosome segregation protein SMC; structural maintenance of chromosomes, ABC ATPase, CFTR adenylate kinase, AP5A, transferase; HET: AP5; 1.63A {Pyrococcus furiosus} PDB: 1xex_A* 1xew_X* | Back alignment and structure |
|---|
| >2va8_A SSO2462, SKI2-type helicase; hydrolase, DNA repair, ATP-bindin nucleotide-binding; 2.30A {Sulfolobus solfataricus} | Back alignment and structure |
|---|
| >3dz8_A RAS-related protein RAB-3B; GDP, GTPase, structural genomics consortium, SGC, cell GTP-binding, lipoprotein, membrane, methylation; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >2wji_A Ferrous iron transport protein B homolog; membrane G-proteins, cell membrane, ION transport, transmembrane; HET: GNP; 1.90A {Methanocaldococcus jannaschii} PDB: 2wjj_A* 2wjh_A* | Back alignment and structure |
|---|
| >1xti_A Probable ATP-dependent RNA helicase P47; alpha-beta fold, gene regulation; 1.95A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 1xtj_A* 1xtk_A | Back alignment and structure |
|---|
| >3vkw_A Replicase large subunit; alpha/beta domain, helicase, transferase; 1.90A {Tomato mosaic virus} | Back alignment and structure |
|---|
| >1rj9_A FTSY, signal recognition protein; SRP-GTPase domain, heterodimer, nucleotide twinning, protein complex, protein transport; HET: GCP; 1.90A {Thermus aquaticus} SCOP: a.24.13.1 c.37.1.10 PDB: 2q9c_A* 2q9b_A* 2q9a_A* 1okk_D* 2xkv_D 2iyl_D* 2cnw_D* 2j7p_D* | Back alignment and structure |
|---|
| >3aez_A Pantothenate kinase; transferase, homodimer, COA biosynthesis, nucleotide binding binding, cytoplasm, nucleotide-binding; HET: GDP PAZ; 2.20A {Mycobacterium tuberculosis} PDB: 2ges_A* 2geu_A* 2gev_A* 2zs7_A* 2zs8_A* 2zs9_A* 2zsa_A* 2zsb_A* 2zsd_A* 2zse_A* 2zsf_A* 2get_A* 3af0_A* 3af1_A* 3af2_A* 3af3_A* 3af4_A* 3avp_A* 3avo_A* 3avq_A* | Back alignment and structure |
|---|
| >3eiq_A Eukaryotic initiation factor 4A-I; PDCD4, anti-oncogene, apoptosis, cell cycle, nucleus, phosph RNA-binding, ATP-binding, helicase, hydrolase; 3.50A {Homo sapiens} | Back alignment and structure |
|---|
| >2gk6_A Regulator of nonsense transcripts 1; UPF1, helicase, NMD, hydrolase; HET: ADP; 2.40A {Homo sapiens} PDB: 2gjk_A* 2gk7_A 2xzo_A* 2xzp_A | Back alignment and structure |
|---|
| >2qgz_A Helicase loader, putative primosome component; structural genomics, PSI-2, protein structure initiative; 2.40A {Streptococcus pyogenes serotype M3} | Back alignment and structure |
|---|
| >2o8b_B DNA mismatch repair protein MSH6; DNA damage response, somatic hypermutat protein-DNA complex, DNA mispair, cancer; HET: DNA ADP; 2.75A {Homo sapiens} PDB: 2o8c_B* 2o8d_B* 2o8e_B* 2o8f_B* | Back alignment and structure |
|---|
| >3tqc_A Pantothenate kinase; biosynthesis of cofactors, prosthetic groups, carriers, TRAN; HET: ADP; 2.30A {Coxiella burnetii} | Back alignment and structure |
|---|
| >4i1u_A Dephospho-COA kinase; structural genomics, niaid, national institute of allergy AN infectious diseases; 2.05A {Burkholderia vietnamiensis} PDB: 4i1v_A* | Back alignment and structure |
|---|
| >3ec2_A DNA replication protein DNAC; helicase loader, replication initiation factor, ATP-binding, nucleotide-binding; HET: DNA ADP; 2.70A {Aquifex aeolicus} PDB: 3ecc_A* | Back alignment and structure |
|---|
| >3v9p_A DTMP kinase, thymidylate kinase; ssgcid, STRU genomics, seattle structural genomics center for infectious transferase; 1.90A {Burkholderia thailandensis} | Back alignment and structure |
|---|
| >1g8f_A Sulfate adenylyltransferase; alpha-beta protein, beta-barrel, rossmann-fold, kinase fold; 1.95A {Saccharomyces cerevisiae} SCOP: b.122.1.3 c.26.1.5 c.37.1.15 PDB: 1g8g_A* 1g8h_A* 1j70_A 1jec_A 1jed_A* 1jee_A* | Back alignment and structure |
|---|
| >2dyk_A GTP-binding protein; GTPase, ribosome-binding protein, structural genomics; HET: GDP; 1.96A {Thermus thermophilus} | Back alignment and structure |
|---|
| >3crm_A TRNA delta(2)-isopentenylpyrophosphate transferase; ATP-binding, nucleotide-binding, nucleotidyltransferase, tRNA processing; 1.90A {Pseudomonas aeruginosa} PDB: 3crq_A 3crr_A | Back alignment and structure |
|---|
| >1qhx_A CPT, protein (chloramphenicol phosphotransferase); kinase, antibiotic resistance, phosphorylation, mononucleoti binding fold; HET: ATP; 2.50A {Streptomyces venezuelae} SCOP: c.37.1.3 PDB: 1grr_A* 1grq_A 1qhs_A* 1qhn_A* 1qhy_A* | Back alignment and structure |
|---|
| >2qtf_A Protein HFLX, GTP-binding protein; beta-alpha-barrels, nucleotide-binding, nucleotide binding protein; 2.00A {Sulfolobus solfataricus P2} PDB: 2qth_A* 3kxi_A* 3kxl_A 3kxk_A | Back alignment and structure |
|---|
| >3trf_A Shikimate kinase, SK; amino acid biosynthesis, transferase; 2.60A {Coxiella burnetii} | Back alignment and structure |
|---|
| >2e87_A Hypothetical protein PH1320; GTP-binding, GTPase, OBG, bundle, GDP, complex, structural G NPPSFA; HET: GDP; 2.35A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >4a2p_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.00A {Anas platyrhynchos} PDB: 4a36_A* | Back alignment and structure |
|---|
| >3b85_A Phosphate starvation-inducible protein; PHOH2, ATPase, PFAM: PF02562, ST genomics, PSI-2, protein structure initiative; 2.35A {Corynebacterium glutamicum atcc 13032} | Back alignment and structure |
|---|
| >1np6_A Molybdopterin-guanine dinucleotide biosynthesis protein B; mixed alpha-beta fold, elongated beta-sheet, walker A motif, P-loop structural motif; 1.90A {Escherichia coli} SCOP: c.37.1.10 PDB: 1p9n_A | Back alignment and structure |
|---|
| >2f7s_A C25KG, RAS-related protein RAB-27B; G-protein, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GDP; 2.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 2iez_A* | Back alignment and structure |
|---|
| >2cbz_A Multidrug resistance-associated protein 1; ABC proteins, MRP1/ABCC1, nucleotide-binding domain, ATP- binding, hydrolysis, transport; HET: ATP; 1.5A {Homo sapiens} | Back alignment and structure |
|---|
| >3a1s_A Iron(II) transport protein B; FEOB, iron transporter, small GTPase, G protein, GDI; HET: GDP; 1.50A {Thermotoga maritima} PDB: 3a1t_A* 3a1u_A* 3a1v_A* 3a1w_A | Back alignment and structure |
|---|
| >3tif_A Uncharacterized ABC transporter ATP-binding prote; nucleotide-binding domain, ABC transporter ATPase; HET: ADP; 1.80A {Methanocaldococcus jannaschii dsm 2661ORGANISM_TAXID} PDB: 1l2t_A* 1f3o_A* | Back alignment and structure |
|---|
| >1fuu_A Yeast initiation factor 4A; IF4A, helicase, DEAD-box protein, translation; 2.50A {Saccharomyces cerevisiae} SCOP: c.37.1.19 PDB: 2vso_A* 2vsx_A* | Back alignment and structure |
|---|
| >1upt_A ARL1, ADP-ribosylation factor-like protein 1; hydrolase/protein-binding, complex (GTPase/golgin), golgin-245, GRIP, golgin, GTPase, G-protein; HET: GTP; 1.7A {Homo sapiens} SCOP: c.37.1.8 PDB: 1r4a_A* | Back alignment and structure |
|---|
| >2fh5_B SR-beta, signal recognition particle receptor beta subunit; endomembrane targeting, GTPase, GAP, longin domain, SEDL, transport protein; HET: GTP; 2.45A {Mus musculus} SCOP: c.37.1.8 PDB: 2go5_2 | Back alignment and structure |
|---|
| >1q0u_A Bstdead; DEAD protein, RNA binding protein; 1.85A {Geobacillus stearothermophilus} SCOP: c.37.1.19 | Back alignment and structure |
|---|
| >2wsm_A Hydrogenase expression/formation protein (HYPB); metal binding protein; 2.30A {Archaeoglobus fulgidus} | Back alignment and structure |
|---|
| >2onk_A Molybdate/tungstate ABC transporter, ATP-binding protein; membrane protein; 3.10A {Archaeoglobus fulgidus} SCOP: c.37.1.12 | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 1116 | ||||
| d1lv7a_ | 256 | c.37.1.20 (A:) AAA domain of cell division protein | 4e-56 | |
| d1ixza_ | 247 | c.37.1.20 (A:) AAA domain of cell division protein | 6e-54 | |
| d1r7ra3 | 265 | c.37.1.20 (A:471-735) Membrane fusion ATPase VCP/p | 5e-46 | |
| d1e32a2 | 258 | c.37.1.20 (A:201-458) Membrane fusion ATPase VCP/p | 5e-37 | |
| d1w44a_ | 321 | c.37.1.11 (A:) NTPase P4 {Bacteriophage phi-12 [Ta | 1e-33 | |
| d1gvnb_ | 273 | c.37.1.21 (B:) Plasmid maintenance system epsilon/ | 7e-20 | |
| d1d2na_ | 246 | c.37.1.20 (A:) Hexamerization domain of N-ethylmal | 2e-19 | |
| d1svma_ | 362 | c.37.1.20 (A:) Papillomavirus large T antigen heli | 5e-18 | |
| d1ofha_ | 309 | c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId | 8e-18 | |
| d1gxca_ | 116 | b.26.1.2 (A:) Chk2 kinase {Human (Homo sapiens) [T | 2e-17 | |
| d1ixsb2 | 239 | c.37.1.20 (B:4-242) Holliday junction helicase Ruv | 1e-13 | |
| d1in4a2 | 238 | c.37.1.20 (A:17-254) Holliday junction helicase Ru | 2e-11 | |
| d1lgpa_ | 113 | b.26.1.2 (A:) Cell cycle checkpoint protein Chfr { | 4e-10 | |
| d1sxja2 | 253 | c.37.1.20 (A:295-547) Replication factor C1 {Baker | 3e-09 | |
| d1fnna2 | 276 | c.37.1.20 (A:1-276) CDC6, N-domain {Archaeon Pyrob | 3e-08 | |
| d1dmza_ | 158 | b.26.1.2 (A:) Phosphotyrosine binding domain of Ra | 4e-07 | |
| d1g41a_ | 443 | c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId | 1e-06 | |
| d2affa1 | 98 | b.26.1.2 (A:3-100) Antigen ki-67 {Human (Homo sapi | 2e-06 | |
| d1lw7a2 | 192 | c.37.1.1 (A:220-411) Transcriptional regulator Nad | 9e-06 | |
| d1viaa_ | 161 | c.37.1.2 (A:) Shikimate kinase (AroK) {Campylobact | 2e-05 | |
| d1uhta_ | 118 | b.26.1.2 (A:) FHA domain containing protein At4G14 | 2e-05 | |
| d1sxje2 | 252 | c.37.1.20 (E:4-255) Replication factor C5 {Baker's | 7e-05 | |
| d1g8pa_ | 333 | c.37.1.20 (A:) ATPase subunit of magnesium chelata | 1e-04 | |
| d2ff4a3 | 99 | b.26.1.2 (A:284-382) Probable regulatory protein E | 1e-04 | |
| d1ny5a2 | 247 | c.37.1.20 (A:138-384) Transcriptional activator si | 1e-04 | |
| d1mzka_ | 122 | b.26.1.2 (A:) Kinase associated protein phosphatas | 1e-04 | |
| d1w5sa2 | 287 | c.37.1.20 (A:7-293) CDC6-like protein APE0152, N-t | 2e-04 | |
| d1qf9a_ | 194 | c.37.1.1 (A:) UMP/CMP kinase {Dictyostelium discoi | 2e-04 | |
| d2piea1 | 127 | b.26.1.2 (A:13-139) Ubiquitin ligase protein RNF8 | 3e-04 | |
| d1zp6a1 | 176 | c.37.1.25 (A:6-181) Hypothetical protein Atu3015 { | 3e-04 | |
| d1g6ga_ | 127 | b.26.1.2 (A:) Phosphotyrosine binding domain of Ra | 4e-04 | |
| d1r6bx2 | 268 | c.37.1.20 (X:169-436) ClpA, an Hsp100 chaperone, A | 6e-04 | |
| d1kaga_ | 169 | c.37.1.2 (A:) Shikimate kinase (AroK) {Escherichia | 6e-04 | |
| d1rkba_ | 173 | c.37.1.1 (A:) Adenylate kinase {Human (Homo sapien | 9e-04 | |
| d3adka_ | 194 | c.37.1.1 (A:) Adenylate kinase {Pig (Sus scrofa) [ | 0.001 | |
| d1qhxa_ | 178 | c.37.1.3 (A:) Chloramphenicol phosphotransferase { | 0.001 | |
| d1e6ca_ | 170 | c.37.1.2 (A:) Shikimate kinase (AroK) {Erwinia chr | 0.001 | |
| d2bdta1 | 176 | c.37.1.25 (A:1-176) Hypothetical protein BH3686 {B | 0.002 | |
| d1ly1a_ | 152 | c.37.1.1 (A:) Polynucleotide kinase, kinase domain | 0.002 | |
| d1zaka1 | 189 | c.37.1.1 (A:3-127,A:159-222) Adenylate kinase {Mai | 0.003 | |
| d2fnaa2 | 283 | c.37.1.20 (A:1-283) Archaeal ATPase SSO1545 {Sulfo | 0.003 | |
| d1yj5a2 | 172 | c.37.1.1 (A:351-522) 5' polynucleotide kinase-3' p | 0.004 | |
| d1um8a_ | 364 | c.37.1.20 (A:) ClpX {Helicobacter pylori [TaxId: 2 | 0.004 | |
| d1y63a_ | 174 | c.37.1.1 (A:) Probable kinase LmjF30.1890 {Leishma | 0.004 |
| >d1lv7a_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Escherichia coli [TaxId: 562]} Length = 256 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: P-loop containing nucleoside triphosphate hydrolases superfamily: P-loop containing nucleoside triphosphate hydrolases family: Extended AAA-ATPase domain domain: AAA domain of cell division protein FtsH species: Escherichia coli [TaxId: 562]
Score = 193 bits (491), Expect = 4e-56
Identities = 68/180 (37%), Positives = 100/180 (55%), Gaps = 8/180 (4%)
Query: 938 VIPPSDIGVTFDDIGALENVKDTLKELVMLPLQRPELFCKGQLTKPCKGILLFGPPGTGK 997
++ I TF D+ + K+ + ELV L+ P F K P KG+L+ GPPGTGK
Sbjct: 1 MLTEDQIKTTFADVAGCDEAKEEVAELVEY-LREPSRFQKLGGKIP-KGVLMVGPPGTGK 58
Query: 998 TMLAKAVATEAGANFINISMSSITSKWFGEGEKYVKAVFSLASKIAPSVVFVDEVDSMLG 1057
T+LAKA+A EA F IS S + G G V+ +F A K AP ++F+DE+D++
Sbjct: 59 TLLAKAIAGEAKVPFFTISGSDFVEMFVGVGASRVRDMFEQAKKAAPCIIFIDEIDAVGR 118
Query: 1058 RRENP--GEHEAMRKMKNEFMVNWDGLRTKDKERVLVLAATNRPFDLDEAVVR--RLPRR 1113
+R G H+ + N+ +V DG + E ++V+AATNRP LD A++R R R+
Sbjct: 119 QRGAGLGGGHDEREQTLNQMLVEMDGF--EGNEGIIVIAATNRPDVLDPALLRPGRFDRQ 176
|
| >d1ixza_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Thermus thermophilus [TaxId: 274]} Length = 247 | Back information, alignment and structure |
|---|
| >d1r7ra3 c.37.1.20 (A:471-735) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Length = 265 | Back information, alignment and structure |
|---|
| >d1e32a2 c.37.1.20 (A:201-458) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Length = 258 | Back information, alignment and structure |
|---|
| >d1w44a_ c.37.1.11 (A:) NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} Length = 321 | Back information, alignment and structure |
|---|
| >d1gvnb_ c.37.1.21 (B:) Plasmid maintenance system epsilon/zeta, toxin zeta subunit {Streptococcus pyogenes [TaxId: 1314]} Length = 273 | Back information, alignment and structure |
|---|
| >d1d2na_ c.37.1.20 (A:) Hexamerization domain of N-ethylmalemide-sensitive fusion (NSF) protein {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Length = 246 | Back information, alignment and structure |
|---|
| >d1svma_ c.37.1.20 (A:) Papillomavirus large T antigen helicase domain {Simian virus 40 [TaxId: 10633]} Length = 362 | Back information, alignment and structure |
|---|
| >d1ofha_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Length = 309 | Back information, alignment and structure |
|---|
| >d1gxca_ b.26.1.2 (A:) Chk2 kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 116 | Back information, alignment and structure |
|---|
| >d1ixsb2 c.37.1.20 (B:4-242) Holliday junction helicase RuvB {Thermus thermophilus [TaxId: 274]} Length = 239 | Back information, alignment and structure |
|---|
| >d1in4a2 c.37.1.20 (A:17-254) Holliday junction helicase RuvB {Thermotoga maritima [TaxId: 2336]} Length = 238 | Back information, alignment and structure |
|---|
| >d1lgpa_ b.26.1.2 (A:) Cell cycle checkpoint protein Chfr {Human (Homo sapiens) [TaxId: 9606]} Length = 113 | Back information, alignment and structure |
|---|
| >d1sxja2 c.37.1.20 (A:295-547) Replication factor C1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 253 | Back information, alignment and structure |
|---|
| >d1fnna2 c.37.1.20 (A:1-276) CDC6, N-domain {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Length = 276 | Back information, alignment and structure |
|---|
| >d1dmza_ b.26.1.2 (A:) Phosphotyrosine binding domain of Rad53 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 158 | Back information, alignment and structure |
|---|
| >d1g41a_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Length = 443 | Back information, alignment and structure |
|---|
| >d2affa1 b.26.1.2 (A:3-100) Antigen ki-67 {Human (Homo sapiens) [TaxId: 9606]} Length = 98 | Back information, alignment and structure |
|---|
| >d1lw7a2 c.37.1.1 (A:220-411) Transcriptional regulator NadR, ribosylnicotinamide kinase domain {Haemophilus influenzae [TaxId: 727]} Length = 192 | Back information, alignment and structure |
|---|
| >d1viaa_ c.37.1.2 (A:) Shikimate kinase (AroK) {Campylobacter jejuni [TaxId: 197]} Length = 161 | Back information, alignment and structure |
|---|
| >d1uhta_ b.26.1.2 (A:) FHA domain containing protein At4G14490 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 118 | Back information, alignment and structure |
|---|
| >d1sxje2 c.37.1.20 (E:4-255) Replication factor C5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 252 | Back information, alignment and structure |
|---|
| >d1g8pa_ c.37.1.20 (A:) ATPase subunit of magnesium chelatase, BchI {Rhodobacter capsulatus [TaxId: 1061]} Length = 333 | Back information, alignment and structure |
|---|
| >d2ff4a3 b.26.1.2 (A:284-382) Probable regulatory protein EmbR, C-terminal domain {Mycobacterium tuberculosis [TaxId: 1773]} Length = 99 | Back information, alignment and structure |
|---|
| >d1ny5a2 c.37.1.20 (A:138-384) Transcriptional activator sigm54 (NtrC1), C-terminal domain {Aquifex aeolicus [TaxId: 63363]} Length = 247 | Back information, alignment and structure |
|---|
| >d1mzka_ b.26.1.2 (A:) Kinase associated protein phosphatase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 122 | Back information, alignment and structure |
|---|
| >d1w5sa2 c.37.1.20 (A:7-293) CDC6-like protein APE0152, N-terminal domain {Aeropyrum pernix [TaxId: 56636]} Length = 287 | Back information, alignment and structure |
|---|
| >d1qf9a_ c.37.1.1 (A:) UMP/CMP kinase {Dictyostelium discoideum [TaxId: 44689]} Length = 194 | Back information, alignment and structure |
|---|
| >d2piea1 b.26.1.2 (A:13-139) Ubiquitin ligase protein RNF8 {Human (Homo sapiens) [TaxId: 9606]} Length = 127 | Back information, alignment and structure |
|---|
| >d1zp6a1 c.37.1.25 (A:6-181) Hypothetical protein Atu3015 {Agrobacterium tumefaciens [TaxId: 358]} Length = 176 | Back information, alignment and structure |
|---|
| >d1g6ga_ b.26.1.2 (A:) Phosphotyrosine binding domain of Rad53 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 127 | Back information, alignment and structure |
|---|
| >d1r6bx2 c.37.1.20 (X:169-436) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} Length = 268 | Back information, alignment and structure |
|---|
| >d1kaga_ c.37.1.2 (A:) Shikimate kinase (AroK) {Escherichia coli [TaxId: 562]} Length = 169 | Back information, alignment and structure |
|---|
| >d1rkba_ c.37.1.1 (A:) Adenylate kinase {Human (Homo sapiens), isoenzyme 6 [TaxId: 9606]} Length = 173 | Back information, alignment and structure |
|---|
| >d3adka_ c.37.1.1 (A:) Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} Length = 194 | Back information, alignment and structure |
|---|
| >d1qhxa_ c.37.1.3 (A:) Chloramphenicol phosphotransferase {Streptomyces venezuelae [TaxId: 54571]} Length = 178 | Back information, alignment and structure |
|---|
| >d1e6ca_ c.37.1.2 (A:) Shikimate kinase (AroK) {Erwinia chrysanthemi [TaxId: 556]} Length = 170 | Back information, alignment and structure |
|---|
| >d2bdta1 c.37.1.25 (A:1-176) Hypothetical protein BH3686 {Bacillus halodurans [TaxId: 86665]} Length = 176 | Back information, alignment and structure |
|---|
| >d1ly1a_ c.37.1.1 (A:) Polynucleotide kinase, kinase domain {Bacteriophage T4 [TaxId: 10665]} Length = 152 | Back information, alignment and structure |
|---|
| >d1zaka1 c.37.1.1 (A:3-127,A:159-222) Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} Length = 189 | Back information, alignment and structure |
|---|
| >d2fnaa2 c.37.1.20 (A:1-283) Archaeal ATPase SSO1545 {Sulfolobus solfataricus [TaxId: 2287]} Length = 283 | Back information, alignment and structure |
|---|
| >d1yj5a2 c.37.1.1 (A:351-522) 5' polynucleotide kinase-3' phosphatase, C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 172 | Back information, alignment and structure |
|---|
| >d1um8a_ c.37.1.20 (A:) ClpX {Helicobacter pylori [TaxId: 210]} Length = 364 | Back information, alignment and structure |
|---|
| >d1y63a_ c.37.1.1 (A:) Probable kinase LmjF30.1890 {Leishmania major [TaxId: 5664]} Length = 174 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 1116 | |||
| d1lv7a_ | 256 | AAA domain of cell division protein FtsH {Escheric | 99.96 | |
| d1ixza_ | 247 | AAA domain of cell division protein FtsH {Thermus | 99.95 | |
| d1e32a2 | 258 | Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu | 99.94 | |
| d1r7ra3 | 265 | Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu | 99.93 | |
| d1gxca_ | 116 | Chk2 kinase {Human (Homo sapiens) [TaxId: 9606]} | 99.85 | |
| d1d2na_ | 246 | Hexamerization domain of N-ethylmalemide-sensitive | 99.85 | |
| d1w44a_ | 321 | NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} | 99.84 | |
| d1lv7a_ | 256 | AAA domain of cell division protein FtsH {Escheric | 99.83 | |
| d1ofha_ | 309 | HslU {Haemophilus influenzae [TaxId: 727]} | 99.82 | |
| d1ixza_ | 247 | AAA domain of cell division protein FtsH {Thermus | 99.8 | |
| d1e32a2 | 258 | Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu | 99.78 | |
| d1lgpa_ | 113 | Cell cycle checkpoint protein Chfr {Human (Homo sa | 99.75 | |
| d1r7ra3 | 265 | Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu | 99.7 | |
| d1in4a2 | 238 | Holliday junction helicase RuvB {Thermotoga mariti | 99.56 | |
| d1ixsb2 | 239 | Holliday junction helicase RuvB {Thermus thermophi | 99.48 | |
| d1iqpa2 | 231 | Replication factor C {Archaeon Pyrococcus furiosus | 99.36 | |
| d1g6ga_ | 127 | Phosphotyrosine binding domain of Rad53 {Baker's y | 99.33 | |
| d1dmza_ | 158 | Phosphotyrosine binding domain of Rad53 {Baker's y | 99.3 | |
| d1r6bx2 | 268 | ClpA, an Hsp100 chaperone, AAA+ modules {Escherich | 99.28 | |
| d1sxjc2 | 227 | Replication factor C3 {Baker's yeast (Saccharomyce | 99.27 | |
| d1jbka_ | 195 | ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} | 99.26 | |
| d2brfa1 | 101 | Polynucleotide kinase 3'-phosphatase {Human (Homo | 99.25 | |
| d1njfa_ | 239 | delta prime subunit of DNA polymerase III, N-domai | 99.25 | |
| d1sxja2 | 253 | Replication factor C1 {Baker's yeast (Saccharomyce | 99.22 | |
| d2piea1 | 127 | Ubiquitin ligase protein RNF8 {Human (Homo sapiens | 99.21 | |
| d1r6bx3 | 315 | ClpA, an Hsp100 chaperone, AAA+ modules {Escherich | 99.19 | |
| d1sxje2 | 252 | Replication factor C5 {Baker's yeast (Saccharomyce | 99.17 | |
| d2ff4a3 | 99 | Probable regulatory protein EmbR, C-terminal domai | 99.17 | |
| d1w44a_ | 321 | NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} | 99.13 | |
| d1qvra3 | 315 | ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 | 99.13 | |
| d1g8pa_ | 333 | ATPase subunit of magnesium chelatase, BchI {Rhodo | 99.12 | |
| d1sxjb2 | 224 | Replication factor C4 {Baker's yeast (Saccharomyce | 99.11 | |
| d1um8a_ | 364 | ClpX {Helicobacter pylori [TaxId: 210]} | 99.09 | |
| d1d2na_ | 246 | Hexamerization domain of N-ethylmalemide-sensitive | 99.09 | |
| d1sxjd2 | 237 | Replication factor C2 {Baker's yeast (Saccharomyce | 99.06 | |
| d2affa1 | 98 | Antigen ki-67 {Human (Homo sapiens) [TaxId: 9606]} | 99.04 | |
| d1uhta_ | 118 | FHA domain containing protein At4G14490 {Thale cre | 99.04 | |
| d1qvra2 | 387 | ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 | 99.0 | |
| d1g41a_ | 443 | HslU {Haemophilus influenzae [TaxId: 727]} | 98.98 | |
| d1ofha_ | 309 | HslU {Haemophilus influenzae [TaxId: 727]} | 98.96 | |
| d1mzka_ | 122 | Kinase associated protein phosphatase {Thale cress | 98.94 | |
| d2g1la1 | 102 | Kinesin-like protein kif1c {Human (Homo sapiens) [ | 98.9 | |
| d1a5ta2 | 207 | delta prime subunit of DNA polymerase III, N-domai | 98.89 | |
| d1l8qa2 | 213 | Chromosomal replication initiation factor DnaA {Aq | 98.86 | |
| d1fnna2 | 276 | CDC6, N-domain {Archaeon Pyrobaculum aerophilum [T | 98.85 | |
| d1svma_ | 362 | Papillomavirus large T antigen helicase domain {Si | 98.81 | |
| d1r6bx2 | 268 | ClpA, an Hsp100 chaperone, AAA+ modules {Escherich | 98.74 | |
| d1w5sa2 | 287 | CDC6-like protein APE0152, N-terminal domain {Aero | 98.73 | |
| d1gvnb_ | 273 | Plasmid maintenance system epsilon/zeta, toxin zet | 98.68 | |
| d1wlna1 | 107 | Afadin {Mouse (Mus musculus) [TaxId: 10090]} | 98.57 | |
| d2gnoa2 | 198 | gamma subunit of DNA polymerase III, N-domain {The | 98.54 | |
| d1ny5a2 | 247 | Transcriptional activator sigm54 (NtrC1), C-termin | 98.5 | |
| d1qvra2 | 387 | ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 | 98.47 | |
| d1in4a2 | 238 | Holliday junction helicase RuvB {Thermotoga mariti | 98.1 | |
| d1jbka_ | 195 | ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} | 98.01 | |
| d1ye8a1 | 178 | Hypothetical kinase-like protein Aq_1292 {Aquifex | 97.98 | |
| d1sxja2 | 253 | Replication factor C1 {Baker's yeast (Saccharomyce | 97.85 | |
| d2fnaa2 | 283 | Archaeal ATPase SSO1545 {Sulfolobus solfataricus [ | 97.72 | |
| d1lw7a2 | 192 | Transcriptional regulator NadR, ribosylnicotinamid | 97.65 | |
| d1sxje2 | 252 | Replication factor C5 {Baker's yeast (Saccharomyce | 97.62 | |
| d1kaga_ | 169 | Shikimate kinase (AroK) {Escherichia coli [TaxId: | 97.59 | |
| d1njfa_ | 239 | delta prime subunit of DNA polymerase III, N-domai | 97.54 | |
| d1rkba_ | 173 | Adenylate kinase {Human (Homo sapiens), isoenzyme | 97.41 | |
| d1r6bx3 | 315 | ClpA, an Hsp100 chaperone, AAA+ modules {Escherich | 97.32 | |
| d1viaa_ | 161 | Shikimate kinase (AroK) {Campylobacter jejuni [Tax | 97.23 | |
| d1zp6a1 | 176 | Hypothetical protein Atu3015 {Agrobacterium tumefa | 97.19 | |
| d1ixsb2 | 239 | Holliday junction helicase RuvB {Thermus thermophi | 97.13 | |
| d1e6ca_ | 170 | Shikimate kinase (AroK) {Erwinia chrysanthemi [Tax | 97.13 | |
| d1iqpa2 | 231 | Replication factor C {Archaeon Pyrococcus furiosus | 97.1 | |
| d1qhxa_ | 178 | Chloramphenicol phosphotransferase {Streptomyces v | 97.03 | |
| d2i3ba1 | 189 | Cancer-related NTPase, C1orf57 {Human (Homo sapien | 96.98 | |
| d1tf7a2 | 242 | Circadian clock protein KaiC {Synechococcus sp. st | 96.97 | |
| d2iyva1 | 165 | Shikimate kinase (AroK) {Mycobacterium tuberculosi | 96.97 | |
| d2bdta1 | 176 | Hypothetical protein BH3686 {Bacillus halodurans [ | 96.96 | |
| d1knqa_ | 171 | Gluconate kinase {Escherichia coli [TaxId: 562]} | 96.96 | |
| d1y63a_ | 174 | Probable kinase LmjF30.1890 {Leishmania major [Tax | 96.87 | |
| d1zina1 | 182 | Adenylate kinase {Bacillus stearothermophilus [Tax | 96.82 | |
| d1g41a_ | 443 | HslU {Haemophilus influenzae [TaxId: 727]} | 96.81 | |
| d1sxjb2 | 224 | Replication factor C4 {Baker's yeast (Saccharomyce | 96.78 | |
| d1zaka1 | 189 | Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} | 96.73 | |
| d1m8pa3 | 183 | ATP sulfurylase C-terminal domain {Fungus (Penicil | 96.7 | |
| d1ak2a1 | 190 | Adenylate kinase {Cow (Bos taurus), mitochondrial | 96.69 | |
| d2cdna1 | 181 | Adenylate kinase {Mycobacterium tuberculosis [TaxI | 96.66 | |
| d1okkd2 | 207 | GTPase domain of the signal recognition particle r | 96.66 | |
| d1p9ra_ | 401 | Extracellular secretion NTPase EpsE {Vibrio choler | 96.63 | |
| d1qf9a_ | 194 | UMP/CMP kinase {Dictyostelium discoideum [TaxId: 4 | 96.6 | |
| d2qy9a2 | 211 | GTPase domain of the signal recognition particle r | 96.6 | |
| d1a5ta2 | 207 | delta prime subunit of DNA polymerase III, N-domai | 96.53 | |
| d1fnna2 | 276 | CDC6, N-domain {Archaeon Pyrobaculum aerophilum [T | 96.52 | |
| d1sxjc2 | 227 | Replication factor C3 {Baker's yeast (Saccharomyce | 96.52 | |
| d2ak3a1 | 189 | Adenylate kinase {Cow (Bos taurus), mitochondrial | 96.51 | |
| d1s3ga1 | 182 | Adenylate kinase {Bacillus globisporus [TaxId: 145 | 96.48 | |
| d1akya1 | 180 | Adenylate kinase {Baker's yeast (Saccharomyces cer | 96.48 | |
| d1w5sa2 | 287 | CDC6-like protein APE0152, N-terminal domain {Aero | 96.47 | |
| d1qvra3 | 315 | ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 | 96.45 | |
| d1ckea_ | 225 | CMP kinase {Escherichia coli [TaxId: 562]} | 96.45 | |
| d1ukza_ | 196 | Uridylate kinase {Baker's yeast (Saccharomyces cer | 96.43 | |
| d1sxjd2 | 237 | Replication factor C2 {Baker's yeast (Saccharomyce | 96.43 | |
| d1teva_ | 194 | UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606] | 96.4 | |
| d2a5yb3 | 277 | CED-4, NB-ARC domain {Caenorhabditis elegans [TaxI | 96.39 | |
| d3adka_ | 194 | Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} | 96.36 | |
| d1vmaa2 | 213 | GTPase domain of the signal recognition particle r | 96.36 | |
| d1x6va3 | 195 | Adenosine-5'phosphosulfate kinase (APS kinase) {Hu | 96.34 | |
| d1e4va1 | 179 | Adenylate kinase {Escherichia coli [TaxId: 562]} | 96.33 | |
| d1xp8a1 | 268 | RecA protein, ATPase-domain {Deinococcus radiodura | 96.32 | |
| d1u94a1 | 263 | RecA protein, ATPase-domain {Escherichia coli [Tax | 96.28 | |
| d1a1va1 | 136 | HCV helicase domain {Human hepatitis C virus (HCV) | 96.22 | |
| d1tf7a1 | 242 | Circadian clock protein KaiC {Synechococcus sp. st | 96.2 | |
| d1bifa1 | 213 | 6-phosphofructo-2-kinase/fructose-2,6-bisphosphata | 96.2 | |
| d1q3ta_ | 223 | CMP kinase {Streptococcus pneumoniae [TaxId: 1313] | 96.16 | |
| d1ly1a_ | 152 | Polynucleotide kinase, kinase domain {Bacteriophag | 96.08 | |
| d1cr2a_ | 277 | Gene 4 protein (g4p, DNA primase), helicase domain | 96.04 | |
| d1j8yf2 | 211 | GTPase domain of the signal sequence recognition p | 96.02 | |
| d1yksa1 | 140 | YFV helicase domain {Yellow fever virus [TaxId: 11 | 95.9 | |
| d1ls1a2 | 207 | GTPase domain of the signal sequence recognition p | 95.9 | |
| d1yj5a2 | 172 | 5' polynucleotide kinase-3' phosphatase, C-termina | 95.86 | |
| d1g6oa_ | 323 | Hexameric traffic ATPase, HP0525 {Helicobacter pyl | 95.77 | |
| d1w36d1 | 359 | Exodeoxyribonuclease V alpha chain (RecD) {Escheri | 95.7 | |
| d1lw7a2 | 192 | Transcriptional regulator NadR, ribosylnicotinamid | 95.69 | |
| d1szpa2 | 251 | DNA repair protein Rad51, catalytic domain {Baker' | 95.54 | |
| d1um8a_ | 364 | ClpX {Helicobacter pylori [TaxId: 210]} | 95.54 | |
| d1gvnb_ | 273 | Plasmid maintenance system epsilon/zeta, toxin zet | 95.48 | |
| d1khta_ | 190 | Adenylate kinase {Archaeon Methanococcus voltae [T | 95.46 | |
| d1np6a_ | 170 | Molybdopterin-guanine dinucleotide biosynthesis pr | 95.32 | |
| d1mo6a1 | 269 | RecA protein, ATPase-domain {Mycobacterium tubercu | 95.21 | |
| d1nksa_ | 194 | Adenylate kinase {Archaeon Sulfolobus acidocaldari | 95.02 | |
| d1m7ga_ | 208 | Adenosine-5'phosphosulfate kinase (APS kinase) {Fu | 94.84 | |
| d2gnoa2 | 198 | gamma subunit of DNA polymerase III, N-domain {The | 94.56 | |
| d1nlfa_ | 274 | Hexameric replicative helicase repA {Escherichia c | 94.42 | |
| d1wb9a2 | 234 | DNA repair protein MutS, the C-terminal domain {Es | 94.15 | |
| d2fh5b1 | 207 | Signal recognition particle receptor beta-subunit | 94.1 | |
| d2gj8a1 | 161 | Probable tRNA modification GTPase TrmE (MnmE), G d | 94.03 | |
| d1rz3a_ | 198 | Hypothetical protein rbstp0775 {Bacillus stearothe | 94.0 | |
| d1lvga_ | 190 | Guanylate kinase {Mouse (Mus musculus) [TaxId: 100 | 93.62 | |
| d1zd9a1 | 164 | ADP-ribosylation factor {Human (Homo sapiens), ARL | 93.57 | |
| d1gkya_ | 186 | Guanylate kinase {Baker's yeast (Saccharomyces cer | 93.38 | |
| d1wf3a1 | 178 | GTPase Era, N-terminal domain {Thermus thermophilu | 93.34 | |
| d1n0wa_ | 242 | DNA repair protein Rad51, catalytic domain {Human | 93.09 | |
| d1l8qa2 | 213 | Chromosomal replication initiation factor DnaA {Aq | 92.87 | |
| d1svma_ | 362 | Papillomavirus large T antigen helicase domain {Si | 92.84 | |
| d1u0ja_ | 267 | Rep 40 protein helicase domain {Adeno-associated v | 92.82 | |
| d1r8sa_ | 160 | ADP-ribosylation factor {Human (Homo sapiens), ARF | 92.82 | |
| d1nrjb_ | 209 | Signal recognition particle receptor beta-subunit | 92.76 | |
| d1kaga_ | 169 | Shikimate kinase (AroK) {Escherichia coli [TaxId: | 92.56 | |
| d1rkba_ | 173 | Adenylate kinase {Human (Homo sapiens), isoenzyme | 92.45 | |
| d1v5wa_ | 258 | Meiotic recombination protein DMC1/LIM15 homolog { | 92.18 | |
| d1ewqa2 | 224 | DNA repair protein MutS, the C-terminal domain {Th | 92.05 | |
| d1ksha_ | 165 | ADP-ribosylation factor {Mouse (Mus musculus), ARL | 92.03 | |
| d1u8za_ | 168 | Ras-related protein RalA {Cotton-top tamarin (Sagu | 92.03 | |
| d2fz4a1 | 206 | DNA repair protein RAD25 {Archaeoglobus fulgidus [ | 91.99 | |
| d2p6ra3 | 202 | Hel308 helicase {Archaeoglobus fulgidus [TaxId: 22 | 91.73 | |
| d1tuea_ | 205 | Replication protein E1 helicase domain {Human papi | 91.6 | |
| d1qhxa_ | 178 | Chloramphenicol phosphotransferase {Streptomyces v | 91.57 | |
| d1uj2a_ | 213 | Uridine-cytidine kinase 2 {Human (Homo sapiens) [T | 91.56 | |
| d1pzna2 | 254 | DNA repair protein Rad51, catalytic domain {Archae | 91.52 | |
| d1xjca_ | 165 | Molybdopterin-guanine dinucleotide biosynthesis pr | 91.47 | |
| d1znwa1 | 182 | Guanylate kinase {Mycobacterium tuberculosis [TaxI | 91.44 | |
| d1zp6a1 | 176 | Hypothetical protein Atu3015 {Agrobacterium tumefa | 91.32 | |
| d1ctqa_ | 166 | cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9 | 91.31 | |
| d1htwa_ | 158 | Hypothetical protein HI0065 {Haemophilus influenza | 91.26 | |
| d1wp9a1 | 200 | putative ATP-dependent RNA helicase PF2015 {Pyroco | 91.06 | |
| d1e0sa_ | 173 | ADP-ribosylation factor {Human (Homo sapiens), ARF | 91.04 | |
| d1gkub1 | 237 | Helicase-like "domain" of reverse gyrase {Archaeon | 91.03 | |
| d1zj6a1 | 177 | ADP-ribosylation factor {Human (Homo sapiens), ARL | 90.98 | |
| d1kkma_ | 176 | HPr kinase HprK C-terminal domain {Lactobacillus c | 90.85 | |
| d1mkya1 | 171 | Probable GTPase Der, N-terminal and middle domains | 90.39 | |
| d1h65a_ | 257 | Chloroplast protein translocon GTPase Toc34 {Garde | 90.24 | |
| d1ye8a1 | 178 | Hypothetical kinase-like protein Aq_1292 {Aquifex | 90.18 | |
| d1fzqa_ | 176 | ADP-ribosylation factor {Mouse (Mus musculus), ARL | 90.07 | |
| d2a5ja1 | 173 | Rab2b {Human (Homo sapiens) [TaxId: 9606]} | 89.96 | |
| d1wmsa_ | 174 | Rab9a {Human (Homo sapiens) [TaxId: 9606]} | 89.89 | |
| d1kaoa_ | 167 | Rap2a {Human (Homo sapiens) [TaxId: 9606]} | 89.82 | |
| d1uf9a_ | 191 | Dephospho-CoA kinase {Thermus thermophilus [TaxId: | 89.54 | |
| d1viaa_ | 161 | Shikimate kinase (AroK) {Campylobacter jejuni [Tax | 89.41 | |
| d2iyva1 | 165 | Shikimate kinase (AroK) {Mycobacterium tuberculosi | 89.34 | |
| d2i1qa2 | 258 | DNA repair protein Rad51, catalytic domain {Archae | 89.25 | |
| d1ko7a2 | 169 | HPr kinase HprK C-terminal domain {Staphylococcus | 89.07 | |
| d1knxa2 | 177 | HPr kinase HprK C-terminal domain {Mycoplasma pneu | 88.74 | |
| d1kgda_ | 178 | Guanylate kinase-like domain of Cask {Human (Homo | 88.55 | |
| d1moza_ | 182 | ADP-ribosylation factor {Baker's yeast (Saccharomy | 88.33 | |
| d1azta2 | 221 | Transducin (alpha subunit) {Cow (Bos taurus) [TaxI | 88.26 | |
| d1uaaa1 | 306 | DEXX box DNA helicase {Escherichia coli, RepD [Tax | 88.25 | |
| d1gsia_ | 208 | Thymidylate kinase {Mycobacterium tuberculosis [Ta | 88.21 | |
| d1yrba1 | 244 | ATP(GTP)-binding protein PAB0955 {Pyrococcus abyss | 88.13 | |
| d1nn5a_ | 209 | Thymidylate kinase {Human (Homo sapiens) [TaxId: 9 | 87.97 | |
| d2bmfa2 | 305 | Dengue virus helicase {Dengue virus type 2 [TaxId: | 87.66 | |
| d1ky3a_ | 175 | Rab-related protein ypt7p {Baker's yeast (Saccharo | 87.49 | |
| d1z06a1 | 165 | Rab-33b {Mouse (Mus musculus) [TaxId: 10090]} | 87.45 | |
| d1r2qa_ | 170 | Rab5a {Human (Homo sapiens) [TaxId: 9606]} | 87.43 | |
| d2f7sa1 | 186 | Rab27b {Human (Homo sapiens) [TaxId: 9606]} | 87.13 | |
| d1pjra1 | 318 | DEXX box DNA helicase {Bacillus stearothermophilus | 87.06 | |
| d1knqa_ | 171 | Gluconate kinase {Escherichia coli [TaxId: 562]} | 87.0 | |
| d2vp4a1 | 197 | Deoxyribonucleoside kinase {Fruit fly (Drosophila | 86.96 | |
| d1odfa_ | 286 | Hypothetical protein Ygr205W {Baker's yeast (Sacch | 86.78 | |
| d1vhta_ | 208 | Dephospho-CoA kinase {Escherichia coli [TaxId: 562 | 86.61 | |
| d1f6ba_ | 186 | SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: | 86.52 | |
| d1s96a_ | 205 | Guanylate kinase {Escherichia coli [TaxId: 562]} | 86.44 | |
| d2erya1 | 171 | r-Ras2 {Human (Homo sapiens) [TaxId: 9606]} | 86.36 | |
| d2qtvb1 | 166 | SAR1 {Baker's yeast (Saccharomyces cerevisiae) [Ta | 86.36 | |
| d1jjva_ | 205 | Dephospho-CoA kinase {Haemophilus influenzae [TaxI | 86.31 | |
| d2bdta1 | 176 | Hypothetical protein BH3686 {Bacillus halodurans [ | 86.12 | |
| d1hv8a1 | 208 | Putative DEAD box RNA helicase {Archaeon Methanoco | 86.06 | |
| d1zcba2 | 200 | Transducin (alpha subunit) {Mouse (Mus musculus) [ | 85.99 | |
| d1e6ca_ | 170 | Shikimate kinase (AroK) {Erwinia chrysanthemi [Tax | 85.98 | |
| d1upta_ | 169 | ADP-ribosylation factor {Human (Homo sapiens), ARL | 85.91 | |
| d2p67a1 | 327 | LAO/AO transport system kinase ArgK {Escherichia c | 85.67 | |
| d1sq5a_ | 308 | Pantothenate kinase PanK {Escherichia coli [TaxId: | 85.65 | |
| d2bmea1 | 174 | Rab4a {Human (Homo sapiens) [TaxId: 9606]} | 85.45 | |
| d4tmka_ | 210 | Thymidylate kinase {Escherichia coli [TaxId: 562]} | 85.17 | |
| d1deka_ | 241 | Deoxynucleoside monophosphate kinase {Bacteriophag | 84.97 | |
| d2gjsa1 | 168 | Rad {Human (Homo sapiens) [TaxId: 9606]} | 84.54 | |
| d1m8pa3 | 183 | ATP sulfurylase C-terminal domain {Fungus (Penicil | 84.28 | |
| d1veca_ | 206 | DEAD box RNA helicase rck/p54 {Human (Homo sapiens | 83.97 | |
| d1byia_ | 224 | Dethiobiotin synthetase {Escherichia coli [TaxId: | 83.55 | |
| d2qm8a1 | 323 | Metallochaperone MeaB {Methylobacterium extorquens | 83.54 | |
| d2ocpa1 | 241 | Deoxyguanosine kinase {Human (Homo sapiens) [TaxId | 83.5 | |
| d1zina1 | 182 | Adenylate kinase {Bacillus stearothermophilus [Tax | 83.03 | |
| d1x6va3 | 195 | Adenosine-5'phosphosulfate kinase (APS kinase) {Hu | 82.92 | |
| d1e9ra_ | 433 | Bacterial conjugative coupling protein TrwB {Esche | 82.43 | |
| d1y63a_ | 174 | Probable kinase LmjF30.1890 {Leishmania major [Tax | 82.41 | |
| d1z0fa1 | 166 | Rab14 {Human (Homo sapiens) [TaxId: 9606]} | 82.24 | |
| d1ihua1 | 296 | Arsenite-translocating ATPase ArsA {Escherichia co | 82.08 | |
| d1sgwa_ | 200 | Putative ABC transporter PF0895 {Pyrococcus furios | 81.97 | |
| d1z2aa1 | 164 | Rab23 {Mouse (Mus musculus) [TaxId: 10090]} | 81.48 | |
| d2eyqa3 | 233 | Transcription-repair coupling factor, TRCF {Escher | 81.44 | |
| d1i2ma_ | 170 | Ran {Human (Homo sapiens) [TaxId: 9606]} | 81.35 | |
| d1tmka_ | 214 | Thymidylate kinase {Baker's yeast (Saccharomyces c | 81.18 | |
| d1xzpa2 | 160 | TrmE GTPase domain {Thermotoga maritima [TaxId: 23 | 81.07 | |
| d2i3ba1 | 189 | Cancer-related NTPase, C1orf57 {Human (Homo sapien | 81.03 | |
| d2onka1 | 240 | Molybdate/tungstate import ATP-binding protein Wtp | 80.87 | |
| d3raba_ | 169 | Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} | 80.85 | |
| d1a7ja_ | 288 | Phosphoribulokinase {Rhodobacter sphaeroides [TaxI | 80.49 | |
| d2awna2 | 232 | Maltose transport protein MalK, N-terminal domain | 80.48 | |
| d1p5zb_ | 241 | Deoxycytidine kinase {Human (Homo sapiens) [TaxId: | 80.36 | |
| d1g2912 | 240 | Maltose transport protein MalK, N-terminal domain | 80.06 | |
| d1zaka1 | 189 | Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} | 80.03 |
| >d1lv7a_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: P-loop containing nucleoside triphosphate hydrolases superfamily: P-loop containing nucleoside triphosphate hydrolases family: Extended AAA-ATPase domain domain: AAA domain of cell division protein FtsH species: Escherichia coli [TaxId: 562]
Probab=99.96 E-value=3.8e-29 Score=270.32 Aligned_cols=172 Identities=40% Similarity=0.610 Sum_probs=149.8
Q ss_pred CCCCCCCcccccCcHHHHHHHHHHHHccccChhhhhcCCCCCCCeEEEEECCCCCchHHHHHHHHHHhCCeeeEEecccc
Q 001244 941 PSDIGVTFDDIGALENVKDTLKELVMLPLQRPELFCKGQLTKPCKGILLFGPPGTGKTMLAKAVATEAGANFINISMSSI 1020 (1116)
Q Consensus 941 ~~e~~vtfddIgGldevk~~L~e~V~lpl~~pelf~~~~l~~p~~gILL~GPPGTGKT~LArAIA~elg~pfI~Is~seL 1020 (1116)
.+++.+||+|++|+++++++|.+.+.+ +.+++.|.+.+. ++++++|||||||||||++|++||++++.+++.++++++
T Consensus 4 ~~~~~~t~~Di~Gl~~~k~~l~e~v~~-~~~~~~~~~~g~-~~~~~iLL~GppGtGKT~la~~iA~~~~~~~~~i~~~~l 81 (256)
T d1lv7a_ 4 EDQIKTTFADVAGCDEAKEEVAELVEY-LREPSRFQKLGG-KIPKGVLMVGPPGTGKTLLAKAIAGEAKVPFFTISGSDF 81 (256)
T ss_dssp ECSSCCCGGGSCSCHHHHHHTHHHHHH-HHCGGGC------CCCCEEEEECCTTSCHHHHHHHHHHHHTCCEEEECSCSS
T ss_pred CCCCCCCHHHHhchHHHHHHHHHHHHH-HHCHHHHHHcCC-CCCCeEEeeCCCCCCccHHHHHHHHHcCCCEEEEEhHHh
Confidence 456689999999999999999998875 778888887664 455899999999999999999999999999999999999
Q ss_pred ccccccchHHHHHHHHHHHhcCCCeEEEEccccccccCCCCCc--hhHHHHHHHHHHHHHhcCCCcCCCCCEEEEEEeCC
Q 001244 1021 TSKWFGEGEKYVKAVFSLASKIAPSVVFVDEVDSMLGRRENPG--EHEAMRKMKNEFMVNWDGLRTKDKERVLVLAATNR 1098 (1116)
Q Consensus 1021 ~sk~~GesEk~Ir~lF~~A~k~sPsIIfIDEID~Llg~R~~~~--~~~~lr~IlneLL~~Ldgl~~k~~~kVLVIaTTNr 1098 (1116)
.++|+|++++.++++|+.|+.++||||||||||.+++.|.... ......+++++|+..++++.. +.+|+||||||+
T Consensus 82 ~~~~~g~~~~~l~~~f~~A~~~~P~il~iDeiD~l~~~r~~~~~~~~~~~~~~~~~ll~~~d~~~~--~~~v~vIatTn~ 159 (256)
T d1lv7a_ 82 VEMFVGVGASRVRDMFEQAKKAAPCIIFIDEIDAVGRQRGAGLGGGHDEREQTLNQMLVEMDGFEG--NEGIIVIAATNR 159 (256)
T ss_dssp TTSCCCCCHHHHHHHHHHHHTTCSEEEEETTHHHHTCCCSTTSCCTTCHHHHHHHHHHHHHHTCCS--SSCEEEEEEESC
T ss_pred hhcchhHHHHHHHHHHHHHHHcCCEEEEEEChhhhCccCCCCCCCCcHHHHHHHHHHHHHhhCCCC--CCCEEEEEeCCC
Confidence 9999999999999999999999999999999999987765432 234557889999999998854 567999999999
Q ss_pred CCCCcHHHHh--hcCCeEEC
Q 001244 1099 PFDLDEAVVR--RLPRRTCV 1116 (1116)
Q Consensus 1099 p~~LD~ALlR--RF~r~I~V 1116 (1116)
|+.||++++| ||+++|+|
T Consensus 160 ~~~ld~al~R~gRfd~~i~i 179 (256)
T d1lv7a_ 160 PDVLDPALLRPGRFDRQVVV 179 (256)
T ss_dssp TTTSCGGGGSTTSSCEEEEC
T ss_pred cccCCHhHcCCCCCCEEEEC
Confidence 9999999998 99999986
|
| >d1ixza_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1e32a2 c.37.1.20 (A:201-458) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1r7ra3 c.37.1.20 (A:471-735) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1gxca_ b.26.1.2 (A:) Chk2 kinase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1d2na_ c.37.1.20 (A:) Hexamerization domain of N-ethylmalemide-sensitive fusion (NSF) protein {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} | Back information, alignment and structure |
|---|
| >d1w44a_ c.37.1.11 (A:) NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} | Back information, alignment and structure |
|---|
| >d1lv7a_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1ofha_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1ixza_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1e32a2 c.37.1.20 (A:201-458) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1lgpa_ b.26.1.2 (A:) Cell cycle checkpoint protein Chfr {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1r7ra3 c.37.1.20 (A:471-735) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1in4a2 c.37.1.20 (A:17-254) Holliday junction helicase RuvB {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1ixsb2 c.37.1.20 (B:4-242) Holliday junction helicase RuvB {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1iqpa2 c.37.1.20 (A:2-232) Replication factor C {Archaeon Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d1g6ga_ b.26.1.2 (A:) Phosphotyrosine binding domain of Rad53 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1dmza_ b.26.1.2 (A:) Phosphotyrosine binding domain of Rad53 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1r6bx2 c.37.1.20 (X:169-436) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1sxjc2 c.37.1.20 (C:12-238) Replication factor C3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1jbka_ c.37.1.20 (A:) ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2brfa1 b.26.1.2 (A:8-108) Polynucleotide kinase 3'-phosphatase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1njfa_ c.37.1.20 (A:) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1sxja2 c.37.1.20 (A:295-547) Replication factor C1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2piea1 b.26.1.2 (A:13-139) Ubiquitin ligase protein RNF8 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1r6bx3 c.37.1.20 (X:437-751) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1sxje2 c.37.1.20 (E:4-255) Replication factor C5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2ff4a3 b.26.1.2 (A:284-382) Probable regulatory protein EmbR, C-terminal domain {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1w44a_ c.37.1.11 (A:) NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} | Back information, alignment and structure |
|---|
| >d1qvra3 c.37.1.20 (A:536-850) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1g8pa_ c.37.1.20 (A:) ATPase subunit of magnesium chelatase, BchI {Rhodobacter capsulatus [TaxId: 1061]} | Back information, alignment and structure |
|---|
| >d1sxjb2 c.37.1.20 (B:7-230) Replication factor C4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1um8a_ c.37.1.20 (A:) ClpX {Helicobacter pylori [TaxId: 210]} | Back information, alignment and structure |
|---|
| >d1d2na_ c.37.1.20 (A:) Hexamerization domain of N-ethylmalemide-sensitive fusion (NSF) protein {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} | Back information, alignment and structure |
|---|
| >d1sxjd2 c.37.1.20 (D:26-262) Replication factor C2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2affa1 b.26.1.2 (A:3-100) Antigen ki-67 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1uhta_ b.26.1.2 (A:) FHA domain containing protein At4G14490 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1qvra2 c.37.1.20 (A:149-535) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1g41a_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1ofha_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1mzka_ b.26.1.2 (A:) Kinase associated protein phosphatase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d2g1la1 b.26.1.2 (A:498-599) Kinesin-like protein kif1c {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1a5ta2 c.37.1.20 (A:1-207) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1l8qa2 c.37.1.20 (A:77-289) Chromosomal replication initiation factor DnaA {Aquifex aeolicus [TaxId: 63363]} | Back information, alignment and structure |
|---|
| >d1fnna2 c.37.1.20 (A:1-276) CDC6, N-domain {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} | Back information, alignment and structure |
|---|
| >d1svma_ c.37.1.20 (A:) Papillomavirus large T antigen helicase domain {Simian virus 40 [TaxId: 10633]} | Back information, alignment and structure |
|---|
| >d1r6bx2 c.37.1.20 (X:169-436) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1w5sa2 c.37.1.20 (A:7-293) CDC6-like protein APE0152, N-terminal domain {Aeropyrum pernix [TaxId: 56636]} | Back information, alignment and structure |
|---|
| >d1gvnb_ c.37.1.21 (B:) Plasmid maintenance system epsilon/zeta, toxin zeta subunit {Streptococcus pyogenes [TaxId: 1314]} | Back information, alignment and structure |
|---|
| >d1wlna1 b.26.1.2 (A:8-114) Afadin {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2gnoa2 c.37.1.20 (A:11-208) gamma subunit of DNA polymerase III, N-domain {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1ny5a2 c.37.1.20 (A:138-384) Transcriptional activator sigm54 (NtrC1), C-terminal domain {Aquifex aeolicus [TaxId: 63363]} | Back information, alignment and structure |
|---|
| >d1qvra2 c.37.1.20 (A:149-535) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1in4a2 c.37.1.20 (A:17-254) Holliday junction helicase RuvB {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1jbka_ c.37.1.20 (A:) ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1ye8a1 c.37.1.11 (A:1-178) Hypothetical kinase-like protein Aq_1292 {Aquifex aeolicus [TaxId: 63363]} | Back information, alignment and structure |
|---|
| >d1sxja2 c.37.1.20 (A:295-547) Replication factor C1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2fnaa2 c.37.1.20 (A:1-283) Archaeal ATPase SSO1545 {Sulfolobus solfataricus [TaxId: 2287]} | Back information, alignment and structure |
|---|
| >d1lw7a2 c.37.1.1 (A:220-411) Transcriptional regulator NadR, ribosylnicotinamide kinase domain {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1sxje2 c.37.1.20 (E:4-255) Replication factor C5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1kaga_ c.37.1.2 (A:) Shikimate kinase (AroK) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1njfa_ c.37.1.20 (A:) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1rkba_ c.37.1.1 (A:) Adenylate kinase {Human (Homo sapiens), isoenzyme 6 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1r6bx3 c.37.1.20 (X:437-751) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1viaa_ c.37.1.2 (A:) Shikimate kinase (AroK) {Campylobacter jejuni [TaxId: 197]} | Back information, alignment and structure |
|---|
| >d1zp6a1 c.37.1.25 (A:6-181) Hypothetical protein Atu3015 {Agrobacterium tumefaciens [TaxId: 358]} | Back information, alignment and structure |
|---|
| >d1ixsb2 c.37.1.20 (B:4-242) Holliday junction helicase RuvB {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1e6ca_ c.37.1.2 (A:) Shikimate kinase (AroK) {Erwinia chrysanthemi [TaxId: 556]} | Back information, alignment and structure |
|---|
| >d1iqpa2 c.37.1.20 (A:2-232) Replication factor C {Archaeon Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d1qhxa_ c.37.1.3 (A:) Chloramphenicol phosphotransferase {Streptomyces venezuelae [TaxId: 54571]} | Back information, alignment and structure |
|---|
| >d2i3ba1 c.37.1.11 (A:1-189) Cancer-related NTPase, C1orf57 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1tf7a2 c.37.1.11 (A:256-497) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} | Back information, alignment and structure |
|---|
| >d2iyva1 c.37.1.2 (A:2-166) Shikimate kinase (AroK) {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d2bdta1 c.37.1.25 (A:1-176) Hypothetical protein BH3686 {Bacillus halodurans [TaxId: 86665]} | Back information, alignment and structure |
|---|
| >d1knqa_ c.37.1.17 (A:) Gluconate kinase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1y63a_ c.37.1.1 (A:) Probable kinase LmjF30.1890 {Leishmania major [TaxId: 5664]} | Back information, alignment and structure |
|---|
| >d1zina1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1g41a_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1sxjb2 c.37.1.20 (B:7-230) Replication factor C4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1zaka1 c.37.1.1 (A:3-127,A:159-222) Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} | Back information, alignment and structure |
|---|
| >d1m8pa3 c.37.1.15 (A:391-573) ATP sulfurylase C-terminal domain {Fungus (Penicillium chrysogenum) [TaxId: 5076]} | Back information, alignment and structure |
|---|
| >d1ak2a1 c.37.1.1 (A:14-146,A:177-233) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-2 [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d2cdna1 c.37.1.1 (A:1-181) Adenylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1okkd2 c.37.1.10 (D:97-303) GTPase domain of the signal recognition particle receptor FtsY {Thermus aquaticus [TaxId: 271]} | Back information, alignment and structure |
|---|
| >d1p9ra_ c.37.1.11 (A:) Extracellular secretion NTPase EpsE {Vibrio cholerae [TaxId: 666]} | Back information, alignment and structure |
|---|
| >d1qf9a_ c.37.1.1 (A:) UMP/CMP kinase {Dictyostelium discoideum [TaxId: 44689]} | Back information, alignment and structure |
|---|
| >d2qy9a2 c.37.1.10 (A:285-495) GTPase domain of the signal recognition particle receptor FtsY {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1a5ta2 c.37.1.20 (A:1-207) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1fnna2 c.37.1.20 (A:1-276) CDC6, N-domain {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} | Back information, alignment and structure |
|---|
| >d1sxjc2 c.37.1.20 (C:12-238) Replication factor C3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2ak3a1 c.37.1.1 (A:0-124,A:162-225) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-3 [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1s3ga1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus globisporus [TaxId: 1459]} | Back information, alignment and structure |
|---|
| >d1akya1 c.37.1.1 (A:3-130,A:169-220) Adenylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1w5sa2 c.37.1.20 (A:7-293) CDC6-like protein APE0152, N-terminal domain {Aeropyrum pernix [TaxId: 56636]} | Back information, alignment and structure |
|---|
| >d1qvra3 c.37.1.20 (A:536-850) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1ckea_ c.37.1.1 (A:) CMP kinase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1ukza_ c.37.1.1 (A:) Uridylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1sxjd2 c.37.1.20 (D:26-262) Replication factor C2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1teva_ c.37.1.1 (A:) UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2a5yb3 c.37.1.20 (B:109-385) CED-4, NB-ARC domain {Caenorhabditis elegans [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d3adka_ c.37.1.1 (A:) Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d1vmaa2 c.37.1.10 (A:82-294) GTPase domain of the signal recognition particle receptor FtsY {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1x6va3 c.37.1.4 (A:34-228) Adenosine-5'phosphosulfate kinase (APS kinase) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1e4va1 c.37.1.1 (A:1-121,A:157-214) Adenylate kinase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1xp8a1 c.37.1.11 (A:15-282) RecA protein, ATPase-domain {Deinococcus radiodurans [TaxId: 1299]} | Back information, alignment and structure |
|---|
| >d1u94a1 c.37.1.11 (A:6-268) RecA protein, ATPase-domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1a1va1 c.37.1.14 (A:190-325) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} | Back information, alignment and structure |
|---|
| >d1tf7a1 c.37.1.11 (A:14-255) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} | Back information, alignment and structure |
|---|
| >d1bifa1 c.37.1.7 (A:37-249) 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase, kinase domain {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1q3ta_ c.37.1.1 (A:) CMP kinase {Streptococcus pneumoniae [TaxId: 1313]} | Back information, alignment and structure |
|---|
| >d1ly1a_ c.37.1.1 (A:) Polynucleotide kinase, kinase domain {Bacteriophage T4 [TaxId: 10665]} | Back information, alignment and structure |
|---|
| >d1cr2a_ c.37.1.11 (A:) Gene 4 protein (g4p, DNA primase), helicase domain {Bacteriophage T7 [TaxId: 10760]} | Back information, alignment and structure |
|---|
| >d1j8yf2 c.37.1.10 (F:87-297) GTPase domain of the signal sequence recognition protein Ffh {Archaeon Acidianus ambivalens [TaxId: 2283]} | Back information, alignment and structure |
|---|
| >d1yksa1 c.37.1.14 (A:185-324) YFV helicase domain {Yellow fever virus [TaxId: 11089]} | Back information, alignment and structure |
|---|
| >d1ls1a2 c.37.1.10 (A:89-295) GTPase domain of the signal sequence recognition protein Ffh {Thermus aquaticus [TaxId: 271]} | Back information, alignment and structure |
|---|
| >d1yj5a2 c.37.1.1 (A:351-522) 5' polynucleotide kinase-3' phosphatase, C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1g6oa_ c.37.1.11 (A:) Hexameric traffic ATPase, HP0525 {Helicobacter pylori [TaxId: 210]} | Back information, alignment and structure |
|---|
| >d1w36d1 c.37.1.19 (D:2-360) Exodeoxyribonuclease V alpha chain (RecD) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1lw7a2 c.37.1.1 (A:220-411) Transcriptional regulator NadR, ribosylnicotinamide kinase domain {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1szpa2 c.37.1.11 (A:145-395) DNA repair protein Rad51, catalytic domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1um8a_ c.37.1.20 (A:) ClpX {Helicobacter pylori [TaxId: 210]} | Back information, alignment and structure |
|---|
| >d1gvnb_ c.37.1.21 (B:) Plasmid maintenance system epsilon/zeta, toxin zeta subunit {Streptococcus pyogenes [TaxId: 1314]} | Back information, alignment and structure |
|---|
| >d1khta_ c.37.1.1 (A:) Adenylate kinase {Archaeon Methanococcus voltae [TaxId: 2188]} | Back information, alignment and structure |
|---|
| >d1np6a_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1mo6a1 c.37.1.11 (A:1-269) RecA protein, ATPase-domain {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1nksa_ c.37.1.1 (A:) Adenylate kinase {Archaeon Sulfolobus acidocaldarius [TaxId: 2285]} | Back information, alignment and structure |
|---|
| >d1m7ga_ c.37.1.4 (A:) Adenosine-5'phosphosulfate kinase (APS kinase) {Fungus (Penicillium chrysogenum) [TaxId: 5076]} | Back information, alignment and structure |
|---|
| >d2gnoa2 c.37.1.20 (A:11-208) gamma subunit of DNA polymerase III, N-domain {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1nlfa_ c.37.1.11 (A:) Hexameric replicative helicase repA {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1wb9a2 c.37.1.12 (A:567-800) DNA repair protein MutS, the C-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2fh5b1 c.37.1.8 (B:63-269) Signal recognition particle receptor beta-subunit {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2gj8a1 c.37.1.8 (A:216-376) Probable tRNA modification GTPase TrmE (MnmE), G domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1rz3a_ c.37.1.6 (A:) Hypothetical protein rbstp0775 {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1lvga_ c.37.1.1 (A:) Guanylate kinase {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1zd9a1 c.37.1.8 (A:18-181) ADP-ribosylation factor {Human (Homo sapiens), ARL8A [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1gkya_ c.37.1.1 (A:) Guanylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1wf3a1 c.37.1.8 (A:3-180) GTPase Era, N-terminal domain {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1n0wa_ c.37.1.11 (A:) DNA repair protein Rad51, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1l8qa2 c.37.1.20 (A:77-289) Chromosomal replication initiation factor DnaA {Aquifex aeolicus [TaxId: 63363]} | Back information, alignment and structure |
|---|
| >d1svma_ c.37.1.20 (A:) Papillomavirus large T antigen helicase domain {Simian virus 40 [TaxId: 10633]} | Back information, alignment and structure |
|---|
| >d1u0ja_ c.37.1.20 (A:) Rep 40 protein helicase domain {Adeno-associated virus 2, AAV2 [TaxId: 10804]} | Back information, alignment and structure |
|---|
| >d1r8sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF1 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1nrjb_ c.37.1.8 (B:) Signal recognition particle receptor beta-subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1kaga_ c.37.1.2 (A:) Shikimate kinase (AroK) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1rkba_ c.37.1.1 (A:) Adenylate kinase {Human (Homo sapiens), isoenzyme 6 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1v5wa_ c.37.1.11 (A:) Meiotic recombination protein DMC1/LIM15 homolog {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ewqa2 c.37.1.12 (A:542-765) DNA repair protein MutS, the C-terminal domain {Thermus aquaticus [TaxId: 271]} | Back information, alignment and structure |
|---|
| >d1ksha_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL2 [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1u8za_ c.37.1.8 (A:) Ras-related protein RalA {Cotton-top tamarin (Saguinus oedipus) [TaxId: 9490]} | Back information, alignment and structure |
|---|
| >d2fz4a1 c.37.1.19 (A:24-229) DNA repair protein RAD25 {Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d2p6ra3 c.37.1.19 (A:1-202) Hel308 helicase {Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d1tuea_ c.37.1.20 (A:) Replication protein E1 helicase domain {Human papillomavirus type 18 [TaxId: 333761]} | Back information, alignment and structure |
|---|
| >d1qhxa_ c.37.1.3 (A:) Chloramphenicol phosphotransferase {Streptomyces venezuelae [TaxId: 54571]} | Back information, alignment and structure |
|---|
| >d1uj2a_ c.37.1.6 (A:) Uridine-cytidine kinase 2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1pzna2 c.37.1.11 (A:96-349) DNA repair protein Rad51, catalytic domain {Archaeon Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d1xjca_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1znwa1 c.37.1.1 (A:20-201) Guanylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1zp6a1 c.37.1.25 (A:6-181) Hypothetical protein Atu3015 {Agrobacterium tumefaciens [TaxId: 358]} | Back information, alignment and structure |
|---|
| >d1ctqa_ c.37.1.8 (A:) cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1htwa_ c.37.1.18 (A:) Hypothetical protein HI0065 {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1wp9a1 c.37.1.19 (A:1-200) putative ATP-dependent RNA helicase PF2015 {Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d1e0sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF6 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1gkub1 c.37.1.16 (B:1-250) Helicase-like "domain" of reverse gyrase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d1zj6a1 c.37.1.8 (A:2-178) ADP-ribosylation factor {Human (Homo sapiens), ARL5A [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1kkma_ c.91.1.2 (A:) HPr kinase HprK C-terminal domain {Lactobacillus casei [TaxId: 1582]} | Back information, alignment and structure |
|---|
| >d1mkya1 c.37.1.8 (A:2-172) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1h65a_ c.37.1.8 (A:) Chloroplast protein translocon GTPase Toc34 {Garden pea (Pisum sativum) [TaxId: 3888]} | Back information, alignment and structure |
|---|
| >d1ye8a1 c.37.1.11 (A:1-178) Hypothetical kinase-like protein Aq_1292 {Aquifex aeolicus [TaxId: 63363]} | Back information, alignment and structure |
|---|
| >d1fzqa_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL3 [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2a5ja1 c.37.1.8 (A:9-181) Rab2b {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wmsa_ c.37.1.8 (A:) Rab9a {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1kaoa_ c.37.1.8 (A:) Rap2a {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1uf9a_ c.37.1.1 (A:) Dephospho-CoA kinase {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1viaa_ c.37.1.2 (A:) Shikimate kinase (AroK) {Campylobacter jejuni [TaxId: 197]} | Back information, alignment and structure |
|---|
| >d2iyva1 c.37.1.2 (A:2-166) Shikimate kinase (AroK) {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d2i1qa2 c.37.1.11 (A:65-322) DNA repair protein Rad51, catalytic domain {Archaeon Methanococcus voltae [TaxId: 2188]} | Back information, alignment and structure |
|---|
| >d1ko7a2 c.91.1.2 (A:130-298) HPr kinase HprK C-terminal domain {Staphylococcus xylosus [TaxId: 1288]} | Back information, alignment and structure |
|---|
| >d1knxa2 c.91.1.2 (A:133-309) HPr kinase HprK C-terminal domain {Mycoplasma pneumoniae [TaxId: 2104]} | Back information, alignment and structure |
|---|
| >d1kgda_ c.37.1.1 (A:) Guanylate kinase-like domain of Cask {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1moza_ c.37.1.8 (A:) ADP-ribosylation factor {Baker's yeast (Saccharomyces cerevisiae), ARL1 [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1azta2 c.37.1.8 (A:35-65,A:202-391) Transducin (alpha subunit) {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1uaaa1 c.37.1.19 (A:2-307) DEXX box DNA helicase {Escherichia coli, RepD [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1gsia_ c.37.1.1 (A:) Thymidylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1yrba1 c.37.1.10 (A:1-244) ATP(GTP)-binding protein PAB0955 {Pyrococcus abyssi [TaxId: 29292]} | Back information, alignment and structure |
|---|
| >d1nn5a_ c.37.1.1 (A:) Thymidylate kinase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2bmfa2 c.37.1.14 (A:178-482) Dengue virus helicase {Dengue virus type 2 [TaxId: 11060]} | Back information, alignment and structure |
|---|
| >d1ky3a_ c.37.1.8 (A:) Rab-related protein ypt7p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1z06a1 c.37.1.8 (A:32-196) Rab-33b {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1r2qa_ c.37.1.8 (A:) Rab5a {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2f7sa1 c.37.1.8 (A:5-190) Rab27b {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1pjra1 c.37.1.19 (A:1-318) DEXX box DNA helicase {Bacillus stearothermophilus, PcrA [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1knqa_ c.37.1.17 (A:) Gluconate kinase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2vp4a1 c.37.1.1 (A:12-208) Deoxyribonucleoside kinase {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1odfa_ c.37.1.6 (A:) Hypothetical protein Ygr205W {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1vhta_ c.37.1.1 (A:) Dephospho-CoA kinase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1f6ba_ c.37.1.8 (A:) SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} | Back information, alignment and structure |
|---|
| >d1s96a_ c.37.1.1 (A:) Guanylate kinase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2erya1 c.37.1.8 (A:10-180) r-Ras2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2qtvb1 c.37.1.8 (B:24-189) SAR1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1jjva_ c.37.1.1 (A:) Dephospho-CoA kinase {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d2bdta1 c.37.1.25 (A:1-176) Hypothetical protein BH3686 {Bacillus halodurans [TaxId: 86665]} | Back information, alignment and structure |
|---|
| >d1hv8a1 c.37.1.19 (A:3-210) Putative DEAD box RNA helicase {Archaeon Methanococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d1zcba2 c.37.1.8 (A:47-75,A:202-372) Transducin (alpha subunit) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1e6ca_ c.37.1.2 (A:) Shikimate kinase (AroK) {Erwinia chrysanthemi [TaxId: 556]} | Back information, alignment and structure |
|---|
| >d1upta_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARL1 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2p67a1 c.37.1.10 (A:1-327) LAO/AO transport system kinase ArgK {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1sq5a_ c.37.1.6 (A:) Pantothenate kinase PanK {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2bmea1 c.37.1.8 (A:6-179) Rab4a {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d4tmka_ c.37.1.1 (A:) Thymidylate kinase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1deka_ c.37.1.1 (A:) Deoxynucleoside monophosphate kinase {Bacteriophage T4 [TaxId: 10665]} | Back information, alignment and structure |
|---|
| >d2gjsa1 c.37.1.8 (A:91-258) Rad {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1m8pa3 c.37.1.15 (A:391-573) ATP sulfurylase C-terminal domain {Fungus (Penicillium chrysogenum) [TaxId: 5076]} | Back information, alignment and structure |
|---|
| >d1veca_ c.37.1.19 (A:) DEAD box RNA helicase rck/p54 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1byia_ c.37.1.10 (A:) Dethiobiotin synthetase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2qm8a1 c.37.1.10 (A:5-327) Metallochaperone MeaB {Methylobacterium extorquens [TaxId: 408]} | Back information, alignment and structure |
|---|
| >d2ocpa1 c.37.1.1 (A:37-277) Deoxyguanosine kinase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1zina1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1x6va3 c.37.1.4 (A:34-228) Adenosine-5'phosphosulfate kinase (APS kinase) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1e9ra_ c.37.1.11 (A:) Bacterial conjugative coupling protein TrwB {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1y63a_ c.37.1.1 (A:) Probable kinase LmjF30.1890 {Leishmania major [TaxId: 5664]} | Back information, alignment and structure |
|---|
| >d1z0fa1 c.37.1.8 (A:8-173) Rab14 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ihua1 c.37.1.10 (A:1-296) Arsenite-translocating ATPase ArsA {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1sgwa_ c.37.1.12 (A:) Putative ABC transporter PF0895 {Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d1z2aa1 c.37.1.8 (A:8-171) Rab23 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2eyqa3 c.37.1.19 (A:546-778) Transcription-repair coupling factor, TRCF {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1i2ma_ c.37.1.8 (A:) Ran {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1tmka_ c.37.1.1 (A:) Thymidylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1xzpa2 c.37.1.8 (A:212-371) TrmE GTPase domain {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d2i3ba1 c.37.1.11 (A:1-189) Cancer-related NTPase, C1orf57 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2onka1 c.37.1.12 (A:1-240) Molybdate/tungstate import ATP-binding protein WtpC (ModC) {Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d3raba_ c.37.1.8 (A:) Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1a7ja_ c.37.1.6 (A:) Phosphoribulokinase {Rhodobacter sphaeroides [TaxId: 1063]} | Back information, alignment and structure |
|---|
| >d2awna2 c.37.1.12 (A:4-235) Maltose transport protein MalK, N-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1p5zb_ c.37.1.1 (B:) Deoxycytidine kinase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1g2912 c.37.1.12 (1:1-240) Maltose transport protein MalK, N-terminal domain {Archaeon Thermococcus litoralis [TaxId: 2265]} | Back information, alignment and structure |
|---|
| >d1zaka1 c.37.1.1 (A:3-127,A:159-222) Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} | Back information, alignment and structure |
|---|