Citrus Sinensis ID: 001244


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820-------830-------840-------850-------860-------870-------880-------890-------900-------910-------920-------930-------940-------950-------960-------970-------980-------990------1000------1010------1020------1030------1040------1050------1060------1070------1080------1090------1100------1110------
MVETRRSSSSSKRALPSSQASPPPSNKRSKATDAPPSTGDMPVAPPSEAASKSGSESREPELRSSDLDLTDDAKPADVDKSVDADVEADALVSPPTPGETAVDAEKSKAVGVVFNGRVKKRATKLGKVGSRIPWARLISQCSQNSHLSMTGAVFTVGHNRQCDLYLKDPSISKNLCRLRRIENGGPSGALLEITGGKGEVEVNGNVHPKDSQVVLRGGDELVFSPSGKHSYIFQQLSDDTLAAPGIHPPMSILEAQSAPLKTMHIEARSGDPSAVAGASILASLSNIQKDLSLIPPPTKAGVDAQNSEIASLASGCDGPEDRIPDVDMKDATSNNDDAGSSSRGKTVVPQSDAANENPNLDSIGLDACVDAEIGKIPGATYELRPLLRMLAGSSSPDFDISGGISKILDEQREIRELLKDSDRPTVLISARRQAFKDSLQEGILGPENIEVSFESFPYYLSDITKNVLIASTYVHLKCNNFAKYASDLPTMCPRILLSGPAGSEIYQETLAKALAKHFSARLLIVDSLLLPGGSSKEADSVKESSRTEKASMFAKRAALLQHRKPTSSVEADITGGTAVGSQALPKPEISTASSKNYTFKKGDRVKFVGNVTSGTTVQPTLRGPGIGFRGRVILPFEDNDFSKIGVRFDRSIPEGNNLGGFCEDDHGFFCTASSLRLDSSLGDEVDKLAINELFEVALNESKSSPLIVFVKDIEKSLTGNNDAYGALKSKLENLPSNVVVIGSHTQLDSRKEKSHPGGLLFTKFGSNQTALLDLAFPDNFSRLHDRSKETPKALKQISRLFPNKVTIQLPQDEALLSDWKQQLERDVETLKGQSNIISIRSVLSRNGLDCVDLESLCIKDQTLTTEGVEKIVGWALSHHFMHCSEAPGKDAKLKISTESIMYGLNILQGIQSESKSLKKSLKDVVTENEFEKKLLADVIPPSDIGVTFDDIGALENVKDTLKELVMLPLQRPELFCKGQLTKPCKGILLFGPPGTGKTMLAKAVATEAGANFINISMSSITSKWFGEGEKYVKAVFSLASKIAPSVVFVDEVDSMLGRRENPGEHEAMRKMKNEFMVNWDGLRTKDKERVLVLAATNRPFDLDEAVVRRLPRRTCV
cccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHccccccccccccccHHHHHccccccccccccHHHcccccccccEEEEccEEEEEccccccccccccccccccEEEEEEEEccccEEEEEEEEcccEEEEccEEcccccEEEEccccEEEEcccccccEEEccccccccccccccccccccccccccccccEEcccccccccccccHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHccccccccccccccHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHcccccccccccccccccccHHHHHHHHHHHHHHccccccccccccccccccccEEEccccccHHHHHHHHHHHHHHHcccEEEEEccccccccccccHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccEEEEEEcccccccccccccccccccccEEEcccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHcccccccEEEEEcccHHHHcccHHHHHHHHHHHccccccEEEEEEccccccccccccccccccccccccHHHHHcccccccccccccccccHHHHHHHHHHcccccEEEcccccHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHcccccccccccccccccccHHHHHHHHHHHHHHHHccccccccccccccccHHHHHHccccccccccHHHHHHHcccccccccHHHHHHHHccccccccccccccccccHHHHHHHHHHHHcccccccccccccccccccEEEEEcccccHHHHHHHHHHHHcccEEEEEEccccccccccHHHHHHHHHHHHHHHccccEEEEEccHHHcccccccccHHHHHHHHHHHHHHHcccccccccEEEEEccccccccHHHHHHHcccccccc
ccccccccccccccccccccccccccccccccccccccccccccccccHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHccccccccEEEcccEEEEcccccccccccccccccHEEEEEEEEccccEEEEEEEEcccEEEEEccEEEccccEEEEccccEEEEcccccEEEEEEccccccccccccccccEEEcccccccccEEEEcccccccHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHcccccccccccccccccccccccccccccccccccHHHHHHHHHHHHcccccccccccccHHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHcccccccEEcccccccEccHHHHHHHHHHHHHHHHHHcHHHHHHccccccccEEEcccccHHHHHHHHHHHHHHHccccEEEEEcccccccccccccccccccHHHHHHHcccHHHHHHccccccccccccccccccccccccccccccccccccccccccEEEEEccccccccccccccccccccccEEEEEEcccccEEEEEEccccccccccccccccccccEEEccHHcccccccccHHHHHHHHHHHHHHHHHHccccEEEEEccHHHHccccHHHHHHHHHHHHHccccEEEEcccccccccccccccccHHHHHcccccccEEEEccccccccccccccccHHHHHHHHHHcccEEEccccccHHHHHHcccHcHHHHcccccHHHHHHHHHHHHccccccccHcHccHccHHHHHHHHHHHHHHHHHHHHHHcccccHccccEEEcccccccccEEEcccccccccccccHccccccccccccccccccccccccccHccHcHHHHHHHHHHHHHHcccccHHHHHHccccccccEEEEEcccccHHHHHHHHHHHHcccEEEEEccHHHHHHHccccHHHHHHHHHHHHHcccEEEEEEHHHHHccccccccccHHHHHHHHHHHHHHccccccccccEEEEEEccccccccHHHHHHcccEEcc
mvetrrssssskralpssqaspppsnkrskatdappstgdmpvappseaasksgsesrepelrssdldltddakpadvdksvdadveadalvspptpgetavdaekskaVGVVFNGRVKKRATklgkvgsripwarlisqcsqnshlsmtgavftvghnrqcdlylkdpsisknlcrlrrienggpsgalleitggkgevevngnvhpkdsqvvlrggdelvfspsgkhsyifqqlsddtlaapgihppmsileaqsaplktmhiearsgdpsaVAGASILASLSNIQkdlslippptkagvdaqnSEIAslasgcdgpedripdvdmkdatsnnddagsssrgktvvpqsdaanenpnldsigldacvdaeigkipgatyELRPLLRmlagssspdfdisggiSKILDEQREIRELLkdsdrptvLISARRQAFKDSlqegilgpenievsfesfpyylsdITKNVLIASTYVHLKCNnfakyasdlptmcprillsgpagseIYQETLAKALAKHFSARLLIVDslllpggsskeadsvkessRTEKASMFAKRAALLqhrkptssveaditggtavgsqalpkpeistassknytfkkgdrvkfvgnvtsgttvqptlrgpgigfrgrvilpfedndfskigvrfdrsipegnnlggfceddhgffctasslrldsslgdevDKLAINELFEVAlnesksspliVFVKDIEksltgnndaYGALKSklenlpsnvvvigshtqldsrkekshpggllftkfgsnqtalldlafpdnfsrlhdrsketPKALKQISRlfpnkvtiqlpqdeALLSDWKQQLERDVETLKGQSNIISIRSVlsrngldcvdleslcikdqtlttEGVEKIVGWALSHhfmhcseapgkdaklkiSTESIMYGLNILQGIQSESKSLKKSLKDVVTENEFEKKLladvippsdigvtfddigALENVKDTLKELVMlplqrpelfckgqltkpckgillfgppgtgkTMLAKAVATEAGANFINISMSSITSKWFGEGEKYVKAVFSLASKIAPSVVFVDEVdsmlgrrenpgeHEAMRKMKNEFMvnwdglrtkdKERVLVLAAtnrpfdldeavvrrlprrtcv
mvetrrssssskralpssqaspppsnkrskatdappstgdmpvappseaasksgsesrepelrssdldltddakPADVDKSVDADVEadalvspptpgetavdaekskavgvvfngrvkkratklgkvgsripwARLISQCSQNSHLSMTGAVFTVGHNRQCDLYLKDPSISKNLCRLRRIENGGPSGALLEITGGKGEVEVNGNVHPKDSQVVLRGGDELVFSPSGKHSYIFQQLSDDTLAAPGIHPPMSILEAQSAPLKTMHIEARSGDPSAVAGASILASLSNIQKDLSLIPPPTKAGVDAQNSEIASLASGCDGPEDRIPDVDMKDAtsnnddagsssrgktvvpqsdaanenpnldsIGLDACVDAEIGKIPGATYELRPLLRMLAGSsspdfdisgGISKILDEQREIREllkdsdrptvlISARRQAFKDSLQEGILGPENIEVSFESFPYYLSDITKNVLIASTYVHLKCNNFAKYASDLPTMCPRILLSGPAGSEIYQETLAKALAKHFSARLLIVDSlllpggsskeadsvkessrteKASMFAKRAAllqhrkptssveaditggtavgsqalpkpeistassknytfkkgdrvkfvgnvtsgttvqptlrgpgigFRGRVILPFEDNDFSKIGVRFDRSIPEGNNLGGFCEDDHGFFCTASSLRLDSSLGDEVDKLAINELFEValneskssplIVFVKDIEKSLTGNNDAYGALKSKLENLPSNVVVIGSHTQLDSRKEKSHPGGLLFTKFGSNQTALLDLAFPDNFSRLHDRSKETPKALKQISRLFPNKVTIQLPQDEALLSDWKQQLERDVEtlkgqsniisirsvlsrnglDCVDLESLcikdqtlttEGVEKIVGWALSHHFMHCSEAPGKDAKLKISTESIMYGLNILQGIQSESKSLKKSLKDVVTENEFEkklladvippsdiGVTFDDIGALENVKDTLKELVMLPLQRPELFCKGQLTKPCKGILLFGPPGTGKTMLAKAVATEAGANFINISMSSITSKWFGEGEKYVKAVFSLaskiapsvvFVDEVDSmlgrrenpgeheaMRKMKNEFMVNWDGLRTKDKERVLVLAatnrpfdldeavvrrlprrtcv
MVETrrssssskralpssqaspppsNKRSKATDAPPSTGDMPVAPPSEAASKSGSESREPELRSSDLDLTDDAKPADVDKSVDADVEADALVSPPTPGETAVDAEKSKAVGVVFNGRVKKRATKLGKVGSRIPWARLISQCSQNSHLSMTGAVFTVGHNRQCDLYLKDPSISKNLCRLRRIENGGPSGALLEITggkgevevngnvHPKDSQVVLRGGDELVFSPSGKHSYIFQQLSDDTLAAPGIHPPMSILEAQSAPLKTMHIEARSGDPSAVAGASILASLSNIQKDLSLIPPPTKAGVDAQNSEIASLASGCDGPEDRIPDVDMKDATSNNDDAGSSSRGKTVVPQSDAANENPNLDSIGLDACVDAEIGKIPGATYELRPLLRMLAGSSSPDFDISGGISKILDEQREIRELLKDSDRPTVLISARRQAFKDSLQEGILGPENIEVSFESFPYYLSDITKNVLIASTYVHLKCNNFAKYASDLPTMCPRILLSGPAGSEIYQETLAKALAKHFSARLLIVDSLLLPGGSSKEADSVKESSRTEKASMFAKRAALLQHRKPTSSVEADITGGTAVGSQALPKPEISTASSKNYTFKKGDRVKFVGNVTSGTTVQPTLRGPGIGFRGRVILPFEDNDFSKIGVRFDRSIPEGNNLGGFCEDDHGFFCTASSLRLDSSLGDEVDKLAINELFEVALNESKSSPLIVFVKDIEKSLTGNNDAYGALKSKLENLPSNVVVIGSHTQLDSRKEKSHPGGLLFTKFGSNQTALLDLAFPDNFSRLHDRSKETPKALKQISRLFPNKVTIQLPQDEALLSDWKQQLERDVETLKGQSNIISIRSVLSRNGLDCVDLESLCIKDQTLTTEGVEKIVGWALSHHFMHCSEAPGKDAKLKISTESIMYGLNILQGIQseskslkkslkDVVTENEFEKKLLADVIPPSDIGVTFDDIGALENVKDTLKELVMLPLQRPELFCKGQLTKPCKGILLFGPPGTGKTMLAKAVATEAGANFINISMSSITSKWFGEGEKYVKAVFSLASKIAPSVVFVDEVDSMLGRRENPGEHEAMRKMKNEFMVNWDGLRTKDKERVLVLAATNRPFDLDEAVVRRLPRRTCV
************************************************************************************************************AVGVVFNGRVKKRATKLGKVGSRIPWARLISQCSQNSHLSMTGAVFTVGHNRQCDLYLKDPSISKNLCRLRRIENGGPSGALLEITGGKGEVEV*********QVVLRGGDELVFSPSGKHSYIFQQLS****************************************************************************************************************************SIGLDACVDAEIGKIPGATYELRPLLRMLAG*******ISGGISKIL*****************VLISARRQAFKDSLQEGILGPENIEVSFESFPYYLSDITKNVLIASTYVHLKCNNFAKYASDLPTMCPRILLSGPAGSEIYQETLAKALAKHFSARLLIVDSLLL*******************************************************************TFKKGDRVKFVGNVTSGTTVQPTLRGPGIGFRGRVILPFEDNDFSKIGVRFDRSIPEGNNLGGFCEDDHGFFCTASSLRLDSSLGDEVDKLAINELFEVALNESKSSPLIVFVKDIEKSLTGNNDAYGALKSKLENLPSNVVVIG***************GLLFTKFGSNQTALLDLAFPDNF****************ISRLFPNKVTIQLPQDEALLSDWKQQLERDVETLKGQSNIISIRSVLSRNGLDCVDLESLCIKDQTLTTEGVEKIVGWALSHHFMHCSEAPGKDAKLKISTESIMYGLNILQGI*************VVTENEFEKKLLADVIPPSDIGVTFDDIGALENVKDTLKELVMLPLQRPELFCKGQLTKPCKGILLFGPPGTGKTMLAKAVATEAGANFINISMSSITSKWFGEGEKYVKAVFSLASKIAPSVVFVDEVD********************EFMVNWDGLRTKDKERVLVLAATNRPFDLDEAVV*********
************************************************************************************************************************************PWARLISQCSQNSHLSMTGAVFTVGHNRQCDLYLKDPSISKNLCRLRRIENGGPSGALLEITGGKGEVEVNGNVHPKDSQVVLRGGDELVFSPSGKHSYIFQQLSD*******************A***TMH*********AVAGASILA********************************************DM*********************************************GKIPGATYELRPLLRMLAG**S***DI*GGIS*******************************DSLQEGILGPENIEVSFESFPYYLSDITKNVLIASTYVHLKCNNFAKYASDLPTMCPRILLSGPAGSEIYQETLAKALAKHFSARLLIVDSLLLP*******************************************************************************************************PFEDNDFSKIGVRFD************CEDDHGFFCTASSLRLDSSLGDEVDKLAINELFEVALNESKSSPLIVFVKDIEKSLTGNNDAYGALKSKLENLPSNVVVIG********************KFGSNQTALLDLAFPDN**************LKQISRLFPNKVTIQLPQDEALLSDWKQQLERDVETLKGQSNIISIRSVLSRNGLDCVDLESLCIKDQTLTTEGVEKIVGWALSHH**************************************************FEKKLLADVIPPSDIGVTFDDIGALENVKDTLKELVMLPLQRPELFCKGQLTKPCKGILLFGPPGTGKTMLAKAVATEAGANFINISMSSITSKWFGEGEKYVKAVFSLASKIAPSVVFVDEVDS******************NEFMVNWDGLRTKDKERVLVLAATNRPFDLDEAVVRRLPRRTCV
*****************************************************************DLDLTDDAKPADVDKSVDADVEADALVS***********EKSKAVGVVFNGRVKKRATKLGKVGSRIPWARLISQCSQNSHLSMTGAVFTVGHNRQCDLYLKDPSISKNLCRLRRIENGGPSGALLEITGGKGEVEVNGNVHPKDSQVVLRGGDELVFSPSGKHSYIFQQLSDDTLAAPGIHPPMSILEAQSAPLKTMHIEARSGDPSAVAGASILASLSNIQKDLSLIPPPTKAGVDAQNSEIASLASGCDGPEDRIPDVDMKDAT******************SDAANENPNLDSIGLDACVDAEIGKIPGATYELRPLLRMLAGSSSPDFDISGGISKILDEQREIRELLKDSDRPTVLISARRQAFKDSLQEGILGPENIEVSFESFPYYLSDITKNVLIASTYVHLKCNNFAKYASDLPTMCPRILLSGPAGSEIYQETLAKALAKHFSARLLIVDSLLLPGG*****************SMFAKRAALL**********ADITGGTAVGSQALPKPEISTASSKNYTFKKGDRVKFVGNVTSGTTVQPTLRGPGIGFRGRVILPFEDNDFSKIGVRFDRSIPEGNNLGGFCEDDHGFFCTASSLRLDSSLGDEVDKLAINELFEVALNESKSSPLIVFVKDIEKSLTGNNDAYGALKSKLENLPSNVVVIGSH*********SHPGGLLFTKFGSNQTALLDLAFPDNFSRLHDRSKETPKALKQISRLFPNKVTIQLPQDEALLSDWKQQLERDVETLKGQSNIISIRSVLSRNGLDCVDLESLCIKDQTLTTEGVEKIVGWALSHHFMHCSEAPGKDAKLKISTESIMYGLNILQGIQSESKSLKKSLKDVVTENEFEKKLLADVIPPSDIGVTFDDIGALENVKDTLKELVMLPLQRPELFCKGQLTKPCKGILLFGPPGTGKTMLAKAVATEAGANFINISMSSITSKWFGEGEKYVKAVFSLASKIAPSVVFVDEVDSMLGRRENPGEHEAMRKMKNEFMVNWDGLRTKDKERVLVLAATNRPFDLDEAVVRRLPRRTCV
**********************************************************************************************************************************RIPWARLISQCSQNSHLSMTGAVFTVGHNRQCDLYLKDPSISKNLCRLRRIENGGPSGALLEITGGKGEVEVNGNVHPKDSQVVLRGGDELVFSPSGKHSYIFQQLSDDTLAAPGIHPPMSILEAQSAPLKTMHIEARSGDPS**************QKDLSLIPP************************************************************NPNLDSIGLDACVDAEIGKIPGATYELRPLLRMLAGSSSPDFDISGGISKILDEQREIRELLKDSDRPTVLISARRQAFKDSLQEGILGPENIEVSFESFPYYLSDITKNVLIASTYVHLKCNNFAKYASDLPTMCPRILLSGPAGSEIYQETLAKALAKHFSARLLIVDSLLLP*******************************************************************FKKGDRVKFVGNVTSGTTVQPTLRGPGIGFRGRVILPFEDNDFSKIGVRFDRSIPEGNNLGGFCEDDHGFFCTASSLRLDSSLGDEVDKLAINELFEVALNESKSSPLIVFVKDIEKSLTGNNDAYGALKSKLENLPSNVVVIGSHTQLDSRKEKSHPGGLLFTKFGSNQTALLDLAFPDNFSRLHDRSKETPKALKQISRLFPNKVTIQLPQDEALLSDWKQQLERDVETLKGQSNIISIRSVLSRNGLDCVDLESLCIKDQTLTTEGVEKIVGWALSHHFMHCSEAPGKDAKLKISTESIMYGLNILQGIQSESKSLKKSLKDVVTENEFEKKLLADVIPPSDIGVTFDDIGALENVKDTLKELVMLPLQRPELFCKGQLTKPCKGILLFGPPGTGKTMLAKAVATEAGANFINISMSSITSKWFGEGEKYVKAVFSLASKIAPSVVFVDEVDSMLGRRENPGEHEAMRKMKNEFMVNWDGLRTKDKERVLVLAATNRPFDLDEAVVRRLPRRTCV
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MVETRRSSSSSKRALPSSQASPPPSNKRSKATDAPPSTGDMPVAPPSEAASKSGSESREPELRSSDLDLTDDAKPADVDKSVDADVEADALVSPPTPGETAVDAEKSKAVGVVFNGRVKKRATKLGKVGSRIPWARLISQCSQNSHLSMTGAVFTVGHNRQCDLYLKDPSISKNLCRLRRIENGGPSGALLEITGGKGEVEVNGNVHPKDSQVVLRGGDELVFSPSGKHSYIFQQLSDDTLAAPGIHPPMSILEAQSAPLKTMHIEARSGDPSAVAGASILASLSNIQKDLSLIPPPTKAGVDAQNSEIASLASGCDGPEDRIPDVDMKDATSNNDDAGSSSRGKTVVPQSDAANENPNLDSIGLDACVDAEIGKIPGATYELRPLLRMLAGSSSPDFDISGGISKILDEQREIRELLKDSDRPTVLISARRQAFKDSLQEGILGPENIEVSFESFPYYLSDITKNVLIASTYVHLKCNNFAKYASDLPTMCPRILLSGPAGSEIYQETLAKALAKHFSARLLIVDSLLLPGGSSKEADSVKESSRTEKASMFAKRAALLQHRKPTSSVEADITGGTAVGSQALPKPEISTASSKNYTFKKGDRVKFVGNVTSGTTVQPTLRGPGIGFRGRVILPFEDNDFSKIGVRFDRSIPEGNNLGGFCEDDHGFFCTASSLRLDSSLGDEVDKLAINELFEVALNESKSSPLIVFVKDIEKSLTGNNDAYGALKSKLENLPSNVVVIGSHTQLDSRKEKSHPGGLLFTKFGSNQTALLDLAFPDNFSRLHDRSKETPKALKQISRLFPNKVTIQLPQDEALLSDWKQQLERDVETLKGQSNIISIRSVLSRNGLDCVDLESLCIKDQTLTTEGVEKIVGWALSHHFMHCSEAPGKDAKLKISTESIMYGLNILQGIQSESKSLKKSLKDVVTENEFEKKLLADVIPPSDIGVTFDDIGALENVKDTLKELVMLPLQRPELFCKGQLTKPCKGILLFGPPGTGKTMLAKAVATEAGANFINISMSSITSKWFGEGEKYVKAVFSLASKIAPSVVFVDEVDSMLGRRENPGEHEAMRKMKNEFMVNWDGLRTKDKERVLVLAATNRPFDLDEAVVRRLPRRTCV
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query1116 2.2.26 [Sep-21-2011]
A2VDN5 614 Spastin OS=Bos taurus GN= yes no 0.175 0.319 0.502 1e-49
Q9QYY8 614 Spastin OS=Mus musculus G yes no 0.175 0.319 0.502 1e-49
B2RYN7 581 Spastin OS=Rattus norvegi no no 0.175 0.337 0.502 2e-49
Q719N1 613 Spastin (Fragment) OS=Sus no no 0.175 0.319 0.497 5e-49
Q9UBP0 616 Spastin OS=Homo sapiens G yes no 0.175 0.318 0.497 6e-49
Q5ZK92 613 Spastin OS=Gallus gallus yes no 0.161 0.293 0.519 7e-49
Q6NW58 570 Spastin OS=Danio rerio GN yes no 0.175 0.343 0.487 1e-48
P28737 362 Protein MSP1 OS=Saccharom yes no 0.169 0.522 0.479 3e-48
F6QV99 361 ATPase family AAA domain- no no 0.177 0.548 0.463 5e-48
Q505J9 361 ATPase family AAA domain- no no 0.177 0.548 0.463 5e-48
>sp|A2VDN5|SPAST_BOVIN Spastin OS=Bos taurus GN=SPAST PE=2 SV=1 Back     alignment and function desciption
 Score =  199 bits (506), Expect = 1e-49,   Method: Compositional matrix adjust.
 Identities = 100/199 (50%), Positives = 138/199 (69%), Gaps = 3/199 (1%)

Query: 918  KKSLKDVVTENEFEKKLLADVIPPSDIGVTFDDIGALENVKDTLKELVMLPLQRPELFCK 977
            KK LK+    +     L+ + I  +   V FDDI   E  K  L+E+V+LP  RPELF  
Sbjct: 309  KKDLKNFRNVDSNLANLIMNEIVDNGTAVKFDDIAGQELAKQALQEIVILPSLRPELFTG 368

Query: 978  GQLTKPCKGILLFGPPGTGKTMLAKAVATEAGANFINISMSSITSKWFGEGEKYVKAVFS 1037
              L  P +G+LLFGPPG GKTMLAKAVA E+ A F NIS +S+TSK+ GEGEK V+A+F+
Sbjct: 369  --LRAPARGLLLFGPPGNGKTMLAKAVAAESNATFFNISAASLTSKYVGEGEKLVRALFA 426

Query: 1038 LASKIAPSVVFVDEVDSMLGRRENPGEHEAMRKMKNEFMVNWDGLRTKDKERVLVLAATN 1097
            +A ++ PS++F+DEVDS+L  R   GEH+A R++K EF++ +DG+++   +RVLV+ ATN
Sbjct: 427  VARELQPSIIFIDEVDSLLCERRE-GEHDASRRLKTEFLIEFDGVQSAGDDRVLVMGATN 485

Query: 1098 RPFDLDEAVVRRLPRRTCV 1116
            RP +LDEAV+RR  +R  V
Sbjct: 486  RPQELDEAVLRRFTKRVYV 504




ATP-dependent microtubule severing protein. Microtubule severing may promote reorganization of cellular microtubule arrays and the release of microtubules from the centrosome following nucleation. Required for membrane traffic from the endoplasmic reticulum (ER) to the Golgi and for completion of the abscission stage of cytokinesis. Also plays a role in axon growth and the formation of axonal branches.
Bos taurus (taxid: 9913)
EC: 3EC: .EC: 6EC: .EC: 4EC: .EC: 3
>sp|Q9QYY8|SPAST_MOUSE Spastin OS=Mus musculus GN=Spast PE=2 SV=3 Back     alignment and function description
>sp|B2RYN7|SPAST_RAT Spastin OS=Rattus norvegicus GN=Spast PE=2 SV=1 Back     alignment and function description
>sp|Q719N1|SPAST_PIG Spastin (Fragment) OS=Sus scrofa GN=SPAST PE=2 SV=2 Back     alignment and function description
>sp|Q9UBP0|SPAST_HUMAN Spastin OS=Homo sapiens GN=SPAST PE=1 SV=1 Back     alignment and function description
>sp|Q5ZK92|SPAST_CHICK Spastin OS=Gallus gallus GN=SPAST PE=2 SV=1 Back     alignment and function description
>sp|Q6NW58|SPAST_DANRE Spastin OS=Danio rerio GN=spast PE=2 SV=2 Back     alignment and function description
>sp|P28737|MSP1_YEAST Protein MSP1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MSP1 PE=1 SV=2 Back     alignment and function description
>sp|F6QV99|ATAD1_BOVIN ATPase family AAA domain-containing protein 1 OS=Bos taurus GN=ATAD1 PE=2 SV=2 Back     alignment and function description
>sp|Q505J9|ATAD1_RAT ATPase family AAA domain-containing protein 1 OS=Rattus norvegicus GN=Atad1 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query1116
359479902 1258 PREDICTED: uncharacterized protein LOC10 0.968 0.859 0.723 0.0
297743865 1287 unnamed protein product [Vitis vinifera] 0.969 0.840 0.707 0.0
449436513 1270 PREDICTED: uncharacterized protein LOC10 0.968 0.851 0.673 0.0
224131154 1231 predicted protein [Populus trichocarpa] 0.887 0.804 0.724 0.0
356536729 1250 PREDICTED: uncharacterized protein LOC10 0.940 0.84 0.686 0.0
356536727 1247 PREDICTED: uncharacterized protein LOC10 0.957 0.857 0.678 0.0
224064434 1223 predicted protein [Populus trichocarpa] 0.901 0.822 0.707 0.0
356502858 1235 PREDICTED: uncharacterized protein LOC10 0.965 0.872 0.662 0.0
357442557 1242 Katanin p60 ATPase-containing subunit A- 0.979 0.880 0.646 0.0
356502860 1334 PREDICTED: uncharacterized protein LOC10 0.859 0.718 0.719 0.0
>gi|359479902|ref|XP_002267361.2| PREDICTED: uncharacterized protein LOC100260666 [Vitis vinifera] Back     alignment and taxonomy information
 Score = 1539 bits (3985), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 800/1106 (72%), Positives = 910/1106 (82%), Gaps = 25/1106 (2%)

Query: 27   KRSKATDAPPSTGDMPVAPPSEA---ASKSGSESREPELRSSDLDLTDDAKPADV----- 78
            KRSK+ +   S+ ++P   P EA   A +SGSE  +   + SD   TD +K +D      
Sbjct: 27   KRSKSQETASSSSEVPGPLPEEALCQAKESGSEHIDQAPQPSDPPRTDTSKASDACDVIA 86

Query: 79   -DKSVDADVEADALV--SPPTPGETAVDAEKSKAVGVVFNGRVKKRATKLGKVGSRIPWA 135
             +KS +A  E +ALV  SP    ++AV  EKSK+V VV N R +KR+ K     + + W 
Sbjct: 87   KEKSTEAVAEGEALVAASPLPLVDSAVGGEKSKSVAVVSN-RGRKRSVK---SNATVAWG 142

Query: 136  RLISQCSQNSHLSMTGAVFTVGHNRQCDLYLKDPSISKNLCRLRRIENGGPSGALLEITG 195
            +L+SQCSQ  H  + G +FT+G +R  +L L+DPSIS  LCRLR IE GG S  LLEITG
Sbjct: 143  KLLSQCSQYPHQPLCGPLFTIGQSRASNLSLRDPSISNTLCRLRHIERGGASVVLLEITG 202

Query: 196  GKGEVEVNGNVHPKDSQVVLRGGDELVFSPSGKHSYIFQQLSDDTLAAPGIHPPMSILEA 255
            GKG V+VNG +H K S +++ GGDELVFS SG+ +YIFQQ + D LAAP I   +SILEA
Sbjct: 203  GKGVVQVNGKIHQKSSTLIISGGDELVFSASGQPAYIFQQFTSDNLAAPVIPSSVSILEA 262

Query: 256  QSAPLKTMHIEARSGDPSAVAGASILASLSNIQKDLSLIPPPTKAGVDAQN-SEIASLAS 314
            QSAP+K +H+EARSGDPSAVAGASILASLSN++KDLSL+PPP K+G D Q  +E+ +   
Sbjct: 263  QSAPVKGIHVEARSGDPSAVAGASILASLSNLRKDLSLLPPP-KSGEDVQQGTEMTT--P 319

Query: 315  GCDGPEDRIPDVDMKDATSNNDDAGSSSRGKTVVPQSDAANENPNLDSIGLDACVDAEIG 374
             C   +  IPD DMKDA  NND AG SSR KT VP S+AANEN NL SIGLDAC D EIG
Sbjct: 320  PCGASDSCIPDADMKDA-ENNDVAGVSSREKTDVPSSEAANENLNLQSIGLDACTDTEIG 378

Query: 375  KIPGATYELRPLLRMLAGSSSPDFDISGGISKILDEQREIRELLKDSDRPTVLISARRQA 434
            K+PGATYELRPLLRMLAGSSS DFD+SG ISKIL+EQREIRE+LKD + P  L S RRQA
Sbjct: 379  KVPGATYELRPLLRMLAGSSSSDFDLSGSISKILEEQREIREILKDLEPPMALTSTRRQA 438

Query: 435  FKDSLQEGILGPENIEVSFESFPYYLSDITKNVLIASTYVHLKCNNFAKYASDLPTMCPR 494
            FKDSLQEGIL  ++IEVSFESFPYYLSD TKNVLI STY+HL    FAKY  DL ++CPR
Sbjct: 439  FKDSLQEGILSSDDIEVSFESFPYYLSDTTKNVLITSTYIHLMHIKFAKYTMDLSSVCPR 498

Query: 495  ILLSGPAGSEIYQETLAKALAKHFSARLLIVDSLLLPGGSS-KEADSVKESSRTEKASMF 553
            ILLSGPAGSEIYQETL KALAKHF+ARLLIVDSLLLPGGS+ K+ D VKE++R E+AS+F
Sbjct: 499  ILLSGPAGSEIYQETLTKALAKHFTARLLIVDSLLLPGGSTPKDPDPVKENTRGERASIF 558

Query: 554  AKRAA---LLQHRKPTSSVEADITGGTAVGSQALPKPEISTASSKNYTFKKGDRVKFVGN 610
            AKRAA   +LQH+KP SSVEADITG + V S+ALPK E STA+SKNY FK G  VKFVG 
Sbjct: 559  AKRAAQAAVLQHKKPASSVEADITGASTVSSRALPKQETSTATSKNYIFKAG-IVKFVGP 617

Query: 611  VTSGTTVQPTLRGPGIGFRGRVILPFEDNDFSKIGVRFDRSIPEGNNLGGFCEDDHGFFC 670
              SG +  P LRGP  G+RG+V+L FE+N  SKIGVRFDRSIPEGN+LGG CEDDHGFFC
Sbjct: 618  PPSGFSPMPPLRGPTNGYRGKVLLAFEENGSSKIGVRFDRSIPEGNDLGGLCEDDHGFFC 677

Query: 671  TASSLRLDSSLGDEVDKLAINELFEVALNESKSSPLIVFVKDIEKSLTGNNDAYGALKSK 730
             A  LRLDSS  D+VDKLA+NELFEVA NESKSSPLI+F+KDIEKS+ GN +AY      
Sbjct: 678  PADLLRLDSSSSDDVDKLALNELFEVASNESKSSPLILFIKDIEKSIVGNPEAYXXXXXX 737

Query: 731  LENLPSNVVVIGSHTQLDSRKEKSHPGGLLFTKFGSNQTALLDLAFPDNFSRLHDRSKET 790
            L+NLP N+V+IGSHTQ+DSRKEKSHPGGLLFTKFGSNQTALLDLAFPDNF RLHDRSKET
Sbjct: 738  LDNLPENIVIIGSHTQMDSRKEKSHPGGLLFTKFGSNQTALLDLAFPDNFGRLHDRSKET 797

Query: 791  PKALKQISRLFPNKVTIQLPQDEALLSDWKQQLERDVETLKGQSNIISIRSVLSRNGLDC 850
            PK +KQ++RLFPNKV IQLPQDE+LL DWKQQL+RD ETLK Q+NI++IRSVL+RNGLDC
Sbjct: 798  PKTMKQLTRLFPNKVMIQLPQDESLLLDWKQQLDRDGETLKAQANIVNIRSVLNRNGLDC 857

Query: 851  VDLESLCIKDQTLTTEGVEKIVGWALSHHFMHCSEAPGKDAKLKISTESIMYGLNILQGI 910
             DLE+L IKDQ+L ++GV+K+VGWALS+HFMHCS+A  +D+KL IS+ESI YGLN+LQGI
Sbjct: 858  PDLETLSIKDQSLASDGVDKLVGWALSYHFMHCSDASVRDSKLLISSESISYGLNLLQGI 917

Query: 911  QSESKSLKKSLKDVVTENEFEKKLLADVIPPSDIGVTFDDIGALENVKDTLKELVMLPLQ 970
            QSESKSLKKSLKDVVTENEFEKKLL+DVIPPSDIGVTFDDIGALENVKDTLKELVMLPLQ
Sbjct: 918  QSESKSLKKSLKDVVTENEFEKKLLSDVIPPSDIGVTFDDIGALENVKDTLKELVMLPLQ 977

Query: 971  RPELFCKGQLTKPCKGILLFGPPGTGKTMLAKAVATEAGANFINISMSSITSKWFGEGEK 1030
            RPELFCKGQLTKPCKGILLFGPPGTGKTMLAKAVATEAGANFINISMSSITSKWFGEGEK
Sbjct: 978  RPELFCKGQLTKPCKGILLFGPPGTGKTMLAKAVATEAGANFINISMSSITSKWFGEGEK 1037

Query: 1031 YVKAVFSLASKIAPSVVFVDEVDSMLGRRENPGEHEAMRKMKNEFMVNWDGLRTKDKERV 1090
            YVKAVFSLASKIAPSVVFVDEVDSMLGRRENPGEHEAMRKMKNEFMVNWDGLRTKDKERV
Sbjct: 1038 YVKAVFSLASKIAPSVVFVDEVDSMLGRRENPGEHEAMRKMKNEFMVNWDGLRTKDKERV 1097

Query: 1091 LVLAATNRPFDLDEAVVRRLPRRTCV 1116
            LVLAATNRPFDLDEAV+RRLPRR  V
Sbjct: 1098 LVLAATNRPFDLDEAVIRRLPRRLMV 1123




Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|297743865|emb|CBI36835.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|449436513|ref|XP_004136037.1| PREDICTED: uncharacterized protein LOC101211144 [Cucumis sativus] Back     alignment and taxonomy information
>gi|224131154|ref|XP_002321014.1| predicted protein [Populus trichocarpa] gi|222861787|gb|EEE99329.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|356536729|ref|XP_003536888.1| PREDICTED: uncharacterized protein LOC100794932 [Glycine max] Back     alignment and taxonomy information
>gi|356536727|ref|XP_003536887.1| PREDICTED: uncharacterized protein LOC100794406 [Glycine max] Back     alignment and taxonomy information
>gi|224064434|ref|XP_002301474.1| predicted protein [Populus trichocarpa] gi|222843200|gb|EEE80747.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|356502858|ref|XP_003520232.1| PREDICTED: uncharacterized protein LOC100800938 [Glycine max] Back     alignment and taxonomy information
>gi|357442557|ref|XP_003591556.1| Katanin p60 ATPase-containing subunit A-like protein [Medicago truncatula] gi|355480604|gb|AES61807.1| Katanin p60 ATPase-containing subunit A-like protein [Medicago truncatula] Back     alignment and taxonomy information
>gi|356502860|ref|XP_003520233.1| PREDICTED: uncharacterized protein LOC100801477 [Glycine max] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query1116
TAIR|locus:2133298 1265 AT4G02480 [Arabidopsis thalian 0.946 0.834 0.629 0.0
TAIR|locus:2126783 1122 AT4G24860 [Arabidopsis thalian 0.297 0.295 0.661 3.9e-185
TAIR|locus:2132922 830 AT4G28000 [Arabidopsis thalian 0.172 0.232 0.675 5.4e-115
TAIR|locus:2031005 1003 AT1G50140 [Arabidopsis thalian 0.380 0.423 0.412 2.1e-101
TAIR|locus:2024522 829 DAA1 "DUO1-activated ATPase 1" 0.391 0.527 0.400 1.2e-94
TAIR|locus:4010714050 829 AT5G52882 [Arabidopsis thalian 0.390 0.525 0.406 6e-91
TAIR|locus:2137777 398 AT4G27680 [Arabidopsis thalian 0.168 0.472 0.576 7.1e-54
TAIR|locus:2168646 403 AT5G53540 [Arabidopsis thalian 0.168 0.466 0.560 1.1e-52
ASPGD|ASPL0000064167 410 AN7047 [Emericella nidulans (t 0.168 0.458 0.517 5.9e-48
UNIPROTKB|G4MSN3 424 MGG_07075 "ATPase family AAA d 0.164 0.433 0.5 1.8e-47
TAIR|locus:2133298 AT4G02480 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 3313 (1171.3 bits), Expect = 0., Sum P(2) = 0.
 Identities = 692/1099 (62%), Positives = 817/1099 (74%)

Query:    37 STGDMPVAPPSEAASKSGSESREPELRSSDLDLTDDAKPA---DV---DKS--VDADVEA 88
             S  ++P+     A S  GSES EPEL SSD    D  KP    DV   + S   DA+ E 
Sbjct:    56 SASEVPIENQGPA-SDPGSESGEPELGSSDPQAMDAEKPVVTTDVPVMENSPETDANPEV 114

Query:    89 DALVSPPTPGETAVDAEKSKAVGVVFNGRVKKRATKLGKVGSRIPWARLISQCSQNSHLS 148
             + L +P   GE   DA+KSKA         KKRA K        PWA+L+SQ SQN H  
Sbjct:   115 EVLATPTVAGEAVADADKSKAA--------KKRALKA-------PWAKLLSQYSQNPHRV 159

Query:   149 MTGAVFTVGHNRQCDLYLKDPSISKNLCRLRRIENGGPSGALLEITXXXXXXXXXXXXHP 208
             + G VFTVG  R CDL ++D ++   LC L++ E+GGPS A LEI             + 
Sbjct:   160 IRGPVFTVGR-RGCDLSIRDQAMPSTLCELKQSEHGGPSVASLEILGNGVIVHVNGKCYQ 218

Query:   209 KDSQVVLRGGDELVFSPSGKHSYIFQQLSDDTLAAPGIHPPMSILEAQSAPLKTMHIEAR 268
             K + V LRGGDE++FS +GKH+YIFQ + D+ LAAP     +SI EA+ APLK +H+E R
Sbjct:   219 KSTCVHLRGGDEVIFSLNGKHAYIFQPVKDENLAAPDRASSLSICEARGAPLKGVHVETR 278

Query:   269 SGD---PSAVAGASILASLSNIQKDLSLIPPPTKAGVDAQNSEIASLASGCDGPEDRIPD 325
             +GD    S V GASILASLS + +   L+PP  KAG   QN  +  + S  +   D I D
Sbjct:   279 AGDVDGASDVDGASILASLSKL-RSFHLLPPIAKAGKRQQNPAVPVVPSSFN---DCISD 334

Query:   326 VDMKDATSNNDDAGSSSRGKTVVPQSDA-ANENPNLDSIGLDACVDAEIGKIPGATYELR 384
              DM DA SNND A  +S  K     +   ANEN N+D  GLD   +A+ G +P A YE+R
Sbjct:   335 TDMNDADSNNDHAAVASVEKIAAASTPGTANENLNVDGSGLDPFQEADGGNVPAAGYEIR 394

Query:   385 PLLRMLAGSSSPDFDISGGISKILDEQREIRELLKDSDRPTVLISARRQAFKDSLQEGIL 444
             P++ +L  SSS  FDI G IS++LDE+RE++E L++ D  +  IS RRQAFKDSL+ G+L
Sbjct:   395 PIVHLLGESSS--FDIRGSISRLLDERREVKEFLREFDLSST-ISTRRQAFKDSLRGGVL 451

Query:   445 GPENIEVSFESFPYYLSDITKNVLIASTYVHLKCNN-FAKYASDLPTMCPRILLSGPAGS 503
               +NI++SFE+FPYYLS  TK VL+ S YVH+   + +A +A+DL T CPRILLSGP+GS
Sbjct:   452 NAQNIDISFENFPYYLSATTKGVLMISMYVHMNGGSKYANFATDLTTACPRILLSGPSGS 511

Query:   504 EIYQETLAKALAKHFSARLLIVDSLLLPGGS-SKEADSVKESSRTEKASMFAKRAA---- 558
             EIYQE LAKALAK F A+L+IVDSLLLPGGS ++EA+S KE SR E+ SM AKRA     
Sbjct:   512 EIYQEMLAKALAKQFGAKLMIVDSLLLPGGSPAREAESSKEGSRRERLSMLAKRAVQAAQ 571

Query:   559 LLQHRKPTSSVEADITGGTAVGSQALPKPEISTASSKNYTFKKGDRVKFVGNVTSG-TTV 617
             +LQH+KPTSSV+ADITGG+ + SQALPK E+STA+SK+YTFK GDRVKFVG   S  +++
Sbjct:   572 VLQHKKPTSSVDADITGGSTLSSQALPKQEVSTATSKSYTFKAGDRVKFVGPSASAISSL 631

Query:   618 QPTLRGPGIGFRGRVILPFEDNDFSKIGVRFDRSIPEGNNLGGFCEDDHGFFCTASSLRL 677
             Q  LRGP IG +G+V L FEDN  SKIG+RFDR + +GN+LGG CE+DHGFFC ASSLRL
Sbjct:   632 QGQLRGPAIGSQGKVALAFEDNCASKIGIRFDRPVQDGNDLGGLCEEDHGFFCAASSLRL 691

Query:   678 DSSLGDEVDKLAINELFEVALNESKSSPLIVFVKDIEKSLTGNNDAYGALKSKLENLPSN 737
             + S  D+ DKLA+NE+FEVAL+ES+   LI+F+KDIEKSL GN+D Y  LKSKLE LP N
Sbjct:   692 EGSSSDDADKLAVNEIFEVALSESEGGSLILFLKDIEKSLVGNSDVYATLKSKLETLPEN 751

Query:   738 VVVIGSHTQLDSRKEKSHPGGLLFTKFGSNQTALLDLAFPDNFSRLHDRSKETPKALKQI 797
             +VVI S TQLDSRKEKSHPGG LFTKFG NQTALLDLAFPDNF +LHDRSKETPK++KQI
Sbjct:   752 IVVIASQTQLDSRKEKSHPGGFLFTKFGGNQTALLDLAFPDNFGKLHDRSKETPKSMKQI 811

Query:   798 SRLFPNKVTIQLPQDEALLSDWKQQLERDVETLKGQSNIISIRSVLSRNGLDCVDLESLC 857
             +RLFPNK+ IQLPQ+EALLSDWK++L+RD E LK Q+NI SI +VL++N LDC DL +LC
Sbjct:   812 TRLFPNKIAIQLPQEEALLSDWKEKLDRDTEILKVQANITSILAVLAKNKLDCPDLGTLC 871

Query:   858 IKDQTLTTEGVEKIVGWALSHHFMHCSEAPGKDAKLKISTESIMYGLNILQGIQXXXXXX 917
             IKDQTL +E VEK+VGWA  HH M C+E   KD KL IS ESI YGL  L  IQ      
Sbjct:   872 IKDQTLPSESVEKVVGWAFGHHLMICTEPIVKDNKLVISAESISYGLQTLHDIQNENKSL 931

Query:   918 XXXXXDVVTENEFEKKLLADVIPPSDIGVTFDDIGALENVKDTLKELVMLPLQRPELFCK 977
                  DVVTENEFEKKLL+DVIPPSDIGV+FDDIGALENVK+TLKELVMLPLQRPELF K
Sbjct:   932 KKSLKDVVTENEFEKKLLSDVIPPSDIGVSFDDIGALENVKETLKELVMLPLQRPELFDK 991

Query:   978 GQLTKPCKGILLFGPPGTGKTMLAKAVATEAGANFINISMSSITSKWFGEGEKYVKAVFS 1037
             GQLTKP KGILLFGPPGTGKTMLAKAVATEAGANFINISMSSITSKWFGEGEKYVKAVFS
Sbjct:   992 GQLTKPTKGILLFGPPGTGKTMLAKAVATEAGANFINISMSSITSKWFGEGEKYVKAVFS 1051

Query:  1038 LASKIAPSVVFVDEVDSMLGRRENPGEHEAMRKMKNEFMVNWDGLRTKDKERVLVLAATN 1097
             LASKIAPSV+FVDEVDSMLGRRENPGEHEAMRKMKNEFMVNWDGLRTKD+ERVLVLAATN
Sbjct:  1052 LASKIAPSVIFVDEVDSMLGRRENPGEHEAMRKMKNEFMVNWDGLRTKDRERVLVLAATN 1111

Query:  1098 RPFDLDEAVVRRLPRRTCV 1116
             RPFDLDEAV+RRLPRR  V
Sbjct:  1112 RPFDLDEAVIRRLPRRLMV 1130


GO:0000166 "nucleotide binding" evidence=IEA
GO:0005524 "ATP binding" evidence=IEA
GO:0009507 "chloroplast" evidence=ISM
GO:0016887 "ATPase activity" evidence=ISS
GO:0017111 "nucleoside-triphosphatase activity" evidence=IEA
GO:0006487 "protein N-linked glycosylation" evidence=RCA
GO:0009630 "gravitropism" evidence=RCA
TAIR|locus:2126783 AT4G24860 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2132922 AT4G28000 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2031005 AT1G50140 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2024522 DAA1 "DUO1-activated ATPase 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:4010714050 AT5G52882 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2137777 AT4G27680 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2168646 AT5G53540 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
ASPGD|ASPL0000064167 AN7047 [Emericella nidulans (taxid:162425)] Back     alignment and assigned GO terms
UNIPROTKB|G4MSN3 MGG_07075 "ATPase family AAA domain-containing protein 1" [Magnaporthe oryzae 70-15 (taxid:242507)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Your Input:
GSVIVG00027975001
SubName- Full=Chromosome chr7 scaffold_42, whole genome shotgun sequence; (1146 aa)
(Vitis vinifera)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query1116
COG0464494 COG0464, SpoVK, ATPases of the AAA+ class [Posttra 7e-57
pfam00004131 pfam00004, AAA, ATPase family associated with vari 8e-45
PRK03992389 PRK03992, PRK03992, proteasome-activating nucleoti 6e-41
COG1222406 COG1222, RPT1, ATP-dependent 26S proteasome regula 2e-40
TIGR01243 733 TIGR01243, CDC48, AAA family ATPase, CDC48 subfami 9e-38
TIGR01242364 TIGR01242, 26Sp45, 26S proteasome subunit P45 fami 3e-37
TIGR01243 733 TIGR01243, CDC48, AAA family ATPase, CDC48 subfami 2e-36
PTZ00454398 PTZ00454, PTZ00454, 26S protease regulatory subuni 3e-32
PTZ00361438 PTZ00361, PTZ00361, 26 proteosome regulatory subun 1e-31
TIGR01241 495 TIGR01241, FtsH_fam, ATP-dependent metalloprotease 7e-30
CHL00176 638 CHL00176, ftsH, cell division protein; Validated 6e-28
COG1223368 COG1223, COG1223, Predicted ATPase (AAA+ superfami 7e-25
PRK10733 644 PRK10733, hflB, ATP-dependent metalloprotease; Rev 5e-24
cd00009151 cd00009, AAA, The AAA+ (ATPases Associated with a 9e-23
TIGR03689 512 TIGR03689, pup_AAA, proteasome ATPase 1e-22
COG0465 596 COG0465, HflB, ATP-dependent Zn proteases [Posttra 2e-22
smart00382148 smart00382, AAA, ATPases associated with a variety 8e-16
COG0464 494 COG0464, SpoVK, ATPases of the AAA+ class [Posttra 1e-15
CHL00195489 CHL00195, ycf46, Ycf46; Provisional 6e-11
PRK13342 413 PRK13342, PRK13342, recombination factor protein R 1e-07
cd00060102 cd00060, FHA, Forkhead associated domain (FHA); fo 2e-06
COG0714 329 COG0714, COG0714, MoxR-like ATPases [General funct 3e-06
COG1224 450 COG1224, TIP49, DNA helicase TIP49, TBP-interactin 7e-06
COG2256 436 COG2256, MGS1, ATPase related to the helicase subu 9e-06
pfam07724168 pfam07724, AAA_2, AAA domain (Cdc48 subfamily) 1e-04
pfam0049867 pfam00498, FHA, FHA domain 1e-04
PRK00080 328 PRK00080, ruvB, Holliday junction DNA helicase Ruv 1e-04
COG2255 332 COG2255, RuvB, Holliday junction resolvasome, heli 2e-04
pfam05496231 pfam05496, RuvB_N, Holliday junction DNA helicase 0.001
PHA02544 316 PHA02544, 44, clamp loader, small subunit; Provisi 0.001
pfam06068 395 pfam06068, TIP49, TIP49 C-terminus 0.002
PRK04195 482 PRK04195, PRK04195, replication factor C large sub 0.002
pfam01078207 pfam01078, Mg_chelatase, Magnesium chelatase, subu 0.002
COG0466 782 COG0466, Lon, ATP-dependent Lon protease, bacteria 0.002
TIGR00763 775 TIGR00763, lon, ATP-dependent protease La 0.003
pfam13207114 pfam13207, AAA_17, AAA domain 0.004
>gnl|CDD|223540 COG0464, SpoVK, ATPases of the AAA+ class [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
 Score =  205 bits (522), Expect = 7e-57
 Identities = 93/208 (44%), Positives = 129/208 (62%), Gaps = 12/208 (5%)

Query: 913  ESKSLKKSLKDVVTENEFEKKLLADVIPPSDIG-----VTFDDIGALENVKDTLKELVML 967
                        VTE++FE+  L  V+P   +      VT DDIG LE  K+ LKE +  
Sbjct: 202  RRAIDLVGEYIGVTEDDFEE-ALKKVLPSRGVLFEDEDVTLDDIGGLEEAKEELKEAIET 260

Query: 968  PLQRPELFCKGQLTKPCKGILLFGPPGTGKTMLAKAVATEAGANFINISMSSITSKWFGE 1027
            PL+RPELF K  L +P KG+LL+GPPGTGKT+LAKAVA E+ + FI++  S + SKW GE
Sbjct: 261  PLKRPELFRKLGL-RPPKGVLLYGPPGTGKTLLAKAVALESRSRFISVKGSELLSKWVGE 319

Query: 1028 GEKYVKAVFSLASKIAPSVVFVDEVDSMLGRRENPGEHEAMRKMKNEFMVNWDGLRTKDK 1087
             EK ++ +F  A K+APS++F+DE+DS+   R  P E  + R++  + +   DG+  +  
Sbjct: 320  SEKNIRELFEKARKLAPSIIFIDEIDSLASGR-GPSEDGSGRRVVGQLLTELDGI--EKA 376

Query: 1088 ERVLVLAATNRPFDLDEAVVR--RLPRR 1113
            E VLV+AATNRP DLD A++R  R  R 
Sbjct: 377  EGVLVIAATNRPDDLDPALLRPGRFDRL 404


Length = 494

>gnl|CDD|215649 pfam00004, AAA, ATPase family associated with various cellular activities (AAA) Back     alignment and domain information
>gnl|CDD|179699 PRK03992, PRK03992, proteasome-activating nucleotidase; Provisional Back     alignment and domain information
>gnl|CDD|224143 COG1222, RPT1, ATP-dependent 26S proteasome regulatory subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|233328 TIGR01243, CDC48, AAA family ATPase, CDC48 subfamily Back     alignment and domain information
>gnl|CDD|130309 TIGR01242, 26Sp45, 26S proteasome subunit P45 family Back     alignment and domain information
>gnl|CDD|233328 TIGR01243, CDC48, AAA family ATPase, CDC48 subfamily Back     alignment and domain information
>gnl|CDD|240423 PTZ00454, PTZ00454, 26S protease regulatory subunit 6B-like protein; Provisional Back     alignment and domain information
>gnl|CDD|185575 PTZ00361, PTZ00361, 26 proteosome regulatory subunit 4-like protein; Provisional Back     alignment and domain information
>gnl|CDD|233327 TIGR01241, FtsH_fam, ATP-dependent metalloprotease FtsH Back     alignment and domain information
>gnl|CDD|214386 CHL00176, ftsH, cell division protein; Validated Back     alignment and domain information
>gnl|CDD|224144 COG1223, COG1223, Predicted ATPase (AAA+ superfamily) [General function prediction only] Back     alignment and domain information
>gnl|CDD|182683 PRK10733, hflB, ATP-dependent metalloprotease; Reviewed Back     alignment and domain information
>gnl|CDD|99707 cd00009, AAA, The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold Back     alignment and domain information
>gnl|CDD|200312 TIGR03689, pup_AAA, proteasome ATPase Back     alignment and domain information
>gnl|CDD|223541 COG0465, HflB, ATP-dependent Zn proteases [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|214640 smart00382, AAA, ATPases associated with a variety of cellular activities Back     alignment and domain information
>gnl|CDD|223540 COG0464, SpoVK, ATPases of the AAA+ class [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|177094 CHL00195, ycf46, Ycf46; Provisional Back     alignment and domain information
>gnl|CDD|237355 PRK13342, PRK13342, recombination factor protein RarA; Reviewed Back     alignment and domain information
>gnl|CDD|238017 cd00060, FHA, Forkhead associated domain (FHA); found in eukaryotic and prokaryotic proteins Back     alignment and domain information
>gnl|CDD|223786 COG0714, COG0714, MoxR-like ATPases [General function prediction only] Back     alignment and domain information
>gnl|CDD|224145 COG1224, TIP49, DNA helicase TIP49, TBP-interacting protein [Transcription] Back     alignment and domain information
>gnl|CDD|225165 COG2256, MGS1, ATPase related to the helicase subunit of the Holliday junction resolvase [DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|219536 pfam07724, AAA_2, AAA domain (Cdc48 subfamily) Back     alignment and domain information
>gnl|CDD|215951 pfam00498, FHA, FHA domain Back     alignment and domain information
>gnl|CDD|234619 PRK00080, ruvB, Holliday junction DNA helicase RuvB; Reviewed Back     alignment and domain information
>gnl|CDD|225164 COG2255, RuvB, Holliday junction resolvasome, helicase subunit [DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|203260 pfam05496, RuvB_N, Holliday junction DNA helicase ruvB N-terminus Back     alignment and domain information
>gnl|CDD|222866 PHA02544, 44, clamp loader, small subunit; Provisional Back     alignment and domain information
>gnl|CDD|147949 pfam06068, TIP49, TIP49 C-terminus Back     alignment and domain information
>gnl|CDD|235250 PRK04195, PRK04195, replication factor C large subunit; Provisional Back     alignment and domain information
>gnl|CDD|144608 pfam01078, Mg_chelatase, Magnesium chelatase, subunit ChlI Back     alignment and domain information
>gnl|CDD|223542 COG0466, Lon, ATP-dependent Lon protease, bacterial type [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|233119 TIGR00763, lon, ATP-dependent protease La Back     alignment and domain information
>gnl|CDD|221983 pfam13207, AAA_17, AAA domain Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 1116
KOG0733 802 consensus Nuclear AAA ATPase (VCP subfamily) [Post 100.0
KOG0730693 consensus AAA+-type ATPase [Posttranslational modi 100.0
KOG0736 953 consensus Peroxisome assembly factor 2 containing 100.0
TIGR01243 733 CDC48 AAA family ATPase, CDC48 subfamily. This sub 100.0
KOG0741744 consensus AAA+-type ATPase [Posttranslational modi 100.0
KOG0737 386 consensus AAA+-type ATPase [Posttranslational modi 100.0
KOG0735 952 consensus AAA+-type ATPase [Posttranslational modi 100.0
COG0464494 SpoVK ATPases of the AAA+ class [Posttranslational 100.0
COG1222406 RPT1 ATP-dependent 26S proteasome regulatory subun 100.0
KOG0738 491 consensus AAA+-type ATPase [Posttranslational modi 100.0
KOG0739 439 consensus AAA+-type ATPase [Posttranslational modi 100.0
KOG0733 802 consensus Nuclear AAA ATPase (VCP subfamily) [Post 99.97
KOG0734 752 consensus AAA+-type ATPase containing the peptidas 99.96
CHL00195489 ycf46 Ycf46; Provisional 99.95
KOG0727408 consensus 26S proteasome regulatory complex, ATPas 99.95
KOG0732 1080 consensus AAA+-type ATPase containing the bromodom 99.94
KOG0728404 consensus 26S proteasome regulatory complex, ATPas 99.94
COG1223368 Predicted ATPase (AAA+ superfamily) [General funct 99.94
KOG0740 428 consensus AAA+-type ATPase [Posttranslational modi 99.94
KOG0731 774 consensus AAA+-type ATPase containing the peptidas 99.94
KOG0726440 consensus 26S proteasome regulatory complex, ATPas 99.93
KOG0729435 consensus 26S proteasome regulatory complex, ATPas 99.93
KOG0652424 consensus 26S proteasome regulatory complex, ATPas 99.93
COG1223368 Predicted ATPase (AAA+ superfamily) [General funct 99.93
COG1222406 RPT1 ATP-dependent 26S proteasome regulatory subun 99.91
TIGR03689 512 pup_AAA proteasome ATPase. In the Actinobacteria, 99.91
PTZ00454398 26S protease regulatory subunit 6B-like protein; P 99.91
KOG0651388 consensus 26S proteasome regulatory complex, ATPas 99.91
COG0465 596 HflB ATP-dependent Zn proteases [Posttranslational 99.91
PRK11034 758 clpA ATP-dependent Clp protease ATP-binding subuni 99.91
PRK03992389 proteasome-activating nucleotidase; Provisional 99.9
PLN00020 413 ribulose bisphosphate carboxylase/oxygenase activa 99.9
TIGR02639731 ClpA ATP-dependent Clp protease ATP-binding subuni 99.9
TIGR01241 495 FtsH_fam ATP-dependent metalloprotease FtsH. HflB( 99.89
PTZ00361438 26 proteosome regulatory subunit 4-like protein; P 99.88
KOG0732 1080 consensus AAA+-type ATPase containing the bromodom 99.88
KOG0737386 consensus AAA+-type ATPase [Posttranslational modi 99.87
KOG0738491 consensus AAA+-type ATPase [Posttranslational modi 99.87
KOG0730 693 consensus AAA+-type ATPase [Posttranslational modi 99.86
TIGR01242364 26Sp45 26S proteasome subunit P45 family. Many pro 99.86
CHL00176 638 ftsH cell division protein; Validated 99.85
COG0542 786 clpA ATP-binding subunits of Clp protease and DnaK 99.85
TIGR03345 852 VI_ClpV1 type VI secretion ATPase, ClpV1 family. M 99.84
TIGR01243 733 CDC48 AAA family ATPase, CDC48 subfamily. This sub 99.83
CHL00095 821 clpC Clp protease ATP binding subunit 99.83
CHL00206 2281 ycf2 Ycf2; Provisional 99.82
KOG0734752 consensus AAA+-type ATPase containing the peptidas 99.82
TIGR03346 852 chaperone_ClpB ATP-dependent chaperone ClpB. Membe 99.82
PF00004132 AAA: ATPase family associated with various cellula 99.81
KOG0741 744 consensus AAA+-type ATPase [Posttranslational modi 99.81
PRK10733 644 hflB ATP-dependent metalloprotease; Reviewed 99.8
PRK10865 857 protein disaggregation chaperone; Provisional 99.79
COG0464494 SpoVK ATPases of the AAA+ class [Posttranslational 99.77
KOG0736953 consensus Peroxisome assembly factor 2 containing 99.75
KOG0739439 consensus AAA+-type ATPase [Posttranslational modi 99.75
KOG0731774 consensus AAA+-type ATPase containing the peptidas 99.74
CHL00195489 ycf46 Ycf46; Provisional 99.73
CHL00206 2281 ycf2 Ycf2; Provisional 99.71
KOG0744423 consensus AAA+-type ATPase [Posttranslational modi 99.69
PTZ00454398 26S protease regulatory subunit 6B-like protein; P 99.68
KOG0726440 consensus 26S proteasome regulatory complex, ATPas 99.68
COG0465596 HflB ATP-dependent Zn proteases [Posttranslational 99.67
PRK03992389 proteasome-activating nucleotidase; Provisional 99.66
TIGR01241495 FtsH_fam ATP-dependent metalloprotease FtsH. HflB( 99.64
CHL00181287 cbbX CbbX; Provisional 99.62
KOG0743457 consensus AAA+-type ATPase [Posttranslational modi 99.62
TIGR02881261 spore_V_K stage V sporulation protein K. Members o 99.62
KOG0728404 consensus 26S proteasome regulatory complex, ATPas 99.61
KOG0727408 consensus 26S proteasome regulatory complex, ATPas 99.61
TIGR02880284 cbbX_cfxQ probable Rubsico expression protein CbbX 99.61
KOG0652424 consensus 26S proteasome regulatory complex, ATPas 99.61
CHL00176638 ftsH cell division protein; Validated 99.6
PTZ00361438 26 proteosome regulatory subunit 4-like protein; P 99.59
KOG0740428 consensus AAA+-type ATPase [Posttranslational modi 99.59
KOG0729435 consensus 26S proteasome regulatory complex, ATPas 99.56
KOG0735952 consensus AAA+-type ATPase [Posttranslational modi 99.56
PRK10733644 hflB ATP-dependent metalloprotease; Reviewed 99.52
TIGR03689512 pup_AAA proteasome ATPase. In the Actinobacteria, 99.5
TIGR01242364 26Sp45 26S proteasome subunit P45 family. Many pro 99.49
TIGR02639 731 ClpA ATP-dependent Clp protease ATP-binding subuni 99.47
KOG0742 630 consensus AAA+-type ATPase [Posttranslational modi 99.47
PLN00020413 ribulose bisphosphate carboxylase/oxygenase activa 99.47
PF05496233 RuvB_N: Holliday junction DNA helicase ruvB N-term 99.45
TIGR00763 775 lon ATP-dependent protease La. This protein is ind 99.44
COG2256 436 MGS1 ATPase related to the helicase subunit of the 99.43
PRK11034 758 clpA ATP-dependent Clp protease ATP-binding subuni 99.37
KOG0651388 consensus 26S proteasome regulatory complex, ATPas 99.36
PRK10865 857 protein disaggregation chaperone; Provisional 99.34
CHL00095 821 clpC Clp protease ATP binding subunit 99.31
TIGR03345 852 VI_ClpV1 type VI secretion ATPase, ClpV1 family. M 99.31
TIGR00390 441 hslU ATP-dependent protease HslVU, ATPase subunit. 99.27
TIGR00635 305 ruvB Holliday junction DNA helicase, RuvB subunit. 99.27
TIGR03346 852 chaperone_ClpB ATP-dependent chaperone ClpB. Membe 99.27
PRK05201 443 hslU ATP-dependent protease ATP-binding subunit Hs 99.27
COG2204 464 AtoC Response regulator containing CheY-like recei 99.25
PRK00080 328 ruvB Holliday junction DNA helicase RuvB; Reviewed 99.25
cd00009151 AAA The AAA+ (ATPases Associated with a wide varie 99.24
KOG2004 906 consensus Mitochondrial ATP-dependent protease PIM 99.23
PRK05342 412 clpX ATP-dependent protease ATP-binding subunit Cl 99.23
COG0466 782 Lon ATP-dependent Lon protease, bacterial type [Po 99.22
KOG1051 898 consensus Chaperone HSP104 and related ATP-depende 99.22
COG2255 332 RuvB Holliday junction resolvasome, helicase subun 99.22
PRK14956 484 DNA polymerase III subunits gamma and tau; Provisi 99.17
PRK12323 700 DNA polymerase III subunits gamma and tau; Provisi 99.15
PRK10787 784 DNA-binding ATP-dependent protease La; Provisional 99.15
KOG2028 554 consensus ATPase related to the helicase subunit o 99.14
PRK07003 830 DNA polymerase III subunits gamma and tau; Validat 99.13
PRK14962 472 DNA polymerase III subunits gamma and tau; Provisi 99.13
PF0049868 FHA: FHA domain; InterPro: IPR000253 The forkhead- 99.12
TIGR00382 413 clpX endopeptidase Clp ATP-binding regulatory subu 99.11
KOG0615475 consensus Serine/threonine protein kinase Chk2 and 99.11
PRK13342 413 recombination factor protein RarA; Reviewed 99.11
PHA02544 316 44 clamp loader, small subunit; Provisional 99.1
COG3829 560 RocR Transcriptional regulator containing PAS, AAA 99.1
PRK04195 482 replication factor C large subunit; Provisional 99.08
cd00060102 FHA Forkhead associated domain (FHA); found in euk 99.06
PRK07940 394 DNA polymerase III subunit delta'; Validated 99.05
smart00382148 AAA ATPases associated with a variety of cellular 99.05
PRK14960 702 DNA polymerase III subunits gamma and tau; Provisi 99.05
TIGR02902 531 spore_lonB ATP-dependent protease LonB. Members of 99.04
PF07728139 AAA_5: AAA domain (dynein-related subfamily); Inte 99.04
COG3604 550 FhlA Transcriptional regulator containing GAF, AAA 99.03
PRK14949 944 DNA polymerase III subunits gamma and tau; Provisi 99.03
PF07724171 AAA_2: AAA domain (Cdc48 subfamily); InterPro: IPR 99.03
PLN03025 319 replication factor C subunit; Provisional 99.02
PRK07994 647 DNA polymerase III subunits gamma and tau; Validat 99.02
PRK14958 509 DNA polymerase III subunits gamma and tau; Provisi 99.02
PF05673249 DUF815: Protein of unknown function (DUF815); Inte 99.02
PF00158168 Sigma54_activat: Sigma-54 interaction domain; Inte 99.0
PRK14961 363 DNA polymerase III subunits gamma and tau; Provisi 98.99
PRK08691 709 DNA polymerase III subunits gamma and tau; Validat 98.96
TIGR02640262 gas_vesic_GvpN gas vesicle protein GvpN. Members o 98.96
PRK11331 459 5-methylcytosine-specific restriction enzyme subun 98.95
PRK07764 824 DNA polymerase III subunits gamma and tau; Validat 98.95
PRK06645 507 DNA polymerase III subunits gamma and tau; Validat 98.95
PRK14964 491 DNA polymerase III subunits gamma and tau; Provisi 98.95
KOG0989 346 consensus Replication factor C, subunit RFC4 [Repl 98.94
KOG0742630 consensus AAA+-type ATPase [Posttranslational modi 98.94
PRK14952 584 DNA polymerase III subunits gamma and tau; Provisi 98.93
PRK05563 559 DNA polymerase III subunits gamma and tau; Validat 98.93
PRK14963 504 DNA polymerase III subunits gamma and tau; Provisi 98.92
PRK14969 527 DNA polymerase III subunits gamma and tau; Provisi 98.92
PRK14951 618 DNA polymerase III subunits gamma and tau; Provisi 98.91
PRK14959 624 DNA polymerase III subunits gamma and tau; Provisi 98.9
PHA02244 383 ATPase-like protein 98.9
PRK12402 337 replication factor C small subunit 2; Reviewed 98.89
PRK14957 546 DNA polymerase III subunits gamma and tau; Provisi 98.89
PRK13407 334 bchI magnesium chelatase subunit I; Provisional 98.89
CHL00081 350 chlI Mg-protoporyphyrin IX chelatase 98.87
TIGR02928 365 orc1/cdc6 family replication initiation protein. M 98.87
COG0714 329 MoxR-like ATPases [General function prediction onl 98.87
TIGR02397 355 dnaX_nterm DNA polymerase III, subunit gamma and t 98.87
TIGR03420226 DnaA_homol_Hda DnaA regulatory inactivator Hda. Me 98.86
PRK14965 576 DNA polymerase III subunits gamma and tau; Provisi 98.86
PRK00149 450 dnaA chromosomal replication initiation protein; R 98.86
PRK05896 605 DNA polymerase III subunits gamma and tau; Validat 98.86
PRK06305 451 DNA polymerase III subunits gamma and tau; Validat 98.85
TIGR01650 327 PD_CobS cobaltochelatase, CobS subunit. This model 98.84
PRK07133 725 DNA polymerase III subunits gamma and tau; Validat 98.82
PRK14970 367 DNA polymerase III subunits gamma and tau; Provisi 98.82
PRK00411 394 cdc6 cell division control protein 6; Reviewed 98.82
PRK13341 725 recombination factor protein RarA/unknown domain f 98.81
PRK14948 620 DNA polymerase III subunits gamma and tau; Provisi 98.81
PF07726131 AAA_3: ATPase family associated with various cellu 98.8
PRK06647 563 DNA polymerase III subunits gamma and tau; Validat 98.8
PF01078206 Mg_chelatase: Magnesium chelatase, subunit ChlI; I 98.79
PRK08903227 DnaA regulatory inactivator Hda; Validated 98.79
PRK12377248 putative replication protein; Provisional 98.79
COG1219 408 ClpX ATP-dependent protease Clp, ATPase subunit [P 98.78
TIGR02442 633 Cob-chelat-sub cobaltochelatase subunit. A number 98.78
COG0542 786 clpA ATP-binding subunits of Clp protease and DnaK 98.78
PRK09111 598 DNA polymerase III subunits gamma and tau; Validat 98.76
PRK14955 397 DNA polymerase III subunits gamma and tau; Provisi 98.76
PRK14953 486 DNA polymerase III subunits gamma and tau; Provisi 98.75
TIGR02903 615 spore_lon_C ATP-dependent protease, Lon family. Me 98.75
PF00004132 AAA: ATPase family associated with various cellula 98.75
TIGR00362 405 DnaA chromosomal replication initiator protein Dna 98.75
PRK08116268 hypothetical protein; Validated 98.74
KOG0745 564 consensus Putative ATP-dependent Clp-type protease 98.74
PRK07952244 DNA replication protein DnaC; Validated 98.74
PRK08084235 DNA replication initiation factor; Provisional 98.73
PRK14088 440 dnaA chromosomal replication initiation protein; P 98.71
PRK06893229 DNA replication initiation factor; Validated 98.71
TIGR02030 337 BchI-ChlI magnesium chelatase ATPase subunit I. Th 98.71
PTZ00112 1164 origin recognition complex 1 protein; Provisional 98.7
PRK14950 585 DNA polymerase III subunits gamma and tau; Provisi 98.7
PRK14086 617 dnaA chromosomal replication initiation protein; P 98.69
PRK00440 319 rfc replication factor C small subunit; Reviewed 98.68
PRK14954 620 DNA polymerase III subunits gamma and tau; Provisi 98.68
PRK15424 538 propionate catabolism operon regulatory protein Pr 98.67
PRK08451 535 DNA polymerase III subunits gamma and tau; Validat 98.66
PRK11608 326 pspF phage shock protein operon transcriptional ac 98.65
TIGR02974 329 phageshock_pspF psp operon transcriptional activat 98.63
COG2812 515 DnaX DNA polymerase III, gamma/tau subunits [DNA r 98.63
KOG0744423 consensus AAA+-type ATPase [Posttranslational modi 98.63
PRK08727233 hypothetical protein; Validated 98.63
COG2607287 Predicted ATPase (AAA+ superfamily) [General funct 98.62
PRK12422 445 chromosomal replication initiation protein; Provis 98.62
KOG0991 333 consensus Replication factor C, subunit RFC2 [Repl 98.62
PRK14971 614 DNA polymerase III subunits gamma and tau; Provisi 98.6
TIGR02329 526 propionate_PrpR propionate catabolism operon regul 98.6
PRK05642234 DNA replication initiation factor; Validated 98.6
smart00350 509 MCM minichromosome maintenance proteins. 98.59
COG1221 403 PspF Transcriptional regulators containing an AAA- 98.58
PRK13531 498 regulatory ATPase RavA; Provisional 98.58
PRK08181269 transposase; Validated 98.56
PF00308219 Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013 98.56
COG0470 325 HolB ATPase involved in DNA replication [DNA repli 98.54
PRK07471 365 DNA polymerase III subunit delta'; Validated 98.53
TIGR01817 534 nifA Nif-specific regulatory protein. This model r 98.52
PRK05564 313 DNA polymerase III subunit delta'; Validated 98.51
PRK11388 638 DNA-binding transcriptional regulator DhaR; Provis 98.51
PRK05022 509 anaerobic nitric oxide reductase transcription reg 98.51
PRK15429 686 formate hydrogenlyase transcriptional activator Fh 98.5
TIGR00678188 holB DNA polymerase III, delta' subunit. At positi 98.5
TIGR03354396 VI_FHA type VI secretion system FHA domain protein 98.5
PRK06620214 hypothetical protein; Validated 98.48
PRK09112 351 DNA polymerase III subunit delta'; Validated 98.48
PRK10820 520 DNA-binding transcriptional regulator TyrR; Provis 98.48
TIGR00368 499 Mg chelatase-related protein. The N-terminal end m 98.47
PRK06835329 DNA replication protein DnaC; Validated 98.47
PRK14087 450 dnaA chromosomal replication initiation protein; P 98.46
KOG1969 877 consensus DNA replication checkpoint protein CHL12 98.45
PF01695178 IstB_IS21: IstB-like ATP binding protein; InterPro 98.45
PTZ00111 915 DNA replication licensing factor MCM4; Provisional 98.45
COG1239 423 ChlI Mg-chelatase subunit ChlI [Coenzyme metabolis 98.43
TIGR02031 589 BchD-ChlD magnesium chelatase ATPase subunit D. Th 98.38
COG1484254 DnaC DNA replication protein [DNA replication, rec 98.38
PRK06526254 transposase; Provisional 98.37
PF13177162 DNA_pol3_delta2: DNA polymerase III, delta subunit 98.37
PRK08939306 primosomal protein DnaI; Reviewed 98.37
TIGR02915 445 PEP_resp_reg putative PEP-CTERM system response re 98.35
smart00763 361 AAA_PrkA PrkA AAA domain. This is a family of PrkA 98.35
PRK06921266 hypothetical protein; Provisional 98.33
PRK08058 329 DNA polymerase III subunit delta'; Validated 98.32
COG1474 366 CDC6 Cdc6-related protein, AAA superfamily ATPase 98.28
PF14532138 Sigma54_activ_2: Sigma-54 interaction domain; PDB: 98.28
PRK10923 469 glnG nitrogen regulation protein NR(I); Provisiona 98.27
PRK05707 328 DNA polymerase III subunit delta'; Validated 98.25
PRK07399 314 DNA polymerase III subunit delta'; Validated 98.25
PRK09183259 transposase/IS protein; Provisional 98.23
PRK11361 457 acetoacetate metabolism regulatory protein AtoC; P 98.21
COG0593 408 DnaA ATPase involved in DNA replication initiation 98.2
PRK09862 506 putative ATP-dependent protease; Provisional 98.17
TIGR02881261 spore_V_K stage V sporulation protein K. Members o 98.16
TIGR00764 608 lon_rel lon-related putative ATP-dependent proteas 98.13
PF13401131 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S 98.1
PRK09087226 hypothetical protein; Validated 98.09
COG0606 490 Predicted ATPase with chaperone activity [Posttran 98.08
PRK15115 444 response regulator GlrR; Provisional 98.08
TIGR00602 637 rad24 checkpoint protein rad24. This family is bas 98.07
KOG0990 360 consensus Replication factor C, subunit RFC5 [Repl 98.07
CHL00181287 cbbX CbbX; Provisional 98.06
smart0024052 FHA Forkhead associated domain. Found in eukaryoti 98.06
PF13173128 AAA_14: AAA domain 98.05
PLN02927668 antheraxanthin epoxidase/zeaxanthin epoxidase 98.04
cd01120165 RecA-like_NTPases RecA-like NTPases. This family i 98.03
TIGR01818 463 ntrC nitrogen regulation protein NR(I). This model 98.01
PRK06871 325 DNA polymerase III subunit delta'; Validated 97.96
PRK06964 342 DNA polymerase III subunit delta'; Validated 97.94
TIGR00763775 lon ATP-dependent protease La. This protein is ind 97.94
PRK07993 334 DNA polymerase III subunit delta'; Validated 97.92
PRK04132 846 replication factor C small subunit; Provisional 97.92
COG3283 511 TyrR Transcriptional regulator of aromatic amino a 97.88
PRK10365 441 transcriptional regulatory protein ZraR; Provision 97.87
COG1224 450 TIP49 DNA helicase TIP49, TBP-interacting protein 97.84
COG1716191 FOG: FHA domain [Signal transduction mechanisms] 97.84
TIGR02880284 cbbX_cfxQ probable Rubsico expression protein CbbX 97.83
PRK08769 319 DNA polymerase III subunit delta'; Validated 97.8
PRK05342412 clpX ATP-dependent protease ATP-binding subunit Cl 97.8
PF05621302 TniB: Bacterial TniB protein; InterPro: IPR008868 97.78
PRK06090 319 DNA polymerase III subunit delta'; Validated 97.78
COG1220 444 HslU ATP-dependent protease HslVU (ClpYQ), ATPase 97.77
PF06068 398 TIP49: TIP49 C-terminus; InterPro: IPR010339 This 97.75
PRK13765 637 ATP-dependent protease Lon; Provisional 97.74
KOG0478 804 consensus DNA replication licensing factor, MCM4 c 97.71
PF01637234 Arch_ATPase: Archaeal ATPase; InterPro: IPR011579 97.68
PRK13406 584 bchD magnesium chelatase subunit D; Provisional 97.67
PRK08699 325 DNA polymerase III subunit delta'; Validated 97.67
COG1241 682 MCM2 Predicted ATPase involved in replication cont 97.67
TIGR00382413 clpX endopeptidase Clp ATP-binding regulatory subu 97.6
COG3284 606 AcoR Transcriptional activator of acetoin/glycerol 97.59
PRK00080328 ruvB Holliday junction DNA helicase RuvB; Reviewed 97.58
PF03969 362 AFG1_ATPase: AFG1-like ATPase; InterPro: IPR005654 97.56
TIGR02237209 recomb_radB DNA repair and recombination protein R 97.54
PF03215 519 Rad17: Rad17 cell cycle checkpoint protein 97.53
PF00493 331 MCM: MCM2/3/5 family This family extends the MCM d 97.52
PHA00729226 NTP-binding motif containing protein 97.5
TIGR01618220 phage_P_loop phage nucleotide-binding protein. Thi 97.5
KOG1881793 consensus Anion exchanger adaptor protein Kanadapt 97.5
cd01124187 KaiC KaiC is a circadian clock protein primarily f 97.49
COG1219408 ClpX ATP-dependent protease Clp, ATPase subunit [P 97.47
KOG2170 344 consensus ATPase of the AAA+ superfamily [General 97.39
PF00910107 RNA_helicase: RNA helicase; InterPro: IPR000605 He 97.38
PRK05917 290 DNA polymerase III subunit delta'; Validated 97.36
PF12774231 AAA_6: Hydrolytic ATP binding site of dynein motor 97.36
PRK11823 446 DNA repair protein RadA; Provisional 97.29
TIGR03015269 pepcterm_ATPase putative secretion ATPase, PEP-CTE 97.29
PF05673249 DUF815: Protein of unknown function (DUF815); Inte 97.28
cd01121 372 Sms Sms (bacterial radA) DNA repair protein. This 97.26
TIGR02928365 orc1/cdc6 family replication initiation protein. M 97.26
KOG1514 767 consensus Origin recognition complex, subunit 1, a 97.22
COG1618179 Predicted nucleotide kinase [Nucleotide transport 97.22
PF12775272 AAA_7: P-loop containing dynein motor region D3; P 97.22
PF05729166 NACHT: NACHT domain 97.21
PF13207121 AAA_17: AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6 97.19
KOG0477 854 consensus DNA replication licensing factor, MCM2 c 97.17
KOG1970 634 consensus Checkpoint RAD17-RFC complex, RAD17/RAD2 97.15
PRK09361225 radB DNA repair and recombination protein RadB; Pr 97.15
KOG0482 721 consensus DNA replication licensing factor, MCM7 c 97.14
COG3456430 Predicted component of the type VI protein secreti 97.14
PRK00411394 cdc6 cell division control protein 6; Reviewed 97.14
TIGR02688 449 conserved hypothetical protein TIGR02688. Members 97.11
PF05707193 Zot: Zonular occludens toxin (Zot); InterPro: IPR0 97.11
PRK08533230 flagellar accessory protein FlaH; Reviewed 97.11
PRK14962472 DNA polymerase III subunits gamma and tau; Provisi 97.1
KOG0479 818 consensus DNA replication licensing factor, MCM3 c 97.1
KOG1051 898 consensus Chaperone HSP104 and related ATP-depende 97.09
PRK08118167 topology modulation protein; Reviewed 97.09
PRK00771 437 signal recognition particle protein Srp54; Provisi 97.08
PRK00149450 dnaA chromosomal replication initiation protein; R 97.08
KOG2035 351 consensus Replication factor C, subunit RFC3 [Cell 97.07
TIGR02012 321 tigrfam_recA protein RecA. This model describes or 97.06
) proteins. It has been suggested that torsins play a role in effectively managing protein folding and that possible breakdown in a neuroprotective mechanism that is, in part, mediated by torsins may be responsible for the neuronal dysfunction associated with dystonia [].; GO: 0005524 ATP binding, 0051085 chaperone mediated protein folding requiring cofactor" target="_blank" href="http://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=PF06309">PF06309127 Torsin: Torsin; InterPro: IPR010448 This family co 97.05
PRK07261171 topology modulation protein; Provisional 97.04
cd00983 325 recA RecA is a bacterial enzyme which has roles in 97.0
KOG0481 729 consensus DNA replication licensing factor, MCM5 c 97.0
PRK05818 261 DNA polymerase III subunit delta'; Validated 96.99
PHA02624647 large T antigen; Provisional 96.98
PF03266168 NTPase_1: NTPase; InterPro: IPR004948 This entry r 96.97
TIGR00635305 ruvB Holliday junction DNA helicase, RuvB subunit. 96.94
PRK00131175 aroK shikimate kinase; Reviewed 96.93
cd01129264 PulE-GspE PulE/GspE The type II secretory pathway 96.92
PRK12723388 flagellar biosynthesis regulator FlhF; Provisional 96.91
COG3854308 SpoIIIAA ncharacterized protein conserved in bacte 96.89
KOG2227 529 consensus Pre-initiation complex, subunit CDC6, AA 96.87
KOG1942 456 consensus DNA helicase, TBP-interacting protein [R 96.86
PRK15455 644 PrkA family serine protein kinase; Provisional 96.86
KOG2228 408 consensus Origin recognition complex, subunit 4 [R 96.85
PRK14722374 flhF flagellar biosynthesis regulator FlhF; Provis 96.83
PF13604196 AAA_30: AAA domain; PDB: 1W36_G 3K70_G 3UPU_B 3GPL 96.82
cd01394218 radB RadB. The archaeal protein radB shares simila 96.8
PF00931 287 NB-ARC: NB-ARC domain; InterPro: IPR002182 This is 96.79
PRK13342413 recombination factor protein RarA; Reviewed 96.78
KOG0745564 consensus Putative ATP-dependent Clp-type protease 96.78
COG4650 531 RtcR Sigma54-dependent transcription regulator con 96.77
KOG0480 764 consensus DNA replication licensing factor, MCM6 c 96.77
PRK04296190 thymidine kinase; Provisional 96.76
PRK14086617 dnaA chromosomal replication initiation protein; P 96.76
PRK13407334 bchI magnesium chelatase subunit I; Provisional 96.75
PRK14974336 cell division protein FtsY; Provisional 96.74
PF13191185 AAA_16: AAA ATPase domain; PDB: 2V1U_A. 96.71
cd01131198 PilT Pilus retraction ATPase PilT. PilT is a nucle 96.71
PRK07276 290 DNA polymerase III subunit delta'; Validated 96.71
cd03283199 ABC_MutS-like MutS-like homolog in eukaryotes. The 96.7
TIGR00390441 hslU ATP-dependent protease HslVU, ATPase subunit. 96.67
PRK06067234 flagellar accessory protein FlaH; Validated 96.66
PRK05800170 cobU adenosylcobinamide kinase/adenosylcobinamide- 96.66
PRK13695174 putative NTPase; Provisional 96.65
PRK10536262 hypothetical protein; Provisional 96.65
PF13671143 AAA_33: AAA domain; PDB: 1LTQ_A 2IA5_K 1RC8_A 1LY1 96.64
PRK11331459 5-methylcytosine-specific restriction enzyme subun 96.64
PRK03839180 putative kinase; Provisional 96.63
PRK13947171 shikimate kinase; Provisional 96.63
TIGR03877237 thermo_KaiC_1 KaiC domain protein, Ph0284 family. 96.59
TIGR02858270 spore_III_AA stage III sporulation protein AA. Mem 96.58
cd00046144 DEXDc DEAD-like helicases superfamily. A diverse f 96.58
TIGR00416 454 sms DNA repair protein RadA. The gene protuct code 96.57
TIGR00362405 DnaA chromosomal replication initiator protein Dna 96.57
cd01122 271 GP4d_helicase GP4d_helicase is a homohexameric 5'- 96.52
cd00464154 SK Shikimate kinase (SK) is the fifth enzyme in th 96.52
cd01128 249 rho_factor Transcription termination factor rho is 96.51
PRK12726407 flagellar biosynthesis regulator FlhF; Provisional 96.51
PRK07132 299 DNA polymerase III subunit delta'; Validated 96.49
PRK10787784 DNA-binding ATP-dependent protease La; Provisional 96.49
PRK00625173 shikimate kinase; Provisional 96.49
PRK09376416 rho transcription termination factor Rho; Provisio 96.47
PHA02544316 44 clamp loader, small subunit; Provisional 96.46
PRK07764 824 DNA polymerase III subunits gamma and tau; Validat 96.45
cd01393226 recA_like RecA is a bacterial enzyme which has rol 96.45
PRK11889436 flhF flagellar biosynthesis regulator FlhF; Provis 96.45
KOG3347176 consensus Predicted nucleotide kinase/nuclear prot 96.43
PRK14532188 adenylate kinase; Provisional 96.4
PF00437270 T2SE: Type II/IV secretion system protein; InterPr 96.37
COG2256436 MGS1 ATPase related to the helicase subunit of the 96.37
PRK06217183 hypothetical protein; Validated 96.36
PRK09354 349 recA recombinase A; Provisional 96.35
cd00544169 CobU Adenosylcobinamide kinase / adenosylcobinamid 96.35
COG5271 4600 MDN1 AAA ATPase containing von Willebrand factor t 96.32
PRK04195482 replication factor C large subunit; Provisional 96.32
PRK10436 462 hypothetical protein; Provisional 96.3
TIGR01359183 UMP_CMP_kin_fam UMP-CMP kinase family. This subfam 96.29
PRK14088440 dnaA chromosomal replication initiation protein; P 96.29
PRK06645507 DNA polymerase III subunits gamma and tau; Validat 96.28
PRK13949169 shikimate kinase; Provisional 96.28
cd00984242 DnaB_C DnaB helicase C terminal domain. The hexame 96.27
TIGR02525372 plasmid_TraJ plasmid transfer ATPase TraJ. Members 96.25
COG1485 367 Predicted ATPase [General function prediction only 96.25
cd01123235 Rad51_DMC1_radA Rad51_DMC1_radA,B. This group of r 96.23
PF00448196 SRP54: SRP54-type protein, GTPase domain; InterPro 96.22
PRK06762166 hypothetical protein; Provisional 96.2
cd01428194 ADK Adenylate kinase (ADK) catalyzes the reversibl 96.19
TIGR01425 429 SRP54_euk signal recognition particle protein SRP5 96.19
COG4619223 ABC-type uncharacterized transport system, ATPase 96.19
PRK07003 830 DNA polymerase III subunits gamma and tau; Validat 96.18
PRK10416318 signal recognition particle-docking protein FtsY; 96.18
PF06745226 KaiC: KaiC; InterPro: IPR014774 This entry represe 96.18
cd02020147 CMPK Cytidine monophosphate kinase (CMPK) catalyze 96.18
cd03280200 ABC_MutS2 MutS2 homologs in bacteria and eukaryote 96.17
TIGR02538 564 type_IV_pilB type IV-A pilus assembly ATPase PilB. 96.17
TIGR03878259 thermo_KaiC_2 KaiC domain protein, AF_0795 family. 96.17
TIGR02533 486 type_II_gspE general secretory pathway protein E. 96.14
TIGR01420343 pilT_fam pilus retraction protein PilT. This model 96.14
PRK14531183 adenylate kinase; Provisional 96.14
PF13479213 AAA_24: AAA domain 96.09
PLN03210 1153 Resistant to P. syringae 6; Provisional 96.09
PRK13948182 shikimate kinase; Provisional 96.08
cd02021150 GntK Gluconate kinase (GntK) catalyzes the phospho 96.08
cd03281213 ABC_MSH5_euk MutS5 homolog in eukaryotes. The MutS 96.05
PRK05973237 replicative DNA helicase; Provisional 96.03
cd03243202 ABC_MutS_homologs The MutS protein initiates DNA m 96.02
PRK14530215 adenylate kinase; Provisional 96.01
COG0563178 Adk Adenylate kinase and related kinases [Nucleoti 96.0
COG2804500 PulE Type II secretory pathway, ATPase PulE/Tfp pi 96.0
TIGR00064272 ftsY signal recognition particle-docking protein F 95.99
TIGR02782299 TrbB_P P-type conjugative transfer ATPase TrbB. Th 95.95
TIGR01313163 therm_gnt_kin carbohydrate kinase, thermoresistant 95.94
TIGR03880224 KaiC_arch_3 KaiC domain protein, AF_0351 family. T 95.93
PRK03731171 aroL shikimate kinase II; Reviewed 95.92
PRK12323 700 DNA polymerase III subunits gamma and tau; Provisi 95.92
PLN03025319 replication factor C subunit; Provisional 95.91
PRK13531498 regulatory ATPase RavA; Provisional 95.9
PRK12724432 flagellar biosynthesis regulator FlhF; Provisional 95.9
PTZ00088229 adenylate kinase 1; Provisional 95.89
PRK05201443 hslU ATP-dependent protease ATP-binding subunit Hs 95.89
PRK14959624 DNA polymerase III subunits gamma and tau; Provisi 95.86
PRK14528186 adenylate kinase; Provisional 95.85
PRK13764 602 ATPase; Provisional 95.85
COG1373 398 Predicted ATPase (AAA+ superfamily) [General funct 95.85
PHA02774613 E1; Provisional 95.84
smart00534185 MUTSac ATPase domain of DNA mismatch repair MUTS f 95.84
PRK14956484 DNA polymerase III subunits gamma and tau; Provisi 95.83
cd00227175 CPT Chloramphenicol (Cm) phosphotransferase (CPT). 95.83
COG0703172 AroK Shikimate kinase [Amino acid transport and me 95.82
TIGR03881229 KaiC_arch_4 KaiC domain protein, PAE1156 family. M 95.81
PRK04328249 hypothetical protein; Provisional 95.81
TIGR03574 249 selen_PSTK L-seryl-tRNA(Sec) kinase, archaeal. Mem 95.79
PRK02496184 adk adenylate kinase; Provisional 95.79
PRK14961363 DNA polymerase III subunits gamma and tau; Provisi 95.78
TIGR02397355 dnaX_nterm DNA polymerase III, subunit gamma and t 95.77
PRK13900332 type IV secretion system ATPase VirB11; Provisiona 95.74
PRK12422445 chromosomal replication initiation protein; Provis 95.73
KOG1968 871 consensus Replication factor C, subunit RFC1 (larg 95.73
PRK14948620 DNA polymerase III subunits gamma and tau; Provisi 95.71
PRK13946184 shikimate kinase; Provisional 95.7
PF09848 352 DUF2075: Uncharacterized conserved protein (DUF207 95.7
PRK05057172 aroK shikimate kinase I; Reviewed 95.69
COG4088 261 Predicted nucleotide kinase [Nucleotide transport 95.69
PRK06547172 hypothetical protein; Provisional 95.68
PRK09519 790 recA DNA recombination protein RecA; Reviewed 95.67
PRK08154309 anaerobic benzoate catabolism transcriptional regu 95.65
cd01130186 VirB11-like_ATPase Type IV secretory pathway compo 95.64
TIGR01360188 aden_kin_iso1 adenylate kinase, isozyme 1 subfamil 95.64
smart00487201 DEXDc DEAD-like helicases superfamily. 95.64
PRK14963504 DNA polymerase III subunits gamma and tau; Provisi 95.63
KOG2383 467 consensus Predicted ATPase [General function predi 95.61
PRK05563559 DNA polymerase III subunits gamma and tau; Validat 95.59
PRK14960 702 DNA polymerase III subunits gamma and tau; Provisi 95.59
PRK00279215 adk adenylate kinase; Reviewed 95.57
cd03227162 ABC_Class2 ABC-type Class 2 contains systems invol 95.55
PRK04301317 radA DNA repair and recombination protein RadA; Va 95.53
TIGR01448 720 recD_rel helicase, putative, RecD/TraA family. Thi 95.52
cd02027149 APSK Adenosine 5'-phosphosulfate kinase (APSK) cat 95.51
cd03115173 SRP The signal recognition particle (SRP) mediates 95.5
PRK12402337 replication factor C small subunit 2; Reviewed 95.5
TIGR01351210 adk adenylate kinases. Adenylate kinase (EC 2.7.4. 95.5
PLN02200234 adenylate kinase family protein 95.47
cd00267157 ABC_ATPase ABC (ATP-binding cassette) transporter 95.46
COG1102179 Cmk Cytidylate kinase [Nucleotide transport and me 95.46
PRK14952584 DNA polymerase III subunits gamma and tau; Provisi 95.45
PF02562205 PhoH: PhoH-like protein; InterPro: IPR003714 PhoH 95.44
PRK06893229 DNA replication initiation factor; Validated 95.41
PRK06731270 flhF flagellar biosynthesis regulator FlhF; Valida 95.37
COG1066 456 Sms Predicted ATP-dependent serine protease [Postt 95.36
cd03216163 ABC_Carb_Monos_I This family represents the domain 95.36
PRK14964491 DNA polymerase III subunits gamma and tau; Provisi 95.36
PRK14965576 DNA polymerase III subunits gamma and tau; Provisi 95.35
PRK04040188 adenylate kinase; Provisional 95.34
PF13481193 AAA_25: AAA domain; PDB: 1G8Y_J 1OLO_A 1NLF_C. 95.33
PF06414199 Zeta_toxin: Zeta toxin; InterPro: IPR010488 This e 95.33
TIGR02655484 circ_KaiC circadian clock protein KaiC. Members of 95.32
TIGR02788308 VirB11 P-type DNA transfer ATPase VirB11. The VirB 95.32
PF04665241 Pox_A32: Poxvirus A32 protein; InterPro: IPR006758 95.32
TIGR03499282 FlhF flagellar biosynthetic protein FlhF. 95.3
PF13238129 AAA_18: AAA domain; PDB: 3IIK_A 3IIJ_A 3IIL_A 1RKB 95.29
PF14516 331 AAA_35: AAA-like domain 95.28
TIGR02236310 recomb_radA DNA repair and recombination protein R 95.23
cd0201969 NK Nucleoside/nucleotide kinase (NK) is a protein 95.2
COG1936180 Predicted nucleotide kinase (related to CMP and AM 95.19
PRK13851344 type IV secretion system protein VirB11; Provision 95.19
>KOG0733 consensus Nuclear AAA ATPase (VCP subfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
Probab=100.00  E-value=9e-58  Score=524.93  Aligned_cols=441  Identities=32%  Similarity=0.461  Sum_probs=352.1

Q ss_pred             CCcccccccccccccchhHHHHHHhhhhhhccccccccccCCCCCCCCceeeeCCCCchHHHHHHHHHHHhhcCCeEEEE
Q 001244          446 PENIEVSFESFPYYLSDITKNVLIASTYVHLKCNNFAKYASDLPTMCPRILLSGPAGSEIYQETLAKALAKHFSARLLIV  525 (1116)
Q Consensus       446 ~~~i~vsf~~FPYylse~tk~~L~~~~~~hLk~~~~~k~~~~L~~~~~~ILLsGp~gsE~Yqe~LaKALA~~f~a~LL~l  525 (1116)
                      ....+|+|.++...  +.|-.-|..-.. |++|+++..|+--.+  ++.+||.||||  ++++|||.|+|.++++|+|-+
T Consensus       182 ~~~snv~f~diGG~--d~~~~el~~li~-~i~~Pe~~~~lGv~P--prGvLlHGPPG--CGKT~lA~AiAgel~vPf~~i  254 (802)
T KOG0733|consen  182 FPESNVSFSDIGGL--DKTLAELCELII-HIKHPEVFSSLGVRP--PRGVLLHGPPG--CGKTSLANAIAGELGVPFLSI  254 (802)
T ss_pred             CCCCCcchhhccCh--HHHHHHHHHHHH-HhcCchhHhhcCCCC--CCceeeeCCCC--ccHHHHHHHHhhhcCCceEee
Confidence            45668999999998  777777766554 899999988776665  47899999999  999999999999999999988


Q ss_pred             ecccCCCCCCccccccccchhhhhhhHHHHHHHhhhccCCCCccccccccccccccCCCCCCcccccccCcccccCCCce
Q 001244          526 DSLLLPGGSSKEADSVKESSRTEKASMFAKRAALLQHRKPTSSVEADITGGTAVGSQALPKPEISTASSKNYTFKKGDRV  605 (1116)
Q Consensus       526 Ds~~l~g~~~ke~~~~~~~~~~e~~s~~~k~s~~~~~~~p~~~~~~~~~g~~~~~~~~~~~~~~~~~~~~~~~~~~gdrv  605 (1116)
                      -.+.+.+|.+-|                                                                    
T Consensus       255 sApeivSGvSGE--------------------------------------------------------------------  266 (802)
T KOG0733|consen  255 SAPEIVSGVSGE--------------------------------------------------------------------  266 (802)
T ss_pred             cchhhhcccCcc--------------------------------------------------------------------
Confidence            877766643311                                                                    


Q ss_pred             eeeccCCCCcccCCCCCCCCCcccceeeeccccCCCCceeeeecCCCCCCCCCCCCcCCCCCcccccccccccCCCcchh
Q 001244          606 KFVGNVTSGTTVQPTLRGPGIGFRGRVILPFEDNDFSKIGVRFDRSIPEGNNLGGFCEDDHGFFCTASSLRLDSSLGDEV  685 (1116)
Q Consensus       606 ~~vg~~~~~~~~~~~~~~p~~g~~g~v~l~~e~n~~~kvgV~Fd~~~~~~~~l~~~c~~~~~~~~~~~~~~~d~s~~~~~  685 (1116)
                                                                                                      
T Consensus       267 --------------------------------------------------------------------------------  266 (802)
T KOG0733|consen  267 --------------------------------------------------------------------------------  266 (802)
T ss_pred             --------------------------------------------------------------------------------
Confidence                                                                                            


Q ss_pred             hHHHHHHHHHHHHhhcCCCCeEEEEcchhhhhcC---------ChhhHHHHHHHHhcCC------CCEEEEeeccCCCcc
Q 001244          686 DKLAINELFEVALNESKSSPLIVFVKDIEKSLTG---------NNDAYGALKSKLENLP------SNVVVIGSHTQLDSR  750 (1116)
Q Consensus       686 ~~~~i~~L~evl~~esk~~P~ILfidDie~~l~~---------~~e~~~~lk~~Le~L~------g~VviIgS~~~~d~~  750 (1116)
                      .+-.|++||+-+.+   ..||||||||||. |+.         ..+++.-|.+-|+.|.      .+|+|||+||+||+ 
T Consensus       267 SEkkiRelF~~A~~---~aPcivFiDeIDA-I~pkRe~aqreMErRiVaQLlt~mD~l~~~~~~g~~VlVIgATnRPDs-  341 (802)
T KOG0733|consen  267 SEKKIRELFDQAKS---NAPCIVFIDEIDA-ITPKREEAQREMERRIVAQLLTSMDELSNEKTKGDPVLVIGATNRPDS-  341 (802)
T ss_pred             cHHHHHHHHHHHhc---cCCeEEEeecccc-cccchhhHHHHHHHHHHHHHHHhhhcccccccCCCCeEEEecCCCCcc-
Confidence            12267888888888   9999999999999 772         2567778888888883      38999999999999 


Q ss_pred             cccCCCCCceeeccCCcchhhccccCCCcccccccccCcchHHHhhhhccccccccccCCchHHHHH--HHHHHHhhchh
Q 001244          751 KEKSHPGGLLFTKFGSNQTALLDLAFPDNFSRLHDRSKETPKALKQISRLFPNKVTIQLPQDEALLS--DWKQQLERDVE  828 (1116)
Q Consensus       751 ~~~~~~~~~~~~~~~~~~~~~lD~a~p~~~~~~~~~~~~~~k~~~~i~klFpn~I~I~~P~DEa~LR--Rfe~qle~~Lp  828 (1116)
                                           ||+|                                       +.|  ||++++.+..|
T Consensus       342 ---------------------lDpa---------------------------------------LRRaGRFdrEI~l~vP  361 (802)
T KOG0733|consen  342 ---------------------LDPA---------------------------------------LRRAGRFDREICLGVP  361 (802)
T ss_pred             ---------------------cCHH---------------------------------------HhccccccceeeecCC
Confidence                                 8875                                       333  77777777777


Q ss_pred             hhhcccchhhhhhh-hhcCCCCCCCchhhhccccccchhhHHHHHHHhhhccccccccCCCCC-cccc---------ccc
Q 001244          829 TLKGQSNIISIRSV-LSRNGLDCVDLESLCIKDQTLTTEGVEKIVGWALSHHFMHCSEAPGKD-AKLK---------IST  897 (1116)
Q Consensus       829 dlk~R~nIl~Iht~-l~~~~lecvDLeeLai~dk~LsgadIEkIV~sAaS~aL~r~~~~i~~d-~KLv---------IS~  897 (1116)
                      +...|..|+++.-. |+-.+  ..|+..||.+|-||-|+|+..||..|...++.|..++.... .+..         +..
T Consensus       362 ~e~aR~~IL~~~~~~lrl~g--~~d~~qlA~lTPGfVGADL~AL~~~Aa~vAikR~ld~~~~p~~~~~~~ed~~~~~~~~  439 (802)
T KOG0733|consen  362 SETAREEILRIICRGLRLSG--DFDFKQLAKLTPGFVGADLMALCREAAFVAIKRILDQSSSPLTKVPISEDSSNKDAEE  439 (802)
T ss_pred             chHHHHHHHHHHHhhCCCCC--CcCHHHHHhcCCCccchhHHHHHHHHHHHHHHHHhhcccCccccCCccccccCCCccc
Confidence            77777788777654 44443  78999999999999999999999999999999876633210 1111         111


Q ss_pred             c--hhh------------hhHHHHHhhhhhhhhhhhhhh--hccChhHHHHHHhcCCCCCC--------CCCCCcccccC
Q 001244          898 E--SIM------------YGLNILQGIQSESKSLKKSLK--DVVTENEFEKKLLADVIPPS--------DIGVTFDDIGA  953 (1116)
Q Consensus       898 E--SLk------------vglsdFq~alne~K~L~~~lk--~~v~~~e~e~~ll~~iIp~~--------e~~vtfddIgG  953 (1116)
                      +  +|+            ..+.++  .++...++.....  -.+.-++|+..+..  |.|.        -++++|+|||+
T Consensus       440 d~S~i~~~~~~~~~~~ld~v~~~~--i~~~~d~~S~E~~~~L~i~~eDF~~Al~~--iQPSakREGF~tVPdVtW~dIGa  515 (802)
T KOG0733|consen  440 DQSSIKITSNAERPLELDRVVQDA--ILNNPDPLSKELLEGLSIKFEDFEEALSK--IQPSAKREGFATVPDVTWDDIGA  515 (802)
T ss_pred             hhhhhhcCCcccccccHHHHHHHH--HHhCCCCcChHHhccceecHHHHHHHHHh--cCcchhcccceecCCCChhhccc
Confidence            1  122            111111  1122222221111  12456678776631  1111        14899999999


Q ss_pred             cHHHHHHHHHHHHccccChhhhhcCCCCCCCeEEEEECCCCCchHHHHHHHHHHhCCeeeEEeccccccccccchHHHHH
Q 001244          954 LENVKDTLKELVMLPLQRPELFCKGQLTKPCKGILLFGPPGTGKTMLAKAVATEAGANFINISMSSITSKWFGEGEKYVK 1033 (1116)
Q Consensus       954 ldevk~~L~e~V~lpl~~pelf~~~~l~~p~~gILL~GPPGTGKT~LArAIA~elg~pfI~Is~seL~sk~~GesEk~Ir 1033 (1116)
                      +++++.+|..+|.+|.++|+.|...|+.. +.||||+||||||||.||+|+|++.|++|+.|..++|+++|+|++|+.++
T Consensus       516 L~~vR~eL~~aI~~PiK~pd~~k~lGi~~-PsGvLL~GPPGCGKTLlAKAVANEag~NFisVKGPELlNkYVGESErAVR  594 (802)
T KOG0733|consen  516 LEEVRLELNMAILAPIKRPDLFKALGIDA-PSGVLLCGPPGCGKTLLAKAVANEAGANFISVKGPELLNKYVGESERAVR  594 (802)
T ss_pred             HHHHHHHHHHHHhhhccCHHHHHHhCCCC-CCceEEeCCCCccHHHHHHHHhhhccCceEeecCHHHHHHHhhhHHHHHH
Confidence            99999999999999999999999999765 58999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHhcCCCeEEEEccccccccCCCCCchhHHHHHHHHHHHHHhcCCCcCCCCCEEEEEEeCCCCCCcHHHHh--hcC
Q 001244         1034 AVFSLASKIAPSVVFVDEVDSMLGRRENPGEHEAMRKMKNEFMVNWDGLRTKDKERVLVLAATNRPFDLDEAVVR--RLP 1111 (1116)
Q Consensus      1034 ~lF~~A~k~sPsIIfIDEID~Llg~R~~~~~~~~lr~IlneLL~~Ldgl~~k~~~kVLVIaTTNrp~~LD~ALlR--RF~ 1111 (1116)
                      ++|+.|+.++||||||||||.|.++|+..+ .....+++|+||++|||+..  +.+|+||||||||+.||+|++|  ||+
T Consensus       595 ~vFqRAR~saPCVIFFDEiDaL~p~R~~~~-s~~s~RvvNqLLtElDGl~~--R~gV~viaATNRPDiIDpAiLRPGRlD  671 (802)
T KOG0733|consen  595 QVFQRARASAPCVIFFDEIDALVPRRSDEG-SSVSSRVVNQLLTELDGLEE--RRGVYVIAATNRPDIIDPAILRPGRLD  671 (802)
T ss_pred             HHHHHhhcCCCeEEEecchhhcCcccCCCC-chhHHHHHHHHHHHhccccc--ccceEEEeecCCCcccchhhcCCCccC
Confidence            999999999999999999999999987744 66778999999999999964  6789999999999999999999  999


Q ss_pred             CeEEC
Q 001244         1112 RRTCV 1116 (1116)
Q Consensus      1112 r~I~V 1116 (1116)
                      +.+||
T Consensus       672 k~LyV  676 (802)
T KOG0733|consen  672 KLLYV  676 (802)
T ss_pred             ceeee
Confidence            99986



>KOG0730 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0736 consensus Peroxisome assembly factor 2 containing the AAA+-type ATPase domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR01243 CDC48 AAA family ATPase, CDC48 subfamily Back     alignment and domain information
>KOG0741 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0737 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0735 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG0464 SpoVK ATPases of the AAA+ class [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG1222 RPT1 ATP-dependent 26S proteasome regulatory subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0738 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0739 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0733 consensus Nuclear AAA ATPase (VCP subfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0734 consensus AAA+-type ATPase containing the peptidase M41 domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>CHL00195 ycf46 Ycf46; Provisional Back     alignment and domain information
>KOG0727 consensus 26S proteasome regulatory complex, ATPase RPT3 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0732 consensus AAA+-type ATPase containing the bromodomain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0728 consensus 26S proteasome regulatory complex, ATPase RPT6 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG1223 Predicted ATPase (AAA+ superfamily) [General function prediction only] Back     alignment and domain information
>KOG0740 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0731 consensus AAA+-type ATPase containing the peptidase M41 domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0726 consensus 26S proteasome regulatory complex, ATPase RPT2 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0729 consensus 26S proteasome regulatory complex, ATPase RPT1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0652 consensus 26S proteasome regulatory complex, ATPase RPT5 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG1223 Predicted ATPase (AAA+ superfamily) [General function prediction only] Back     alignment and domain information
>COG1222 RPT1 ATP-dependent 26S proteasome regulatory subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR03689 pup_AAA proteasome ATPase Back     alignment and domain information
>PTZ00454 26S protease regulatory subunit 6B-like protein; Provisional Back     alignment and domain information
>KOG0651 consensus 26S proteasome regulatory complex, ATPase RPT4 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG0465 HflB ATP-dependent Zn proteases [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK11034 clpA ATP-dependent Clp protease ATP-binding subunit; Provisional Back     alignment and domain information
>PRK03992 proteasome-activating nucleotidase; Provisional Back     alignment and domain information
>PLN00020 ribulose bisphosphate carboxylase/oxygenase activase -RuBisCO activase (RCA); Provisional Back     alignment and domain information
>TIGR02639 ClpA ATP-dependent Clp protease ATP-binding subunit clpA Back     alignment and domain information
>TIGR01241 FtsH_fam ATP-dependent metalloprotease FtsH Back     alignment and domain information
>PTZ00361 26 proteosome regulatory subunit 4-like protein; Provisional Back     alignment and domain information
>KOG0732 consensus AAA+-type ATPase containing the bromodomain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0737 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0738 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0730 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR01242 26Sp45 26S proteasome subunit P45 family Back     alignment and domain information
>CHL00176 ftsH cell division protein; Validated Back     alignment and domain information
>COG0542 clpA ATP-binding subunits of Clp protease and DnaK/DnaJ chaperones [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR03345 VI_ClpV1 type VI secretion ATPase, ClpV1 family Back     alignment and domain information
>TIGR01243 CDC48 AAA family ATPase, CDC48 subfamily Back     alignment and domain information
>CHL00095 clpC Clp protease ATP binding subunit Back     alignment and domain information
>CHL00206 ycf2 Ycf2; Provisional Back     alignment and domain information
>KOG0734 consensus AAA+-type ATPase containing the peptidase M41 domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR03346 chaperone_ClpB ATP-dependent chaperone ClpB Back     alignment and domain information
>PF00004 AAA: ATPase family associated with various cellular activities (AAA); InterPro: IPR003959 AAA ATPases (ATPases Associated with diverse cellular Activities) form a large protein family and play a number of roles in the cell including cell-cycle regulation, protein proteolysis and disaggregation, organelle biogenesis and intracellular transport Back     alignment and domain information
>KOG0741 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK10733 hflB ATP-dependent metalloprotease; Reviewed Back     alignment and domain information
>PRK10865 protein disaggregation chaperone; Provisional Back     alignment and domain information
>COG0464 SpoVK ATPases of the AAA+ class [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0736 consensus Peroxisome assembly factor 2 containing the AAA+-type ATPase domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0739 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0731 consensus AAA+-type ATPase containing the peptidase M41 domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>CHL00195 ycf46 Ycf46; Provisional Back     alignment and domain information
>CHL00206 ycf2 Ycf2; Provisional Back     alignment and domain information
>KOG0744 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PTZ00454 26S protease regulatory subunit 6B-like protein; Provisional Back     alignment and domain information
>KOG0726 consensus 26S proteasome regulatory complex, ATPase RPT2 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG0465 HflB ATP-dependent Zn proteases [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK03992 proteasome-activating nucleotidase; Provisional Back     alignment and domain information
>TIGR01241 FtsH_fam ATP-dependent metalloprotease FtsH Back     alignment and domain information
>CHL00181 cbbX CbbX; Provisional Back     alignment and domain information
>KOG0743 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR02881 spore_V_K stage V sporulation protein K Back     alignment and domain information
>KOG0728 consensus 26S proteasome regulatory complex, ATPase RPT6 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0727 consensus 26S proteasome regulatory complex, ATPase RPT3 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR02880 cbbX_cfxQ probable Rubsico expression protein CbbX Back     alignment and domain information
>KOG0652 consensus 26S proteasome regulatory complex, ATPase RPT5 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>CHL00176 ftsH cell division protein; Validated Back     alignment and domain information
>PTZ00361 26 proteosome regulatory subunit 4-like protein; Provisional Back     alignment and domain information
>KOG0740 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0729 consensus 26S proteasome regulatory complex, ATPase RPT1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0735 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK10733 hflB ATP-dependent metalloprotease; Reviewed Back     alignment and domain information
>TIGR03689 pup_AAA proteasome ATPase Back     alignment and domain information
>TIGR01242 26Sp45 26S proteasome subunit P45 family Back     alignment and domain information
>TIGR02639 ClpA ATP-dependent Clp protease ATP-binding subunit clpA Back     alignment and domain information
>KOG0742 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PLN00020 ribulose bisphosphate carboxylase/oxygenase activase -RuBisCO activase (RCA); Provisional Back     alignment and domain information
>PF05496 RuvB_N: Holliday junction DNA helicase ruvB N-terminus; InterPro: IPR008824 The RuvB protein makes up part of the RuvABC revolvasome which catalyses the resolution of Holliday junctions that arise during genetic recombination and DNA repair Back     alignment and domain information
>TIGR00763 lon ATP-dependent protease La Back     alignment and domain information
>COG2256 MGS1 ATPase related to the helicase subunit of the Holliday junction resolvase [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK11034 clpA ATP-dependent Clp protease ATP-binding subunit; Provisional Back     alignment and domain information
>KOG0651 consensus 26S proteasome regulatory complex, ATPase RPT4 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK10865 protein disaggregation chaperone; Provisional Back     alignment and domain information
>CHL00095 clpC Clp protease ATP binding subunit Back     alignment and domain information
>TIGR03345 VI_ClpV1 type VI secretion ATPase, ClpV1 family Back     alignment and domain information
>TIGR00390 hslU ATP-dependent protease HslVU, ATPase subunit Back     alignment and domain information
>TIGR00635 ruvB Holliday junction DNA helicase, RuvB subunit Back     alignment and domain information
>TIGR03346 chaperone_ClpB ATP-dependent chaperone ClpB Back     alignment and domain information
>PRK05201 hslU ATP-dependent protease ATP-binding subunit HslU; Provisional Back     alignment and domain information
>COG2204 AtoC Response regulator containing CheY-like receiver, AAA-type ATPase, and DNA-binding domains [Signal transduction mechanisms] Back     alignment and domain information
>PRK00080 ruvB Holliday junction DNA helicase RuvB; Reviewed Back     alignment and domain information
>cd00009 AAA The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold Back     alignment and domain information
>KOG2004 consensus Mitochondrial ATP-dependent protease PIM1/LON [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK05342 clpX ATP-dependent protease ATP-binding subunit ClpX; Provisional Back     alignment and domain information
>COG0466 Lon ATP-dependent Lon protease, bacterial type [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1051 consensus Chaperone HSP104 and related ATP-dependent Clp proteases [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG2255 RuvB Holliday junction resolvasome, helicase subunit [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK14956 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK12323 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK10787 DNA-binding ATP-dependent protease La; Provisional Back     alignment and domain information
>KOG2028 consensus ATPase related to the helicase subunit of the Holliday junction resolvase [Replication, recombination and repair] Back     alignment and domain information
>PRK07003 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK14962 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PF00498 FHA: FHA domain; InterPro: IPR000253 The forkhead-associated (FHA) domain [] is a phosphopeptide recognition domain found in many regulatory proteins Back     alignment and domain information
>TIGR00382 clpX endopeptidase Clp ATP-binding regulatory subunit (clpX) Back     alignment and domain information
>KOG0615 consensus Serine/threonine protein kinase Chk2 and related proteins [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PRK13342 recombination factor protein RarA; Reviewed Back     alignment and domain information
>PHA02544 44 clamp loader, small subunit; Provisional Back     alignment and domain information
>COG3829 RocR Transcriptional regulator containing PAS, AAA-type ATPase, and DNA-binding domains [Transcription / Signal transduction mechanisms] Back     alignment and domain information
>PRK04195 replication factor C large subunit; Provisional Back     alignment and domain information
>cd00060 FHA Forkhead associated domain (FHA); found in eukaryotic and prokaryotic proteins Back     alignment and domain information
>PRK07940 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>smart00382 AAA ATPases associated with a variety of cellular activities Back     alignment and domain information
>PRK14960 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>TIGR02902 spore_lonB ATP-dependent protease LonB Back     alignment and domain information
>PF07728 AAA_5: AAA domain (dynein-related subfamily); InterPro: IPR011704 The ATPases Associated to a variety of cellular Activities (AAA) are a family distinguished by a highly conserved module of 230 amino acids [] Back     alignment and domain information
>COG3604 FhlA Transcriptional regulator containing GAF, AAA-type ATPase, and DNA binding domains [Transcription / Signal transduction mechanisms] Back     alignment and domain information
>PRK14949 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PF07724 AAA_2: AAA domain (Cdc48 subfamily); InterPro: IPR013093 ATPases Associated to a variety of cellular Activities (AAA) are a family distinguished by a highly conserved module of 230 amino acids [] Back     alignment and domain information
>PLN03025 replication factor C subunit; Provisional Back     alignment and domain information
>PRK07994 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK14958 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PF05673 DUF815: Protein of unknown function (DUF815); InterPro: IPR008533 This domain consists of several bacterial proteins of unknown function Back     alignment and domain information
>PF00158 Sigma54_activat: Sigma-54 interaction domain; InterPro: IPR002078 Some bacterial regulatory proteins activate the expression of genes from promoters recognised by core RNA polymerase associated with the alternative sigma-54 factor Back     alignment and domain information
>PRK14961 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK08691 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>TIGR02640 gas_vesic_GvpN gas vesicle protein GvpN Back     alignment and domain information
>PRK11331 5-methylcytosine-specific restriction enzyme subunit McrB; Provisional Back     alignment and domain information
>PRK07764 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK06645 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK14964 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>KOG0989 consensus Replication factor C, subunit RFC4 [Replication, recombination and repair] Back     alignment and domain information
>KOG0742 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK14952 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK05563 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK14963 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14969 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14951 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14959 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PHA02244 ATPase-like protein Back     alignment and domain information
>PRK12402 replication factor C small subunit 2; Reviewed Back     alignment and domain information
>PRK14957 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK13407 bchI magnesium chelatase subunit I; Provisional Back     alignment and domain information
>CHL00081 chlI Mg-protoporyphyrin IX chelatase Back     alignment and domain information
>TIGR02928 orc1/cdc6 family replication initiation protein Back     alignment and domain information
>COG0714 MoxR-like ATPases [General function prediction only] Back     alignment and domain information
>TIGR02397 dnaX_nterm DNA polymerase III, subunit gamma and tau Back     alignment and domain information
>TIGR03420 DnaA_homol_Hda DnaA regulatory inactivator Hda Back     alignment and domain information
>PRK14965 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK00149 dnaA chromosomal replication initiation protein; Reviewed Back     alignment and domain information
>PRK05896 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK06305 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>TIGR01650 PD_CobS cobaltochelatase, CobS subunit Back     alignment and domain information
>PRK07133 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK14970 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK00411 cdc6 cell division control protein 6; Reviewed Back     alignment and domain information
>PRK13341 recombination factor protein RarA/unknown domain fusion protein; Reviewed Back     alignment and domain information
>PRK14948 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PF07726 AAA_3: ATPase family associated with various cellular activities (AAA); InterPro: IPR011703 This entry includes some of the AAA proteins not detected by the IPR003959 from INTERPRO model Back     alignment and domain information
>PRK06647 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PF01078 Mg_chelatase: Magnesium chelatase, subunit ChlI; InterPro: IPR000523 Magnesium-chelatase is a three-component enzyme that catalyses the insertion of Mg2+ into protoporphyrin IX Back     alignment and domain information
>PRK08903 DnaA regulatory inactivator Hda; Validated Back     alignment and domain information
>PRK12377 putative replication protein; Provisional Back     alignment and domain information
>COG1219 ClpX ATP-dependent protease Clp, ATPase subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR02442 Cob-chelat-sub cobaltochelatase subunit Back     alignment and domain information
>COG0542 clpA ATP-binding subunits of Clp protease and DnaK/DnaJ chaperones [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK09111 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK14955 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14953 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>TIGR02903 spore_lon_C ATP-dependent protease, Lon family Back     alignment and domain information
>PF00004 AAA: ATPase family associated with various cellular activities (AAA); InterPro: IPR003959 AAA ATPases (ATPases Associated with diverse cellular Activities) form a large protein family and play a number of roles in the cell including cell-cycle regulation, protein proteolysis and disaggregation, organelle biogenesis and intracellular transport Back     alignment and domain information
>TIGR00362 DnaA chromosomal replication initiator protein DnaA Back     alignment and domain information
>PRK08116 hypothetical protein; Validated Back     alignment and domain information
>KOG0745 consensus Putative ATP-dependent Clp-type protease (AAA+ ATPase superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK07952 DNA replication protein DnaC; Validated Back     alignment and domain information
>PRK08084 DNA replication initiation factor; Provisional Back     alignment and domain information
>PRK14088 dnaA chromosomal replication initiation protein; Provisional Back     alignment and domain information
>PRK06893 DNA replication initiation factor; Validated Back     alignment and domain information
>TIGR02030 BchI-ChlI magnesium chelatase ATPase subunit I Back     alignment and domain information
>PTZ00112 origin recognition complex 1 protein; Provisional Back     alignment and domain information
>PRK14950 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14086 dnaA chromosomal replication initiation protein; Provisional Back     alignment and domain information
>PRK00440 rfc replication factor C small subunit; Reviewed Back     alignment and domain information
>PRK14954 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK15424 propionate catabolism operon regulatory protein PrpR; Provisional Back     alignment and domain information
>PRK08451 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK11608 pspF phage shock protein operon transcriptional activator; Provisional Back     alignment and domain information
>TIGR02974 phageshock_pspF psp operon transcriptional activator PspF Back     alignment and domain information
>COG2812 DnaX DNA polymerase III, gamma/tau subunits [DNA replication, recombination, and repair] Back     alignment and domain information
>KOG0744 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK08727 hypothetical protein; Validated Back     alignment and domain information
>COG2607 Predicted ATPase (AAA+ superfamily) [General function prediction only] Back     alignment and domain information
>PRK12422 chromosomal replication initiation protein; Provisional Back     alignment and domain information
>KOG0991 consensus Replication factor C, subunit RFC2 [Replication, recombination and repair] Back     alignment and domain information
>PRK14971 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>TIGR02329 propionate_PrpR propionate catabolism operon regulatory protein PrpR Back     alignment and domain information
>PRK05642 DNA replication initiation factor; Validated Back     alignment and domain information
>smart00350 MCM minichromosome maintenance proteins Back     alignment and domain information
>COG1221 PspF Transcriptional regulators containing an AAA-type ATPase domain and a DNA-binding domain [Transcription / Signal transduction mechanisms] Back     alignment and domain information
>PRK13531 regulatory ATPase RavA; Provisional Back     alignment and domain information
>PRK08181 transposase; Validated Back     alignment and domain information
>PF00308 Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013317 This entry represents the central domain of bacterial DnaA proteins [, , ] that play an important role in initiating and regulating chromosomal replication Back     alignment and domain information
>COG0470 HolB ATPase involved in DNA replication [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK07471 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>TIGR01817 nifA Nif-specific regulatory protein Back     alignment and domain information
>PRK05564 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK11388 DNA-binding transcriptional regulator DhaR; Provisional Back     alignment and domain information
>PRK05022 anaerobic nitric oxide reductase transcription regulator; Provisional Back     alignment and domain information
>PRK15429 formate hydrogenlyase transcriptional activator FhlA; Provisional Back     alignment and domain information
>TIGR00678 holB DNA polymerase III, delta' subunit Back     alignment and domain information
>TIGR03354 VI_FHA type VI secretion system FHA domain protein Back     alignment and domain information
>PRK06620 hypothetical protein; Validated Back     alignment and domain information
>PRK09112 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK10820 DNA-binding transcriptional regulator TyrR; Provisional Back     alignment and domain information
>TIGR00368 Mg chelatase-related protein Back     alignment and domain information
>PRK06835 DNA replication protein DnaC; Validated Back     alignment and domain information
>PRK14087 dnaA chromosomal replication initiation protein; Provisional Back     alignment and domain information
>KOG1969 consensus DNA replication checkpoint protein CHL12/CTF18 [Cell cycle control, cell division, chromosome partitioning; Replication, recombination and repair] Back     alignment and domain information
>PF01695 IstB_IS21: IstB-like ATP binding protein; InterPro: IPR002611 Proteins in this entry contain an ATP/GTP binding P-loop motif Back     alignment and domain information
>PTZ00111 DNA replication licensing factor MCM4; Provisional Back     alignment and domain information
>COG1239 ChlI Mg-chelatase subunit ChlI [Coenzyme metabolism] Back     alignment and domain information
>TIGR02031 BchD-ChlD magnesium chelatase ATPase subunit D Back     alignment and domain information
>COG1484 DnaC DNA replication protein [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK06526 transposase; Provisional Back     alignment and domain information
>PF13177 DNA_pol3_delta2: DNA polymerase III, delta subunit; PDB: 1NJF_B 3GLG_G 1XXH_I 1NJG_A 3GLF_B 3GLI_G 1IQP_E 2GNO_A 1SXJ_E 1A5T_A Back     alignment and domain information
>PRK08939 primosomal protein DnaI; Reviewed Back     alignment and domain information
>TIGR02915 PEP_resp_reg putative PEP-CTERM system response regulator Back     alignment and domain information
>smart00763 AAA_PrkA PrkA AAA domain Back     alignment and domain information
>PRK06921 hypothetical protein; Provisional Back     alignment and domain information
>PRK08058 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>COG1474 CDC6 Cdc6-related protein, AAA superfamily ATPase [DNA replication, recombination, and repair / Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF14532 Sigma54_activ_2: Sigma-54 interaction domain; PDB: 3CO5_B 3N70_H Back     alignment and domain information
>PRK10923 glnG nitrogen regulation protein NR(I); Provisional Back     alignment and domain information
>PRK05707 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK07399 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK09183 transposase/IS protein; Provisional Back     alignment and domain information
>PRK11361 acetoacetate metabolism regulatory protein AtoC; Provisional Back     alignment and domain information
>COG0593 DnaA ATPase involved in DNA replication initiation [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK09862 putative ATP-dependent protease; Provisional Back     alignment and domain information
>TIGR02881 spore_V_K stage V sporulation protein K Back     alignment and domain information
>TIGR00764 lon_rel lon-related putative ATP-dependent protease Back     alignment and domain information
>PF13401 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S_B Back     alignment and domain information
>PRK09087 hypothetical protein; Validated Back     alignment and domain information
>COG0606 Predicted ATPase with chaperone activity [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK15115 response regulator GlrR; Provisional Back     alignment and domain information
>TIGR00602 rad24 checkpoint protein rad24 Back     alignment and domain information
>KOG0990 consensus Replication factor C, subunit RFC5 [Replication, recombination and repair] Back     alignment and domain information
>CHL00181 cbbX CbbX; Provisional Back     alignment and domain information
>smart00240 FHA Forkhead associated domain Back     alignment and domain information
>PF13173 AAA_14: AAA domain Back     alignment and domain information
>PLN02927 antheraxanthin epoxidase/zeaxanthin epoxidase Back     alignment and domain information
>cd01120 RecA-like_NTPases RecA-like NTPases Back     alignment and domain information
>TIGR01818 ntrC nitrogen regulation protein NR(I) Back     alignment and domain information
>PRK06871 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK06964 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>TIGR00763 lon ATP-dependent protease La Back     alignment and domain information
>PRK07993 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK04132 replication factor C small subunit; Provisional Back     alignment and domain information
>COG3283 TyrR Transcriptional regulator of aromatic amino acids metabolism [Transcription / Amino acid transport and metabolism] Back     alignment and domain information
>PRK10365 transcriptional regulatory protein ZraR; Provisional Back     alignment and domain information
>COG1224 TIP49 DNA helicase TIP49, TBP-interacting protein [Transcription] Back     alignment and domain information
>COG1716 FOG: FHA domain [Signal transduction mechanisms] Back     alignment and domain information
>TIGR02880 cbbX_cfxQ probable Rubsico expression protein CbbX Back     alignment and domain information
>PRK08769 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK05342 clpX ATP-dependent protease ATP-binding subunit ClpX; Provisional Back     alignment and domain information
>PF05621 TniB: Bacterial TniB protein; InterPro: IPR008868 This family consists of several bacterial TniB NTP-binding proteins Back     alignment and domain information
>PRK06090 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>COG1220 HslU ATP-dependent protease HslVU (ClpYQ), ATPase subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF06068 TIP49: TIP49 C-terminus; InterPro: IPR010339 This family consists of the C-terminal region of several eukaryotic and archaeal RuvB-like 1 (Pontin or TIP49a) and RuvB-like 2 (Reptin or TIP49b) proteins Back     alignment and domain information
>PRK13765 ATP-dependent protease Lon; Provisional Back     alignment and domain information
>KOG0478 consensus DNA replication licensing factor, MCM4 component [Replication, recombination and repair] Back     alignment and domain information
>PF01637 Arch_ATPase: Archaeal ATPase; InterPro: IPR011579 This domain has been found in a number of bacterial and archaeal proteins, all of which contain a conserved P-loop motif that is involved in binding ATP Back     alignment and domain information
>PRK13406 bchD magnesium chelatase subunit D; Provisional Back     alignment and domain information
>PRK08699 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>COG1241 MCM2 Predicted ATPase involved in replication control, Cdc46/Mcm family [DNA replication, recombination, and repair] Back     alignment and domain information
>TIGR00382 clpX endopeptidase Clp ATP-binding regulatory subunit (clpX) Back     alignment and domain information
>COG3284 AcoR Transcriptional activator of acetoin/glycerol metabolism [Secondary metabolites biosynthesis, transport, and catabolism / Transcription] Back     alignment and domain information
>PRK00080 ruvB Holliday junction DNA helicase RuvB; Reviewed Back     alignment and domain information
>PF03969 AFG1_ATPase: AFG1-like ATPase; InterPro: IPR005654 ATPase family gene 1 (AFG1) ATPase is a 377 amino acid putative protein with an ATPase motif typical of the protein family including SEC18p PAS1, CDC48-VCP and TBP Back     alignment and domain information
>TIGR02237 recomb_radB DNA repair and recombination protein RadB Back     alignment and domain information
>PF03215 Rad17: Rad17 cell cycle checkpoint protein Back     alignment and domain information
>PF00493 MCM: MCM2/3/5 family This family extends the MCM domain of Prosite Back     alignment and domain information
>PHA00729 NTP-binding motif containing protein Back     alignment and domain information
>TIGR01618 phage_P_loop phage nucleotide-binding protein Back     alignment and domain information
>KOG1881 consensus Anion exchanger adaptor protein Kanadaptin, contains FHA domain [General function prediction only] Back     alignment and domain information
>cd01124 KaiC KaiC is a circadian clock protein primarily found in cyanobacteria KaiC is a RecA-like ATPase, having both Walker A and Walker B motifs Back     alignment and domain information
>COG1219 ClpX ATP-dependent protease Clp, ATPase subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2170 consensus ATPase of the AAA+ superfamily [General function prediction only] Back     alignment and domain information
>PF00910 RNA_helicase: RNA helicase; InterPro: IPR000605 Helicases have been classified in 5 superfamilies (SF1-SF5) Back     alignment and domain information
>PRK05917 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PF12774 AAA_6: Hydrolytic ATP binding site of dynein motor region D1; PDB: 3VKH_A 3VKG_A 4AKI_A 4AI6_B 4AKH_A 4AKG_A 3QMZ_A Back     alignment and domain information
>PRK11823 DNA repair protein RadA; Provisional Back     alignment and domain information
>TIGR03015 pepcterm_ATPase putative secretion ATPase, PEP-CTERM locus subfamily Back     alignment and domain information
>PF05673 DUF815: Protein of unknown function (DUF815); InterPro: IPR008533 This domain consists of several bacterial proteins of unknown function Back     alignment and domain information
>cd01121 Sms Sms (bacterial radA) DNA repair protein Back     alignment and domain information
>TIGR02928 orc1/cdc6 family replication initiation protein Back     alignment and domain information
>KOG1514 consensus Origin recognition complex, subunit 1, and related proteins [Replication, recombination and repair] Back     alignment and domain information
>COG1618 Predicted nucleotide kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>PF12775 AAA_7: P-loop containing dynein motor region D3; PDB: 4AKI_A 4AI6_B 4AKH_A 4AKG_A 3QMZ_A 3VKH_A 3VKG_A Back     alignment and domain information
>PF05729 NACHT: NACHT domain Back     alignment and domain information
>PF13207 AAA_17: AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6_G 2QT1_A 2QSZ_A 2QSY_A 2QT0_A 2QG6_A 2P0E_A Back     alignment and domain information
>KOG0477 consensus DNA replication licensing factor, MCM2 component [Replication, recombination and repair] Back     alignment and domain information
>KOG1970 consensus Checkpoint RAD17-RFC complex, RAD17/RAD24 component [Cell cycle control, cell division, chromosome partitioning; Replication, recombination and repair] Back     alignment and domain information
>PRK09361 radB DNA repair and recombination protein RadB; Provisional Back     alignment and domain information
>KOG0482 consensus DNA replication licensing factor, MCM7 component [Replication, recombination and repair] Back     alignment and domain information
>COG3456 Predicted component of the type VI protein secretion system, contains a FHA domain [Intracellular trafficking, secretion, and vesicular transport; Signal transduction mechanisms] Back     alignment and domain information
>PRK00411 cdc6 cell division control protein 6; Reviewed Back     alignment and domain information
>TIGR02688 conserved hypothetical protein TIGR02688 Back     alignment and domain information
>PF05707 Zot: Zonular occludens toxin (Zot); InterPro: IPR008900 This entry consists of bacterial and viral proteins which are very similar to the Zonular occludens toxin (Zot) Back     alignment and domain information
>PRK08533 flagellar accessory protein FlaH; Reviewed Back     alignment and domain information
>PRK14962 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>KOG0479 consensus DNA replication licensing factor, MCM3 component [Replication, recombination and repair] Back     alignment and domain information
>KOG1051 consensus Chaperone HSP104 and related ATP-dependent Clp proteases [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK08118 topology modulation protein; Reviewed Back     alignment and domain information
>PRK00771 signal recognition particle protein Srp54; Provisional Back     alignment and domain information
>PRK00149 dnaA chromosomal replication initiation protein; Reviewed Back     alignment and domain information
>KOG2035 consensus Replication factor C, subunit RFC3 [Cell cycle control, cell division, chromosome partitioning; Replication, recombination and repair] Back     alignment and domain information
>TIGR02012 tigrfam_recA protein RecA Back     alignment and domain information
>PF06309 Torsin: Torsin; InterPro: IPR010448 This family consists of several eukaryotic torsin proteins Back     alignment and domain information
>PRK07261 topology modulation protein; Provisional Back     alignment and domain information
>cd00983 recA RecA is a bacterial enzyme which has roles in homologous recombination, DNA repair, and the induction of the SOS response Back     alignment and domain information
>KOG0481 consensus DNA replication licensing factor, MCM5 component [Replication, recombination and repair] Back     alignment and domain information
>PRK05818 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PHA02624 large T antigen; Provisional Back     alignment and domain information
>PF03266 NTPase_1: NTPase; InterPro: IPR004948 This entry represents a family of nucleoside-triphosphatases which have activity towards ATP, GTP, CTP, TTP and UTP and may hydrolyse nucleoside diphosphates with lower efficiency [] Back     alignment and domain information
>TIGR00635 ruvB Holliday junction DNA helicase, RuvB subunit Back     alignment and domain information
>PRK00131 aroK shikimate kinase; Reviewed Back     alignment and domain information
>cd01129 PulE-GspE PulE/GspE The type II secretory pathway is the main terminal branch of the general secretory pathway (GSP) Back     alignment and domain information
>PRK12723 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>COG3854 SpoIIIAA ncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>KOG2227 consensus Pre-initiation complex, subunit CDC6, AAA+ superfamily ATPase [Replication, recombination and repair; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG1942 consensus DNA helicase, TBP-interacting protein [Replication, recombination and repair] Back     alignment and domain information
>PRK15455 PrkA family serine protein kinase; Provisional Back     alignment and domain information
>KOG2228 consensus Origin recognition complex, subunit 4 [Replication, recombination and repair] Back     alignment and domain information
>PRK14722 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PF13604 AAA_30: AAA domain; PDB: 1W36_G 3K70_G 3UPU_B 3GPL_A 3E1S_A 3GP8_A Back     alignment and domain information
>cd01394 radB RadB Back     alignment and domain information
>PF00931 NB-ARC: NB-ARC domain; InterPro: IPR002182 This is the NB-ARC domain, a novel signalling motif found in bacteria and eukaryotes, shared by plant resistance gene products and regulators of cell death in animals [] Back     alignment and domain information
>PRK13342 recombination factor protein RarA; Reviewed Back     alignment and domain information
>KOG0745 consensus Putative ATP-dependent Clp-type protease (AAA+ ATPase superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG4650 RtcR Sigma54-dependent transcription regulator containing an AAA-type ATPase domain and a DNA-binding domain [Transcription / Signal transduction mechanisms] Back     alignment and domain information
>KOG0480 consensus DNA replication licensing factor, MCM6 component [Replication, recombination and repair] Back     alignment and domain information
>PRK04296 thymidine kinase; Provisional Back     alignment and domain information
>PRK14086 dnaA chromosomal replication initiation protein; Provisional Back     alignment and domain information
>PRK13407 bchI magnesium chelatase subunit I; Provisional Back     alignment and domain information
>PRK14974 cell division protein FtsY; Provisional Back     alignment and domain information
>PF13191 AAA_16: AAA ATPase domain; PDB: 2V1U_A Back     alignment and domain information
>cd01131 PilT Pilus retraction ATPase PilT Back     alignment and domain information
>PRK07276 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>cd03283 ABC_MutS-like MutS-like homolog in eukaryotes Back     alignment and domain information
>TIGR00390 hslU ATP-dependent protease HslVU, ATPase subunit Back     alignment and domain information
>PRK06067 flagellar accessory protein FlaH; Validated Back     alignment and domain information
>PRK05800 cobU adenosylcobinamide kinase/adenosylcobinamide-phosphate guanylyltransferase; Validated Back     alignment and domain information
>PRK13695 putative NTPase; Provisional Back     alignment and domain information
>PRK10536 hypothetical protein; Provisional Back     alignment and domain information
>PF13671 AAA_33: AAA domain; PDB: 1LTQ_A 2IA5_K 1RC8_A 1LY1_A 1RRC_A 1RPZ_A 3ZVM_A 1YJ5_A 3ZVL_A 3U7E_B Back     alignment and domain information
>PRK11331 5-methylcytosine-specific restriction enzyme subunit McrB; Provisional Back     alignment and domain information
>PRK03839 putative kinase; Provisional Back     alignment and domain information
>PRK13947 shikimate kinase; Provisional Back     alignment and domain information
>TIGR03877 thermo_KaiC_1 KaiC domain protein, Ph0284 family Back     alignment and domain information
>TIGR02858 spore_III_AA stage III sporulation protein AA Back     alignment and domain information
>cd00046 DEXDc DEAD-like helicases superfamily Back     alignment and domain information
>TIGR00416 sms DNA repair protein RadA Back     alignment and domain information
>TIGR00362 DnaA chromosomal replication initiator protein DnaA Back     alignment and domain information
>cd01122 GP4d_helicase GP4d_helicase is a homohexameric 5'-3' helicases Back     alignment and domain information
>cd00464 SK Shikimate kinase (SK) is the fifth enzyme in the shikimate pathway, a seven-step biosynthetic pathway which converts erythrose-4-phosphate to chorismic acid, found in bacteria, fungi and plants Back     alignment and domain information
>cd01128 rho_factor Transcription termination factor rho is a bacterial ATP-dependent RNA/DNA helicase Back     alignment and domain information
>PRK12726 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PRK07132 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK10787 DNA-binding ATP-dependent protease La; Provisional Back     alignment and domain information
>PRK00625 shikimate kinase; Provisional Back     alignment and domain information
>PRK09376 rho transcription termination factor Rho; Provisional Back     alignment and domain information
>PHA02544 44 clamp loader, small subunit; Provisional Back     alignment and domain information
>PRK07764 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>cd01393 recA_like RecA is a bacterial enzyme which has roles in homologous recombination, DNA repair, and the induction of the SOS response Back     alignment and domain information
>PRK11889 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>KOG3347 consensus Predicted nucleotide kinase/nuclear protein involved oxidative stress response [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK14532 adenylate kinase; Provisional Back     alignment and domain information
>PF00437 T2SE: Type II/IV secretion system protein; InterPro: IPR001482 A number of bacterial proteins, some of which are involved in a general secretion pathway (GSP) for the export of proteins (also called the type II pathway) belong to this group [, ] Back     alignment and domain information
>COG2256 MGS1 ATPase related to the helicase subunit of the Holliday junction resolvase [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK06217 hypothetical protein; Validated Back     alignment and domain information
>PRK09354 recA recombinase A; Provisional Back     alignment and domain information
>cd00544 CobU Adenosylcobinamide kinase / adenosylcobinamide phosphate guanyltransferase (CobU) Back     alignment and domain information
>COG5271 MDN1 AAA ATPase containing von Willebrand factor type A (vWA) domain [General function prediction only] Back     alignment and domain information
>PRK04195 replication factor C large subunit; Provisional Back     alignment and domain information
>PRK10436 hypothetical protein; Provisional Back     alignment and domain information
>TIGR01359 UMP_CMP_kin_fam UMP-CMP kinase family Back     alignment and domain information
>PRK14088 dnaA chromosomal replication initiation protein; Provisional Back     alignment and domain information
>PRK06645 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK13949 shikimate kinase; Provisional Back     alignment and domain information
>cd00984 DnaB_C DnaB helicase C terminal domain Back     alignment and domain information
>TIGR02525 plasmid_TraJ plasmid transfer ATPase TraJ Back     alignment and domain information
>COG1485 Predicted ATPase [General function prediction only] Back     alignment and domain information
>cd01123 Rad51_DMC1_radA Rad51_DMC1_radA,B Back     alignment and domain information
>PF00448 SRP54: SRP54-type protein, GTPase domain; InterPro: IPR000897 The signal recognition particle (SRP) is a multimeric protein, which along with its conjugate receptor (SR), is involved in targeting secretory proteins to the rough endoplasmic reticulum (RER) membrane in eukaryotes, or to the plasma membrane in prokaryotes [, ] Back     alignment and domain information
>PRK06762 hypothetical protein; Provisional Back     alignment and domain information
>cd01428 ADK Adenylate kinase (ADK) catalyzes the reversible phosphoryl transfer from adenosine triphosphates (ATP) to adenosine monophosphates (AMP) and to yield adenosine diphosphates (ADP) Back     alignment and domain information
>TIGR01425 SRP54_euk signal recognition particle protein SRP54 Back     alignment and domain information
>COG4619 ABC-type uncharacterized transport system, ATPase component [General function prediction only] Back     alignment and domain information
>PRK07003 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK10416 signal recognition particle-docking protein FtsY; Provisional Back     alignment and domain information
>PF06745 KaiC: KaiC; InterPro: IPR014774 This entry represents a domain within bacterial and archaeal proteins, most of which are hypothetical Back     alignment and domain information
>cd02020 CMPK Cytidine monophosphate kinase (CMPK) catalyzes the reversible phosphorylation of cytidine monophosphate (CMP) to produce cytidine diphosphate (CDP), using ATP as the preferred phosphoryl donor Back     alignment and domain information
>cd03280 ABC_MutS2 MutS2 homologs in bacteria and eukaryotes Back     alignment and domain information
>TIGR02538 type_IV_pilB type IV-A pilus assembly ATPase PilB Back     alignment and domain information
>TIGR03878 thermo_KaiC_2 KaiC domain protein, AF_0795 family Back     alignment and domain information
>TIGR02533 type_II_gspE general secretory pathway protein E Back     alignment and domain information
>TIGR01420 pilT_fam pilus retraction protein PilT Back     alignment and domain information
>PRK14531 adenylate kinase; Provisional Back     alignment and domain information
>PF13479 AAA_24: AAA domain Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>PRK13948 shikimate kinase; Provisional Back     alignment and domain information
>cd02021 GntK Gluconate kinase (GntK) catalyzes the phosphoryl transfer from ATP to gluconate Back     alignment and domain information
>cd03281 ABC_MSH5_euk MutS5 homolog in eukaryotes Back     alignment and domain information
>PRK05973 replicative DNA helicase; Provisional Back     alignment and domain information
>cd03243 ABC_MutS_homologs The MutS protein initiates DNA mismatch repair by recognizing mispaired and unpaired bases embedded in duplex DNA and activating endo- and exonucleases to remove the mismatch Back     alignment and domain information
>PRK14530 adenylate kinase; Provisional Back     alignment and domain information
>COG0563 Adk Adenylate kinase and related kinases [Nucleotide transport and metabolism] Back     alignment and domain information
>COG2804 PulE Type II secretory pathway, ATPase PulE/Tfp pilus assembly pathway, ATPase PilB [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>TIGR00064 ftsY signal recognition particle-docking protein FtsY Back     alignment and domain information
>TIGR02782 TrbB_P P-type conjugative transfer ATPase TrbB Back     alignment and domain information
>TIGR01313 therm_gnt_kin carbohydrate kinase, thermoresistant glucokinase family Back     alignment and domain information
>TIGR03880 KaiC_arch_3 KaiC domain protein, AF_0351 family Back     alignment and domain information
>PRK03731 aroL shikimate kinase II; Reviewed Back     alignment and domain information
>PRK12323 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PLN03025 replication factor C subunit; Provisional Back     alignment and domain information
>PRK13531 regulatory ATPase RavA; Provisional Back     alignment and domain information
>PRK12724 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PTZ00088 adenylate kinase 1; Provisional Back     alignment and domain information
>PRK05201 hslU ATP-dependent protease ATP-binding subunit HslU; Provisional Back     alignment and domain information
>PRK14959 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14528 adenylate kinase; Provisional Back     alignment and domain information
>PRK13764 ATPase; Provisional Back     alignment and domain information
>COG1373 Predicted ATPase (AAA+ superfamily) [General function prediction only] Back     alignment and domain information
>PHA02774 E1; Provisional Back     alignment and domain information
>smart00534 MUTSac ATPase domain of DNA mismatch repair MUTS family Back     alignment and domain information
>PRK14956 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>cd00227 CPT Chloramphenicol (Cm) phosphotransferase (CPT) Back     alignment and domain information
>COG0703 AroK Shikimate kinase [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR03881 KaiC_arch_4 KaiC domain protein, PAE1156 family Back     alignment and domain information
>PRK04328 hypothetical protein; Provisional Back     alignment and domain information
>TIGR03574 selen_PSTK L-seryl-tRNA(Sec) kinase, archaeal Back     alignment and domain information
>PRK02496 adk adenylate kinase; Provisional Back     alignment and domain information
>PRK14961 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>TIGR02397 dnaX_nterm DNA polymerase III, subunit gamma and tau Back     alignment and domain information
>PRK13900 type IV secretion system ATPase VirB11; Provisional Back     alignment and domain information
>PRK12422 chromosomal replication initiation protein; Provisional Back     alignment and domain information
>KOG1968 consensus Replication factor C, subunit RFC1 (large subunit) [Replication, recombination and repair] Back     alignment and domain information
>PRK14948 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK13946 shikimate kinase; Provisional Back     alignment and domain information
>PF09848 DUF2075: Uncharacterized conserved protein (DUF2075); InterPro: IPR018647 This domain, found in putative ATP/GTP binding proteins, has no known function Back     alignment and domain information
>PRK05057 aroK shikimate kinase I; Reviewed Back     alignment and domain information
>COG4088 Predicted nucleotide kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK06547 hypothetical protein; Provisional Back     alignment and domain information
>PRK09519 recA DNA recombination protein RecA; Reviewed Back     alignment and domain information
>PRK08154 anaerobic benzoate catabolism transcriptional regulator; Reviewed Back     alignment and domain information
>cd01130 VirB11-like_ATPase Type IV secretory pathway component VirB11, and related ATPases Back     alignment and domain information
>TIGR01360 aden_kin_iso1 adenylate kinase, isozyme 1 subfamily Back     alignment and domain information
>smart00487 DEXDc DEAD-like helicases superfamily Back     alignment and domain information
>PRK14963 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>KOG2383 consensus Predicted ATPase [General function prediction only] Back     alignment and domain information
>PRK05563 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK14960 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK00279 adk adenylate kinase; Reviewed Back     alignment and domain information
>cd03227 ABC_Class2 ABC-type Class 2 contains systems involved in cellular processes other than transport Back     alignment and domain information
>PRK04301 radA DNA repair and recombination protein RadA; Validated Back     alignment and domain information
>TIGR01448 recD_rel helicase, putative, RecD/TraA family Back     alignment and domain information
>cd02027 APSK Adenosine 5'-phosphosulfate kinase (APSK) catalyzes the phosphorylation of adenosine 5'-phosphosulfate to form 3'-phosphoadenosine 5'-phosphosulfate (PAPS) Back     alignment and domain information
>cd03115 SRP The signal recognition particle (SRP) mediates the transport to or across the plasma membrane in bacteria and the endoplasmic reticulum in eukaryotes Back     alignment and domain information
>PRK12402 replication factor C small subunit 2; Reviewed Back     alignment and domain information
>TIGR01351 adk adenylate kinases Back     alignment and domain information
>PLN02200 adenylate kinase family protein Back     alignment and domain information
>cd00267 ABC_ATPase ABC (ATP-binding cassette) transporter nucleotide-binding domain; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules Back     alignment and domain information
>COG1102 Cmk Cytidylate kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK14952 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PF02562 PhoH: PhoH-like protein; InterPro: IPR003714 PhoH is a cytoplasmic protein and predicted ATPase that is induced by phosphate starvation and belongings to the phosphate regulon (pho) in Escherichia coli [] Back     alignment and domain information
>PRK06893 DNA replication initiation factor; Validated Back     alignment and domain information
>PRK06731 flhF flagellar biosynthesis regulator FlhF; Validated Back     alignment and domain information
>COG1066 Sms Predicted ATP-dependent serine protease [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd03216 ABC_Carb_Monos_I This family represents the domain I of the carbohydrate uptake proteins that transport only monosaccharides (Monos) Back     alignment and domain information
>PRK14964 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14965 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK04040 adenylate kinase; Provisional Back     alignment and domain information
>PF13481 AAA_25: AAA domain; PDB: 1G8Y_J 1OLO_A 1NLF_C Back     alignment and domain information
>PF06414 Zeta_toxin: Zeta toxin; InterPro: IPR010488 This entry represents a domain originally identified in bacterial zeta toxin proteins, where it comprises the whole protein [] Back     alignment and domain information
>TIGR02655 circ_KaiC circadian clock protein KaiC Back     alignment and domain information
>TIGR02788 VirB11 P-type DNA transfer ATPase VirB11 Back     alignment and domain information
>PF04665 Pox_A32: Poxvirus A32 protein; InterPro: IPR006758 This entry contains uncharacterised proteins belonging to the B354L family which include the pox virus A32 protein Back     alignment and domain information
>TIGR03499 FlhF flagellar biosynthetic protein FlhF Back     alignment and domain information
>PF13238 AAA_18: AAA domain; PDB: 3IIK_A 3IIJ_A 3IIL_A 1RKB_A 3IIM_A 2AXP_A 3KB2_A 1KHT_A 1NKS_A 3H86_C Back     alignment and domain information
>PF14516 AAA_35: AAA-like domain Back     alignment and domain information
>TIGR02236 recomb_radA DNA repair and recombination protein RadA Back     alignment and domain information
>cd02019 NK Nucleoside/nucleotide kinase (NK) is a protein superfamily consisting of multiple families of enzymes that share structural similarity and are functionally related to the catalysis of the reversible phosphate group transfer from nucleoside triphosphates to nucleosides/nucleotides, nucleoside monophosphates, or sugars Back     alignment and domain information
>COG1936 Predicted nucleotide kinase (related to CMP and AMP kinases) [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK13851 type IV secretion system protein VirB11; Provisional Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query1116
3vfd_A 389 Human Spastin Aaa Domain Length = 389 2e-49
3d8b_A 357 Crystal Structure Of Human Fidgetin-Like Protein 1 3e-46
3b9p_A 297 Spastin Length = 297 2e-43
2qp9_X 355 Crystal Structure Of S.Cerevisiae Vps4 Length = 355 3e-41
2rko_A 331 Crystal Structure Of The Vps4p-Dimer Length = 331 5e-41
3eih_A 340 Crystal Structure Of S.Cerevisiae Vps4 In The Prese 9e-41
3eie_A 322 Crystal Structure Of S.Cerevisiae Vps4 In The So4-B 1e-40
2zam_A 444 Crystal Structure Of Mouse Skd1VPS4B APO-Form Lengt 2e-39
1xwi_A 322 Crystal Structure Of Vps4b Length = 322 7e-39
3cf1_A 806 Structure Of P97VCP IN COMPLEX WITH ADPADP.ALFX Len 3e-32
1r7r_A 816 The Crystal Structure Of Murine P97VCP AT 3.6A Leng 3e-32
3cf0_A 301 Structure Of D2 Subdomain Of P97VCP IN COMPLEX WITH 4e-32
3h4m_A 285 Aaa Atpase Domain Of The Proteasome- Activating Nuc 4e-31
4b4t_L437 Near-Atomic Resolution Structural Model Of The Yeas 6e-30
3hu3_A 489 Structure Of P97 N-D1 R155h Mutant In Complex With 1e-29
3hu2_A 489 Structure Of P97 N-D1 R86a Mutant In Complex With A 1e-29
3hu1_A 489 Structure Of P97 N-D1 R95g Mutant In Complex With A 1e-29
2x8a_A 274 Human Nuclear Valosin Containing Protein Like (Nvl) 1e-29
1e32_A458 Structure Of The N-Terminal Domain And The D1 Aaa D 2e-29
4b4t_K428 Near-Atomic Resolution Structural Model Of The Yeas 4e-28
4b4t_I437 Near-Atomic Resolution Structural Model Of The Yeas 3e-27
4b4t_M434 Near-Atomic Resolution Structural Model Of The Yeas 5e-27
4b4t_J405 Near-Atomic Resolution Structural Model Of The Yeas 2e-26
2ce7_A 476 Edta Treated Length = 476 3e-25
4b4t_H467 Near-Atomic Resolution Structural Model Of The Yeas 6e-25
3kds_E 465 Apo-ftsh Crystal Structure Length = 465 1e-24
1lv7_A257 Crystal Structure Of The Aaa Domain Of Ftsh Length 5e-23
2r62_A268 Crystal Structure Of Helicobacter Pylori Atp Depend 6e-22
2qz4_A262 Human Paraplegin, Aaa Domain In Complex With Adp Le 8e-21
1iy2_A278 Crystal Structure Of The Ftsh Atpase Domain From Th 6e-19
1ixz_A254 Crystal Structure Of The Ftsh Atpase Domain From Th 8e-19
4eiw_A 508 Whole Cytosolic Region Of Atp-Dependent Metalloprot 1e-18
2dhr_A 499 Whole Cytosolic Region Of Atp-Dependent Metalloprot 1e-18
3m6a_A 543 Crystal Structure Of Bacillus Subtilis Lon C-Termin 4e-06
>pdb|3VFD|A Chain A, Human Spastin Aaa Domain Length = 389 Back     alignment and structure

Iteration: 1

Score = 194 bits (494), Expect = 2e-49, Method: Compositional matrix adjust. Identities = 94/183 (51%), Positives = 132/183 (72%), Gaps = 3/183 (1%) Query: 934 LLADVIPPSDIGVTFDDIGALENVKDTLKELVMLPLQRPELFCKGQLTKPCKGILLFGPP 993 L+ + I + V FDDI + K L+E+V+LP RPELF L P +G+LLFGPP Sbjct: 100 LIMNEIVDNGTAVKFDDIAGQDLAKQALQEIVILPSLRPELFTG--LRAPARGLLLFGPP 157 Query: 994 GTGKTMLAKAVATEAGANFINISMSSITSKWFGEGEKYVKAVFSLASKIAPSVVFVDEVD 1053 G GKTMLAKAVA E+ A F NIS +S+TSK+ GEGEK V+A+F++A ++ PS++F+D+VD Sbjct: 158 GNGKTMLAKAVAAESNATFFNISAASLTSKYVGEGEKLVRALFAVARELQPSIIFIDQVD 217 Query: 1054 SMLGRRENPGEHEAMRKMKNEFMVNWDGLRTKDKERVLVLAATNRPFDLDEAVVRRLPRR 1113 S+L R GEH+A R++K EF++ +DG+++ +RVLV+ ATNRP +LDEAV+RR +R Sbjct: 218 SLLCERRE-GEHDASRRLKTEFLIEFDGVQSAGDDRVLVMGATNRPQELDEAVLRRFIKR 276 Query: 1114 TCV 1116 V Sbjct: 277 VYV 279
>pdb|3D8B|A Chain A, Crystal Structure Of Human Fidgetin-Like Protein 1 In Complex With Adp Length = 357 Back     alignment and structure
>pdb|3B9P|A Chain A, Spastin Length = 297 Back     alignment and structure
>pdb|2QP9|X Chain X, Crystal Structure Of S.Cerevisiae Vps4 Length = 355 Back     alignment and structure
>pdb|2RKO|A Chain A, Crystal Structure Of The Vps4p-Dimer Length = 331 Back     alignment and structure
>pdb|3EIH|A Chain A, Crystal Structure Of S.Cerevisiae Vps4 In The Presence Of Atpgammas Length = 340 Back     alignment and structure
>pdb|3EIE|A Chain A, Crystal Structure Of S.Cerevisiae Vps4 In The So4-Bound State Length = 322 Back     alignment and structure
>pdb|2ZAM|A Chain A, Crystal Structure Of Mouse Skd1VPS4B APO-Form Length = 444 Back     alignment and structure
>pdb|1XWI|A Chain A, Crystal Structure Of Vps4b Length = 322 Back     alignment and structure
>pdb|3CF1|A Chain A, Structure Of P97VCP IN COMPLEX WITH ADPADP.ALFX Length = 806 Back     alignment and structure
>pdb|1R7R|A Chain A, The Crystal Structure Of Murine P97VCP AT 3.6A Length = 816 Back     alignment and structure
>pdb|3CF0|A Chain A, Structure Of D2 Subdomain Of P97VCP IN COMPLEX WITH ADP Length = 301 Back     alignment and structure
>pdb|3H4M|A Chain A, Aaa Atpase Domain Of The Proteasome- Activating Nucleotidase Length = 285 Back     alignment and structure
>pdb|4B4T|L Chain L, Near-Atomic Resolution Structural Model Of The Yeast 26s Proteasome Length = 437 Back     alignment and structure
>pdb|3HU3|A Chain A, Structure Of P97 N-D1 R155h Mutant In Complex With Atpgs Length = 489 Back     alignment and structure
>pdb|3HU2|A Chain A, Structure Of P97 N-D1 R86a Mutant In Complex With Atpgs Length = 489 Back     alignment and structure
>pdb|3HU1|A Chain A, Structure Of P97 N-D1 R95g Mutant In Complex With Atpgs Length = 489 Back     alignment and structure
>pdb|2X8A|A Chain A, Human Nuclear Valosin Containing Protein Like (Nvl), C- Terminal Aaa-Atpase Domain Length = 274 Back     alignment and structure
>pdb|1E32|A Chain A, Structure Of The N-Terminal Domain And The D1 Aaa Domain Of Membrane Fusion Atpase P97 Length = 458 Back     alignment and structure
>pdb|4B4T|K Chain K, Near-Atomic Resolution Structural Model Of The Yeast 26s Proteasome Length = 428 Back     alignment and structure
>pdb|4B4T|I Chain I, Near-Atomic Resolution Structural Model Of The Yeast 26s Proteasome Length = 437 Back     alignment and structure
>pdb|4B4T|M Chain M, Near-Atomic Resolution Structural Model Of The Yeast 26s Proteasome Length = 434 Back     alignment and structure
>pdb|4B4T|J Chain J, Near-Atomic Resolution Structural Model Of The Yeast 26s Proteasome Length = 405 Back     alignment and structure
>pdb|2CE7|A Chain A, Edta Treated Length = 476 Back     alignment and structure
>pdb|4B4T|H Chain H, Near-Atomic Resolution Structural Model Of The Yeast 26s Proteasome Length = 467 Back     alignment and structure
>pdb|3KDS|E Chain E, Apo-ftsh Crystal Structure Length = 465 Back     alignment and structure
>pdb|1LV7|A Chain A, Crystal Structure Of The Aaa Domain Of Ftsh Length = 257 Back     alignment and structure
>pdb|2R62|A Chain A, Crystal Structure Of Helicobacter Pylori Atp Dependent Protease, Ftsh Length = 268 Back     alignment and structure
>pdb|2QZ4|A Chain A, Human Paraplegin, Aaa Domain In Complex With Adp Length = 262 Back     alignment and structure
>pdb|1IY2|A Chain A, Crystal Structure Of The Ftsh Atpase Domain From Thermus Thermophilus Length = 278 Back     alignment and structure
>pdb|1IXZ|A Chain A, Crystal Structure Of The Ftsh Atpase Domain From Thermus Thermophilus Length = 254 Back     alignment and structure
>pdb|4EIW|A Chain A, Whole Cytosolic Region Of Atp-Dependent Metalloprotease Ftsh (G399l) Length = 508 Back     alignment and structure
>pdb|2DHR|A Chain A, Whole Cytosolic Region Of Atp-Dependent Metalloprotease Ftsh (G399l) Length = 499 Back     alignment and structure
>pdb|3M6A|A Chain A, Crystal Structure Of Bacillus Subtilis Lon C-Terminal Domain Length = 543 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query1116
3b9p_A 297 CG5977-PA, isoform A; AAA ATPase, ATP-binding, nuc 9e-99
3vfd_A 389 Spastin; ATPase, microtubule severing, hydrolase; 1e-97
3d8b_A 357 Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, s 1e-93
3eie_A 322 Vacuolar protein sorting-associated protein 4; AAA 6e-90
1xwi_A 322 SKD1 protein; VPS4B, AAA ATPase, protein transport 3e-88
2qp9_X 355 Vacuolar protein sorting-associated protein 4; ATP 5e-83
2zan_A 444 Vacuolar protein sorting-associating protein 4B; S 2e-79
3cf0_A 301 Transitional endoplasmic reticulum ATPase; AAA, P9 3e-53
2x8a_A274 Nuclear valosin-containing protein-like; nuclear p 2e-52
3h4m_A285 Proteasome-activating nucleotidase; ATPase, PAN, A 7e-51
1ypw_A 806 Transitional endoplasmic reticulum ATPase; AAA, P9 3e-49
1ypw_A 806 Transitional endoplasmic reticulum ATPase; AAA, P9 2e-42
3hu3_A 489 Transitional endoplasmic reticulum ATPase; VCP, tr 1e-46
1d2n_A272 N-ethylmaleimide-sensitive fusion protein; hexamer 7e-39
3t15_A 293 Ribulose bisphosphate carboxylase/oxygenase activ 3e-38
1ixz_A254 ATP-dependent metalloprotease FTSH; AAA domain fol 6e-31
1lv7_A257 FTSH; alpha/beta domain, four helix bundle, hydrol 1e-30
2r62_A268 Cell division protease FTSH homolog; ATPase domain 2e-30
1iy2_A278 ATP-dependent metalloprotease FTSH; AAA domain fol 3e-30
2qz4_A262 Paraplegin; AAA+, SPG7, protease, ADP, structural 4e-30
2ce7_A 476 Cell division protein FTSH; metalloprotease; HET: 1e-24
2dhr_A 499 FTSH; AAA+ protein, hexameric Zn metalloprotease, 2e-24
1lgp_A116 Cell cycle checkpoint protein CHFR; FHA, tungstate 3e-18
1gxc_A149 CHK2, CDS1, serine/threonine-protein kinase CHK2; 1e-16
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 8e-15
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 4e-12
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-11
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-08
3i6u_A419 CDS1, serine/threonine-protein kinase CHK2; Ser/Th 2e-09
3syl_A 309 Protein CBBX; photosynthesis, rubisco activase, AA 2e-09
3pvs_A 447 Replication-associated recombination protein A; ma 5e-09
2c9o_A 456 RUVB-like 1; hexameric helicase, AAA+-ATPase, ATP- 1e-08
1sxj_A 516 Activator 1 95 kDa subunit; clamp loader, processi 4e-08
2jqj_A151 DNA damage response protein kinase DUN1; protein/p 1e-06
3pie_A1155 5'->3' exoribonuclease (XRN1); beta berrel, tudor 2e-06
2chg_A226 Replication factor C small subunit; DNA-binding pr 3e-05
2chq_A 319 Replication factor C small subunit; DNA-binding pr 7e-05
1qu5_A182 Protein kinase SPK1; FHA, RAD53, transferase; NMR 8e-05
1dmz_A158 Protein (protein kinase SPK1); beta-sandwich, anti 9e-05
1iqp_A 327 RFCS; clamp loader, extended AAA-ATPase domain, co 1e-04
2qgz_A308 Helicase loader, putative primosome component; str 1e-04
3ec2_A180 DNA replication protein DNAC; helicase loader, rep 1e-04
3hx1_A131 SLR1951 protein; P74513_SYNY3, adenylate cyclase-l 1e-04
1r21_A128 Antigen KI-67; beta sandwich, cell cycle; NMR {Hom 2e-04
3pfi_A 338 Holliday junction ATP-dependent DNA helicase RUVB; 3e-04
1in4_A 334 RUVB, holliday junction DNA helicase RUVB; AAA+-cl 3e-04
1hqc_A 324 RUVB; extended AAA-ATPase domain, complex with nuc 4e-04
3m6a_A 543 ATP-dependent protease LA 1; alpha, beta, ATP-bind 5e-04
>3b9p_A CG5977-PA, isoform A; AAA ATPase, ATP-binding, nucleotide-binding, hydrolase; 2.70A {Drosophila melanogaster} Length = 297 Back     alignment and structure
 Score =  313 bits (805), Expect = 9e-99
 Identities = 94/183 (51%), Positives = 129/183 (70%), Gaps = 4/183 (2%)

Query: 932  KKLLADVIPPSDIGVTFDDIGALENVKDTLKELVMLPLQRPELFCKGQLTKPCKGILLFG 991
             +L+ D I      V + DI   +  K  L+E+V+LP  RPELF    L  P KG+LLFG
Sbjct: 4    VQLILDEIVEGGAKVEWTDIAGQDVAKQALQEMVILPSVRPELFTG--LRAPAKGLLLFG 61

Query: 992  PPGTGKTMLAKAVATEAGANFINISMSSITSKWFGEGEKYVKAVFSLASKIAPSVVFVDE 1051
            PPG GKT+LA+AVATE  A F+NIS +S+TSK+ G+GEK V+A+F++A  + PS++F+DE
Sbjct: 62   PPGNGKTLLARAVATECSATFLNISAASLTSKYVGDGEKLVRALFAVARHMQPSIIFIDE 121

Query: 1052 VDSMLGRRENPGEHEAMRKMKNEFMVNWDGLRT-KDKERVLVLAATNRPFDLDEAVVRRL 1110
            VDS+L  R +  EHEA R++K EF+V +DGL    D +R++VLAATNRP +LDEA +RR 
Sbjct: 122  VDSLLSERSS-SEHEASRRLKTEFLVEFDGLPGNPDGDRIVVLAATNRPQELDEAALRRF 180

Query: 1111 PRR 1113
             +R
Sbjct: 181  TKR 183


>3vfd_A Spastin; ATPase, microtubule severing, hydrolase; 3.30A {Homo sapiens} Length = 389 Back     alignment and structure
>3d8b_A Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, structural genomics consortium, ATP- hydrolase, magnesium, metal-binding, nucleotide-binding; HET: ADP; 2.00A {Homo sapiens} Length = 357 Back     alignment and structure
>3eie_A Vacuolar protein sorting-associated protein 4; AAA ATPase, ATP-binding cassette, ATP-binding, endosome, MEM nucleotide-binding; 2.70A {Saccharomyces cerevisiae} PDB: 3eih_A* 2rko_A 3mhv_C Length = 322 Back     alignment and structure
>1xwi_A SKD1 protein; VPS4B, AAA ATPase, protein transport; 2.80A {Homo sapiens} Length = 322 Back     alignment and structure
>2qp9_X Vacuolar protein sorting-associated protein 4; ATPase domain, beta domain, C-terminal helix, ATP-binding, E nucleotide-binding; 2.90A {Saccharomyces cerevisiae} PDB: 2qpa_A* Length = 355 Back     alignment and structure
>2zan_A Vacuolar protein sorting-associating protein 4B; SKD1, VPS4B, AAA ATPase, ATP-binding, coiled coil, membrane, nucleotide-binding, phosphorylation; HET: ATP; 3.00A {Mus musculus} PDB: 2zam_A* 2zao_A* 2jqh_A 2jqk_A 1wr0_A 2jq9_A 2k3w_A 1yxr_A Length = 444 Back     alignment and structure
>3cf0_A Transitional endoplasmic reticulum ATPase; AAA, P97/VCP, ERAD, CDC48, ATP-binding, lipid-binding, nucle binding, nucleus, phosphoprotein, transport; HET: ADP; 3.00A {Mus musculus} Length = 301 Back     alignment and structure
>2x8a_A Nuclear valosin-containing protein-like; nuclear protein; 2.60A {Homo sapiens} Length = 274 Back     alignment and structure
>3h4m_A Proteasome-activating nucleotidase; ATPase, PAN, ATP-binding, nucleotide-binding, HY; HET: ADP; 3.11A {Methanocaldococcus jannaschii} Length = 285 Back     alignment and structure
>3hu3_A Transitional endoplasmic reticulum ATPase; VCP, transport protein; HET: AGS; 2.20A {Homo sapiens} PDB: 3hu2_A* 3hu1_A* 1e32_A* 1s3s_A* 2pjh_B Length = 489 Back     alignment and structure
>1d2n_A N-ethylmaleimide-sensitive fusion protein; hexamerization domain, ATPase, transport; HET: ANP; 1.75A {Cricetulus griseus} SCOP: c.37.1.20 PDB: 1nsf_A* Length = 272 Back     alignment and structure
>3t15_A Ribulose bisphosphate carboxylase/oxygenase activ chloroplastic; photosynthesis, rubisco activase, AAA+ protein; 2.95A {Nicotiana tabacum} PDB: 3zw6_A Length = 293 Back     alignment and structure
>1ixz_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 2.20A {Thermus thermophilus} SCOP: c.37.1.20 PDB: 1iy0_A* 1iy1_A* Length = 254 Back     alignment and structure
>1lv7_A FTSH; alpha/beta domain, four helix bundle, hydrolase; 1.50A {Escherichia coli} SCOP: c.37.1.20 Length = 257 Back     alignment and structure
>2r62_A Cell division protease FTSH homolog; ATPase domain, ATP-binding, cell CELL division, hydrolase, membrane, metal-binding; 3.30A {Helicobacter pylori} PDB: 2r65_A* Length = 268 Back     alignment and structure
>1iy2_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 3.20A {Thermus thermophilus} SCOP: c.37.1.20 Length = 278 Back     alignment and structure
>2qz4_A Paraplegin; AAA+, SPG7, protease, ADP, structural genomics, structural G consortium, SGC, ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.22A {Homo sapiens} Length = 262 Back     alignment and structure
>2ce7_A Cell division protein FTSH; metalloprotease; HET: ADP; 2.44A {Thermotoga maritima} SCOP: a.269.1.1 c.37.1.20 PDB: 2cea_A* 3kds_E* Length = 476 Back     alignment and structure
>2dhr_A FTSH; AAA+ protein, hexameric Zn metalloprotease, hydrolase; HET: ADP; 3.90A {Thermus thermophilus} Length = 499 Back     alignment and structure
>1lgp_A Cell cycle checkpoint protein CHFR; FHA, tungstate, domain swapping; 2.00A {Homo sapiens} SCOP: b.26.1.2 PDB: 1lgq_A Length = 116 Back     alignment and structure
>1gxc_A CHK2, CDS1, serine/threonine-protein kinase CHK2; phosphoprotein-binding domain, checkpoint kinase, transferase; HET: TPO; 2.7A {Homo sapiens} SCOP: b.26.1.2 Length = 149 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>3i6u_A CDS1, serine/threonine-protein kinase CHK2; Ser/Thr protein kinase, FHA domain, ATP-binding, cell cycle, mutation, LI-fraumeni syndrome, magnesium; 3.00A {Homo sapiens} PDB: 3i6w_A Length = 419 Back     alignment and structure
>3syl_A Protein CBBX; photosynthesis, rubisco activase, AAA+ protein, calvin cycle chaperone; 3.00A {Rhodobacter sphaeroides} PDB: 3syk_A 3zuh_A* Length = 309 Back     alignment and structure
>3pvs_A Replication-associated recombination protein A; maintenance of genome stability Pro recombination; 2.50A {Escherichia coli} Length = 447 Back     alignment and structure
>2c9o_A RUVB-like 1; hexameric helicase, AAA+-ATPase, ATP-binding, chromatin regulator, growth regulation, hydrolase, nuclear protein, DNA recombination; HET: ADP; 2.2A {Homo sapiens} PDB: 2xsz_A* Length = 456 Back     alignment and structure
>1sxj_A Activator 1 95 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Length = 516 Back     alignment and structure
>2jqj_A DNA damage response protein kinase DUN1; protein/phosphopeptide, cell cycle; HET: DNA; NMR {Saccharomyces cerevisiae} PDB: 2jql_A* Length = 151 Back     alignment and structure
>3pie_A 5'->3' exoribonuclease (XRN1); beta berrel, tudor domain, chromo domain, mRNA turnover, RRN processing, RNA binding, DNA binding; 2.90A {Kluyveromyces lactis} PDB: 3pif_A Length = 1155 Back     alignment and structure
>2chg_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATPase, ATP-binding, nucleotide-binding; HET: ANP; 2.1A {Archaeoglobus fulgidus} Length = 226 Back     alignment and structure
>2chq_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATP ATP-binding, nucleotide-binding; HET: ANP; 3.5A {Archaeoglobus fulgidus} PDB: 2chv_A Length = 319 Back     alignment and structure
>1qu5_A Protein kinase SPK1; FHA, RAD53, transferase; NMR {Saccharomyces cerevisiae} SCOP: b.26.1.2 Length = 182 Back     alignment and structure
>1dmz_A Protein (protein kinase SPK1); beta-sandwich, antiparallel beta-sheets, transferase; NMR {Saccharomyces cerevisiae} SCOP: b.26.1.2 PDB: 1fhq_A 1fhr_A* 1j4k_A* 1j4l_A* 1k2m_A* 1k2n_A* Length = 158 Back     alignment and structure
>1iqp_A RFCS; clamp loader, extended AAA-ATPase domain, complex with ADP, replication; HET: ADP; 2.80A {Pyrococcus furiosus} SCOP: a.80.1.1 c.37.1.20 Length = 327 Back     alignment and structure
>2qgz_A Helicase loader, putative primosome component; structural genomics, PSI-2, protein structure initiative; 2.40A {Streptococcus pyogenes serotype M3} Length = 308 Back     alignment and structure
>3ec2_A DNA replication protein DNAC; helicase loader, replication initiation factor, ATP-binding, nucleotide-binding; HET: DNA ADP; 2.70A {Aquifex aeolicus} PDB: 3ecc_A* Length = 180 Back     alignment and structure
>3hx1_A SLR1951 protein; P74513_SYNY3, adenylate cyclase-like protein, NESG, structural genomics, PSI-2, protein structure initiative; 2.50A {Synechocystis SP} Length = 131 Back     alignment and structure
>1r21_A Antigen KI-67; beta sandwich, cell cycle; NMR {Homo sapiens} SCOP: b.26.1.2 PDB: 2aff_A* Length = 128 Back     alignment and structure
>3pfi_A Holliday junction ATP-dependent DNA helicase RUVB; probable holliday junction DNA helicase; HET: ADP; 2.69A {Campylobacter jejuni subsp} Length = 338 Back     alignment and structure
>1in4_A RUVB, holliday junction DNA helicase RUVB; AAA+-class ATPase, winged-helix domain, ATP hydrolysis, walker A, walker B, sensor 1, sensor 2; HET: ADP; 1.60A {Thermotoga maritima} SCOP: a.4.5.11 c.37.1.20 PDB: 1in5_A* 1in6_A* 1in8_A* 1in7_A* 1j7k_A* Length = 334 Back     alignment and structure
>1hqc_A RUVB; extended AAA-ATPase domain, complex with nucleotide, hydrolase; HET: ADE; 3.20A {Thermus thermophilus} SCOP: a.4.5.11 c.37.1.20 PDB: 1ixs_B* 1ixr_C* Length = 324 Back     alignment and structure
>3m6a_A ATP-dependent protease LA 1; alpha, beta, ATP-binding, hydrolase, nucleotide-binding, Pro serine protease, stress response; HET: ADP; 3.40A {Bacillus subtilis} PDB: 1x37_A Length = 543 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query1116
3cf2_A 806 TER ATPase, transitional endoplasmic reticulum ATP 100.0
1ypw_A 806 Transitional endoplasmic reticulum ATPase; AAA, P9 100.0
4b4t_J405 26S protease regulatory subunit 8 homolog; hydrola 99.98
4b4t_I437 26S protease regulatory subunit 4 homolog; hydrola 99.97
4b4t_H467 26S protease regulatory subunit 7 homolog; hydrola 99.97
4b4t_M434 26S protease regulatory subunit 6A; hydrolase, AAA 99.97
4b4t_L437 26S protease subunit RPT4; hydrolase, AAA-atpases, 99.97
4b4t_K428 26S protease regulatory subunit 6B homolog; hydrol 99.97
3cf2_A 806 TER ATPase, transitional endoplasmic reticulum ATP 99.94
1xwi_A 322 SKD1 protein; VPS4B, AAA ATPase, protein transport 99.93
3eie_A 322 Vacuolar protein sorting-associated protein 4; AAA 99.91
2qp9_X 355 Vacuolar protein sorting-associated protein 4; ATP 99.9
4b4t_J405 26S protease regulatory subunit 8 homolog; hydrola 99.9
2zan_A 444 Vacuolar protein sorting-associating protein 4B; S 99.89
4b4t_I437 26S protease regulatory subunit 4 homolog; hydrola 99.89
3cf0_A 301 Transitional endoplasmic reticulum ATPase; AAA, P9 99.89
2x8a_A274 Nuclear valosin-containing protein-like; nuclear p 99.88
4b4t_H467 26S protease regulatory subunit 7 homolog; hydrola 99.88
3d8b_A 357 Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, s 99.88
4b4t_L437 26S protease subunit RPT4; hydrolase, AAA-atpases, 99.88
3vfd_A 389 Spastin; ATPase, microtubule severing, hydrolase; 99.87
3b9p_A 297 CG5977-PA, isoform A; AAA ATPase, ATP-binding, nuc 99.87
4b4t_K428 26S protease regulatory subunit 6B homolog; hydrol 99.87
3pxi_A758 Negative regulator of genetic competence CLPC/MEC; 99.87
4b4t_M434 26S protease regulatory subunit 6A; hydrolase, AAA 99.86
1r6b_X 758 CLPA protein; AAA+, N-terminal domain, CLPS, cryst 99.86
3h4m_A285 Proteasome-activating nucleotidase; ATPase, PAN, A 99.86
2ce7_A 476 Cell division protein FTSH; metalloprotease; HET: 99.86
1lv7_A257 FTSH; alpha/beta domain, four helix bundle, hydrol 99.86
2qz4_A262 Paraplegin; AAA+, SPG7, protease, ADP, structural 99.85
3hu3_A 489 Transitional endoplasmic reticulum ATPase; VCP, tr 99.85
1qvr_A854 CLPB protein; coiled coil, AAA ATPase, chaperone; 99.81
2dhr_A 499 FTSH; AAA+ protein, hexameric Zn metalloprotease, 99.8
3t15_A 293 Ribulose bisphosphate carboxylase/oxygenase activ 99.79
2r62_A268 Cell division protease FTSH homolog; ATPase domain 99.79
1ixz_A254 ATP-dependent metalloprotease FTSH; AAA domain fol 99.78
1ypw_A 806 Transitional endoplasmic reticulum ATPase; AAA, P9 99.75
1iy2_A278 ATP-dependent metalloprotease FTSH; AAA domain fol 99.75
1gxc_A149 CHK2, CDS1, serine/threonine-protein kinase CHK2; 99.73
2c9o_A 456 RUVB-like 1; hexameric helicase, AAA+-ATPase, ATP- 99.69
1lgp_A116 Cell cycle checkpoint protein CHFR; FHA, tungstate 99.68
1xwi_A322 SKD1 protein; VPS4B, AAA ATPase, protein transport 99.67
2qp9_X355 Vacuolar protein sorting-associated protein 4; ATP 99.62
3eie_A322 Vacuolar protein sorting-associated protein 4; AAA 99.61
2zan_A444 Vacuolar protein sorting-associating protein 4B; S 99.59
3syl_A 309 Protein CBBX; photosynthesis, rubisco activase, AA 99.59
1g41_A 444 Heat shock protein HSLU; AAA-ATPase, CLPY, ATP-dep 99.59
1d2n_A272 N-ethylmaleimide-sensitive fusion protein; hexamer 99.58
1ofh_A 310 ATP-dependent HSL protease ATP-binding subunit HSL 99.57
3hu3_A489 Transitional endoplasmic reticulum ATPase; VCP, tr 99.55
2p65_A187 Hypothetical protein PF08_0063; CLPB, malaria, str 99.54
2x8a_A274 Nuclear valosin-containing protein-like; nuclear p 99.54
3cf0_A301 Transitional endoplasmic reticulum ATPase; AAA, P9 99.53
3hws_A 363 ATP-dependent CLP protease ATP-binding subunit CL; 99.53
1jbk_A195 CLPB protein; beta barrel, chaperone; 1.80A {Esche 99.51
2jqj_A151 DNA damage response protein kinase DUN1; protein/p 99.5
1g6g_A127 Protein kinase RAD53; beta-sandwich, phosphopeptid 99.5
3h4m_A285 Proteasome-activating nucleotidase; ATPase, PAN, A 99.49
2ce7_A476 Cell division protein FTSH; metalloprotease; HET: 99.49
3b9p_A297 CG5977-PA, isoform A; AAA ATPase, ATP-binding, nuc 99.48
3i6u_A419 CDS1, serine/threonine-protein kinase CHK2; Ser/Th 99.46
3pfi_A 338 Holliday junction ATP-dependent DNA helicase RUVB; 99.46
3m6a_A 543 ATP-dependent protease LA 1; alpha, beta, ATP-bind 99.46
3d8b_A357 Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, s 99.46
1lv7_A257 FTSH; alpha/beta domain, four helix bundle, hydrol 99.46
3vfd_A389 Spastin; ATPase, microtubule severing, hydrolase; 99.45
2qz4_A262 Paraplegin; AAA+, SPG7, protease, ADP, structural 99.44
1um8_A 376 ATP-dependent CLP protease ATP-binding subunit CL; 99.43
3uk6_A 368 RUVB-like 2; hexameric AAA+ ATP-ASE, DNA unwinding 99.36
4h87_A130 Kanadaptin; FHA domain of PF00498, mRNA processing 99.34
2r62_A268 Cell division protease FTSH homolog; ATPase domain 99.34
1hqc_A 324 RUVB; extended AAA-ATPase domain, complex with nuc 99.33
2dhr_A499 FTSH; AAA+ protein, hexameric Zn metalloprotease, 99.32
3u61_B 324 DNA polymerase accessory protein 44; AAA+, ATP hyd 99.32
1r6b_X 758 CLPA protein; AAA+, N-terminal domain, CLPS, cryst 99.3
2pie_A138 E3 ubiquitin-protein ligase RNF8; FHA domain, comp 99.3
1qvr_A 854 CLPB protein; coiled coil, AAA ATPase, chaperone; 99.3
4fcw_A311 Chaperone protein CLPB; AAA domain; HET: ADP; 2.35 99.3
1g3g_A164 Protien kinase SPK1; FHA domain, RAD53, phosphopep 99.3
2chg_A226 Replication factor C small subunit; DNA-binding pr 99.29
3n70_A145 Transport activator; sigma-54, ntpase, PSI, MCSG, 99.28
3pxg_A 468 Negative regulator of genetic competence CLPC/MEC; 99.27
1l8q_A 324 Chromosomal replication initiator protein DNAA; AA 99.27
1g8p_A 350 Magnesium-chelatase 38 kDa subunit; parallel beta 99.26
3pvs_A 447 Replication-associated recombination protein A; ma 99.25
3va4_A132 Mediator of DNA damage checkpoint protein 1; cell 99.25
3cmw_A 1706 Protein RECA, recombinase A; homologous recombinat 99.24
3co5_A143 Putative two-component system transcriptional RES 99.24
3pxi_A 758 Negative regulator of genetic competence CLPC/MEC; 99.22
2v1u_A 387 Cell division control protein 6 homolog; DNA repli 99.22
2qby_B 384 CDC6 homolog 3, cell division control protein 6 ho 99.21
1qu5_A182 Protein kinase SPK1; FHA, RAD53, transferase; NMR 99.21
3te6_A 318 Regulatory protein SIR3; heterochromatin, gene sil 99.19
1sxj_A 516 Activator 1 95 kDa subunit; clamp loader, processi 99.18
1uht_A118 Expressed protein; FHA domain, beta-sandwich, anti 99.18
2bjv_A265 PSP operon transcriptional activator; AAA, transcr 99.18
2r44_A 331 Uncharacterized protein; putative ATPase, structur 99.18
1ixz_A254 ATP-dependent metalloprotease FTSH; AAA domain fol 99.16
1njg_A250 DNA polymerase III subunit gamma; rossman-like fol 99.16
1dmz_A158 Protein (protein kinase SPK1); beta-sandwich, anti 99.15
3po8_A100 RV0020C protein, putative uncharacterized protein 99.12
3hx1_A131 SLR1951 protein; P74513_SYNY3, adenylate cyclase-l 99.12
2z4s_A 440 Chromosomal replication initiator protein DNAA; AA 99.12
2chq_A 319 Replication factor C small subunit; DNA-binding pr 99.11
1r21_A128 Antigen KI-67; beta sandwich, cell cycle; NMR {Hom 99.11
1sxj_D 353 Activator 1 41 kDa subunit; clamp loader, processi 99.11
3els_A158 PRE-mRNA leakage protein 1; intrinsically unstruct 99.1
1ojl_A 304 Transcriptional regulatory protein ZRAR; response 99.1
2qby_A 386 CDC6 homolog 1, cell division control protein 6 ho 99.09
2xt9_B115 Putative signal transduction protein GARA; lyase-s 99.09
3t15_A293 Ribulose bisphosphate carboxylase/oxygenase activ 99.08
1iqp_A 327 RFCS; clamp loader, extended AAA-ATPase domain, co 99.08
1sxj_B 323 Activator 1 37 kDa subunit; clamp loader, processi 99.08
2csw_A145 Ubiquitin ligase protein RNF8; 11-stranded beta sa 99.07
1iy2_A278 ATP-dependent metalloprotease FTSH; AAA domain fol 99.05
2kb3_A143 Oxoglutarate dehydrogenase inhibitor; forkhead-ass 99.04
3nbx_X 500 ATPase RAVA; AAA+ ATPase, alpha-beta-alpha structu 99.04
2c9o_A456 RUVB-like 1; hexameric helicase, AAA+-ATPase, ATP- 99.04
2jpe_A140 Nuclear inhibitor of protein phosphatase 1; FHA do 99.04
3bos_A242 Putative DNA replication factor; P-loop containing 99.03
1fnn_A 389 CDC6P, cell division control protein 6; ORC1, AAA 99.03
1mzk_A139 Kinase associated protein phosphatase; beta sandwi 99.03
1g41_A444 Heat shock protein HSLU; AAA-ATPase, CLPY, ATP-dep 99.02
1jr3_A 373 DNA polymerase III subunit gamma; processivity, pr 99.02
2kfu_A162 RV1827 PThr 22; FHA domain, phosphorylation, intra 99.0
3f9v_A 595 Minichromosome maintenance protein MCM; replicativ 98.96
3elv_A205 PRE-mRNA leakage protein 1; intrinsically unstruct 98.96
3gqs_A106 Adenylate cyclase-like protein; FHA domain, struct 98.94
4ejq_A154 Kinesin-like protein KIF1A; homodimer, FHA domain, 98.93
3oun_A157 Putative uncharacterized protein TB39.8; peptidogl 98.92
1sxj_E 354 Activator 1 40 kDa subunit; clamp loader, processi 98.9
1wln_A120 Afadin; beta sandwich, FHA domain, structural geno 98.9
1sxj_C 340 Activator 1 40 kDa subunit; clamp loader, processi 98.88
3ec2_A180 DNA replication protein DNAC; helicase loader, rep 98.88
2ff4_A388 Probable regulatory protein EMBR; winged-helix, te 98.87
1in4_A 334 RUVB, holliday junction DNA helicase RUVB; AAA+-cl 98.86
3fm8_A124 Kinesin-like protein KIF13B; kinesin, GAP, GTPase 98.8
1a5t_A 334 Delta prime, HOLB; zinc finger, DNA replication; 2 98.8
3cmw_A 1706 Protein RECA, recombinase A; homologous recombinat 98.79
2gno_A 305 DNA polymerase III, gamma subunit-related protein; 98.78
2w58_A202 DNAI, primosome component (helicase loader); ATP-b 98.73
3uv0_A102 Mutator 2, isoform B; FHA, protein binding, dimeri 98.72
1ny5_A387 Transcriptional regulator (NTRC family); AAA+ ATPa 98.68
2kjq_A149 DNAA-related protein; solution structure, NESG, st 98.66
3k1j_A 604 LON protease, ATP-dependent protease LON; ATP-bind 98.65
2brf_A110 Bifunctional polynucleotide phosphatase/kinase; hy 98.61
3kt9_A102 Aprataxin; FHA domain, beta sandwich, beta sheet, 98.61
1yj5_C143 5' polynucleotide kinase-3' phosphatase FHA domai; 98.56
4akg_A 2695 Glutathione S-transferase class-MU 26 kDa isozyme 98.52
2vhj_A331 Ntpase P4, P4; non- hydrolysable ATP analogue, hyd 98.52
3dzd_A368 Transcriptional regulator (NTRC family); sigma43 a 98.52
1w5s_A 412 Origin recognition complex subunit 2 ORC2; replica 98.49
2qgz_A308 Helicase loader, putative primosome component; str 98.44
3syl_A309 Protein CBBX; photosynthesis, rubisco activase, AA 98.42
1ujx_A119 Polynucleotide kinase 3'-phosphatase; DNA repair, 98.39
2r2a_A199 Uncharacterized protein; zonular occludens toxin, 98.29
3f8t_A 506 Predicted ATPase involved in replication control, 98.27
4egx_A184 Kinesin-like protein KIF1A; FHA domain, transport 98.23
1d2n_A272 N-ethylmaleimide-sensitive fusion protein; hexamer 98.23
3uk6_A368 RUVB-like 2; hexameric AAA+ ATP-ASE, DNA unwinding 98.23
3hws_A363 ATP-dependent CLP protease ATP-binding subunit CL; 98.21
1ofh_A310 ATP-dependent HSL protease ATP-binding subunit HSL 98.16
3m6a_A543 ATP-dependent protease LA 1; alpha, beta, ATP-bind 98.15
1jbk_A195 CLPB protein; beta barrel, chaperone; 1.80A {Esche 98.07
1um8_A376 ATP-dependent CLP protease ATP-binding subunit CL; 98.01
3cmu_A 2050 Protein RECA, recombinase A; homologous recombinat 97.97
4akg_A 2695 Glutathione S-transferase class-MU 26 kDa isozyme 97.96
3huf_A325 DNA repair and telomere maintenance protein NBS1; 97.88
1tue_A212 Replication protein E1; helicase, replication, E1E 97.87
3pxg_A468 Negative regulator of genetic competence CLPC/MEC; 97.87
2r44_A331 Uncharacterized protein; putative ATPase, structur 97.85
1sxj_A516 Activator 1 95 kDa subunit; clamp loader, processi 97.85
2v1u_A387 Cell division control protein 6 homolog; DNA repli 97.79
3pfi_A338 Holliday junction ATP-dependent DNA helicase RUVB; 97.78
3u61_B324 DNA polymerase accessory protein 44; AAA+, ATP hyd 97.78
2p65_A187 Hypothetical protein PF08_0063; CLPB, malaria, str 97.74
2fna_A 357 Conserved hypothetical protein; structural genomic 97.74
2qen_A 350 Walker-type ATPase; unknown function; HET: ADP; 2. 97.65
4a0e_A123 YSCD, type III secretion protein; transport protei 97.65
1hqc_A324 RUVB; extended AAA-ATPase domain, complex with nuc 97.65
2chg_A226 Replication factor C small subunit; DNA-binding pr 97.6
1wv3_A238 Similar to DNA segregation ATPase and related prot 97.59
1ye8_A178 Protein THEP1, hypothetical UPF0334 kinase-like pr 97.58
1u0j_A267 DNA replication protein; AAA+ protein, P-loop atpa 97.54
4fcw_A311 Chaperone protein CLPB; AAA domain; HET: ADP; 2.35 97.48
3vkg_A 3245 Dynein heavy chain, cytoplasmic; AAA+ protein, mol 97.45
1g8p_A350 Magnesium-chelatase 38 kDa subunit; parallel beta 97.43
1svm_A377 Large T antigen; AAA+ fold, viral protein; HET: AT 97.43
2z4s_A440 Chromosomal replication initiator protein DNAA; AA 97.4
2qby_A386 CDC6 homolog 1, cell division control protein 6 ho 97.31
2cvh_A220 DNA repair and recombination protein RADB; filamen 97.31
3kw6_A78 26S protease regulatory subunit 8; structural geno 97.3
1xp8_A 366 RECA protein, recombinase A; recombination, radior 97.25
2w0m_A235 SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus 97.22
3nbx_X500 ATPase RAVA; AAA+ ATPase, alpha-beta-alpha structu 97.2
3te6_A318 Regulatory protein SIR3; heterochromatin, gene sil 97.17
1njg_A250 DNA polymerase III subunit gamma; rossman-like fol 97.16
3hr8_A 356 Protein RECA; alpha and beta proteins (A/B, A+B), 97.15
3bos_A242 Putative DNA replication factor; P-loop containing 97.12
1n0w_A243 DNA repair protein RAD51 homolog 1; DNA repair, ho 97.11
2krk_A86 26S protease regulatory subunit 8; structural geno 97.1
3pvs_A447 Replication-associated recombination protein A; ma 97.1
2zr9_A 349 Protein RECA, recombinase A; recombination, RECA m 97.07
2qby_B384 CDC6 homolog 3, cell division control protein 6 ho 97.02
3cmu_A 2050 Protein RECA, recombinase A; homologous recombinat 97.0
1l8q_A324 Chromosomal replication initiator protein DNAA; AA 97.0
3vkg_A 3245 Dynein heavy chain, cytoplasmic; AAA+ protein, mol 96.99
2chq_A319 Replication factor C small subunit; DNA-binding pr 96.96
1qhx_A178 CPT, protein (chloramphenicol phosphotransferase); 96.89
1sxj_B323 Activator 1 37 kDa subunit; clamp loader, processi 96.85
2orw_A184 Thymidine kinase; TMTK, TP4A, transferase; HET: 4T 96.75
2z43_A324 DNA repair and recombination protein RADA; archaea 96.74
1u94_A 356 RECA protein, recombinase A; homologous recombinat 96.74
3trf_A185 Shikimate kinase, SK; amino acid biosynthesis, tra 96.73
1v5w_A343 DMC1, meiotic recombination protein DMC1/LIM15 hom 96.7
3upu_A 459 ATP-dependent DNA helicase DDA; RECA-like domain, 96.65
1iqp_A327 RFCS; clamp loader, extended AAA-ATPase domain, co 96.58
2ehv_A251 Hypothetical protein PH0186; KAIC, RECA ATPase, un 96.56
2dr3_A247 UPF0273 protein PH0284; RECA superfamily ATPase, h 96.56
3vaa_A199 Shikimate kinase, SK; structural genomics, center 96.55
1sxj_D353 Activator 1 41 kDa subunit; clamp loader, processi 96.51
1jr3_A373 DNA polymerase III subunit gamma; processivity, pr 96.49
3aji_B83 S6C, proteasome (prosome, macropain) 26S subunit, 96.46
1fnn_A389 CDC6P, cell division control protein 6; ORC1, AAA 96.44
3kb2_A173 SPBC2 prophage-derived uncharacterized protein YOR 96.44
3jvv_A356 Twitching mobility protein; hexameric P-loop ATPas 96.38
3vlf_B88 26S protease regulatory subunit 7 homolog; heat re 96.37
4a74_A231 DNA repair and recombination protein RADA; hydrola 96.37
3f9v_A595 Minichromosome maintenance protein MCM; replicativ 96.37
3io5_A 333 Recombination and repair protein; storage dimer, i 96.35
2b8t_A223 Thymidine kinase; deoxyribonucleoside kinase, zinc 96.34
3lda_A400 DNA repair protein RAD51; DNA binding protein, ATP 96.33
1via_A175 Shikimate kinase; structural genomics, transferase 96.33
3iij_A180 Coilin-interacting nuclear ATPase protein; alpha a 96.31
3dm5_A 443 SRP54, signal recognition 54 kDa protein; protein- 96.31
1zuh_A168 Shikimate kinase; alpha-beta protein, transferase; 96.29
2iyv_A184 Shikimate kinase, SK; transferase, aromatic amino 96.25
3bh0_A 315 DNAB-like replicative helicase; ATPase, replicatio 96.24
2rhm_A193 Putative kinase; P-loop containing nucleoside trip 96.22
1a5t_A334 Delta prime, HOLB; zinc finger, DNA replication; 2 96.22
1sxj_E354 Activator 1 40 kDa subunit; clamp loader, processi 96.2
1y63_A184 LMAJ004144AAA protein; structural genomics, protei 96.19
2p5t_B253 PEZT; postsegregational killing system, phosphoryl 96.19
1gvn_B 287 Zeta; postsegregational killing system, plasmid; 1 96.18
2i1q_A322 DNA repair and recombination protein RADA; ATPase, 96.16
1aky_A220 Adenylate kinase; ATP:AMP phosphotransferase, myok 96.15
1tev_A196 UMP-CMP kinase; ploop, NMP binding region, LID reg 96.14
3lw7_A179 Adenylate kinase related protein (ADKA-like); AMP, 96.14
2i3b_A189 HCR-ntpase, human cancer-related ntpase; AAA, ross 96.13
2cdn_A201 Adenylate kinase; phosphoryl transfer, associative 96.12
1pzn_A349 RAD51, DNA repair and recombination protein RAD51, 96.12
1vma_A306 Cell division protein FTSY; TM0570, structural gen 96.08
1e6c_A173 Shikimate kinase; phosphoryl transfer, ADP, shikim 96.08
1nlf_A 279 Regulatory protein REPA; replicative DNA helicase 96.07
2ze6_A 253 Isopentenyl transferase; crown GALL tumor, cytokin 96.06
2c95_A196 Adenylate kinase 1; transferase, AP4A, nucleotide 96.06
2r8r_A228 Sensor protein; KDPD, PFAM02702, MCSG, structural 96.04
3a4m_A 260 L-seryl-tRNA(SEC) kinase; P-loop motif, walker A m 96.04
3e1s_A 574 Exodeoxyribonuclease V, subunit RECD; alpha and be 96.03
1kag_A173 SKI, shikimate kinase I; transferase, structural g 96.03
2pt5_A168 Shikimate kinase, SK; aromatic amino acid biosynth 95.99
3dl0_A216 Adenylate kinase; phosphotransferase, zinc coordin 95.94
3cm0_A186 Adenylate kinase; ATP-binding, cytoplasm, nucleoti 95.91
2gno_A305 DNA polymerase III, gamma subunit-related protein; 95.9
2zts_A251 Putative uncharacterized protein PH0186; KAIC like 95.9
1ak2_A233 Adenylate kinase isoenzyme-2; nucleoside monophosp 95.89
2bwj_A199 Adenylate kinase 5; phosphoryl transfer reaction, 95.88
3fb4_A216 Adenylate kinase; psychrophIle, phosphotransferase 95.88
1kht_A192 Adenylate kinase; phosphotransferase, signaling pr 95.87
1z6t_A 591 APAF-1, apoptotic protease activating factor 1; ca 95.86
1g5t_A196 COB(I)alamin adenosyltransferase; P-loop protein, 95.86
1qf9_A194 UMP/CMP kinase, protein (uridylmonophosphate/cytid 95.85
2r6a_A 454 DNAB helicase, replicative helicase; replication, 95.84
2dzn_B82 26S protease regulatory subunit 6B homolog; ankyri 95.83
2fz4_A237 DNA repair protein RAD25; RECA-like domain, DNA da 95.82
2q6t_A 444 DNAB replication FORK helicase; hydrolase; 2.90A { 95.81
1ukz_A203 Uridylate kinase; transferase; HET: ADP AMP; 1.90A 95.8
2vli_A183 Antibiotic resistance protein; transferase, tunica 95.79
1ly1_A181 Polynucleotide kinase; PNK, phosphatase, transfera 95.79
3t61_A202 Gluconokinase; PSI-biology, structural genomics, p 95.79
1zd8_A227 GTP:AMP phosphotransferase mitochondrial; ATP:AMP 95.78
2iut_A 574 DNA translocase FTSK; nucleotide-binding, chromoso 95.78
3tlx_A243 Adenylate kinase 2; structural genomics, structura 95.78
3be4_A217 Adenylate kinase; malaria, cryptosporidium parvum 95.75
1knq_A175 Gluconate kinase; ALFA/beta structure, transferase 95.69
1cr0_A 296 DNA primase/helicase; RECA-type protein fold, tran 95.59
3kl4_A 433 SRP54, signal recognition 54 kDa protein; signal r 95.59
1zp6_A191 Hypothetical protein ATU3015; alpha-beta protein., 95.58
1zak_A222 Adenylate kinase; ATP:AMP-phosphotransferase, tran 95.55
1e4v_A214 Adenylate kinase; transferase(phosphotransferase); 95.5
3bgw_A 444 DNAB-like replicative helicase; ATPase, replicatio 95.46
3sr0_A206 Adenylate kinase; phosphoryl transfer analogue, AL 95.44
2pbr_A195 DTMP kinase, thymidylate kinase; transferase, nucl 95.4
4eun_A200 Thermoresistant glucokinase; putative sugar kinase 95.39
2pez_A179 Bifunctional 3'-phosphoadenosine 5'- phosphosulfat 95.37
3umf_A217 Adenylate kinase; rossmann fold, transferase; 2.05 95.32
2jaq_A205 Deoxyguanosine kinase; transferase, deoxyribonucle 95.31
2ga8_A 359 Hypothetical 39.9 kDa protein; YFR007W, YFH7, unkn 95.27
3b6e_A216 Interferon-induced helicase C domain-containing P; 95.13
1nks_A194 Adenylate kinase; thermophilic, transferase; HET: 95.13
3crm_A 323 TRNA delta(2)-isopentenylpyrophosphate transferase 95.11
3sfz_A 1249 APAF-1, apoptotic peptidase activating factor 1; a 95.1
2xb4_A223 Adenylate kinase; ATP-binding, nucleotide-binding, 95.1
1cke_A227 CK, MSSA, protein (cytidine monophosphate kinase); 95.08
1q57_A 503 DNA primase/helicase; dntpase, DNA replication, tr 95.07
2eyu_A261 Twitching motility protein PILT; pilus retraction 95.04
2if2_A204 Dephospho-COA kinase; alpha-beta protein, structur 95.03
2z0h_A197 DTMP kinase, thymidylate kinase; ATP-binding, nucl 95.03
2v54_A204 DTMP kinase, thymidylate kinase; nucleotide biosyn 95.01
1sxj_C340 Activator 1 40 kDa subunit; clamp loader, processi 94.97
2ius_A 512 DNA translocase FTSK; nucleotide-binding, chromoso 94.89
1uf9_A203 TT1252 protein; P-loop, nucleotide binding domain, 94.87
1w5s_A412 Origin recognition complex subunit 2 ORC2; replica 94.76
3ake_A208 Cytidylate kinase; CMP kinase, CMP complex, open c 94.74
2plr_A213 DTMP kinase, probable thymidylate kinase; TMP-bind 94.73
2ewv_A372 Twitching motility protein PILT; pilus retraction 94.7
3uie_A200 Adenylyl-sulfate kinase 1, chloroplastic; rossmann 94.66
1p9r_A 418 General secretion pathway protein E; bacterial typ 94.57
2wwf_A212 Thymidilate kinase, putative; transferase, malaria 94.56
1w36_D 608 RECD, exodeoxyribonuclease V alpha chain; recombin 94.55
2bbw_A246 Adenylate kinase 4, AK4; nucleotide kinase, nucleo 94.52
4gp7_A171 Metallophosphoesterase; polynucleotide kinase phos 94.52
4a1f_A 338 DNAB helicase, replicative DNA helicase; hydrolase 94.47
2grj_A192 Dephospho-COA kinase; TM1387, EC 2.7.1.24, dephosp 94.44
1m7g_A211 Adenylylsulfate kinase; APS kinase, transferase, s 94.43
1jjv_A206 Dephospho-COA kinase; P-loop nucleotide-binding fo 94.42
1ex7_A186 Guanylate kinase; substrate-induced FIT, domain mo 94.41
3r20_A233 Cytidylate kinase; structural genomics, seattle st 94.39
1jr3_D 343 DNA polymerase III, delta subunit; processivity, p 94.35
3a8t_A 339 Adenylate isopentenyltransferase; rossmann fold pr 94.35
4e22_A252 Cytidylate kinase; P-loop, CMP/ATP binding, transf 94.35
1nn5_A215 Similar to deoxythymidylate kinase (thymidylate K; 94.32
1uj2_A252 Uridine-cytidine kinase 2; alpha/beta mononucleoti 94.28
3nwj_A250 ATSK2; P loop, shikimate, nucleoside monophosphate 94.26
2yvu_A186 Probable adenylyl-sulfate kinase; transferase, str 94.18
1vht_A218 Dephospho-COA kinase; structural genomics, transfe 93.93
2h92_A219 Cytidylate kinase; rossmann fold, transferase; HET 93.87
2pt7_A330 CAG-ALFA; ATPase, protein-protein complex, type IV 93.81
1ltq_A 301 Polynucleotide kinase; phosphatase, alpha/beta, P- 93.81
2px0_A296 Flagellar biosynthesis protein FLHF; SRP GTPase, f 93.81
1q3t_A236 Cytidylate kinase; nucleotide monophosphate kinase 93.79
3foz_A 316 TRNA delta(2)-isopentenylpyrophosphate transferas; 93.79
2gxq_A207 Heat resistant RNA dependent ATPase; RNA helicase, 93.72
3zvl_A416 Bifunctional polynucleotide phosphatase/kinase; hy 93.65
3pie_A1155 5'->3' exoribonuclease (XRN1); beta berrel, tudor 93.64
2qt1_A207 Nicotinamide riboside kinase 1; non-protein kinase 93.57
2j37_W 504 Signal recognition particle 54 kDa protein (SRP54) 93.48
3ney_A197 55 kDa erythrocyte membrane protein; structural ge 93.44
2f6r_A281 COA synthase, bifunctional coenzyme A synthase; 18 93.42
4b3f_X 646 DNA-binding protein smubp-2; hydrolase, helicase; 93.37
2yhs_A503 FTSY, cell division protein FTSY; cell cycle, prot 93.35
2a5y_B 549 CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis 93.31
3d3q_A 340 TRNA delta(2)-isopentenylpyrophosphate transferase 93.27
3llm_A235 ATP-dependent RNA helicase A; alpha-beta-alpha, st 93.25
2qor_A204 Guanylate kinase; phosphotransferase, purine metab 93.15
1j8m_F297 SRP54, signal recognition 54 kDa protein; signalin 93.1
2bdt_A189 BH3686; alpha-beta protein, structural genomics, P 93.09
3exa_A 322 TRNA delta(2)-isopentenylpyrophosphate transferase 93.08
3fdi_A201 Uncharacterized protein; cytidylate kinase like pr 93.04
2qmh_A205 HPR kinase/phosphorylase; V267F mutation, ATP-bind 92.76
1qde_A224 EIF4A, translation initiation factor 4A; DEAD box 92.63
1hv8_A 367 Putative ATP-dependent RNA helicase MJ0669; RNA-bi 92.62
2axn_A 520 6-phosphofructo-2-kinase/fructose-2,6- biphosphata 92.56
2j41_A207 Guanylate kinase; GMP, GMK, transferase, ATP-bindi 92.55
1sky_E 473 F1-ATPase, F1-ATP synthase; F1FO ATP synthase, alp 92.46
1vec_A206 ATP-dependent RNA helicase P54; DEAD-box protein, 92.44
1w4r_A195 Thymidine kinase; type II, human, cytosolic, phosp 92.36
3eph_A 409 TRNA isopentenyltransferase; transferase, alternat 92.36
2oap_1 511 GSPE-2, type II secretion system protein; hexameri 92.3
3thx_B 918 DNA mismatch repair protein MSH3; ABC family ATPas 92.26
2w58_A202 DNAI, primosome component (helicase loader); ATP-b 92.25
3b9q_A302 Chloroplast SRP receptor homolog, alpha subunit CP 92.23
3tau_A208 Guanylate kinase, GMP kinase; structural genomics, 92.23
3asz_A211 Uridine kinase; cytidine phosphorylation, transfer 92.17
1xx6_A191 Thymidine kinase; NESG, northeast structural genom 92.17
1kgd_A180 CASK, peripheral plasma membrane CASK; maguk, guan 92.13
3tr0_A205 Guanylate kinase, GMP kinase; purines, pyrimidines 91.97
1tf7_A525 KAIC; homohexamer, hexamer, circadian clock protei 91.9
3n70_A145 Transport activator; sigma-54, ntpase, PSI, MCSG, 91.72
1rz3_A201 Hypothetical protein rbstp0775; MCSG, structural g 91.65
2xau_A 773 PRE-mRNA-splicing factor ATP-dependent RNA helica; 91.61
1nrj_B218 SR-beta, signal recognition particle receptor beta 91.6
2ffh_A 425 Protein (FFH); SRP54, signal recognition particle, 91.59
1zu4_A320 FTSY; GTPase, signal recognition particle, SRP, re 91.57
3thx_A 934 DNA mismatch repair protein MSH2; ABC family ATPas 91.56
3c8u_A208 Fructokinase; YP_612366.1, putative fructose trans 91.56
2v3c_C 432 SRP54, signal recognition 54 kDa protein; nucleoti 91.46
3e70_C328 DPA, signal recognition particle receptor; FTSY, S 91.41
2bjv_A265 PSP operon transcriptional activator; AAA, transcr 91.4
1t6n_A220 Probable ATP-dependent RNA helicase; RECA-like fol 91.31
1tf7_A 525 KAIC; homohexamer, hexamer, circadian clock protei 91.28
2xxa_A 433 Signal recognition particle protein; protein trans 91.26
3hdt_A223 Putative kinase; structura genomics, PSI-2, protei 91.07
1x6v_B 630 Bifunctional 3'-phosphoadenosine 5'- phosphosulfat 90.98
3gmt_A230 Adenylate kinase; ssgcid, ATP-BIN cytoplasm, nucle 90.93
2pl3_A236 Probable ATP-dependent RNA helicase DDX10; DEAD, s 90.87
3lxx_A239 GTPase IMAP family member 4; structural genomics c 90.86
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 90.84
1ls1_A295 Signal recognition particle protein; FFH, SRP54, S 90.65
3a00_A186 Guanylate kinase, GMP kinase; domain movement, dim 90.46
1lvg_A198 Guanylate kinase, GMP kinase; transferase; HET: AD 90.42
1gtv_A214 TMK, thymidylate kinase; transferase, transferase 90.38
3tbk_A 555 RIG-I helicase domain; DECH helicase, ATP binding, 90.3
3lxw_A247 GTPase IMAP family member 1; immunity, structural 90.26
4eaq_A229 DTMP kinase, thymidylate kinase; structural genomi 90.1
3pey_A 395 ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, A 89.98
3iuy_A228 Probable ATP-dependent RNA helicase DDX53; REC-A-l 89.85
2a9k_A187 RAS-related protein RAL-A; bacterial ADP-ribosyltr 89.72
2gza_A361 Type IV secretion system protein VIRB11; ATPase, h 89.61
2jeo_A245 Uridine-cytidine kinase 1; UCK, transferase, ATP-b 89.48
1a7j_A 290 Phosphoribulokinase; transferase, calvin cycle; 2. 89.43
2zj8_A 720 DNA helicase, putative SKI2-type helicase; RECA fo 89.3
1htw_A158 HI0065; nucleotide-binding fold, structural genomi 89.28
1zd9_A188 ADP-ribosylation factor-like 10B; transport protei 89.26
1wb9_A800 DNA mismatch repair protein MUTS; DNA-binding, ATP 89.1
1znw_A207 Guanylate kinase, GMP kinase; ATP:GMP-phosphotrans 89.05
3ice_A 422 Transcription termination factor RHO; transcriptio 89.03
3bor_A237 Human initiation factor 4A-II; translation initiat 88.91
1c9k_A180 COBU, adenosylcobinamide kinase; alpha/beta struct 88.77
1p5z_B 263 DCK, deoxycytidine kinase; nucleoside kinase, P-lo 88.76
2oxc_A230 Probable ATP-dependent RNA helicase DDX20; DEAD, s 88.75
2gj8_A172 MNME, tRNA modification GTPase TRME; G-domain dime 88.73
1u8z_A168 RAS-related protein RAL-A; GNP, GTP, GMPPNP, GPPNH 88.6
1r8s_A164 ADP-ribosylation factor 1; protein transport/excha 88.59
2j9r_A214 Thymidine kinase; TK1, DNK, lasso, transferase, AT 88.49
1wp9_A 494 ATP-dependent RNA helicase, putative; ATPase, DNA 88.46
3fht_A 412 ATP-dependent RNA helicase DDX19B; DBP5, DEAD-box 88.45
3p32_A 355 Probable GTPase RV1496/MT1543; structural genomics 88.45
1z6g_A218 Guanylate kinase; structural genomics, SGC, struct 88.42
2bov_A206 RAla, RAS-related protein RAL-A; C3BOT, exoenzyme, 88.35
3tqf_A181 HPR(Ser) kinase; transferase, hydrolase; 2.80A {Co 88.22
3co5_A143 Putative two-component system transcriptional RES 88.14
3k53_A 271 Ferrous iron transport protein B; GTPase fold, hel 88.14
1ky3_A182 GTP-binding protein YPT7P; vesicular traffic, GTP 88.03
1odf_A 290 YGR205W, hypothetical 33.3 kDa protein in ADE3-Ser 88.01
3oiy_A 414 Reverse gyrase helicase domain; topoisomerase, DNA 87.96
3h1t_A 590 Type I site-specific restriction-modification syst 87.95
2ocp_A 241 DGK, deoxyguanosine kinase; protein-nucleotide com 87.92
1wms_A177 RAB-9, RAB9, RAS-related protein RAB-9A; GTPase, p 87.84
1ewq_A765 DNA mismatch repair protein MUTS; multiple domains 87.78
1m8p_A573 Sulfate adenylyltransferase; rossmann fold, phosph 87.78
2fwr_A 472 DNA repair protein RAD25; DNA unwinding, XPB, DNA 87.77
4edh_A213 DTMP kinase, thymidylate kinase; structural genomi 87.67
3iby_A 256 Ferrous iron transport protein B; G protein, G dom 87.66
1s96_A219 Guanylate kinase, GMP kinase; E.coli, dimer, SAD, 87.58
2j0s_A 410 ATP-dependent RNA helicase DDX48; mRNA processing, 87.47
3pqc_A195 Probable GTP-binding protein ENGB; rossmann fold, 87.46
2wjg_A188 FEOB, ferrous iron transport protein B homolog; me 87.44
1xjc_A169 MOBB protein homolog; structural genomics, midwest 87.26
3fe2_A242 Probable ATP-dependent RNA helicase DDX5; DEAD, AD 87.24
2v9p_A305 Replication protein E1; AAA+ molecular motor, DNA 87.21
1bif_A 469 6-phosphofructo-2-kinase/ fructose-2,6-bisphospha; 87.12
2og2_A359 Putative signal recognition particle receptor; nuc 87.08
1fzq_A181 ADP-ribosylation factor-like protein 3; protein-GD 87.02
2v6i_A 431 RNA helicase; membrane, hydrolase, transmembrane, 86.96
3def_A262 T7I23.11 protein; chloroplast, TOC33, GTPase, hydr 86.94
3ly5_A262 ATP-dependent RNA helicase DDX18; alpha-beta, stru 86.89
3lnc_A231 Guanylate kinase, GMP kinase; ALS collaborative cr 86.84
2qm8_A 337 GTPase/ATPase; G protein, G3E, metallochaperone, c 86.8
1sq5_A308 Pantothenate kinase; P-loop, transferase; HET: PAU 86.74
3ber_A249 Probable ATP-dependent RNA helicase DDX47; DEAD, A 86.63
3dkp_A245 Probable ATP-dependent RNA helicase DDX52; DEAD, A 86.6
1z06_A189 RAS-related protein RAB-33B; RAB GTPase, RAB33B GT 86.54
3kta_A182 Chromosome segregation protein SMC; structural mai 86.45
2va8_A 715 SSO2462, SKI2-type helicase; hydrolase, DNA repair 86.42
3dz8_A191 RAS-related protein RAB-3B; GDP, GTPase, structura 86.31
2wji_A165 Ferrous iron transport protein B homolog; membrane 86.25
1xti_A 391 Probable ATP-dependent RNA helicase P47; alpha-bet 86.08
3vkw_A 446 Replicase large subunit; alpha/beta domain, helica 85.97
1rj9_A304 FTSY, signal recognition protein; SRP-GTPase domai 85.91
3aez_A312 Pantothenate kinase; transferase, homodimer, COA b 85.8
3eiq_A 414 Eukaryotic initiation factor 4A-I; PDCD4, anti-onc 85.74
2gk6_A 624 Regulator of nonsense transcripts 1; UPF1, helicas 85.73
2qgz_A308 Helicase loader, putative primosome component; str 85.34
2o8b_B 1022 DNA mismatch repair protein MSH6; DNA damage respo 85.32
3tqc_A321 Pantothenate kinase; biosynthesis of cofactors, pr 85.3
4i1u_A210 Dephospho-COA kinase; structural genomics, niaid, 85.26
3ec2_A180 DNA replication protein DNAC; helicase loader, rep 85.21
3v9p_A227 DTMP kinase, thymidylate kinase; ssgcid, STRU geno 85.13
1g8f_A511 Sulfate adenylyltransferase; alpha-beta protein, b 85.12
2dyk_A161 GTP-binding protein; GTPase, ribosome-binding prot 85.06
3crm_A323 TRNA delta(2)-isopentenylpyrophosphate transferase 84.91
1qhx_A178 CPT, protein (chloramphenicol phosphotransferase); 84.83
2qtf_A364 Protein HFLX, GTP-binding protein; beta-alpha-barr 84.72
3trf_A185 Shikimate kinase, SK; amino acid biosynthesis, tra 84.42
2e87_A357 Hypothetical protein PH1320; GTP-binding, GTPase, 84.19
4a2p_A 556 RIG-I, retinoic acid inducible protein I; hydrolas 84.18
3b85_A208 Phosphate starvation-inducible protein; PHOH2, ATP 84.18
1np6_A174 Molybdopterin-guanine dinucleotide biosynthesis pr 84.17
3fho_A 508 ATP-dependent RNA helicase DBP5; mRNA export, ATPa 84.12
2f7s_A217 C25KG, RAS-related protein RAB-27B; G-protein, str 84.11
2cbz_A237 Multidrug resistance-associated protein 1; ABC pro 83.98
3a1s_A 258 Iron(II) transport protein B; FEOB, iron transport 83.97
3tif_A235 Uncharacterized ABC transporter ATP-binding prote; 83.96
1fuu_A 394 Yeast initiation factor 4A; IF4A, helicase, DEAD-b 83.94
1upt_A171 ARL1, ADP-ribosylation factor-like protein 1; hydr 83.85
2fh5_B214 SR-beta, signal recognition particle receptor beta 83.77
1q0u_A219 Bstdead; DEAD protein, RNA binding protein; 1.85A 83.75
2wsm_A221 Hydrogenase expression/formation protein (HYPB); m 83.61
2onk_A240 Molybdate/tungstate ABC transporter, ATP-binding p 83.6
>3cf2_A TER ATPase, transitional endoplasmic reticulum ATPase, valosi; AAA, CDC48, ERAD, transport protein; HET: ADP ANP; 3.50A {Mus musculus} PDB: 3cf1_A* 3cf3_A* 1r7r_A* Back     alignment and structure
Probab=100.00  E-value=1.5e-52  Score=516.82  Aligned_cols=427  Identities=27%  Similarity=0.419  Sum_probs=332.4

Q ss_pred             ccccccccccccchhHHHHHHhhhhhhcccccccc-ccCCCCCCCCceeeeCCCCchHHHHHHHHHHHhhcCCeEEEEec
Q 001244          449 IEVSFESFPYYLSDITKNVLIASTYVHLKCNNFAK-YASDLPTMCPRILLSGPAGSEIYQETLAKALAKHFSARLLIVDS  527 (1116)
Q Consensus       449 i~vsf~~FPYylse~tk~~L~~~~~~hLk~~~~~k-~~~~L~~~~~~ILLsGp~gsE~Yqe~LaKALA~~f~a~LL~lDs  527 (1116)
                      -+|+|++...+  ++.|..|.+.....|+|+++.+ ++   ...++.|||+||||  +++++||||+|++++++++.++.
T Consensus       199 ~~v~~~dIgGl--~~~~~~l~e~v~~pl~~p~~f~~~g---~~~p~GILL~GPPG--TGKT~LAraiA~elg~~~~~v~~  271 (806)
T 3cf2_A          199 NEVGYDDIGGC--RKQLAQIKEMVELPLRHPALFKAIG---VKPPRGILLYGPPG--TGKTLIARAVANETGAFFFLING  271 (806)
T ss_dssp             SSCCGGGCCSC--CTTHHHHHHHHHHHHHCCGGGTSCC---CCCCCEEEEECCTT--SCHHHHHHHHHTTTTCEEEEEEH
T ss_pred             CCCChhhhcCH--HHHHHHHHHHHHHHccCHHHHhhcC---CCCCCeEEEECCCC--CCHHHHHHHHHHHhCCeEEEEEh
Confidence            36899999999  9999999999988999988753 33   24568999999999  89999999999999999999987


Q ss_pred             ccCCCCCCccccccccchhhhhhhHHHHHHHhhhccCCCCccccccccccccccCCCCCCcccccccCcccccCCCceee
Q 001244          528 LLLPGGSSKEADSVKESSRTEKASMFAKRAALLQHRKPTSSVEADITGGTAVGSQALPKPEISTASSKNYTFKKGDRVKF  607 (1116)
Q Consensus       528 ~~l~g~~~ke~~~~~~~~~~e~~s~~~k~s~~~~~~~p~~~~~~~~~g~~~~~~~~~~~~~~~~~~~~~~~~~~gdrv~~  607 (1116)
                      .++.+                                                                         +|
T Consensus       272 ~~l~s-------------------------------------------------------------------------k~  278 (806)
T 3cf2_A          272 PEIMS-------------------------------------------------------------------------KL  278 (806)
T ss_dssp             HHHHS-------------------------------------------------------------------------SC
T ss_pred             HHhhc-------------------------------------------------------------------------cc
Confidence            55443                                                                         12


Q ss_pred             eccCCCCcccCCCCCCCCCcccceeeeccccCCCCceeeeecCCCCCCCCCCCCcCCCCCcccccccccccCCCcchhhH
Q 001244          608 VGNVTSGTTVQPTLRGPGIGFRGRVILPFEDNDFSKIGVRFDRSIPEGNNLGGFCEDDHGFFCTASSLRLDSSLGDEVDK  687 (1116)
Q Consensus       608 vg~~~~~~~~~~~~~~p~~g~~g~v~l~~e~n~~~kvgV~Fd~~~~~~~~l~~~c~~~~~~~~~~~~~~~d~s~~~~~~~  687 (1116)
                      +                                                                           ++.+
T Consensus       279 ~---------------------------------------------------------------------------gese  283 (806)
T 3cf2_A          279 A---------------------------------------------------------------------------GESE  283 (806)
T ss_dssp             T---------------------------------------------------------------------------THHH
T ss_pred             c---------------------------------------------------------------------------hHHH
Confidence            1                                                                           2233


Q ss_pred             HHHHHHHHHHHhhcCCCCeEEEEcchhhhhcC--------ChhhHHHHHHHHhcCCC--CEEEEeeccCCCcccccCCCC
Q 001244          688 LAINELFEVALNESKSSPLIVFVKDIEKSLTG--------NNDAYGALKSKLENLPS--NVVVIGSHTQLDSRKEKSHPG  757 (1116)
Q Consensus       688 ~~i~~L~evl~~esk~~P~ILfidDie~~l~~--------~~e~~~~lk~~Le~L~g--~VviIgS~~~~d~~~~~~~~~  757 (1116)
                      ..+..+|+.+..   .+|+||||||||.+...        ..++.+.|...|+.+..  +|+|||++|+++.        
T Consensus       284 ~~lr~lF~~A~~---~~PsIIfIDEiDal~~~r~~~~~~~~~riv~~LL~~mdg~~~~~~V~VIaaTN~~d~--------  352 (806)
T 3cf2_A          284 SNLRKAFEEAEK---NAPAIIFIDELDAIAPKREKTHGEVERRIVSQLLTLMDGLKQRAHVIVMAATNRPNS--------  352 (806)
T ss_dssp             HHHHHHHHHHTT---SCSEEEEEESGGGTCCTTTTCCCTTHHHHHHHHHTHHHHCCGGGCEEEEEECSSTTT--------
T ss_pred             HHHHHHHHHHHH---cCCeEEEEehhcccccccCCCCChHHHHHHHHHHHHHhcccccCCEEEEEecCChhh--------
Confidence            467788887766   89999999999995431        13567778888888854  8999999998887        


Q ss_pred             CceeeccCCcchhhccccCCCcccccccccCcchHHHhhhhc--cccccccccCCchHHHHHHHHHHHhhchhhhhcccc
Q 001244          758 GLLFTKFGSNQTALLDLAFPDNFSRLHDRSKETPKALKQISR--LFPNKVTIQLPQDEALLSDWKQQLERDVETLKGQSN  835 (1116)
Q Consensus       758 ~~~~~~~~~~~~~~lD~a~p~~~~~~~~~~~~~~k~~~~i~k--lFpn~I~I~~P~DEa~LRRfe~qle~~Lpdlk~R~n  835 (1116)
                                    ||+|                     +.+  +|...|+|++|+.++|+..|+.              
T Consensus       353 --------------LD~A---------------------LrR~GRFd~~I~i~~Pd~~~R~~IL~~--------------  383 (806)
T 3cf2_A          353 --------------IDPA---------------------LRRFGRFDREVDIGIPDATGRLEILQI--------------  383 (806)
T ss_dssp             --------------SCTT---------------------TTSTTSSCEEEECCCCCHHHHHHHHHH--------------
T ss_pred             --------------cCHH---------------------HhCCcccceEEecCCCCHHHHHHHHHH--------------
Confidence                          7876                     333  7888889999988888755543              


Q ss_pred             hhhhhhhhhcCCC-CCCCchhhhccccccchhhHHHHHHHhhhccccccccCCCCCcc-c-ccccchhhhhHHHHHhhhh
Q 001244          836 IISIRSVLSRNGL-DCVDLESLCIKDQTLTTEGVEKIVGWALSHHFMHCSEAPGKDAK-L-KISTESIMYGLNILQGIQS  912 (1116)
Q Consensus       836 Il~Iht~l~~~~l-ecvDLeeLai~dk~LsgadIEkIV~sAaS~aL~r~~~~i~~d~K-L-vIS~ESLkvglsdFq~aln  912 (1116)
                          |+.  ...+ .++||+.|+..|.+|+++|+..||..|...++.|....+..... . ....+.+.+...+|..++.
T Consensus       384 ----~l~--~~~~~~dvdl~~lA~~T~GfsgaDL~~Lv~eA~~~A~~r~~~~i~~~~~~~~~e~~~~~~v~~~Df~~Al~  457 (806)
T 3cf2_A          384 ----HTK--NMKLADDVDLEQVANETHGHVGADLAALCSEAALQAIRKKMDLIDLEDETIDAEVMNSLAVTMDDFRWALS  457 (806)
T ss_dssp             ----TCS--SSEECTTCCHHHHHHHCCSCCHHHHHHHHHHHHHHHHHHHHHHGGGTCCCCSHHHHHHCEECTTHHHHHHS
T ss_pred             ----Hhc--CCCCCcccCHHHHHHhcCCCCHHHHHHHHHHHHHHHHHhccccccccccccchhhhccceeeHHHHHHHHH
Confidence                321  1112 67899999999999999999999999999999876543311111 1 0111233344455555544


Q ss_pred             hhhhhhhhhhhccChhHHHHHHhcCCCCCCCCCCCcccccCcHHHHHHHHHHHHccccChhhhhcCCCCCCCeEEEEECC
Q 001244          913 ESKSLKKSLKDVVTENEFEKKLLADVIPPSDIGVTFDDIGALENVKDTLKELVMLPLQRPELFCKGQLTKPCKGILLFGP  992 (1116)
Q Consensus       913 e~K~L~~~lk~~v~~~e~e~~ll~~iIp~~e~~vtfddIgGldevk~~L~e~V~lpl~~pelf~~~~l~~p~~gILL~GP  992 (1116)
                      +.++...                .. .....+.++|++|+|++++++.|.+.+.+|+++++.|.+.+ .++++++|||||
T Consensus       458 ~~~ps~~----------------r~-~~~~~p~v~w~diggl~~~k~~l~e~v~~p~~~p~~f~~~g-~~~~~gvLl~GP  519 (806)
T 3cf2_A          458 QSNPSAL----------------RE-TVVEVPQVTWEDIGGLEDVKRELQELVQYPVEHPDKFLKFG-MTPSKGVLFYGP  519 (806)
T ss_dssp             SSSCCCC----------------CC-CCCBCCCCCSTTCCSCHHHHHHHTTTTTTTTTCSGGGSSSC-CCCCSCCEEESS
T ss_pred             hCCCccc----------------cc-ccccCCCCCHHHhCCHHHHHHHHHHHHHhhhhCHHHHHhcC-CCCCceEEEecC
Confidence            4332110                00 11223468999999999999999999999999999998877 456799999999


Q ss_pred             CCCchHHHHHHHHHHhCCeeeEEeccccccccccchHHHHHHHHHHHhcCCCeEEEEccccccccCCCCC--chhHHHHH
Q 001244          993 PGTGKTMLAKAVATEAGANFINISMSSITSKWFGEGEKYVKAVFSLASKIAPSVVFVDEVDSMLGRRENP--GEHEAMRK 1070 (1116)
Q Consensus       993 PGTGKT~LArAIA~elg~pfI~Is~seL~sk~~GesEk~Ir~lF~~A~k~sPsIIfIDEID~Llg~R~~~--~~~~~lr~ 1070 (1116)
                      ||||||++|+|||++++.+|+.++.++++++|+|+++++++++|..|++.+||||||||||.|++.|...  ..+...++
T Consensus       520 PGtGKT~lAkaiA~e~~~~f~~v~~~~l~s~~vGese~~vr~lF~~Ar~~~P~IifiDEiDsl~~~R~~~~~~~~~~~~r  599 (806)
T 3cf2_A          520 PGCGKTLLAKAIANECQANFISIKGPELLTMWFGESEANVREIFDKARQAAPCVLFFDELDSIAKARGGNIGDGGGAADR  599 (806)
T ss_dssp             TTSSHHHHHHHHHHTTTCEEEECCHHHHHTTTCSSCHHHHHHHHHHHHTTCSEEEECSCGGGCC--------------CH
T ss_pred             CCCCchHHHHHHHHHhCCceEEeccchhhccccchHHHHHHHHHHHHHHcCCceeechhhhHHhhccCCCCCCCchHHHH
Confidence            9999999999999999999999999999999999999999999999999999999999999999888642  34456789


Q ss_pred             HHHHHHHHhcCCCcCCCCCEEEEEEeCCCCCCcHHHHh--hcCCeEEC
Q 001244         1071 MKNEFMVNWDGLRTKDKERVLVLAATNRPFDLDEAVVR--RLPRRTCV 1116 (1116)
Q Consensus      1071 IlneLL~~Ldgl~~k~~~kVLVIaTTNrp~~LD~ALlR--RF~r~I~V 1116 (1116)
                      ++++||.+|||+..  ..+|+||||||+|+.||+|++|  ||+++|+|
T Consensus       600 v~~~lL~~mdg~~~--~~~V~vi~aTN~p~~lD~AllRpgRfd~~i~v  645 (806)
T 3cf2_A          600 VINQILTEMDGMST--KKNVFIIGATNRPDIIDPAILRPGRLDQLIYI  645 (806)
T ss_dssp             HHHHHHHHHHSSCS--SSSEEEECC-CCSSSSCHHHHSTTTSCCEEEC
T ss_pred             HHHHHHHHHhCCCC--CCCEEEEEeCCCchhCCHhHcCCCcceEEEEE
Confidence            99999999999975  4679999999999999999999  99999986



>4b4t_J 26S protease regulatory subunit 8 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4b4t_I 26S protease regulatory subunit 4 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4b4t_H 26S protease regulatory subunit 7 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4b4t_M 26S protease regulatory subunit 6A; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4b4t_L 26S protease subunit RPT4; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4b4t_K 26S protease regulatory subunit 6B homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3cf2_A TER ATPase, transitional endoplasmic reticulum ATPase, valosi; AAA, CDC48, ERAD, transport protein; HET: ADP ANP; 3.50A {Mus musculus} PDB: 3cf1_A* 3cf3_A* 1r7r_A* Back     alignment and structure
>1xwi_A SKD1 protein; VPS4B, AAA ATPase, protein transport; 2.80A {Homo sapiens} Back     alignment and structure
>3eie_A Vacuolar protein sorting-associated protein 4; AAA ATPase, ATP-binding cassette, ATP-binding, endosome, MEM nucleotide-binding; 2.70A {Saccharomyces cerevisiae} PDB: 3eih_A* 2rko_A 3mhv_C Back     alignment and structure
>2qp9_X Vacuolar protein sorting-associated protein 4; ATPase domain, beta domain, C-terminal helix, ATP-binding, E nucleotide-binding; 2.90A {Saccharomyces cerevisiae} PDB: 2qpa_A* Back     alignment and structure
>4b4t_J 26S protease regulatory subunit 8 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2zan_A Vacuolar protein sorting-associating protein 4B; SKD1, VPS4B, AAA ATPase, ATP-binding, coiled coil, membrane, nucleotide-binding, phosphorylation; HET: ATP; 3.00A {Mus musculus} PDB: 2zam_A* 2zao_A* 2jqh_A 2jqk_A 1wr0_A 2jq9_A 2k3w_A 1yxr_A Back     alignment and structure
>4b4t_I 26S protease regulatory subunit 4 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3cf0_A Transitional endoplasmic reticulum ATPase; AAA, P97/VCP, ERAD, CDC48, ATP-binding, lipid-binding, nucle binding, nucleus, phosphoprotein, transport; HET: ADP; 3.00A {Mus musculus} Back     alignment and structure
>2x8a_A Nuclear valosin-containing protein-like; nuclear protein; 2.60A {Homo sapiens} Back     alignment and structure
>4b4t_H 26S protease regulatory subunit 7 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3d8b_A Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, structural genomics consortium, ATP- hydrolase, magnesium, metal-binding, nucleotide-binding; HET: ADP; 2.00A {Homo sapiens} Back     alignment and structure
>4b4t_L 26S protease subunit RPT4; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3vfd_A Spastin; ATPase, microtubule severing, hydrolase; 3.30A {Homo sapiens} Back     alignment and structure
>3b9p_A CG5977-PA, isoform A; AAA ATPase, ATP-binding, nucleotide-binding, hydrolase; 2.70A {Drosophila melanogaster} Back     alignment and structure
>4b4t_K 26S protease regulatory subunit 6B homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3pxi_A Negative regulator of genetic competence CLPC/MEC; CLPB, proteolysis, CLPX, HSP100/CLP, AAA+ proteins, PR binding; 6.93A {Bacillus subtilis} Back     alignment and structure
>4b4t_M 26S protease regulatory subunit 6A; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1r6b_X CLPA protein; AAA+, N-terminal domain, CLPS, crystal, binding mechanism, hydrolase; HET: ADP; 2.25A {Escherichia coli} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 PDB: 1ksf_X* Back     alignment and structure
>3h4m_A Proteasome-activating nucleotidase; ATPase, PAN, ATP-binding, nucleotide-binding, HY; HET: ADP; 3.11A {Methanocaldococcus jannaschii} Back     alignment and structure
>2ce7_A Cell division protein FTSH; metalloprotease; HET: ADP; 2.44A {Thermotoga maritima} SCOP: a.269.1.1 c.37.1.20 PDB: 2cea_A* 3kds_E* Back     alignment and structure
>1lv7_A FTSH; alpha/beta domain, four helix bundle, hydrolase; 1.50A {Escherichia coli} SCOP: c.37.1.20 Back     alignment and structure
>2qz4_A Paraplegin; AAA+, SPG7, protease, ADP, structural genomics, structural G consortium, SGC, ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.22A {Homo sapiens} Back     alignment and structure
>3hu3_A Transitional endoplasmic reticulum ATPase; VCP, transport protein; HET: AGS; 2.20A {Homo sapiens} PDB: 3hu2_A* 3hu1_A* 1e32_A* 1s3s_A* Back     alignment and structure
>1qvr_A CLPB protein; coiled coil, AAA ATPase, chaperone; HET: ANP; 3.00A {Thermus thermophilus} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 Back     alignment and structure
>2dhr_A FTSH; AAA+ protein, hexameric Zn metalloprotease, hydrolase; HET: ADP; 3.90A {Thermus thermophilus} Back     alignment and structure
>3t15_A Ribulose bisphosphate carboxylase/oxygenase activ chloroplastic; photosynthesis, rubisco activase, AAA+ protein; 2.95A {Nicotiana tabacum} PDB: 3zw6_A Back     alignment and structure
>2r62_A Cell division protease FTSH homolog; ATPase domain, ATP-binding, cell CELL division, hydrolase, membrane, metal-binding; 3.30A {Helicobacter pylori} PDB: 2r65_A* Back     alignment and structure
>1ixz_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 2.20A {Thermus thermophilus} SCOP: c.37.1.20 PDB: 1iy0_A* 1iy1_A* Back     alignment and structure
>1iy2_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 3.20A {Thermus thermophilus} SCOP: c.37.1.20 Back     alignment and structure
>1gxc_A CHK2, CDS1, serine/threonine-protein kinase CHK2; phosphoprotein-binding domain, checkpoint kinase, transferase; HET: TPO; 2.7A {Homo sapiens} SCOP: b.26.1.2 Back     alignment and structure
>2c9o_A RUVB-like 1; hexameric helicase, AAA+-ATPase, ATP-binding, chromatin regulator, growth regulation, hydrolase, nuclear protein, DNA recombination; HET: ADP; 2.2A {Homo sapiens} PDB: 2xsz_A* Back     alignment and structure
>1lgp_A Cell cycle checkpoint protein CHFR; FHA, tungstate, domain swapping; 2.00A {Homo sapiens} SCOP: b.26.1.2 PDB: 1lgq_A Back     alignment and structure
>1xwi_A SKD1 protein; VPS4B, AAA ATPase, protein transport; 2.80A {Homo sapiens} Back     alignment and structure
>2qp9_X Vacuolar protein sorting-associated protein 4; ATPase domain, beta domain, C-terminal helix, ATP-binding, E nucleotide-binding; 2.90A {Saccharomyces cerevisiae} PDB: 2qpa_A* Back     alignment and structure
>3eie_A Vacuolar protein sorting-associated protein 4; AAA ATPase, ATP-binding cassette, ATP-binding, endosome, MEM nucleotide-binding; 2.70A {Saccharomyces cerevisiae} PDB: 3eih_A* 2rko_A 3mhv_C Back     alignment and structure
>2zan_A Vacuolar protein sorting-associating protein 4B; SKD1, VPS4B, AAA ATPase, ATP-binding, coiled coil, membrane, nucleotide-binding, phosphorylation; HET: ATP; 3.00A {Mus musculus} PDB: 2zam_A* 2zao_A* 2jqh_A 2jqk_A 1wr0_A 2jq9_A 2k3w_A 1yxr_A Back     alignment and structure
>3syl_A Protein CBBX; photosynthesis, rubisco activase, AAA+ protein, calvin cycle chaperone; 3.00A {Rhodobacter sphaeroides} PDB: 3syk_A 3zuh_A* Back     alignment and structure
>1g41_A Heat shock protein HSLU; AAA-ATPase, CLPY, ATP-dependent proteolysis, chaperone; HET: ADP; 2.30A {Haemophilus influenzae} SCOP: c.37.1.20 PDB: 1g3i_A* 1im2_A* 1kyi_A* 1g4a_E* 1g4b_E 1yyf_A* 1do0_A* 1do2_A* 1e94_E* 1hqy_E* 1ht1_E* 1ht2_E* Back     alignment and structure
>1d2n_A N-ethylmaleimide-sensitive fusion protein; hexamerization domain, ATPase, transport; HET: ANP; 1.75A {Cricetulus griseus} SCOP: c.37.1.20 PDB: 1nsf_A* Back     alignment and structure
>1ofh_A ATP-dependent HSL protease ATP-binding subunit HSLU; chaperone, hydrolase, ATP-binding; HET: ADP; 2.5A {Haemophilus influenzae} SCOP: c.37.1.20 PDB: 1ofi_A* Back     alignment and structure
>3hu3_A Transitional endoplasmic reticulum ATPase; VCP, transport protein; HET: AGS; 2.20A {Homo sapiens} PDB: 3hu2_A* 3hu1_A* 1e32_A* 1s3s_A* Back     alignment and structure
>2p65_A Hypothetical protein PF08_0063; CLPB, malaria, structural genomics, structural genomics consortium, SGC, unknown function; 1.70A {Plasmodium falciparum} Back     alignment and structure
>2x8a_A Nuclear valosin-containing protein-like; nuclear protein; 2.60A {Homo sapiens} Back     alignment and structure
>3cf0_A Transitional endoplasmic reticulum ATPase; AAA, P97/VCP, ERAD, CDC48, ATP-binding, lipid-binding, nucle binding, nucleus, phosphoprotein, transport; HET: ADP; 3.00A {Mus musculus} Back     alignment and structure
>3hws_A ATP-dependent CLP protease ATP-binding subunit CL; CLPXP, AAA+ molecular machine, hexamer, asymmetric,, ATP-BIN chaperone, metal-binding; HET: ADP; 3.25A {Escherichia coli} PDB: 3hte_A Back     alignment and structure
>1jbk_A CLPB protein; beta barrel, chaperone; 1.80A {Escherichia coli} SCOP: c.37.1.20 Back     alignment and structure
>2jqj_A DNA damage response protein kinase DUN1; protein/phosphopeptide, cell cycle; HET: DNA; NMR {Saccharomyces cerevisiae} PDB: 2jql_A* Back     alignment and structure
>1g6g_A Protein kinase RAD53; beta-sandwich, phosphopeptide complex, cell cycle; HET: TPO; 1.60A {Saccharomyces cerevisiae} SCOP: b.26.1.2 Back     alignment and structure
>3h4m_A Proteasome-activating nucleotidase; ATPase, PAN, ATP-binding, nucleotide-binding, HY; HET: ADP; 3.11A {Methanocaldococcus jannaschii} Back     alignment and structure
>2ce7_A Cell division protein FTSH; metalloprotease; HET: ADP; 2.44A {Thermotoga maritima} SCOP: a.269.1.1 c.37.1.20 PDB: 2cea_A* 3kds_E* Back     alignment and structure
>3b9p_A CG5977-PA, isoform A; AAA ATPase, ATP-binding, nucleotide-binding, hydrolase; 2.70A {Drosophila melanogaster} Back     alignment and structure
>3i6u_A CDS1, serine/threonine-protein kinase CHK2; Ser/Thr protein kinase, FHA domain, ATP-binding, cell cycle, mutation, LI-fraumeni syndrome, magnesium; 3.00A {Homo sapiens} PDB: 3i6w_A Back     alignment and structure
>3pfi_A Holliday junction ATP-dependent DNA helicase RUVB; probable holliday junction DNA helicase; HET: ADP; 2.69A {Campylobacter jejuni subsp} Back     alignment and structure
>3m6a_A ATP-dependent protease LA 1; alpha, beta, ATP-binding, hydrolase, nucleotide-binding, Pro serine protease, stress response; HET: ADP; 3.40A {Bacillus subtilis} PDB: 1x37_A Back     alignment and structure
>3d8b_A Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, structural genomics consortium, ATP- hydrolase, magnesium, metal-binding, nucleotide-binding; HET: ADP; 2.00A {Homo sapiens} Back     alignment and structure
>1lv7_A FTSH; alpha/beta domain, four helix bundle, hydrolase; 1.50A {Escherichia coli} SCOP: c.37.1.20 Back     alignment and structure
>3vfd_A Spastin; ATPase, microtubule severing, hydrolase; 3.30A {Homo sapiens} Back     alignment and structure
>2qz4_A Paraplegin; AAA+, SPG7, protease, ADP, structural genomics, structural G consortium, SGC, ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.22A {Homo sapiens} Back     alignment and structure
>1um8_A ATP-dependent CLP protease ATP-binding subunit CL; CLPP binding loop, chaperone; HET: ADP; 2.60A {Helicobacter pylori} SCOP: c.37.1.20 Back     alignment and structure
>3uk6_A RUVB-like 2; hexameric AAA+ ATP-ASE, DNA unwinding, hydrolase; HET: ADP; 2.95A {Homo sapiens} PDB: 2xsz_D* Back     alignment and structure
>4h87_A Kanadaptin; FHA domain of PF00498, mRNA processing, nucleus, structural joint center for structural genomics, JCSG, protein structu initiative; HET: SO4; 1.55A {Homo sapiens} Back     alignment and structure
>2r62_A Cell division protease FTSH homolog; ATPase domain, ATP-binding, cell CELL division, hydrolase, membrane, metal-binding; 3.30A {Helicobacter pylori} PDB: 2r65_A* Back     alignment and structure
>1hqc_A RUVB; extended AAA-ATPase domain, complex with nucleotide, hydrolase; HET: ADE; 3.20A {Thermus thermophilus} SCOP: a.4.5.11 c.37.1.20 PDB: 1ixs_B* 1ixr_C* Back     alignment and structure
>2dhr_A FTSH; AAA+ protein, hexameric Zn metalloprotease, hydrolase; HET: ADP; 3.90A {Thermus thermophilus} Back     alignment and structure
>3u61_B DNA polymerase accessory protein 44; AAA+, ATP hydrolase, clamp loader, sliding clamp, primer-TEM DNA, DNA binding protein-DNA complex; HET: DNA ADP 08T; 3.20A {Enterobacteria phage T4} PDB: 3u5z_B* 3u60_B* Back     alignment and structure
>1r6b_X CLPA protein; AAA+, N-terminal domain, CLPS, crystal, binding mechanism, hydrolase; HET: ADP; 2.25A {Escherichia coli} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 PDB: 1ksf_X* Back     alignment and structure
>2pie_A E3 ubiquitin-protein ligase RNF8; FHA domain, complex, ligase, signaling protein; HET: TPO; 1.35A {Homo sapiens} SCOP: b.26.1.2 Back     alignment and structure
>1qvr_A CLPB protein; coiled coil, AAA ATPase, chaperone; HET: ANP; 3.00A {Thermus thermophilus} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 Back     alignment and structure
>4fcw_A Chaperone protein CLPB; AAA domain; HET: ADP; 2.35A {Thermus thermophilus} PDB: 4fcv_A* 4fd2_A* 4fct_A* Back     alignment and structure
>1g3g_A Protien kinase SPK1; FHA domain, RAD53, phosphopeptide, phosphoprotein, transferase; NMR {Saccharomyces cerevisiae} SCOP: b.26.1.2 PDB: 1j4o_A 1j4p_A* 1j4q_A* 1k3j_A 1k3n_A* 1k3q_A* 2a0t_A* 2jqi_A* Back     alignment and structure
>2chg_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATPase, ATP-binding, nucleotide-binding; HET: ANP; 2.1A {Archaeoglobus fulgidus} Back     alignment and structure
>3n70_A Transport activator; sigma-54, ntpase, PSI, MCSG, structural genomics, center for structural genomics; 2.80A {Escherichia coli} Back     alignment and structure
>3pxg_A Negative regulator of genetic competence CLPC/MEC; CLPB, proteolysis, CLPX, HSP100/CLP, AAA+ proteins, PR binding; 3.65A {Bacillus subtilis} Back     alignment and structure
>1l8q_A Chromosomal replication initiator protein DNAA; AAA+, helix-turn-helix, nucleotide-binding, DNA binding, REP initiation, DNA binding protein; HET: ADP; 2.70A {Aquifex aeolicus} SCOP: a.4.12.2 c.37.1.20 PDB: 3r8f_A* 2hcb_A* Back     alignment and structure
>1g8p_A Magnesium-chelatase 38 kDa subunit; parallel beta sheet, P-loop, rossman fold, AAA+, photosynthesis, metal transport; 2.10A {Rhodobacter capsulatus} SCOP: c.37.1.20 PDB: 2x31_G Back     alignment and structure
>3pvs_A Replication-associated recombination protein A; maintenance of genome stability Pro recombination; 2.50A {Escherichia coli} Back     alignment and structure
>3va4_A Mediator of DNA damage checkpoint protein 1; cell cycle, FHA domain, DNA-damage, CHK2 and MDC1 dimerizati; HET: TPO; 1.54A {Mus musculus} PDB: 3va1_A* 3umz_A 3unm_A 3unn_A* 3uot_A* 3un0_B Back     alignment and structure
>3cmw_A Protein RECA, recombinase A; homologous recombination, recombination/DNA complex; HET: DNA ADP; 2.80A {Escherichia coli} PDB: 3cmt_A* 3cmx_A* 3cmv_A* Back     alignment and structure
>3co5_A Putative two-component system transcriptional RES regulator; structural genomics, APC89341.1; 2.40A {Neisseria gonorrhoeae} Back     alignment and structure
>3pxi_A Negative regulator of genetic competence CLPC/MEC; CLPB, proteolysis, CLPX, HSP100/CLP, AAA+ proteins, PR binding; 6.93A {Bacillus subtilis} Back     alignment and structure
>2v1u_A Cell division control protein 6 homolog; DNA replication, nucleotide-binding, replication, archaea; HET: ADP; 3.10A {Aeropyrum pernix} Back     alignment and structure
>2qby_B CDC6 homolog 3, cell division control protein 6 homolog 3; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} Back     alignment and structure
>1qu5_A Protein kinase SPK1; FHA, RAD53, transferase; NMR {Saccharomyces cerevisiae} SCOP: b.26.1.2 Back     alignment and structure
>3te6_A Regulatory protein SIR3; heterochromatin, gene silencing, SIR complex, HMR, HML, TELO AAA+ domain, structural, nucleus, gene RE; 2.80A {Saccharomyces cerevisiae} Back     alignment and structure
>1sxj_A Activator 1 95 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>1uht_A Expressed protein; FHA domain, beta-sandwich, antiparallel beta-sheets, phosphopeptide binding motif, structural genomics; NMR {Arabidopsis thaliana} SCOP: b.26.1.2 Back     alignment and structure
>2bjv_A PSP operon transcriptional activator; AAA, transcription activation, gene regulation, sigma54 activator, enhancer binding protein, PSPF; 1.7A {Escherichia coli} PDB: 2bjw_A 2c96_A* 2c98_A* 2c99_A* 2c9c_A* 2vii_A* Back     alignment and structure
>2r44_A Uncharacterized protein; putative ATPase, structural genomics, joint center for struc genomics, JCSG; HET: MSE PG4; 2.00A {Cytophaga hutchinsonii atcc 33406} Back     alignment and structure
>1ixz_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 2.20A {Thermus thermophilus} SCOP: c.37.1.20 PDB: 1iy0_A* 1iy1_A* Back     alignment and structure
>1njg_A DNA polymerase III subunit gamma; rossman-like fold, AAA+ ATPase domains, sensor 1, sensor 2, transferase; HET: DNA; 2.20A {Escherichia coli} SCOP: c.37.1.20 PDB: 1njf_A* Back     alignment and structure
>1dmz_A Protein (protein kinase SPK1); beta-sandwich, antiparallel beta-sheets, transferase; NMR {Saccharomyces cerevisiae} SCOP: b.26.1.2 PDB: 1fhq_A 1fhr_A* 1j4k_A* 1j4l_A* 1k2m_A* 1k2n_A* Back     alignment and structure
>3po8_A RV0020C protein, putative uncharacterized protein TB39.8; FHA domain, synthetic peptide, peptide binding protein; 1.50A {Mycobacterium tuberculosis} SCOP: b.26.1.0 PDB: 3poa_A* 2lc1_A Back     alignment and structure
>3hx1_A SLR1951 protein; P74513_SYNY3, adenylate cyclase-like protein, NESG, structural genomics, PSI-2, protein structure initiative; 2.50A {Synechocystis SP} Back     alignment and structure
>2z4s_A Chromosomal replication initiator protein DNAA; AAA+ ATPase, domain III (ATPase domain), ATP-binding, cytoplasm, DNA replication; HET: ADP; 3.00A {Thermotoga maritima} PDB: 2z4r_A* Back     alignment and structure
>2chq_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATP ATP-binding, nucleotide-binding; HET: ANP; 3.5A {Archaeoglobus fulgidus} PDB: 2chv_A Back     alignment and structure
>1r21_A Antigen KI-67; beta sandwich, cell cycle; NMR {Homo sapiens} SCOP: b.26.1.2 PDB: 2aff_A* Back     alignment and structure
>1sxj_D Activator 1 41 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>3els_A PRE-mRNA leakage protein 1; intrinsically unstructured domain, forkhead-associated domai domain, PRE-mRNA retention and splicing; 1.80A {Saccharomyces cerevisiae} Back     alignment and structure
>1ojl_A Transcriptional regulatory protein ZRAR; response regulator, two component system, AAA domain, NTRC family, DNA-binding; HET: ATP; 3.0A {Salmonella typhimurium} Back     alignment and structure
>2qby_A CDC6 homolog 1, cell division control protein 6 homolog 1; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} Back     alignment and structure
>2xt9_B Putative signal transduction protein GARA; lyase-signaling protein complex, KDH, KGD; HET: TPP; 2.20A {Mycobacterium smegmatis} Back     alignment and structure
>3t15_A Ribulose bisphosphate carboxylase/oxygenase activ chloroplastic; photosynthesis, rubisco activase, AAA+ protein; 2.95A {Nicotiana tabacum} PDB: 3zw6_A Back     alignment and structure
>1iqp_A RFCS; clamp loader, extended AAA-ATPase domain, complex with ADP, replication; HET: ADP; 2.80A {Pyrococcus furiosus} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>1sxj_B Activator 1 37 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>2csw_A Ubiquitin ligase protein RNF8; 11-stranded beta sandwich, ring finger protein 8, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.26.1.2 Back     alignment and structure
>1iy2_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 3.20A {Thermus thermophilus} SCOP: c.37.1.20 Back     alignment and structure
>2kb3_A Oxoglutarate dehydrogenase inhibitor; forkhead-associated domain, kinase substrate, GARA, FHA, cytoplasm, phosphoprotein; HET: TPO; NMR {Corynebacterium glutamicum} PDB: 2kb4_A Back     alignment and structure
>3nbx_X ATPase RAVA; AAA+ ATPase, alpha-beta-alpha structure, rossman fold, hydro; HET: ADP; 2.91A {Escherichia coli} Back     alignment and structure
>2c9o_A RUVB-like 1; hexameric helicase, AAA+-ATPase, ATP-binding, chromatin regulator, growth regulation, hydrolase, nuclear protein, DNA recombination; HET: ADP; 2.2A {Homo sapiens} PDB: 2xsz_A* Back     alignment and structure
>2jpe_A Nuclear inhibitor of protein phosphatase 1; FHA domain, NIPP1, mRNA splicing, transcription; NMR {Mus musculus} Back     alignment and structure
>3bos_A Putative DNA replication factor; P-loop containing nucleoside triphosphate hydrolases, struct genomics; HET: MSE CDP; 1.75A {Shewanella amazonensis} PDB: 3sc3_A Back     alignment and structure
>1fnn_A CDC6P, cell division control protein 6; ORC1, AAA protein, DNA replication initation factor, cell cycle control factor; HET: ADP; 2.00A {Pyrobaculum aerophilum} SCOP: a.4.5.11 c.37.1.20 Back     alignment and structure
>1g41_A Heat shock protein HSLU; AAA-ATPase, CLPY, ATP-dependent proteolysis, chaperone; HET: ADP; 2.30A {Haemophilus influenzae} SCOP: c.37.1.20 PDB: 1g3i_A* 1im2_A* 1kyi_A* 1g4a_E* 1g4b_E 1yyf_A* 1do0_A* 1do2_A* 1e94_E* 1hqy_E* 1ht1_E* 1ht2_E* Back     alignment and structure
>1jr3_A DNA polymerase III subunit gamma; processivity, processivity clamp, clamp loader, AAA+ ATPase, transferase; HET: DNA; 2.70A {Escherichia coli} SCOP: a.80.1.1 c.37.1.20 PDB: 1xxh_B* 3glh_B* 3glf_B* 3gli_B* 3glg_B* 1xxi_B* Back     alignment and structure
>2kfu_A RV1827 PThr 22; FHA domain, phosphorylation, intramolecular interaction, glutamate metabolism, phosphoprotein, protein binding; HET: TPO; NMR {Mycobacterium tuberculosis} PDB: 2kkl_A Back     alignment and structure
>3f9v_A Minichromosome maintenance protein MCM; replicative helicase, DNA replication, MCM complex, AAA+ Pro ATP-binding, DNA-binding, helicase; 4.35A {Sulfolobus solfataricus} Back     alignment and structure
>3elv_A PRE-mRNA leakage protein 1; intrinsically unstructured domain, forkhead-associated domai domain, PRE-mRNA retention and splicing; 2.40A {Saccharomyces cerevisiae} PDB: 2jkd_A Back     alignment and structure
>3gqs_A Adenylate cyclase-like protein; FHA domain, structural genomics, PSI-2, protein structure in midwest center for structural genomics, MCSG; 2.20A {Chlamydia trachomatis} Back     alignment and structure
>4ejq_A Kinesin-like protein KIF1A; homodimer, FHA domain, transport protein; 1.89A {Homo sapiens} PDB: 2eh0_A 2g1l_A Back     alignment and structure
>3oun_A Putative uncharacterized protein TB39.8; peptidoglycan, Ser/Thr kinase, pseudokinase, FHA domain, REG phosphorylation; HET: TPO; 2.71A {Mycobacterium tuberculosis} Back     alignment and structure
>1sxj_E Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>1wln_A Afadin; beta sandwich, FHA domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: b.26.1.2 Back     alignment and structure
>1sxj_C Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>3ec2_A DNA replication protein DNAC; helicase loader, replication initiation factor, ATP-binding, nucleotide-binding; HET: DNA ADP; 2.70A {Aquifex aeolicus} PDB: 3ecc_A* Back     alignment and structure
>2ff4_A Probable regulatory protein EMBR; winged-helix, tetratricopeptide repeat, beta-sandwich, trans; HET: DNA TPO; 1.90A {Mycobacterium tuberculosis} SCOP: a.4.6.1 a.118.8.3 b.26.1.2 PDB: 2fez_A* Back     alignment and structure
>1in4_A RUVB, holliday junction DNA helicase RUVB; AAA+-class ATPase, winged-helix domain, ATP hydrolysis, walker A, walker B, sensor 1, sensor 2; HET: ADP; 1.60A {Thermotoga maritima} SCOP: a.4.5.11 c.37.1.20 PDB: 1in5_A* 1in6_A* 1in8_A* 1in7_A* 1j7k_A* Back     alignment and structure
>3fm8_A Kinesin-like protein KIF13B; kinesin, GAP, GTPase activation, structural genomics consort ATP-binding, cytoskeleton, microtubule, motor protein, NUCL binding; 2.30A {Homo sapiens} PDB: 3mdb_A* Back     alignment and structure
>1a5t_A Delta prime, HOLB; zinc finger, DNA replication; 2.20A {Escherichia coli K12} SCOP: a.80.1.1 c.37.1.20 PDB: 1jr3_E* 1xxh_E* 1xxi_E* 3glf_E* 3glg_E* 3glh_E* 3gli_E* Back     alignment and structure
>3cmw_A Protein RECA, recombinase A; homologous recombination, recombination/DNA complex; HET: DNA ADP; 2.80A {Escherichia coli} PDB: 3cmt_A* 3cmx_A* 3cmv_A* Back     alignment and structure
>2gno_A DNA polymerase III, gamma subunit-related protein; structural genomics, joint center for structural genomics, J protein structure initiative; HET: DNA; 2.00A {Thermotoga maritima} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>2w58_A DNAI, primosome component (helicase loader); ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.50A {Geobacillus kaustophilus HTA426} Back     alignment and structure
>3uv0_A Mutator 2, isoform B; FHA, protein binding, dimerization; 1.90A {Drosophila melanogaster} Back     alignment and structure
>1ny5_A Transcriptional regulator (NTRC family); AAA+ ATPase, sigma54 activator, bacterial transcription, DIM transcription; HET: ADP; 2.40A {Aquifex aeolicus} SCOP: c.23.1.1 c.37.1.20 PDB: 1ny6_A* 3m0e_A* 1zy2_A* Back     alignment and structure
>2kjq_A DNAA-related protein; solution structure, NESG, structural genomics, PSI-2, protei structure initiative; NMR {Neisseria meningitidis serogroup B} Back     alignment and structure
>3k1j_A LON protease, ATP-dependent protease LON; ATP-binding, nucleotide-binding, Pro hydrolase; HET: ADP PE8; 2.00A {Thermococcus onnurineus} Back     alignment and structure
>2brf_A Bifunctional polynucleotide phosphatase/kinase; hydrolase/transferase, FHA, forkhead-associated, PNKP, PNK, polynucleotide kinase 3' phosphatase; 1.40A {Homo sapiens} SCOP: b.26.1.2 PDB: 2w3o_A* 1yjm_A* Back     alignment and structure
>3kt9_A Aprataxin; FHA domain, beta sandwich, beta sheet, AMP hydrolase, alternative splicing, disease mutation, DNA damage, DNA repair, DNA-binding; 1.65A {Homo sapiens} SCOP: b.26.1.0 Back     alignment and structure
>1yj5_C 5' polynucleotide kinase-3' phosphatase FHA domai; beta sandwich, P-loop, transferase; 2.80A {Mus musculus} SCOP: b.26.1.2 Back     alignment and structure
>4akg_A Glutathione S-transferase class-MU 26 kDa isozyme heavy chain cytoplasmic; motor protein, AAA+ protein, ASCE protein, P-loop ntpase; HET: ATP ADP; 3.30A {Schistosoma japonicum} PDB: 4ai6_A* 4akh_A* 4aki_A* 3qmz_A Back     alignment and structure
>2vhj_A Ntpase P4, P4; non- hydrolysable ATP analogue, hydrolase, virus dsRNA, molecular motor, packaging ATPase, hexameric helicase; HET: ADP; 1.80A {Pseudomonas phage PHI12} PDB: 2vhq_A* 1w44_A* 1w46_A* 1w47_A* 1w48_A* 1w49_A* 1w4a_A* 1w4b_A* 1w4c_A 2vht_A* 2vhu_A* 2vhc_A* Back     alignment and structure
>3dzd_A Transcriptional regulator (NTRC family); sigma43 activator, AAA+ ATPase, response regulator, transcriptional activator, ATP-binding; HET: ADP; 2.40A {Aquifex aeolicus} PDB: 1zit_A 2jrl_A Back     alignment and structure
>1w5s_A Origin recognition complex subunit 2 ORC2; replication, CDC6, DNA replication initiation, DNA BIND protein, AAA+ ATPase; HET: ADP; 2.4A {Aeropyrum pernix} SCOP: a.4.5.11 c.37.1.20 PDB: 1w5t_A* Back     alignment and structure
>2qgz_A Helicase loader, putative primosome component; structural genomics, PSI-2, protein structure initiative; 2.40A {Streptococcus pyogenes serotype M3} Back     alignment and structure
>3syl_A Protein CBBX; photosynthesis, rubisco activase, AAA+ protein, calvin cycle chaperone; 3.00A {Rhodobacter sphaeroides} PDB: 3syk_A 3zuh_A* Back     alignment and structure
>1ujx_A Polynucleotide kinase 3'-phosphatase; DNA repair, FHA domain, beta-sandwich, antiparallel beta-sheets, phosphopeptide binding motif; NMR {Mus musculus} SCOP: b.26.1.2 Back     alignment and structure
>2r2a_A Uncharacterized protein; zonular occludens toxin, structural genomics, APC84050.2, PS protein structure initiative; HET: MSE; 1.82A {Neisseria meningitidis MC58} Back     alignment and structure
>3f8t_A Predicted ATPase involved in replication control, CDC46/MCM family; helicase, MCM homolog, DNA replication, ATP-binding, DNA-binding; 1.90A {Methanopyrus kandleri AV19} Back     alignment and structure
>4egx_A Kinesin-like protein KIF1A; FHA domain, transport protein; 2.51A {Homo sapiens} Back     alignment and structure
>1d2n_A N-ethylmaleimide-sensitive fusion protein; hexamerization domain, ATPase, transport; HET: ANP; 1.75A {Cricetulus griseus} SCOP: c.37.1.20 PDB: 1nsf_A* Back     alignment and structure
>3uk6_A RUVB-like 2; hexameric AAA+ ATP-ASE, DNA unwinding, hydrolase; HET: ADP; 2.95A {Homo sapiens} PDB: 2xsz_D* Back     alignment and structure
>3hws_A ATP-dependent CLP protease ATP-binding subunit CL; CLPXP, AAA+ molecular machine, hexamer, asymmetric,, ATP-BIN chaperone, metal-binding; HET: ADP; 3.25A {Escherichia coli} PDB: 3hte_A Back     alignment and structure
>1ofh_A ATP-dependent HSL protease ATP-binding subunit HSLU; chaperone, hydrolase, ATP-binding; HET: ADP; 2.5A {Haemophilus influenzae} SCOP: c.37.1.20 PDB: 1ofi_A* Back     alignment and structure
>3m6a_A ATP-dependent protease LA 1; alpha, beta, ATP-binding, hydrolase, nucleotide-binding, Pro serine protease, stress response; HET: ADP; 3.40A {Bacillus subtilis} PDB: 1x37_A Back     alignment and structure
>1jbk_A CLPB protein; beta barrel, chaperone; 1.80A {Escherichia coli} SCOP: c.37.1.20 Back     alignment and structure
>1um8_A ATP-dependent CLP protease ATP-binding subunit CL; CLPP binding loop, chaperone; HET: ADP; 2.60A {Helicobacter pylori} SCOP: c.37.1.20 Back     alignment and structure
>3cmu_A Protein RECA, recombinase A; homologous recombination, recombination/DNA complex; HET: DNA ADP; 4.20A {Escherichia coli} Back     alignment and structure
>4akg_A Glutathione S-transferase class-MU 26 kDa isozyme heavy chain cytoplasmic; motor protein, AAA+ protein, ASCE protein, P-loop ntpase; HET: ATP ADP; 3.30A {Schistosoma japonicum} PDB: 4ai6_A* 4akh_A* 4aki_A* 3qmz_A Back     alignment and structure
>3huf_A DNA repair and telomere maintenance protein NBS1; NBS1, FHA domain, BRCT domain, phosphoprotein binding, phosp binding, DNA repair; HET: DNA TPO; 2.15A {Schizosaccharomyces pombe} PDB: 3hue_A* 3i0m_A* 3i0n_A* Back     alignment and structure
>1tue_A Replication protein E1; helicase, replication, E1E2 complex, AAA+ protein; 2.10A {Human papillomavirus type 18} SCOP: c.37.1.20 Back     alignment and structure
>3pxg_A Negative regulator of genetic competence CLPC/MEC; CLPB, proteolysis, CLPX, HSP100/CLP, AAA+ proteins, PR binding; 3.65A {Bacillus subtilis} Back     alignment and structure
>2r44_A Uncharacterized protein; putative ATPase, structural genomics, joint center for struc genomics, JCSG; HET: MSE PG4; 2.00A {Cytophaga hutchinsonii atcc 33406} Back     alignment and structure
>1sxj_A Activator 1 95 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>2v1u_A Cell division control protein 6 homolog; DNA replication, nucleotide-binding, replication, archaea; HET: ADP; 3.10A {Aeropyrum pernix} Back     alignment and structure
>3pfi_A Holliday junction ATP-dependent DNA helicase RUVB; probable holliday junction DNA helicase; HET: ADP; 2.69A {Campylobacter jejuni subsp} Back     alignment and structure
>3u61_B DNA polymerase accessory protein 44; AAA+, ATP hydrolase, clamp loader, sliding clamp, primer-TEM DNA, DNA binding protein-DNA complex; HET: DNA ADP 08T; 3.20A {Enterobacteria phage T4} PDB: 3u5z_B* 3u60_B* Back     alignment and structure
>2p65_A Hypothetical protein PF08_0063; CLPB, malaria, structural genomics, structural genomics consortium, SGC, unknown function; 1.70A {Plasmodium falciparum} Back     alignment and structure
>2fna_A Conserved hypothetical protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE ADP; 2.00A {Sulfolobus solfataricus} SCOP: a.4.5.11 c.37.1.20 Back     alignment and structure
>2qen_A Walker-type ATPase; unknown function; HET: ADP; 2.25A {Pyrococcus abyssi} Back     alignment and structure
>4a0e_A YSCD, type III secretion protein; transport protein, SAD phasing, type III secretion system; 2.04A {Yersinia pestis} PDB: 4d9v_A Back     alignment and structure
>1hqc_A RUVB; extended AAA-ATPase domain, complex with nucleotide, hydrolase; HET: ADE; 3.20A {Thermus thermophilus} SCOP: a.4.5.11 c.37.1.20 PDB: 1ixs_B* 1ixr_C* Back     alignment and structure
>2chg_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATPase, ATP-binding, nucleotide-binding; HET: ANP; 2.1A {Archaeoglobus fulgidus} Back     alignment and structure
>1wv3_A Similar to DNA segregation ATPase and related proteins; structural genomics, unknown function; 1.75A {Staphylococcus aureus subsp} SCOP: b.26.1.4 b.26.1.4 Back     alignment and structure
>1ye8_A Protein THEP1, hypothetical UPF0334 kinase-like protein AQ_1292; mixed alpha-beta protein, rossman fold, signaling protein, transferase; 1.40A {Aquifex aeolicus} SCOP: c.37.1.11 Back     alignment and structure
>1u0j_A DNA replication protein; AAA+ protein, P-loop atpases, helicase; HET: DNA ADP; 2.10A {Adeno-associated virus - 2} SCOP: c.37.1.20 PDB: 1s9h_A Back     alignment and structure
>4fcw_A Chaperone protein CLPB; AAA domain; HET: ADP; 2.35A {Thermus thermophilus} PDB: 4fcv_A* 4fd2_A* 4fct_A* Back     alignment and structure
>3vkg_A Dynein heavy chain, cytoplasmic; AAA+ protein, molecular motor, microtubles, motor protein; HET: ADP SPM; 2.81A {Dictyostelium discoideum} PDB: 3vkh_A* Back     alignment and structure
>1g8p_A Magnesium-chelatase 38 kDa subunit; parallel beta sheet, P-loop, rossman fold, AAA+, photosynthesis, metal transport; 2.10A {Rhodobacter capsulatus} SCOP: c.37.1.20 PDB: 2x31_G Back     alignment and structure
>1svm_A Large T antigen; AAA+ fold, viral protein; HET: ATP; 1.94A {Simian virus 40} SCOP: c.37.1.20 PDB: 1svl_A* 1svo_A 1n25_A 2h1l_A Back     alignment and structure
>2z4s_A Chromosomal replication initiator protein DNAA; AAA+ ATPase, domain III (ATPase domain), ATP-binding, cytoplasm, DNA replication; HET: ADP; 3.00A {Thermotoga maritima} PDB: 2z4r_A* Back     alignment and structure
>2qby_A CDC6 homolog 1, cell division control protein 6 homolog 1; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} Back     alignment and structure
>2cvh_A DNA repair and recombination protein RADB; filament formation, homologous recombination, ATPase domain, hyperthermophIle; HET: DNA; 2.20A {Thermococcus kodakarensis} PDB: 2cvf_A* Back     alignment and structure
>3kw6_A 26S protease regulatory subunit 8; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; 2.10A {Homo sapiens} Back     alignment and structure
>1xp8_A RECA protein, recombinase A; recombination, radioresistance, DNA-repair, ATPase, DNA-BIND protein, DNA binding protein; HET: AGS; 2.50A {Deinococcus radiodurans} SCOP: c.37.1.11 d.48.1.1 Back     alignment and structure
>2w0m_A SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus solfataricus P2} Back     alignment and structure
>3nbx_X ATPase RAVA; AAA+ ATPase, alpha-beta-alpha structure, rossman fold, hydro; HET: ADP; 2.91A {Escherichia coli} Back     alignment and structure
>3te6_A Regulatory protein SIR3; heterochromatin, gene silencing, SIR complex, HMR, HML, TELO AAA+ domain, structural, nucleus, gene RE; 2.80A {Saccharomyces cerevisiae} Back     alignment and structure
>1njg_A DNA polymerase III subunit gamma; rossman-like fold, AAA+ ATPase domains, sensor 1, sensor 2, transferase; HET: DNA; 2.20A {Escherichia coli} SCOP: c.37.1.20 PDB: 1njf_A* Back     alignment and structure
>3hr8_A Protein RECA; alpha and beta proteins (A/B, A+B), ATP-binding, cytoplasm, damage, DNA recombination, DNA repair, DNA-binding; 1.95A {Thermotoga maritima} Back     alignment and structure
>3bos_A Putative DNA replication factor; P-loop containing nucleoside triphosphate hydrolases, struct genomics; HET: MSE CDP; 1.75A {Shewanella amazonensis} PDB: 3sc3_A Back     alignment and structure
>1n0w_A DNA repair protein RAD51 homolog 1; DNA repair, homologous recombination, breast cancer susceptibility, RECA-like ATPase, protein complex; HET: DNA MSE; 1.70A {Homo sapiens} SCOP: c.37.1.11 Back     alignment and structure
>2krk_A 26S protease regulatory subunit 8; structural genomics, northeast structural genomics consortium (NESG), target HR3102A, PSI-2; NMR {Homo sapiens} Back     alignment and structure
>3pvs_A Replication-associated recombination protein A; maintenance of genome stability Pro recombination; 2.50A {Escherichia coli} Back     alignment and structure
>2zr9_A Protein RECA, recombinase A; recombination, RECA mutants, DNA-repair, ATP-binding, DNA DA recombination, DNA repair, DNA-binding; HET: DTP; 2.50A {Mycobacterium smegmatis str} PDB: 2zr0_A* 2zra_A* 2zrb_A 2zrm_A* 1ubc_A* 1ubf_A* 1ubg_A* 1ube_A* 2g88_A* 2odw_A* 2oe2_A 2oep_A* 2oes_A 2ofo_A 2zr7_A 2odn_A* 2zrn_A 2zro_A* 2zrp_A* 2zre_A* ... Back     alignment and structure
>2qby_B CDC6 homolog 3, cell division control protein 6 homolog 3; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} Back     alignment and structure
>3cmu_A Protein RECA, recombinase A; homologous recombination, recombination/DNA complex; HET: DNA ADP; 4.20A {Escherichia coli} Back     alignment and structure
>1l8q_A Chromosomal replication initiator protein DNAA; AAA+, helix-turn-helix, nucleotide-binding, DNA binding, REP initiation, DNA binding protein; HET: ADP; 2.70A {Aquifex aeolicus} SCOP: a.4.12.2 c.37.1.20 PDB: 3r8f_A* 2hcb_A* Back     alignment and structure
>3vkg_A Dynein heavy chain, cytoplasmic; AAA+ protein, molecular motor, microtubles, motor protein; HET: ADP SPM; 2.81A {Dictyostelium discoideum} PDB: 3vkh_A* Back     alignment and structure
>2chq_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATP ATP-binding, nucleotide-binding; HET: ANP; 3.5A {Archaeoglobus fulgidus} PDB: 2chv_A Back     alignment and structure
>1qhx_A CPT, protein (chloramphenicol phosphotransferase); kinase, antibiotic resistance, phosphorylation, mononucleoti binding fold; HET: ATP; 2.50A {Streptomyces venezuelae} SCOP: c.37.1.3 PDB: 1grr_A* 1grq_A 1qhs_A* 1qhn_A* 1qhy_A* Back     alignment and structure
>1sxj_B Activator 1 37 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>2orw_A Thymidine kinase; TMTK, TP4A, transferase; HET: 4TA; 1.50A {Thermotoga maritima} PDB: 2qpo_A 2qq0_A* 2qqe_A* Back     alignment and structure
>2z43_A DNA repair and recombination protein RADA; archaea, filament, DNA binding, molecular SWI RECA, DMC1; HET: DNA; 1.93A {Sulfolobus solfataricus} PDB: 2bke_A* 2dfl_A* 2zub_A* 2zuc_A* 2zud_A* Back     alignment and structure
>1u94_A RECA protein, recombinase A; homologous recombination, ATPase, DNA repair, DNA binding protein; 1.90A {Escherichia coli} SCOP: c.37.1.11 d.48.1.1 PDB: 1u98_A 1u99_A 1xms_A* 1xmv_A* 2rec_A 2reb_A 1n03_A* 1rea_A 1aa3_A Back     alignment and structure
>3trf_A Shikimate kinase, SK; amino acid biosynthesis, transferase; 2.60A {Coxiella burnetii} Back     alignment and structure
>1v5w_A DMC1, meiotic recombination protein DMC1/LIM15 homolog; DNA-binding protein, ring protein, octamer, AAA ATPase; 3.20A {Homo sapiens} SCOP: c.37.1.11 PDB: 2zjb_A Back     alignment and structure
>3upu_A ATP-dependent DNA helicase DDA; RECA-like domain, SH3 domain, PIN-tower interface, coupling hydrolysis to DNA unwinding, ssDNA; 3.30A {Enterobacteria phage T4} Back     alignment and structure
>1iqp_A RFCS; clamp loader, extended AAA-ATPase domain, complex with ADP, replication; HET: ADP; 2.80A {Pyrococcus furiosus} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>2dr3_A UPF0273 protein PH0284; RECA superfamily ATPase, hexamer, structural genomics; HET: ADP; 2.00A {Pyrococcus horikoshii} Back     alignment and structure
>3vaa_A Shikimate kinase, SK; structural genomics, center for structural genomics of infec diseases, csgid, metal binding, transferase; 1.70A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1sxj_D Activator 1 41 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>1jr3_A DNA polymerase III subunit gamma; processivity, processivity clamp, clamp loader, AAA+ ATPase, transferase; HET: DNA; 2.70A {Escherichia coli} SCOP: a.80.1.1 c.37.1.20 PDB: 1xxh_B* 3glh_B* 3glf_B* 3gli_B* 3glg_B* 1xxi_B* Back     alignment and structure
>3aji_B S6C, proteasome (prosome, macropain) 26S subunit, ATPA; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dwz_B* 2dvw_B* Back     alignment and structure
>1fnn_A CDC6P, cell division control protein 6; ORC1, AAA protein, DNA replication initation factor, cell cycle control factor; HET: ADP; 2.00A {Pyrobaculum aerophilum} SCOP: a.4.5.11 c.37.1.20 Back     alignment and structure
>3kb2_A SPBC2 prophage-derived uncharacterized protein YORR; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; HET: G3D; 2.20A {Bacillus subtilis} SCOP: c.37.1.1 PDB: 2axp_A* Back     alignment and structure
>3jvv_A Twitching mobility protein; hexameric P-loop ATPase, secretion ATPase, ATP-binding, FIMB nucleotide-binding, transport; HET: ACP CIT; 2.60A {Pseudomonas aeruginosa} PDB: 3jvu_A* Back     alignment and structure
>3vlf_B 26S protease regulatory subunit 7 homolog; heat repeat, chaperone, chaperone-protein binding complex; HET: DNA; 3.80A {Saccharomyces cerevisiae} PDB: 4a3v_B* Back     alignment and structure
>4a74_A DNA repair and recombination protein RADA; hydrolase, recombinase; HET: DNA ANP; 1.48A {Pyrococcus furiosus} PDB: 4a6x_A* 4a6p_A* 4a7o_A* Back     alignment and structure
>3f9v_A Minichromosome maintenance protein MCM; replicative helicase, DNA replication, MCM complex, AAA+ Pro ATP-binding, DNA-binding, helicase; 4.35A {Sulfolobus solfataricus} Back     alignment and structure
>3io5_A Recombination and repair protein; storage dimer, inactive conformation, RECA like core domain, binding, DNA damage, DNA recombination; 2.40A {Enterobacteria phage T4} Back     alignment and structure
>2b8t_A Thymidine kinase; deoxyribonucleoside kinase, zinc-binding domain, TK1, UU-TK, transferase; HET: THM; 2.00A {Ureaplasma parvum} SCOP: c.37.1.24 g.39.1.14 PDB: 2uz3_A* Back     alignment and structure
>3lda_A DNA repair protein RAD51; DNA binding protein, ATP-binding, DNA damage, DNA recombinat repair, nucleotide-binding; HET: DNA; 2.50A {Saccharomyces cerevisiae} PDB: 1szp_A* Back     alignment and structure
>1via_A Shikimate kinase; structural genomics, transferase; HET: MSE; 1.57A {Campylobacter jejuni} SCOP: c.37.1.2 Back     alignment and structure
>3iij_A Coilin-interacting nuclear ATPase protein; alpha and beta proteins (A/B), protein binding, transferase, phosphotransferase; HET: ADP; 1.76A {Homo sapiens} SCOP: c.37.1.1 PDB: 3iik_A 3iil_A* 3iim_A* 1rkb_A Back     alignment and structure
>3dm5_A SRP54, signal recognition 54 kDa protein; protein-RNA, signal recognition particle, SRP-GTPase, protein targeting, cytoplasm, GTP-binding; HET: GDP; 2.51A {Pyrococcus furiosus} Back     alignment and structure
>1zuh_A Shikimate kinase; alpha-beta protein, transferase; 1.80A {Helicobacter pylori} PDB: 1zui_A* 3hr7_A 3muf_A* 3mrs_A 3n2e_A* Back     alignment and structure
>2iyv_A Shikimate kinase, SK; transferase, aromatic amino acid biosynthesis, P-loop kinase, metal- binding, shikimate pathway; HET: ADP; 1.35A {Mycobacterium tuberculosis} SCOP: c.37.1.2 PDB: 2iyr_A* 2iyq_A* 2iyt_A 2iyu_A* 2iys_A* 2iyw_A* 2iyx_A* 2iyy_A* 2iyz_A* 2g1k_A* 1l4y_A* 1u8a_A* 1we2_A* 1zyu_A* 2dfn_A* 2dft_A* 2g1j_A 1l4u_A* 3baf_A* Back     alignment and structure
>3bh0_A DNAB-like replicative helicase; ATPase, replication; 2.35A {Bacillus phage SPP1} Back     alignment and structure
>2rhm_A Putative kinase; P-loop containing nucleoside triphosphate hydrolases fold, S genomics, joint center for structural genomics, JCSG; HET: MSE; 1.70A {Chloroflexus aurantiacus} Back     alignment and structure
>1a5t_A Delta prime, HOLB; zinc finger, DNA replication; 2.20A {Escherichia coli K12} SCOP: a.80.1.1 c.37.1.20 PDB: 1jr3_E* 1xxh_E* 1xxi_E* 3glf_E* 3glg_E* 3glh_E* 3gli_E* Back     alignment and structure
>1sxj_E Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>1y63_A LMAJ004144AAA protein; structural genomics, protein structure initiative, PSI, SGPP structural genomics of pathogenic protozoa consortium; HET: ADP; 1.70A {Leishmania major} SCOP: c.37.1.1 Back     alignment and structure
>2p5t_B PEZT; postsegregational killing system, phosphoryltransferase, HEL helix motif, transcription regulator; 3.20A {Streptococcus pneumoniae} Back     alignment and structure
>1gvn_B Zeta; postsegregational killing system, plasmid; 1.95A {Streptococcus pyogenes} SCOP: c.37.1.21 PDB: 3q8x_B* Back     alignment and structure
>2i1q_A DNA repair and recombination protein RADA; ATPase, recombinase, ATP complex, calcium stimulation, RECA, DMC1; HET: DNA ANP; 1.90A {Methanococcus voltae} SCOP: a.60.4.1 c.37.1.11 PDB: 1xu4_A* 2b21_A* 2fpk_A* 2fpl_A* 2fpm_A* 1t4g_A* 3fyh_A* 2f1j_A* 2f1i_A* 2f1h_A* 3ntu_A* 3ewa_A* 3ew9_A* 3etl_A* 4dc9_A* 2gdj_A* Back     alignment and structure
>1aky_A Adenylate kinase; ATP:AMP phosphotransferase, myokinase, transferase (phosphotransferase); HET: AP5; 1.63A {Saccharomyces cerevisiae} SCOP: c.37.1.1 g.41.2.1 PDB: 2aky_A* 3aky_A* 1dvr_A* Back     alignment and structure
>1tev_A UMP-CMP kinase; ploop, NMP binding region, LID region, conformational changes, transferase; 2.10A {Homo sapiens} SCOP: c.37.1.1 Back     alignment and structure
>3lw7_A Adenylate kinase related protein (ADKA-like); AMP, PSI, MCSG, structural genomics, midwest center for structural genomics; HET: AMP; 2.30A {Sulfolobus solfataricus} PDB: 3h0k_A Back     alignment and structure
>2i3b_A HCR-ntpase, human cancer-related ntpase; AAA, rossmann, hydrolase; NMR {Homo sapiens} SCOP: c.37.1.11 Back     alignment and structure
>2cdn_A Adenylate kinase; phosphoryl transfer, associative mechanism, ATP-binding, nucleotide biosynthesis, nucleotide-binding, transferase; HET: ADP; 1.9A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1p4s_A Back     alignment and structure
>1pzn_A RAD51, DNA repair and recombination protein RAD51, RADA; heptameric ring, heptamer, ring, oligomer, RAD51 polymerizat motif; HET: DNA; 2.85A {Pyrococcus furiosus} SCOP: a.60.4.1 c.37.1.11 Back     alignment and structure
>1vma_A Cell division protein FTSY; TM0570, structural genomics, JCS protein structure initiative, PSI, joint center for structu genomics; HET: CIT; 1.60A {Thermotoga maritima} SCOP: a.24.13.1 c.37.1.10 Back     alignment and structure
>1e6c_A Shikimate kinase; phosphoryl transfer, ADP, shikimate pathway, P-loop protein, transferase; 1.8A {Erwinia chrysanthemi} SCOP: c.37.1.2 PDB: 1shk_A 2shk_A* Back     alignment and structure
>1nlf_A Regulatory protein REPA; replicative DNA helicase structural changes, replication; 1.95A {Escherichia coli} SCOP: c.37.1.11 PDB: 1g8y_A 1olo_A Back     alignment and structure
>2ze6_A Isopentenyl transferase; crown GALL tumor, cytokinin biosynthesis; HET: DST AMP; 2.10A {Agrobacterium tumefaciens} PDB: 2ze5_A* 2ze7_A* 2ze8_A Back     alignment and structure
>2c95_A Adenylate kinase 1; transferase, AP4A, nucleotide kinase, transferase ATP-bindi; HET: B4P; 1.71A {Homo sapiens} PDB: 1z83_A* 3adk_A Back     alignment and structure
>2r8r_A Sensor protein; KDPD, PFAM02702, MCSG, structural genomics, protein structure initiative, midwest center for structural genomics, kinase; 2.30A {Pseudomonas syringae PV} Back     alignment and structure
>3a4m_A L-seryl-tRNA(SEC) kinase; P-loop motif, walker A motif, ATP binding motif, ATP- binding, nucleotide-binding, transferase; HET: ADP; 1.79A {Methanocaldococcus jannaschii} PDB: 3a4l_A* 3a4n_A 3am1_A* 3add_A* 3adc_A* 3adb_A* Back     alignment and structure
>3e1s_A Exodeoxyribonuclease V, subunit RECD; alpha and beta protein, ATP-binding, nucleotide-binding, HYD; 2.20A {Deinococcus radiodurans} PDB: 3gp8_A 3gpl_A* Back     alignment and structure
>1kag_A SKI, shikimate kinase I; transferase, structural genomics, PSI, protein structure initiative; 2.05A {Escherichia coli} SCOP: c.37.1.2 Back     alignment and structure
>2pt5_A Shikimate kinase, SK; aromatic amino acid biosynthesis, P-loop kinase, SHI kinase, shikimate pathway; 2.10A {Aquifex aeolicus} Back     alignment and structure
>3dl0_A Adenylate kinase; phosphotransferase, zinc coordination, ATP-binding, binding, nucleotide biosynthesis, nucleotide-binding, trans; HET: AP5; 1.58A {Bacillus subtilis} PDB: 1p3j_A* 2ori_A* 2eu8_A* 2oo7_A* 2p3s_A* 2qaj_A* 2osb_A* 3dkv_A* 1zin_A* 1zio_A* 1zip_A* 1s3g_A* Back     alignment and structure
>3cm0_A Adenylate kinase; ATP-binding, cytoplasm, nucleotide biosynthesis, nucleotide-binding, transferase, structural genomics; 1.80A {Thermus thermophilus} Back     alignment and structure
>2gno_A DNA polymerase III, gamma subunit-related protein; structural genomics, joint center for structural genomics, J protein structure initiative; HET: DNA; 2.00A {Thermotoga maritima} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>2zts_A Putative uncharacterized protein PH0186; KAIC like protein, ATP-binding, nucleotide-binding, ATP- binding protein; HET: ADP; 2.07A {Pyrococcus horikoshii} Back     alignment and structure
>1ak2_A Adenylate kinase isoenzyme-2; nucleoside monophosphate kinase, phosphotransferase; 1.92A {Bos taurus} SCOP: c.37.1.1 g.41.2.1 PDB: 2ak2_A 2c9y_A* Back     alignment and structure
>2bwj_A Adenylate kinase 5; phosphoryl transfer reaction, transferase; HET: AMP; 2.3A {Homo sapiens} Back     alignment and structure
>3fb4_A Adenylate kinase; psychrophIle, phosphotransferase, ATP-binding, nucleotide-binding, transferase; HET: AP5; 2.00A {Marinibacillus marinus} Back     alignment and structure
>1kht_A Adenylate kinase; phosphotransferase, signaling protein, transferase; HET: AMP; 2.50A {Methanococcus voltae} SCOP: c.37.1.1 PDB: 3h86_B* 1ki9_A Back     alignment and structure
>1z6t_A APAF-1, apoptotic protease activating factor 1; caspase activation, ADP, nucleotide binding, CARD, apoptosis; HET: ADP; 2.21A {Homo sapiens} Back     alignment and structure
>1g5t_A COB(I)alamin adenosyltransferase; P-loop protein, cobalamin biosynthesis, RECA fold; HET: ATP; 1.80A {Salmonella typhimurium} SCOP: c.37.1.11 PDB: 1g5r_A* 1g64_A* Back     alignment and structure
>1qf9_A UMP/CMP kinase, protein (uridylmonophosphate/cytidylmonophosphate kinase); nucleoside monophosphate kinase, NMP kinase; HET: ADP C5P; 1.70A {Dictyostelium discoideum} SCOP: c.37.1.1 PDB: 1uke_A* 2ukd_A* 3ukd_A* 4ukd_A* 5ukd_A* Back     alignment and structure
>2r6a_A DNAB helicase, replicative helicase; replication, DNAB; 2.90A {Geobacillus stearothermophilus} PDB: 2r6c_A 2r6d_A 2r6e_A 2vyf_A 2vye_A Back     alignment and structure
>2dzn_B 26S protease regulatory subunit 6B homolog; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} PDB: 2dzo_B Back     alignment and structure
>2fz4_A DNA repair protein RAD25; RECA-like domain, DNA damage recognition domain, DNA binding; HET: DNA; 2.40A {Archaeoglobus fulgidus} SCOP: c.37.1.19 Back     alignment and structure
>2q6t_A DNAB replication FORK helicase; hydrolase; 2.90A {Thermus aquaticus} Back     alignment and structure
>1ukz_A Uridylate kinase; transferase; HET: ADP AMP; 1.90A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 1uky_A* Back     alignment and structure
>2vli_A Antibiotic resistance protein; transferase, tunicamycin, phosphotransferase; 1.95A {Deinococcus radiodurans} Back     alignment and structure
>1ly1_A Polynucleotide kinase; PNK, phosphatase, transferase; 2.00A {Enterobacteria phage T4} SCOP: c.37.1.1 Back     alignment and structure
>3t61_A Gluconokinase; PSI-biology, structural genomics, protein structure initiati YORK structural genomics research consortium, nysgrc; 2.20A {Sinorhizobium meliloti} Back     alignment and structure
>1zd8_A GTP:AMP phosphotransferase mitochondrial; ATP:AMP phosphotransferase, myokinase, structural genomics, structural genomics consortium, SGC; 1.48A {Homo sapiens} PDB: 2ak3_A* Back     alignment and structure
>2iut_A DNA translocase FTSK; nucleotide-binding, chromosome partition, ATP-binding, DNA- cell division, DNA translocation, KOPS, membrane; HET: DNA SAP; 2.25A {Pseudomonas aeruginosa} PDB: 2iuu_A* Back     alignment and structure
>3tlx_A Adenylate kinase 2; structural genomics, structural genomics consortium, SGC, RO fold, transferase, ATP binding, phosphorylation; HET: ADP ATP AMP; 2.75A {Plasmodium falciparum} Back     alignment and structure
>3be4_A Adenylate kinase; malaria, cryptosporidium parvum nonprotein inhibitors, nucleotide-binding, transferase; HET: AP5; 1.60A {Cryptosporidium parvum iowa II} Back     alignment and structure
>1knq_A Gluconate kinase; ALFA/beta structure, transferase; 2.00A {Escherichia coli} SCOP: c.37.1.17 PDB: 1ko1_A 1ko4_A 1ko5_A* 1ko8_A* 1kof_A* Back     alignment and structure
>1cr0_A DNA primase/helicase; RECA-type protein fold, transferase; HET: DNA; 2.30A {Enterobacteria phage T7} SCOP: c.37.1.11 PDB: 1cr1_A* 1cr2_A* 1cr4_A* 1e0j_A* 1e0k_A* Back     alignment and structure
>3kl4_A SRP54, signal recognition 54 kDa protein; signal recognition particle, SRP, SRP54, FFH, signal sequenc peptide; 3.50A {Sulfolobus solfataricus} PDB: 1qzx_A 1qzw_A Back     alignment and structure
>1zp6_A Hypothetical protein ATU3015; alpha-beta protein., structural genomics, PSI, protein struc initiative; 3.20A {Agrobacterium tumefaciens str} SCOP: c.37.1.25 Back     alignment and structure
>1zak_A Adenylate kinase; ATP:AMP-phosphotransferase, transferase; HET: AP5; 3.50A {Zea mays} SCOP: c.37.1.1 g.41.2.1 Back     alignment and structure
>1e4v_A Adenylate kinase; transferase(phosphotransferase); HET: AP5; 1.85A {Escherichia coli} SCOP: c.37.1.1 g.41.2.1 PDB: 1e4y_A* 1ake_A* 1ank_A* 2eck_A* 3hpq_A* 4ake_A 3hpr_A* Back     alignment and structure
>3bgw_A DNAB-like replicative helicase; ATPase, replication; 3.91A {Bacillus phage SPP1} Back     alignment and structure
>3sr0_A Adenylate kinase; phosphoryl transfer analogue, ALF4, transferase (phosphotran phosphoryl transfer, nucleotide-binding; HET: ADP AMP; 1.56A {Aquifex aeolicus} PDB: 2rh5_A 2rgx_A* Back     alignment and structure
>2pbr_A DTMP kinase, thymidylate kinase; transferase, nucleotide biosynthesis, TMP-binding, A binding, structural genomics, NPPSFA; 1.96A {Aquifex aeolicus} Back     alignment and structure
>4eun_A Thermoresistant glucokinase; putative sugar kinase, enzyme function initiative, EFI, STRU genomics, transferase; 1.60A {Janibacter SP} Back     alignment and structure
>2pez_A Bifunctional 3'-phosphoadenosine 5'- phosphosulfate synthetase 1 (PAPS synthetase...; NMP-kinase fold, protein in complex with nucleic acid; HET: GGZ DAT; 1.40A {Homo sapiens} PDB: 2pey_A* 2ax4_A* Back     alignment and structure
>3umf_A Adenylate kinase; rossmann fold, transferase; 2.05A {Schistosoma mansoni} Back     alignment and structure
>2jaq_A Deoxyguanosine kinase; transferase, deoxyribonucleoside kinase; HET: DCP; 2.3A {Mycoplasma mycoides subsp} PDB: 2jat_A* 2jas_A* Back     alignment and structure
>2ga8_A Hypothetical 39.9 kDa protein; YFR007W, YFH7, unknown function; HET: CME; 1.77A {Saccharomyces cerevisiae} PDB: 2gaa_A* Back     alignment and structure
>3b6e_A Interferon-induced helicase C domain-containing P; DECH, DEXD/H RNA-binding helicase, innate immunity, IFIH1, S genomics; 1.60A {Homo sapiens} Back     alignment and structure
>1nks_A Adenylate kinase; thermophilic, transferase; HET: AMP ADP; 2.57A {Sulfolobus acidocaldarius} SCOP: c.37.1.1 Back     alignment and structure
>3crm_A TRNA delta(2)-isopentenylpyrophosphate transferase; ATP-binding, nucleotide-binding, nucleotidyltransferase, tRNA processing; 1.90A {Pseudomonas aeruginosa} PDB: 3crq_A 3crr_A Back     alignment and structure
>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* Back     alignment and structure
>2xb4_A Adenylate kinase; ATP-binding, nucleotide-binding, transferase; HET: SRT; 1.80A {Desulfovibrio gigas} PDB: 3l0s_A* 3l0p_A* Back     alignment and structure
>1cke_A CK, MSSA, protein (cytidine monophosphate kinase); nucleotide monophosphate kinase,, transferase; 1.75A {Escherichia coli} SCOP: c.37.1.1 PDB: 1kdo_A* 1kdp_A* 1kdr_A* 1kdt_A* 2cmk_A* 2fem_A 2feo_A* Back     alignment and structure
>1q57_A DNA primase/helicase; dntpase, DNA replication, transferase; HET: DNA; 3.45A {Enterobacteria phage T7} SCOP: c.37.1.11 e.13.1.2 Back     alignment and structure
>2eyu_A Twitching motility protein PILT; pilus retraction motor, C-terminal domain PILT, protein transport; 1.87A {Aquifex aeolicus} Back     alignment and structure
>2if2_A Dephospho-COA kinase; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium, NESG; 3.00A {Aquifex aeolicus} Back     alignment and structure
>2v54_A DTMP kinase, thymidylate kinase; nucleotide biosynthesis, ATP-binding, nucleotide-binding, poxvirus, transferase; HET: TYD POP; 2.4A {Vaccinia virus copenhagen} PDB: 2w0s_A* Back     alignment and structure
>1sxj_C Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>2ius_A DNA translocase FTSK; nucleotide-binding, chromosome partition, ATP-binding, DNA- binding, cell division, transmembrane, inner membrane; HET: DNA; 2.7A {Escherichia coli} PDB: 2j5p_A* Back     alignment and structure
>1uf9_A TT1252 protein; P-loop, nucleotide binding domain, structural genomics, riken structural genomics/proteomics initiative, RSGI; HET: ATP; 2.80A {Thermus thermophilus} SCOP: c.37.1.1 Back     alignment and structure
>1w5s_A Origin recognition complex subunit 2 ORC2; replication, CDC6, DNA replication initiation, DNA BIND protein, AAA+ ATPase; HET: ADP; 2.4A {Aeropyrum pernix} SCOP: a.4.5.11 c.37.1.20 PDB: 1w5t_A* Back     alignment and structure
>3ake_A Cytidylate kinase; CMP kinase, CMP complex, open conformation, nucleotide metab transferase; HET: C5P; 1.50A {Thermus thermophilus} PDB: 3akc_A* 3akd_A* Back     alignment and structure
>2plr_A DTMP kinase, probable thymidylate kinase; TMP-binding, ATP-binding, structural GEN NPPSFA; HET: 1PE PGE EPE PG4; 1.60A {Sulfolobus tokodaii} Back     alignment and structure
>2ewv_A Twitching motility protein PILT; pilus retraction motor, ATPase, hexameric PILT, protein TRAN; HET: ADP; 2.80A {Aquifex aeolicus} PDB: 2eww_A* 2gsz_A* Back     alignment and structure
>3uie_A Adenylyl-sulfate kinase 1, chloroplastic; rossmann fold, transferase-transferase complex; HET: ADX ANP; 1.79A {Arabidopsis thaliana} SCOP: c.37.1.0 PDB: 4fxp_A* Back     alignment and structure
>1p9r_A General secretion pathway protein E; bacterial type II secretion system cytoplasmic protein - GSPE, putative ATPase/ ATP binding protein; 2.50A {Vibrio cholerae} SCOP: c.37.1.11 PDB: 1p9w_A* Back     alignment and structure
>2wwf_A Thymidilate kinase, putative; transferase, malaria; HET: TMP ADP; 1.89A {Plasmodium falciparum} PDB: 2wwg_A* 2wwh_A* 2wwi_A* Back     alignment and structure
>1w36_D RECD, exodeoxyribonuclease V alpha chain; recombination, helicase, hydrolase, DNA repair; HET: DNA; 3.1A {Escherichia coli} SCOP: c.37.1.19 c.37.1.19 PDB: 3k70_D* Back     alignment and structure
>2bbw_A Adenylate kinase 4, AK4; nucleotide kinase, nucleotide binding, human, structura genomics, structural genomics consortium, SGC, transferase; HET: GP5; 2.05A {Homo sapiens} PDB: 2ar7_A* 3ndp_A Back     alignment and structure
>4gp7_A Metallophosphoesterase; polynucleotide kinase phosphatase, RNA repair, transferase; HET: ATP CIT; 2.00A {Clostridium thermocellum} PDB: 4gp6_A* Back     alignment and structure
>4a1f_A DNAB helicase, replicative DNA helicase; hydrolase, DNA replication, ATPase; HET: FLC; 2.50A {Helicobacter pylori} Back     alignment and structure
>2grj_A Dephospho-COA kinase; TM1387, EC 2.7.1.24, dephosphocoenzyme kinase, structural genomics, joint center for structural GE JCSG; HET: ADP COD; 2.60A {Thermotoga maritima} Back     alignment and structure
>1m7g_A Adenylylsulfate kinase; APS kinase, transferase, sulfate Met nucleotide 2 kinase; HET: AV2 ADX ADP; 1.43A {Penicillium chrysogenum} SCOP: c.37.1.4 PDB: 1d6j_A* 1m7h_A* 3cr7_A* Back     alignment and structure
>1jjv_A Dephospho-COA kinase; P-loop nucleotide-binding fold, structure 2 function project, S2F, structural genomics, transferase; HET: ATP; 2.00A {Haemophilus influenzae} SCOP: c.37.1.1 Back     alignment and structure
>1ex7_A Guanylate kinase; substrate-induced FIT, domain movement, GMP, ATP, substrate specificity, X-RAY diffraction, transferase; HET: 5GP; 1.90A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 1ex6_A* 1gky_A* 3sqk_A 4f4j_A Back     alignment and structure
>3r20_A Cytidylate kinase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, ADP, DCMP, D transferase; 2.00A {Mycobacterium smegmatis} SCOP: c.37.1.0 PDB: 3r8c_A 4die_A* Back     alignment and structure
>1jr3_D DNA polymerase III, delta subunit; processivity, processivity clamp, clamp loader, AAA+ ATPase, transferase; HET: DNA; 2.70A {Escherichia coli} SCOP: a.80.1.1 c.37.1.20 PDB: 1jqj_C* 1xxh_A* 1xxi_A* 3glf_A* 3glg_A* 3glh_A* 3gli_A* Back     alignment and structure
>3a8t_A Adenylate isopentenyltransferase; rossmann fold protein; HET: ATP; 2.37A {Humulus lupulus} Back     alignment and structure
>4e22_A Cytidylate kinase; P-loop, CMP/ATP binding, transferase; 2.32A {Yersinia pseudotuberculosis} Back     alignment and structure
>1nn5_A Similar to deoxythymidylate kinase (thymidylate K; P-loop, D4TMP, transferase; HET: 2DT ANP; 1.50A {Homo sapiens} SCOP: c.37.1.1 PDB: 1e2e_A* 1e2d_A* 1e2g_A* 1e2q_A* 1e99_A* 1e9a_A* 1e9b_A* 1nmx_A* 1nmz_A* 1nn0_A* 1nn1_A* 1e2f_A* 1nn3_A* 2xx3_A* 1e9c_A* 1e9d_A* 1e9e_A* 1e98_A* 1nmy_A* 1e9f_A* Back     alignment and structure
>1uj2_A Uridine-cytidine kinase 2; alpha/beta mononucleotide-binding HOLD, transferase; HET: C5P ADP; 1.80A {Homo sapiens} SCOP: c.37.1.6 PDB: 1uei_A* 1uej_A* 1udw_A 1ufq_A* 1xrj_A* Back     alignment and structure
>3nwj_A ATSK2; P loop, shikimate, nucleoside monophosphate kinase, shikimat ATP binding, chloroplast, transferase; 2.35A {Arabidopsis thaliana} Back     alignment and structure
>2yvu_A Probable adenylyl-sulfate kinase; transferase, structural genomics, NPPSFA, national P protein structural and functional analyses; 2.10A {Aeropyrum pernix} Back     alignment and structure
>1vht_A Dephospho-COA kinase; structural genomics, transferase; HET: BA3; 1.59A {Escherichia coli} SCOP: c.37.1.1 PDB: 1vhl_A* 1viy_A 1t3h_A 1n3b_A Back     alignment and structure
>2h92_A Cytidylate kinase; rossmann fold, transferase; HET: C5P PG4; 2.30A {Staphylococcus aureus} Back     alignment and structure
>2pt7_A CAG-ALFA; ATPase, protein-protein complex, type IV secretion, hydrolas binding complex; 2.40A {Helicobacter pylori} SCOP: c.37.1.11 PDB: 1nly_A* 1nlz_A 1opx_A* 1g6o_A Back     alignment and structure
>1ltq_A Polynucleotide kinase; phosphatase, alpha/beta, P-loop, transferase; HET: ADP; 2.33A {Enterobacteria phage T4} SCOP: c.108.1.9 c.37.1.1 PDB: 1rc8_A* 1rpz_A* 1rrc_A* 2ia5_A Back     alignment and structure
>2px0_A Flagellar biosynthesis protein FLHF; SRP GTPase, flagellum, protein transport, biosynthetic protein; HET: GNP; 3.00A {Bacillus subtilis} PDB: 2px3_A* 3syn_A* Back     alignment and structure
>1q3t_A Cytidylate kinase; nucleotide monophosphate kinase, CMP kinase, transferase; NMR {Streptococcus pneumoniae} SCOP: c.37.1.1 Back     alignment and structure
>3foz_A TRNA delta(2)-isopentenylpyrophosphate transferas; nucleoside modification, isopentenyl-tRNA transferase, transferase-RNA complex; 2.50A {Escherichia coli k-12} PDB: 2zxu_A* 2zm5_A Back     alignment and structure
>2gxq_A Heat resistant RNA dependent ATPase; RNA helicase, atomic resolution, AMP complex, ribosome biogenesis, thermophilic, hydrolase; HET: AMP; 1.20A {Thermus thermophilus HB27} PDB: 2gxs_A* 2gxu_A 3mwj_A 3mwk_A* 3mwl_A* 3nbf_A* 3nej_A Back     alignment and structure
>3zvl_A Bifunctional polynucleotide phosphatase/kinase; hydrolase-transferase complex, base excision repair, BER, non-homologous END-joining, NHEJ; 1.65A {Mus musculus} PDB: 3zvm_A* 3zvn_A* 1yj5_A 3u7e_B* 3u7f_B* 3u7h_B* 3u7g_A* Back     alignment and structure
>3pie_A 5'->3' exoribonuclease (XRN1); beta berrel, tudor domain, chromo domain, mRNA turnover, RRN processing, RNA binding, DNA binding; 2.90A {Kluyveromyces lactis} PDB: 3pif_A Back     alignment and structure
>2qt1_A Nicotinamide riboside kinase 1; non-protein kinase, NAD+, NRK1, nicotinic acid riboside kinase activity, NAD biosynthesis; HET: NNR; 1.32A {Homo sapiens} PDB: 2qsy_A* 2qsz_A* 2qt0_A* 2p0e_A* 2qg6_A* 2ql6_A* Back     alignment and structure
>2j37_W Signal recognition particle 54 kDa protein (SRP54); ribosome, SRP, translation/RNA; 8.00A {Canis SP} PDB: 1wgw_A Back     alignment and structure
>3ney_A 55 kDa erythrocyte membrane protein; structural genomics consortium, SGC, 55 kDa erythrocyte MEMB protein; 2.26A {Homo sapiens} SCOP: c.37.1.0 Back     alignment and structure
>2f6r_A COA synthase, bifunctional coenzyme A synthase; 18044849, bifunctional coenzyme A synthase (COA synthase), S genomics; HET: ACO UNL; 1.70A {Mus musculus} Back     alignment and structure
>4b3f_X DNA-binding protein smubp-2; hydrolase, helicase; 2.50A {Homo sapiens} PDB: 4b3g_A Back     alignment and structure
>2yhs_A FTSY, cell division protein FTSY; cell cycle, protein targeting, simibi class GTPase, GTP-BIND membrane, nucleotide-binding; 1.60A {Escherichia coli} PDB: 2qy9_A 2xxa_B* 1fts_A Back     alignment and structure
>2a5y_B CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis elegans} SCOP: a.4.5.80 a.77.1.3 c.37.1.20 PDB: 3lqq_A* 3lqr_A* Back     alignment and structure
>3d3q_A TRNA delta(2)-isopentenylpyrophosphate transferase; alpha-beta protein, structural genomics, PSI-2; 2.70A {Staphylococcus epidermidis atcc 12228} Back     alignment and structure
>3llm_A ATP-dependent RNA helicase A; alpha-beta-alpha, structural genomics, structural genomics consortium, SGC, activator, ATP-binding, DNA-binding; HET: ADP; 2.80A {Homo sapiens} Back     alignment and structure
>2qor_A Guanylate kinase; phosphotransferase, purine metabolism, structural genomics, structural genomics of pathogenic protozoa consortium; HET: 5GP POP; 1.80A {Plasmodium vivax} Back     alignment and structure
>1j8m_F SRP54, signal recognition 54 kDa protein; signaling protein; 2.00A {Acidianus ambivalens} SCOP: a.24.13.1 c.37.1.10 PDB: 1j8y_F Back     alignment and structure
>2bdt_A BH3686; alpha-beta protein, structural genomics, PSI, protein struct initiative, northeast structural genomics consortium, NESG, function; 2.40A {Bacillus halodurans} SCOP: c.37.1.25 Back     alignment and structure
>3exa_A TRNA delta(2)-isopentenylpyrophosphate transferase; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; 2.30A {Bacillus halodurans} PDB: 2qgn_A Back     alignment and structure
>3fdi_A Uncharacterized protein; cytidylate kinase like protein, PSI, MCSG, PRK04182 class ME structural genomics, protein structure initiative; 2.20A {Eubacterium ventriosum} Back     alignment and structure
>2qmh_A HPR kinase/phosphorylase; V267F mutation, ATP-binding, carbohydrate metabolism, magnesium, metal-binding, multifunctional enzyme; 2.60A {Lactobacillus casei} PDB: 1jb1_A 1kkl_A 1kkm_A* Back     alignment and structure
>1qde_A EIF4A, translation initiation factor 4A; DEAD box protein family, gene regulation; 2.00A {Saccharomyces cerevisiae} SCOP: c.37.1.19 PDB: 1qva_A Back     alignment and structure
>1hv8_A Putative ATP-dependent RNA helicase MJ0669; RNA-binding protein, ATPase, RNA binding protein; 3.00A {Methanocaldococcus jannaschii} SCOP: c.37.1.19 c.37.1.19 Back     alignment and structure
>2axn_A 6-phosphofructo-2-kinase/fructose-2,6- biphosphatase 3 (6PF-2-K/FRU- 2,6-P2ASE brain/placenta-type...; bifunctional enzyme, EDTA complex; HET: F6P EDT ADP; 2.10A {Homo sapiens} PDB: 2dwo_A* 2dwp_A* 2i1v_B* 3qpu_A* 3qpv_A* 3qpw_A* Back     alignment and structure
>2j41_A Guanylate kinase; GMP, GMK, transferase, ATP-binding, nucleotide- binding; HET: 5GP; 1.9A {Staphylococcus aureus} Back     alignment and structure
>1sky_E F1-ATPase, F1-ATP synthase; F1FO ATP synthase, alpha3BETA3 SUBC F1-ATPase, hydrolase; 3.20A {Bacillus SP} SCOP: a.69.1.1 b.49.1.1 c.37.1.11 Back     alignment and structure
>1vec_A ATP-dependent RNA helicase P54; DEAD-box protein, RNA binding protein; HET: TLA; 2.01A {Homo sapiens} SCOP: c.37.1.19 Back     alignment and structure
>1w4r_A Thymidine kinase; type II, human, cytosolic, phosphorylation, transferase; HET: TTP; 1.83A {Homo sapiens} PDB: 1xbt_A* 2wvj_A* 2j87_A* Back     alignment and structure
>3eph_A TRNA isopentenyltransferase; transferase, alternative initiation, ATP-binding, cytoplasm, mitochondrion, nucleotide-binding, nucleus; 2.95A {Saccharomyces cerevisiae} PDB: 3epj_A 3epk_A* 3epl_A* Back     alignment and structure
>2oap_1 GSPE-2, type II secretion system protein; hexameric ATPase, hydrolase; HET: ANP; 2.95A {Archaeoglobus fulgidus} PDB: 2oaq_1 Back     alignment and structure
>3thx_B DNA mismatch repair protein MSH3; ABC family ATPase, mismatch recognition, mismatched unpaired DNA binding protein-DNA complex; HET: DNA ADP; 2.70A {Homo sapiens} PDB: 3thw_B* 3thy_B* 3thz_B* Back     alignment and structure
>2w58_A DNAI, primosome component (helicase loader); ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.50A {Geobacillus kaustophilus HTA426} Back     alignment and structure
>3b9q_A Chloroplast SRP receptor homolog, alpha subunit CPFTSY; protein translocation, GTP-binding, nucleotide-binding, protein transport; 1.75A {Arabidopsis thaliana} Back     alignment and structure
>3tau_A Guanylate kinase, GMP kinase; structural genomics, center for structural genomics of infec diseases, csgid, putative guanylate kinase; HET: MSE; 2.05A {Listeria monocytogenes} Back     alignment and structure
>3asz_A Uridine kinase; cytidine phosphorylation, transferase; HET: C5P; 2.25A {Thermus thermophilus} PDB: 3asy_A* Back     alignment and structure
>1xx6_A Thymidine kinase; NESG, northeast structural genomics consortium, protein STRU initiative, PSI, structural genomics, DNA synthesis; HET: ADP; 2.00A {Clostridium acetobutylicum} SCOP: c.37.1.24 g.39.1.14 Back     alignment and structure
>1kgd_A CASK, peripheral plasma membrane CASK; maguk, guanylate kinase like domain, protein binding; 1.31A {Homo sapiens} SCOP: c.37.1.1 Back     alignment and structure
>3tr0_A Guanylate kinase, GMP kinase; purines, pyrimidines, nucleosides, nucleotides, transferase; HET: 5GP; 1.85A {Coxiella burnetii} Back     alignment and structure
>1tf7_A KAIC; homohexamer, hexamer, circadian clock protein; HET: ATP; 2.80A {Synechococcus SP} SCOP: c.37.1.11 c.37.1.11 PDB: 3s1a_A* 1u9i_A* 2gbl_A* 3dvl_A* 3k0a_A* 3k09_A* 3jzm_A* 3k0e_A* 4dug_A* 3ua2_A* 3k0c_A* 3k0f_A* Back     alignment and structure
>3n70_A Transport activator; sigma-54, ntpase, PSI, MCSG, structural genomics, center for structural genomics; 2.80A {Escherichia coli} Back     alignment and structure
>1rz3_A Hypothetical protein rbstp0775; MCSG, structural genomics, PSI, protein structure initiative; 1.90A {Geobacillus stearothermophilus} SCOP: c.37.1.6 Back     alignment and structure
>2xau_A PRE-mRNA-splicing factor ATP-dependent RNA helica; hydrolase, ribosome biogenesis, ATPase, ATP-binding, OB-fold; HET: ADP; 1.90A {Saccharomyces cerevisiae} PDB: 3kx2_B* Back     alignment and structure
>1nrj_B SR-beta, signal recognition particle receptor beta subunit; transmembrane, endoplasmic reticulum, GTP-binding; HET: GTP; 1.70A {Saccharomyces cerevisiae} SCOP: c.37.1.8 Back     alignment and structure
>2ffh_A Protein (FFH); SRP54, signal recognition particle, GTPase, M domain, RNA-binding, signal sequence-binding, helix-turn-helix, protein targeting; 3.20A {Thermus aquaticus} SCOP: a.24.13.1 a.36.1.1 c.37.1.10 PDB: 2iy3_A Back     alignment and structure
>1zu4_A FTSY; GTPase, signal recognition particle, SRP, receptor, protein transport; 1.95A {Mycoplasma mycoides} PDB: 1zu5_A Back     alignment and structure
>3thx_A DNA mismatch repair protein MSH2; ABC family ATPase, mismatch recognition, mismatched unpaired DNA binding protein-DNA complex; HET: DNA ADP; 2.70A {Homo sapiens} PDB: 2o8c_A* 2o8d_A* 2o8f_A* 3thw_A* 2o8b_A* 3thy_A* 3thz_A* 2o8e_A* Back     alignment and structure
>3c8u_A Fructokinase; YP_612366.1, putative fructose transport system kinase, STRU genomics, joint center for structural genomics, JCSG; 1.95A {Silicibacter SP} Back     alignment and structure
>2v3c_C SRP54, signal recognition 54 kDa protein; nucleotide-binding, signal recognition particle, GTP-binding, RNA-binding; 2.50A {Methanocaldococcus jannaschii} PDB: 3ndb_B Back     alignment and structure
>3e70_C DPA, signal recognition particle receptor; FTSY, SRP-GTPase, protein-targeting, transport protein; HET: GDP; 1.97A {Pyrococcus furiosus} PDB: 3dmd_B 3dm9_B* Back     alignment and structure
>2bjv_A PSP operon transcriptional activator; AAA, transcription activation, gene regulation, sigma54 activator, enhancer binding protein, PSPF; 1.7A {Escherichia coli} PDB: 2bjw_A 2c96_A* 2c98_A* 2c99_A* 2c9c_A* 2vii_A* Back     alignment and structure
>1t6n_A Probable ATP-dependent RNA helicase; RECA-like fold, PRE-mRNA processing protein; HET: FLC; 1.94A {Homo sapiens} SCOP: c.37.1.19 Back     alignment and structure
>1tf7_A KAIC; homohexamer, hexamer, circadian clock protein; HET: ATP; 2.80A {Synechococcus SP} SCOP: c.37.1.11 c.37.1.11 PDB: 3s1a_A* 1u9i_A* 2gbl_A* 3dvl_A* 3k0a_A* 3k09_A* 3jzm_A* 3k0e_A* 4dug_A* 3ua2_A* 3k0c_A* 3k0f_A* Back     alignment and structure
>2xxa_A Signal recognition particle protein; protein transport, RNA/RNA binding protein, hydrolase, gtpas; HET: GCP; 3.94A {Escherichia coli} PDB: 2j28_9 Back     alignment and structure
>3hdt_A Putative kinase; structura genomics, PSI-2, protein structure initiative, midwest CENT structural genomics, MCSG; 2.79A {Clostridium symbiosum atcc 14940} Back     alignment and structure
>1x6v_B Bifunctional 3'-phosphoadenosine 5'- phosphosulfate synthethase 1; transferase, ATP sulfurylase, APS kinase, PAPS; HET: ADP; 1.75A {Homo sapiens} SCOP: b.122.1.3 c.26.1.5 c.37.1.4 PDB: 1xjq_B* 1xnj_B* 2qjf_A* 2ofx_A* 2ofw_A* Back     alignment and structure
>3gmt_A Adenylate kinase; ssgcid, ATP-BIN cytoplasm, nucleotide biosynthesis, nucleotide-BIND transferase, structural genomics; 2.10A {Burkholderia pseudomallei 1710B} Back     alignment and structure
>2pl3_A Probable ATP-dependent RNA helicase DDX10; DEAD, structural genomics, structural genomic consortium, SGC, hydrolase; HET: ADP; 2.15A {Homo sapiens} Back     alignment and structure
>3lxx_A GTPase IMAP family member 4; structural genomics consortium, SGC, coiled coil, GTP- binding, nucleotide-binding, immune system; HET: GDP; 2.15A {Homo sapiens} Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Back     alignment and structure
>1ls1_A Signal recognition particle protein; FFH, SRP54, SRP, GTPase, ultrahigh resolution, protein transport; 1.10A {Thermus aquaticus} SCOP: a.24.13.1 c.37.1.10 PDB: 1jpn_B* 1jpj_A* 1ry1_U* 2j45_A* 1o87_A* 2c04_A* 2j46_A* 1rj9_B* 2c03_A* 2j7p_A* 1okk_A* 2cnw_A* 1ng1_A* 2xkv_A 3ng1_A 1ffh_A 2ng1_A* Back     alignment and structure
>1lvg_A Guanylate kinase, GMP kinase; transferase; HET: ADP 5GP; 2.10A {Mus musculus} SCOP: c.37.1.1 Back     alignment and structure
>1gtv_A TMK, thymidylate kinase; transferase, transferase (ATP:TMP phosphotransferase); HET: TYD TMP; 1.55A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1g3u_A* 1gsi_A* 1mrn_A* 1mrs_A* 1n5i_A* 1n5j_A* 1n5k_A* 1n5l_A* 1w2g_A* 1w2h_A* Back     alignment and structure
>3tbk_A RIG-I helicase domain; DECH helicase, ATP binding, hydrolase; HET: ANP; 2.14A {Mus musculus} Back     alignment and structure
>4eaq_A DTMP kinase, thymidylate kinase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, MTBI, transferase; HET: ATM; 1.85A {Staphylococcus aureus subsp} PDB: 4dwj_A* 4f4i_A Back     alignment and structure
>3pey_A ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, ATPase, helicase, mRNA-export, nuclear pore, hydrolase-RNA complex; HET: ADP; 1.40A {Saccharomyces cerevisiae} PDB: 3pew_A* 3pex_A* 3pez_A* 3rrm_A* 3rrn_A* 2kbe_A 3gfp_A 2kbf_A 3pev_A* 3peu_A* Back     alignment and structure
>3iuy_A Probable ATP-dependent RNA helicase DDX53; REC-A-like, DEAD-BOX, structural genomics, structural genomi consortium, SGC, ATP-binding, hydrolase; HET: AMP; 2.40A {Homo sapiens} Back     alignment and structure
>2a9k_A RAS-related protein RAL-A; bacterial ADP-ribosyltransferase, RAL, RHO, GD binding; HET: GDP NAD; 1.73A {Homo sapiens} SCOP: c.37.1.8 PDB: 2a78_A* Back     alignment and structure
>2gza_A Type IV secretion system protein VIRB11; ATPase, hydrolase; 2.60A {Brucella suis} Back     alignment and structure
>2jeo_A Uridine-cytidine kinase 1; UCK, transferase, ATP-binding, nucleoside kinase, nucleotide-binding; 2.50A {Homo sapiens} PDB: 2uvq_A* Back     alignment and structure
>1a7j_A Phosphoribulokinase; transferase, calvin cycle; 2.50A {Rhodobacter sphaeroides} SCOP: c.37.1.6 Back     alignment and structure
>2zj8_A DNA helicase, putative SKI2-type helicase; RECA fold, ATP-binding, hydrolase, nucleotide- binding; 2.00A {Pyrococcus furiosus} PDB: 2zj5_A* 2zj2_A 2zja_A* Back     alignment and structure
>1htw_A HI0065; nucleotide-binding fold, structural genomics, structure 2 function project, S2F, unknown function; HET: ADP; 1.70A {Haemophilus influenzae} SCOP: c.37.1.18 PDB: 1fl9_A Back     alignment and structure
>1zd9_A ADP-ribosylation factor-like 10B; transport protein, GDP-binding, membrane trafficking, structural genomics, structural genomics consortium, SGC; HET: GDP; 1.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 2al7_A* 2h18_A* Back     alignment and structure
>1wb9_A DNA mismatch repair protein MUTS; DNA-binding, ATP-binding, DNA binding, DNA repair, mismatch recognition; HET: DNA ADP; 2.10A {Escherichia coli} SCOP: a.113.1.1 c.37.1.12 c.55.6.1 d.75.2.1 PDB: 1wbb_A* 1e3m_A* 1oh5_A* 1oh6_A* 1oh7_A* 1oh8_A* 1w7a_A* 2wtu_A* 1wbd_A* 1ng9_A* 3k0s_A* Back     alignment and structure
>1znw_A Guanylate kinase, GMP kinase; ATP:GMP-phosphotransferase, TR; 2.10A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1znx_A* 1zny_A* 1znz_A* 1s4q_A 1z8f_A Back     alignment and structure
>3ice_A Transcription termination factor RHO; transcription, ATPase, hexamer, helicase, RNA, RECA, OB fold ATP-binding, hydrolase; HET: MSE ADP SPD; 2.80A {Escherichia coli k-12} PDB: 1pv4_A 1pvo_A* 1xpo_A* 1xpr_A* 1xpu_A* 2ht1_A Back     alignment and structure
>3bor_A Human initiation factor 4A-II; translation initiation, DEAD BOX, structural genomics, helic binding, HOST-virus interaction, hydrolase; 1.85A {Homo sapiens} PDB: 2g9n_A* Back     alignment and structure
>1c9k_A COBU, adenosylcobinamide kinase; alpha/beta structure rossmann fold P-loop, transferase; HET: 5GP; 2.20A {Salmonella typhimurium} SCOP: c.37.1.11 PDB: 1cbu_A Back     alignment and structure
>1p5z_B DCK, deoxycytidine kinase; nucleoside kinase, P-loop, ARAC, cytarabine, transferase; HET: AR3 ADP; 1.60A {Homo sapiens} SCOP: c.37.1.1 PDB: 1p60_A* 1p61_B* 1p62_B* 2a7q_A* 2qrn_A* 2qro_A* 3exk_A* 3hp1_A* 2no7_A* 2no1_A* 2no6_A* 2no0_A* 2no9_A* 2noa_A* 2zi5_A* 2zi4_A* 2zi6_A* 2zi7_B* 2zia_A* 3kfx_A* ... Back     alignment and structure
>2oxc_A Probable ATP-dependent RNA helicase DDX20; DEAD, structural genomics, structural genomics consortium, SGC, hydrolase; HET: ADP; 1.30A {Homo sapiens} PDB: 3b7g_A* Back     alignment and structure
>2gj8_A MNME, tRNA modification GTPase TRME; G-domain dimer, alpha-beta-sandwich, hydrolase; HET: GDP; 1.70A {Escherichia coli BL21} SCOP: c.37.1.8 PDB: 2gj9_A* 2gja_A* 1rfl_A Back     alignment and structure
>1u8z_A RAS-related protein RAL-A; GNP, GTP, GMPPNP, GPPNHP, GDP, GTPase, signaling protein; HET: GDP; 1.50A {Saguinus oedipus} SCOP: c.37.1.8 PDB: 1u8y_A* 1u90_A* 1uad_A* 1zc3_A* 1zc4_A* 2kwi_A* 2ke5_A* Back     alignment and structure
>1r8s_A ADP-ribosylation factor 1; protein transport/exchange factor, protein transport-exchang complex; HET: GDP; 1.46A {Bos taurus} SCOP: c.37.1.8 PDB: 1re0_A* 1s9d_A* 1u81_A* 1r8q_A* 1rrf_A* 1rrg_A* 1hur_A* 1o3y_A* 1j2j_A* 2j59_A* 1mr3_F* 2k5u_A* 3lrp_A* 3tjz_A* 3rd1_A* 2ksq_A* 2a5d_A* 2a5f_A* 2j5x_A* 1e0s_A* ... Back     alignment and structure
>2j9r_A Thymidine kinase; TK1, DNK, lasso, transferase, ATP-binding, deoxyribonucleoside kinase, DNA synthesis, phosphate accept nucleotide-binding; HET: THM; 2.7A {Bacillus anthracis} PDB: 2ja1_A* Back     alignment and structure
>1wp9_A ATP-dependent RNA helicase, putative; ATPase, DNA replication, DNA repair, DNA recombina hydrolase; 2.90A {Pyrococcus furiosus} SCOP: c.37.1.19 c.37.1.19 Back     alignment and structure
>3fht_A ATP-dependent RNA helicase DDX19B; DBP5, DEAD-box helicase, RNA dependent ATPase, mRNA export, nucleocytoplasmic transport, NUP214, CAN; HET: ANP; 2.20A {Homo sapiens} PDB: 3ews_A* 3g0h_A* 3fhc_B Back     alignment and structure
>3p32_A Probable GTPase RV1496/MT1543; structural genomics, seattle structural genomics center for infectious disease, ssgcid, MEAB, MMAA; HET: GDP PGE; 1.90A {Mycobacterium tuberculosis} PDB: 3md0_A* 4gt1_A* 3nxs_A* 3tk1_A* Back     alignment and structure
>1z6g_A Guanylate kinase; structural genomics, SGC, structural genom consortium, transferase; HET: EPE; 2.18A {Plasmodium falciparum} Back     alignment and structure
>2bov_A RAla, RAS-related protein RAL-A; C3BOT, exoenzyme, RAla, GTPase, ribosylating toxin, GTP-binding, lipoprotein, prenylation; HET: GDP; 2.66A {Homo sapiens} Back     alignment and structure
>3tqf_A HPR(Ser) kinase; transferase, hydrolase; 2.80A {Coxiella burnetii} Back     alignment and structure
>3co5_A Putative two-component system transcriptional RES regulator; structural genomics, APC89341.1; 2.40A {Neisseria gonorrhoeae} Back     alignment and structure
>3k53_A Ferrous iron transport protein B; GTPase fold, helical bundle, G-protein, prokaryote, GTP-BIND nucleotide-binding, metal transport; 2.70A {Pyrococcus furiosus} Back     alignment and structure
>1ky3_A GTP-binding protein YPT7P; vesicular traffic, GTP hydrolysis, YPT/RAB protein, endocytosis, hydrolase, endocytosis/exocytosis complex; HET: GDP; 1.35A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 1ky2_A* Back     alignment and structure
>1odf_A YGR205W, hypothetical 33.3 kDa protein in ADE3-Ser2 intergenic region; yeast protein, ATP binding protein; 2.25A {Saccharomyces cerevisiae} SCOP: c.37.1.6 Back     alignment and structure
>3oiy_A Reverse gyrase helicase domain; topoisomerase, DNA supercoiling, archaea, isomeras; 2.35A {Thermotoga maritima} PDB: 3p4y_A 3p4x_A* Back     alignment and structure
>3h1t_A Type I site-specific restriction-modification system, R (restriction) subunit; hydrolase, restriction enzyme HSDR, ATP-binding; 2.30A {Vibrio vulnificus} Back     alignment and structure
>2ocp_A DGK, deoxyguanosine kinase; protein-nucleotide complex, transferase; HET: DTP; 2.80A {Homo sapiens} SCOP: c.37.1.1 Back     alignment and structure
>1wms_A RAB-9, RAB9, RAS-related protein RAB-9A; GTPase, protein transport; HET: GDP; 1.25A {Homo sapiens} SCOP: c.37.1.8 PDB: 1s8f_A* 1yzl_A* 2ocb_A* Back     alignment and structure
>1ewq_A DNA mismatch repair protein MUTS; multiple domains of protein, mostly mixed alpha-beta structures, one domain is entirely helical; HET: DNA; 2.20A {Thermus aquaticus} SCOP: a.113.1.1 c.37.1.12 c.55.6.1 d.75.2.1 PDB: 1nne_A* 1fw6_A* 1ewr_A* Back     alignment and structure
>1m8p_A Sulfate adenylyltransferase; rossmann fold, phosphosulfate binding, T-state; HET: PPS; 2.60A {Penicillium chrysogenum} SCOP: b.122.1.3 c.26.1.5 c.37.1.15 PDB: 1i2d_A* Back     alignment and structure
>2fwr_A DNA repair protein RAD25; DNA unwinding, XPB, DNA binding protein; HET: DNA; 2.60A {Archaeoglobus fulgidus} SCOP: c.37.1.19 c.37.1.19 PDB: 2fzl_A* Back     alignment and structure
>4edh_A DTMP kinase, thymidylate kinase; structural genomics, PSI-biology; HET: TMP ADP; 1.32A {Pseudomonas aeruginosa PAO1} PDB: 4e5u_A* 4esh_A* 4gmd_A* 3uwk_A* 3uwo_A* 3uxm_A* Back     alignment and structure
>3iby_A Ferrous iron transport protein B; G protein, G domain, iron uptake, cell inner membrane, cell GTP-binding, ION transport, membrane; 2.50A {Legionella pneumophila} Back     alignment and structure
>1s96_A Guanylate kinase, GMP kinase; E.coli, dimer, SAD, transferase; 2.00A {Escherichia coli} SCOP: c.37.1.1 PDB: 2an9_A* 2anb_A* 2anc_A 2f3r_A* 2f3t_A* Back     alignment and structure
>2j0s_A ATP-dependent RNA helicase DDX48; mRNA processing, phosphorylation, rRNA processing, mRNA splicing, mRNA transport; HET: ANP; 2.21A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 2j0q_A* 2hyi_C* 3ex7_C* 2xb2_A* 2hxy_A 2j0u_A 2j0u_B 2zu6_A Back     alignment and structure
>3pqc_A Probable GTP-binding protein ENGB; rossmann fold, GTPase, cell cycle, hydrolase; HET: GDP; 1.90A {Thermotoga maritima} PDB: 3pr1_A Back     alignment and structure
>2wjg_A FEOB, ferrous iron transport protein B homolog; membrane G-proteins, cell membrane, ION transport, transmembrane; HET: GDP; 2.20A {Methanocaldococcus jannaschii} Back     alignment and structure
>1xjc_A MOBB protein homolog; structural genomics, midwest center for structural GEN PSI, protein structure initiative, MCSG; 2.10A {Geobacillus stearothermophilus} SCOP: c.37.1.10 Back     alignment and structure
>3fe2_A Probable ATP-dependent RNA helicase DDX5; DEAD, ADP, ATP-binding, hydrolase, nucleotide- RNA-binding, methylation, mRNA processing, mRNA S nucleus; HET: ADP; 2.60A {Homo sapiens} PDB: 4a4d_A Back     alignment and structure
>2v9p_A Replication protein E1; AAA+ molecular motor, DNA replication, DNA translocation, nucleotide-binding, DNA-binding; 3.00A {Bovine papillomavirus type 1} PDB: 2gxa_A* Back     alignment and structure
>1bif_A 6-phosphofructo-2-kinase/ fructose-2,6-bisphospha; transferase (phospho), phosphatase, hydrolase (phosp glycolysis, bifunctional enzyme; HET: AGS; 2.00A {Rattus norvegicus} SCOP: c.37.1.7 c.60.1.4 PDB: 3bif_A* 2bif_A* 1k6m_A* 1c80_A* 1c7z_A* 1c81_A* 1tip_A* 1fbt_A Back     alignment and structure
>2og2_A Putative signal recognition particle receptor; nucleotide-binding, protein transport; 2.00A {Arabidopsis thaliana} Back     alignment and structure
>1fzq_A ADP-ribosylation factor-like protein 3; protein-GDP complex without magnesium, ARF family, RAS superfamily, G-domain, signaling protein; HET: MES GDP; 1.70A {Mus musculus} SCOP: c.37.1.8 PDB: 3bh7_A* 3bh6_A* Back     alignment and structure
>2v6i_A RNA helicase; membrane, hydrolase, transmembrane, RNA replication, viral replication, nucleotide-binding; 2.10A {Kokobera virus} PDB: 2v6j_A Back     alignment and structure
>3def_A T7I23.11 protein; chloroplast, TOC33, GTPase, hydrolase; HET: GDP; 1.96A {Arabidopsis thaliana} PDB: 3bb3_A* 3bb4_A* 2j3e_A* Back     alignment and structure
>3ly5_A ATP-dependent RNA helicase DDX18; alpha-beta, structural genomics, structural genomics consort ATP-binding, hydrolase, nucleotide-binding, RNA-B; 2.80A {Homo sapiens} Back     alignment and structure
>3lnc_A Guanylate kinase, GMP kinase; ALS collaborative crystallography, emerald biostructures, ATP-binding, cytoplasm, nucleotide-binding; HET: 5GP; 1.95A {Anaplasma phagocytophilum} Back     alignment and structure
>2qm8_A GTPase/ATPase; G protein, G3E, metallochaperone, chaperone; HET: MSE; 1.70A {Methylobacterium extorquens} SCOP: c.37.1.10 PDB: 2qm7_A* Back     alignment and structure
>1sq5_A Pantothenate kinase; P-loop, transferase; HET: PAU ADP; 2.20A {Escherichia coli} SCOP: c.37.1.6 PDB: 1esm_A* 1esn_A* Back     alignment and structure
>3ber_A Probable ATP-dependent RNA helicase DDX47; DEAD, AMP, structural genomics, structural GEN consortium, SGC, ATP-binding, hydrolase; HET: AMP PGE; 1.40A {Homo sapiens} Back     alignment and structure
>3dkp_A Probable ATP-dependent RNA helicase DDX52; DEAD, ADP, structural genomics, structural GEN consortium, SGC, rRNA, ATP-binding, hydrolase; HET: ADP; 2.10A {Homo sapiens} Back     alignment and structure
>1z06_A RAS-related protein RAB-33B; RAB GTPase, RAB33B GTPase, vesicular trafficking, protein transport; HET: GNP; 1.81A {Mus musculus} SCOP: c.37.1.8 PDB: 2g77_B* Back     alignment and structure
>3kta_A Chromosome segregation protein SMC; structural maintenance of chromosomes, ABC ATPase, CFTR adenylate kinase, AP5A, transferase; HET: AP5; 1.63A {Pyrococcus furiosus} PDB: 1xex_A* 1xew_X* Back     alignment and structure
>2va8_A SSO2462, SKI2-type helicase; hydrolase, DNA repair, ATP-bindin nucleotide-binding; 2.30A {Sulfolobus solfataricus} Back     alignment and structure
>3dz8_A RAS-related protein RAB-3B; GDP, GTPase, structural genomics consortium, SGC, cell GTP-binding, lipoprotein, membrane, methylation; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>2wji_A Ferrous iron transport protein B homolog; membrane G-proteins, cell membrane, ION transport, transmembrane; HET: GNP; 1.90A {Methanocaldococcus jannaschii} PDB: 2wjj_A* 2wjh_A* Back     alignment and structure
>1xti_A Probable ATP-dependent RNA helicase P47; alpha-beta fold, gene regulation; 1.95A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 1xtj_A* 1xtk_A Back     alignment and structure
>3vkw_A Replicase large subunit; alpha/beta domain, helicase, transferase; 1.90A {Tomato mosaic virus} Back     alignment and structure
>1rj9_A FTSY, signal recognition protein; SRP-GTPase domain, heterodimer, nucleotide twinning, protein complex, protein transport; HET: GCP; 1.90A {Thermus aquaticus} SCOP: a.24.13.1 c.37.1.10 PDB: 2q9c_A* 2q9b_A* 2q9a_A* 1okk_D* 2xkv_D 2iyl_D* 2cnw_D* 2j7p_D* Back     alignment and structure
>3aez_A Pantothenate kinase; transferase, homodimer, COA biosynthesis, nucleotide binding binding, cytoplasm, nucleotide-binding; HET: GDP PAZ; 2.20A {Mycobacterium tuberculosis} PDB: 2ges_A* 2geu_A* 2gev_A* 2zs7_A* 2zs8_A* 2zs9_A* 2zsa_A* 2zsb_A* 2zsd_A* 2zse_A* 2zsf_A* 2get_A* 3af0_A* 3af1_A* 3af2_A* 3af3_A* 3af4_A* 3avp_A* 3avo_A* 3avq_A* Back     alignment and structure
>3eiq_A Eukaryotic initiation factor 4A-I; PDCD4, anti-oncogene, apoptosis, cell cycle, nucleus, phosph RNA-binding, ATP-binding, helicase, hydrolase; 3.50A {Homo sapiens} Back     alignment and structure
>2gk6_A Regulator of nonsense transcripts 1; UPF1, helicase, NMD, hydrolase; HET: ADP; 2.40A {Homo sapiens} PDB: 2gjk_A* 2gk7_A 2xzo_A* 2xzp_A Back     alignment and structure
>2qgz_A Helicase loader, putative primosome component; structural genomics, PSI-2, protein structure initiative; 2.40A {Streptococcus pyogenes serotype M3} Back     alignment and structure
>2o8b_B DNA mismatch repair protein MSH6; DNA damage response, somatic hypermutat protein-DNA complex, DNA mispair, cancer; HET: DNA ADP; 2.75A {Homo sapiens} PDB: 2o8c_B* 2o8d_B* 2o8e_B* 2o8f_B* Back     alignment and structure
>3tqc_A Pantothenate kinase; biosynthesis of cofactors, prosthetic groups, carriers, TRAN; HET: ADP; 2.30A {Coxiella burnetii} Back     alignment and structure
>4i1u_A Dephospho-COA kinase; structural genomics, niaid, national institute of allergy AN infectious diseases; 2.05A {Burkholderia vietnamiensis} PDB: 4i1v_A* Back     alignment and structure
>3ec2_A DNA replication protein DNAC; helicase loader, replication initiation factor, ATP-binding, nucleotide-binding; HET: DNA ADP; 2.70A {Aquifex aeolicus} PDB: 3ecc_A* Back     alignment and structure
>3v9p_A DTMP kinase, thymidylate kinase; ssgcid, STRU genomics, seattle structural genomics center for infectious transferase; 1.90A {Burkholderia thailandensis} Back     alignment and structure
>1g8f_A Sulfate adenylyltransferase; alpha-beta protein, beta-barrel, rossmann-fold, kinase fold; 1.95A {Saccharomyces cerevisiae} SCOP: b.122.1.3 c.26.1.5 c.37.1.15 PDB: 1g8g_A* 1g8h_A* 1j70_A 1jec_A 1jed_A* 1jee_A* Back     alignment and structure
>2dyk_A GTP-binding protein; GTPase, ribosome-binding protein, structural genomics; HET: GDP; 1.96A {Thermus thermophilus} Back     alignment and structure
>3crm_A TRNA delta(2)-isopentenylpyrophosphate transferase; ATP-binding, nucleotide-binding, nucleotidyltransferase, tRNA processing; 1.90A {Pseudomonas aeruginosa} PDB: 3crq_A 3crr_A Back     alignment and structure
>1qhx_A CPT, protein (chloramphenicol phosphotransferase); kinase, antibiotic resistance, phosphorylation, mononucleoti binding fold; HET: ATP; 2.50A {Streptomyces venezuelae} SCOP: c.37.1.3 PDB: 1grr_A* 1grq_A 1qhs_A* 1qhn_A* 1qhy_A* Back     alignment and structure
>2qtf_A Protein HFLX, GTP-binding protein; beta-alpha-barrels, nucleotide-binding, nucleotide binding protein; 2.00A {Sulfolobus solfataricus P2} PDB: 2qth_A* 3kxi_A* 3kxl_A 3kxk_A Back     alignment and structure
>3trf_A Shikimate kinase, SK; amino acid biosynthesis, transferase; 2.60A {Coxiella burnetii} Back     alignment and structure
>2e87_A Hypothetical protein PH1320; GTP-binding, GTPase, OBG, bundle, GDP, complex, structural G NPPSFA; HET: GDP; 2.35A {Pyrococcus horikoshii} Back     alignment and structure
>4a2p_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.00A {Anas platyrhynchos} PDB: 4a36_A* Back     alignment and structure
>3b85_A Phosphate starvation-inducible protein; PHOH2, ATPase, PFAM: PF02562, ST genomics, PSI-2, protein structure initiative; 2.35A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>1np6_A Molybdopterin-guanine dinucleotide biosynthesis protein B; mixed alpha-beta fold, elongated beta-sheet, walker A motif, P-loop structural motif; 1.90A {Escherichia coli} SCOP: c.37.1.10 PDB: 1p9n_A Back     alignment and structure
>2f7s_A C25KG, RAS-related protein RAB-27B; G-protein, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GDP; 2.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 2iez_A* Back     alignment and structure
>2cbz_A Multidrug resistance-associated protein 1; ABC proteins, MRP1/ABCC1, nucleotide-binding domain, ATP- binding, hydrolysis, transport; HET: ATP; 1.5A {Homo sapiens} Back     alignment and structure
>3a1s_A Iron(II) transport protein B; FEOB, iron transporter, small GTPase, G protein, GDI; HET: GDP; 1.50A {Thermotoga maritima} PDB: 3a1t_A* 3a1u_A* 3a1v_A* 3a1w_A Back     alignment and structure
>3tif_A Uncharacterized ABC transporter ATP-binding prote; nucleotide-binding domain, ABC transporter ATPase; HET: ADP; 1.80A {Methanocaldococcus jannaschii dsm 2661ORGANISM_TAXID} PDB: 1l2t_A* 1f3o_A* Back     alignment and structure
>1fuu_A Yeast initiation factor 4A; IF4A, helicase, DEAD-box protein, translation; 2.50A {Saccharomyces cerevisiae} SCOP: c.37.1.19 PDB: 2vso_A* 2vsx_A* Back     alignment and structure
>1upt_A ARL1, ADP-ribosylation factor-like protein 1; hydrolase/protein-binding, complex (GTPase/golgin), golgin-245, GRIP, golgin, GTPase, G-protein; HET: GTP; 1.7A {Homo sapiens} SCOP: c.37.1.8 PDB: 1r4a_A* Back     alignment and structure
>2fh5_B SR-beta, signal recognition particle receptor beta subunit; endomembrane targeting, GTPase, GAP, longin domain, SEDL, transport protein; HET: GTP; 2.45A {Mus musculus} SCOP: c.37.1.8 PDB: 2go5_2 Back     alignment and structure
>1q0u_A Bstdead; DEAD protein, RNA binding protein; 1.85A {Geobacillus stearothermophilus} SCOP: c.37.1.19 Back     alignment and structure
>2wsm_A Hydrogenase expression/formation protein (HYPB); metal binding protein; 2.30A {Archaeoglobus fulgidus} Back     alignment and structure
>2onk_A Molybdate/tungstate ABC transporter, ATP-binding protein; membrane protein; 3.10A {Archaeoglobus fulgidus} SCOP: c.37.1.12 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 1116
d1lv7a_256 c.37.1.20 (A:) AAA domain of cell division protein 4e-56
d1ixza_247 c.37.1.20 (A:) AAA domain of cell division protein 6e-54
d1r7ra3265 c.37.1.20 (A:471-735) Membrane fusion ATPase VCP/p 5e-46
d1e32a2258 c.37.1.20 (A:201-458) Membrane fusion ATPase VCP/p 5e-37
d1w44a_321 c.37.1.11 (A:) NTPase P4 {Bacteriophage phi-12 [Ta 1e-33
d1gvnb_273 c.37.1.21 (B:) Plasmid maintenance system epsilon/ 7e-20
d1d2na_246 c.37.1.20 (A:) Hexamerization domain of N-ethylmal 2e-19
d1svma_362 c.37.1.20 (A:) Papillomavirus large T antigen heli 5e-18
d1ofha_ 309 c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId 8e-18
d1gxca_116 b.26.1.2 (A:) Chk2 kinase {Human (Homo sapiens) [T 2e-17
d1ixsb2239 c.37.1.20 (B:4-242) Holliday junction helicase Ruv 1e-13
d1in4a2238 c.37.1.20 (A:17-254) Holliday junction helicase Ru 2e-11
d1lgpa_113 b.26.1.2 (A:) Cell cycle checkpoint protein Chfr { 4e-10
d1sxja2253 c.37.1.20 (A:295-547) Replication factor C1 {Baker 3e-09
d1fnna2276 c.37.1.20 (A:1-276) CDC6, N-domain {Archaeon Pyrob 3e-08
d1dmza_158 b.26.1.2 (A:) Phosphotyrosine binding domain of Ra 4e-07
d1g41a_ 443 c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId 1e-06
d2affa198 b.26.1.2 (A:3-100) Antigen ki-67 {Human (Homo sapi 2e-06
d1lw7a2192 c.37.1.1 (A:220-411) Transcriptional regulator Nad 9e-06
d1viaa_161 c.37.1.2 (A:) Shikimate kinase (AroK) {Campylobact 2e-05
d1uhta_118 b.26.1.2 (A:) FHA domain containing protein At4G14 2e-05
d1sxje2252 c.37.1.20 (E:4-255) Replication factor C5 {Baker's 7e-05
d1g8pa_ 333 c.37.1.20 (A:) ATPase subunit of magnesium chelata 1e-04
d2ff4a399 b.26.1.2 (A:284-382) Probable regulatory protein E 1e-04
d1ny5a2247 c.37.1.20 (A:138-384) Transcriptional activator si 1e-04
d1mzka_122 b.26.1.2 (A:) Kinase associated protein phosphatas 1e-04
d1w5sa2287 c.37.1.20 (A:7-293) CDC6-like protein APE0152, N-t 2e-04
d1qf9a_194 c.37.1.1 (A:) UMP/CMP kinase {Dictyostelium discoi 2e-04
d2piea1127 b.26.1.2 (A:13-139) Ubiquitin ligase protein RNF8 3e-04
d1zp6a1176 c.37.1.25 (A:6-181) Hypothetical protein Atu3015 { 3e-04
d1g6ga_127 b.26.1.2 (A:) Phosphotyrosine binding domain of Ra 4e-04
d1r6bx2268 c.37.1.20 (X:169-436) ClpA, an Hsp100 chaperone, A 6e-04
d1kaga_169 c.37.1.2 (A:) Shikimate kinase (AroK) {Escherichia 6e-04
d1rkba_173 c.37.1.1 (A:) Adenylate kinase {Human (Homo sapien 9e-04
d3adka_194 c.37.1.1 (A:) Adenylate kinase {Pig (Sus scrofa) [ 0.001
d1qhxa_178 c.37.1.3 (A:) Chloramphenicol phosphotransferase { 0.001
d1e6ca_170 c.37.1.2 (A:) Shikimate kinase (AroK) {Erwinia chr 0.001
d2bdta1176 c.37.1.25 (A:1-176) Hypothetical protein BH3686 {B 0.002
d1ly1a_152 c.37.1.1 (A:) Polynucleotide kinase, kinase domain 0.002
d1zaka1189 c.37.1.1 (A:3-127,A:159-222) Adenylate kinase {Mai 0.003
d2fnaa2 283 c.37.1.20 (A:1-283) Archaeal ATPase SSO1545 {Sulfo 0.003
d1yj5a2172 c.37.1.1 (A:351-522) 5' polynucleotide kinase-3' p 0.004
d1um8a_ 364 c.37.1.20 (A:) ClpX {Helicobacter pylori [TaxId: 2 0.004
d1y63a_174 c.37.1.1 (A:) Probable kinase LmjF30.1890 {Leishma 0.004
>d1lv7a_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Escherichia coli [TaxId: 562]} Length = 256 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Extended AAA-ATPase domain
domain: AAA domain of cell division protein FtsH
species: Escherichia coli [TaxId: 562]
 Score =  193 bits (491), Expect = 4e-56
 Identities = 68/180 (37%), Positives = 100/180 (55%), Gaps = 8/180 (4%)

Query: 938  VIPPSDIGVTFDDIGALENVKDTLKELVMLPLQRPELFCKGQLTKPCKGILLFGPPGTGK 997
            ++    I  TF D+   +  K+ + ELV   L+ P  F K     P KG+L+ GPPGTGK
Sbjct: 1    MLTEDQIKTTFADVAGCDEAKEEVAELVEY-LREPSRFQKLGGKIP-KGVLMVGPPGTGK 58

Query: 998  TMLAKAVATEAGANFINISMSSITSKWFGEGEKYVKAVFSLASKIAPSVVFVDEVDSMLG 1057
            T+LAKA+A EA   F  IS S     + G G   V+ +F  A K AP ++F+DE+D++  
Sbjct: 59   TLLAKAIAGEAKVPFFTISGSDFVEMFVGVGASRVRDMFEQAKKAAPCIIFIDEIDAVGR 118

Query: 1058 RRENP--GEHEAMRKMKNEFMVNWDGLRTKDKERVLVLAATNRPFDLDEAVVR--RLPRR 1113
            +R     G H+   +  N+ +V  DG   +  E ++V+AATNRP  LD A++R  R  R+
Sbjct: 119  QRGAGLGGGHDEREQTLNQMLVEMDGF--EGNEGIIVIAATNRPDVLDPALLRPGRFDRQ 176


>d1ixza_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Thermus thermophilus [TaxId: 274]} Length = 247 Back     information, alignment and structure
>d1r7ra3 c.37.1.20 (A:471-735) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Length = 265 Back     information, alignment and structure
>d1e32a2 c.37.1.20 (A:201-458) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Length = 258 Back     information, alignment and structure
>d1w44a_ c.37.1.11 (A:) NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} Length = 321 Back     information, alignment and structure
>d1gvnb_ c.37.1.21 (B:) Plasmid maintenance system epsilon/zeta, toxin zeta subunit {Streptococcus pyogenes [TaxId: 1314]} Length = 273 Back     information, alignment and structure
>d1d2na_ c.37.1.20 (A:) Hexamerization domain of N-ethylmalemide-sensitive fusion (NSF) protein {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Length = 246 Back     information, alignment and structure
>d1svma_ c.37.1.20 (A:) Papillomavirus large T antigen helicase domain {Simian virus 40 [TaxId: 10633]} Length = 362 Back     information, alignment and structure
>d1ofha_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Length = 309 Back     information, alignment and structure
>d1gxca_ b.26.1.2 (A:) Chk2 kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 116 Back     information, alignment and structure
>d1ixsb2 c.37.1.20 (B:4-242) Holliday junction helicase RuvB {Thermus thermophilus [TaxId: 274]} Length = 239 Back     information, alignment and structure
>d1in4a2 c.37.1.20 (A:17-254) Holliday junction helicase RuvB {Thermotoga maritima [TaxId: 2336]} Length = 238 Back     information, alignment and structure
>d1lgpa_ b.26.1.2 (A:) Cell cycle checkpoint protein Chfr {Human (Homo sapiens) [TaxId: 9606]} Length = 113 Back     information, alignment and structure
>d1sxja2 c.37.1.20 (A:295-547) Replication factor C1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 253 Back     information, alignment and structure
>d1fnna2 c.37.1.20 (A:1-276) CDC6, N-domain {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Length = 276 Back     information, alignment and structure
>d1dmza_ b.26.1.2 (A:) Phosphotyrosine binding domain of Rad53 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 158 Back     information, alignment and structure
>d1g41a_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Length = 443 Back     information, alignment and structure
>d2affa1 b.26.1.2 (A:3-100) Antigen ki-67 {Human (Homo sapiens) [TaxId: 9606]} Length = 98 Back     information, alignment and structure
>d1lw7a2 c.37.1.1 (A:220-411) Transcriptional regulator NadR, ribosylnicotinamide kinase domain {Haemophilus influenzae [TaxId: 727]} Length = 192 Back     information, alignment and structure
>d1viaa_ c.37.1.2 (A:) Shikimate kinase (AroK) {Campylobacter jejuni [TaxId: 197]} Length = 161 Back     information, alignment and structure
>d1uhta_ b.26.1.2 (A:) FHA domain containing protein At4G14490 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 118 Back     information, alignment and structure
>d1sxje2 c.37.1.20 (E:4-255) Replication factor C5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 252 Back     information, alignment and structure
>d1g8pa_ c.37.1.20 (A:) ATPase subunit of magnesium chelatase, BchI {Rhodobacter capsulatus [TaxId: 1061]} Length = 333 Back     information, alignment and structure
>d2ff4a3 b.26.1.2 (A:284-382) Probable regulatory protein EmbR, C-terminal domain {Mycobacterium tuberculosis [TaxId: 1773]} Length = 99 Back     information, alignment and structure
>d1ny5a2 c.37.1.20 (A:138-384) Transcriptional activator sigm54 (NtrC1), C-terminal domain {Aquifex aeolicus [TaxId: 63363]} Length = 247 Back     information, alignment and structure
>d1mzka_ b.26.1.2 (A:) Kinase associated protein phosphatase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 122 Back     information, alignment and structure
>d1w5sa2 c.37.1.20 (A:7-293) CDC6-like protein APE0152, N-terminal domain {Aeropyrum pernix [TaxId: 56636]} Length = 287 Back     information, alignment and structure
>d1qf9a_ c.37.1.1 (A:) UMP/CMP kinase {Dictyostelium discoideum [TaxId: 44689]} Length = 194 Back     information, alignment and structure
>d2piea1 b.26.1.2 (A:13-139) Ubiquitin ligase protein RNF8 {Human (Homo sapiens) [TaxId: 9606]} Length = 127 Back     information, alignment and structure
>d1zp6a1 c.37.1.25 (A:6-181) Hypothetical protein Atu3015 {Agrobacterium tumefaciens [TaxId: 358]} Length = 176 Back     information, alignment and structure
>d1g6ga_ b.26.1.2 (A:) Phosphotyrosine binding domain of Rad53 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 127 Back     information, alignment and structure
>d1r6bx2 c.37.1.20 (X:169-436) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} Length = 268 Back     information, alignment and structure
>d1kaga_ c.37.1.2 (A:) Shikimate kinase (AroK) {Escherichia coli [TaxId: 562]} Length = 169 Back     information, alignment and structure
>d1rkba_ c.37.1.1 (A:) Adenylate kinase {Human (Homo sapiens), isoenzyme 6 [TaxId: 9606]} Length = 173 Back     information, alignment and structure
>d3adka_ c.37.1.1 (A:) Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} Length = 194 Back     information, alignment and structure
>d1qhxa_ c.37.1.3 (A:) Chloramphenicol phosphotransferase {Streptomyces venezuelae [TaxId: 54571]} Length = 178 Back     information, alignment and structure
>d1e6ca_ c.37.1.2 (A:) Shikimate kinase (AroK) {Erwinia chrysanthemi [TaxId: 556]} Length = 170 Back     information, alignment and structure
>d2bdta1 c.37.1.25 (A:1-176) Hypothetical protein BH3686 {Bacillus halodurans [TaxId: 86665]} Length = 176 Back     information, alignment and structure
>d1ly1a_ c.37.1.1 (A:) Polynucleotide kinase, kinase domain {Bacteriophage T4 [TaxId: 10665]} Length = 152 Back     information, alignment and structure
>d1zaka1 c.37.1.1 (A:3-127,A:159-222) Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} Length = 189 Back     information, alignment and structure
>d2fnaa2 c.37.1.20 (A:1-283) Archaeal ATPase SSO1545 {Sulfolobus solfataricus [TaxId: 2287]} Length = 283 Back     information, alignment and structure
>d1yj5a2 c.37.1.1 (A:351-522) 5' polynucleotide kinase-3' phosphatase, C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 172 Back     information, alignment and structure
>d1um8a_ c.37.1.20 (A:) ClpX {Helicobacter pylori [TaxId: 210]} Length = 364 Back     information, alignment and structure
>d1y63a_ c.37.1.1 (A:) Probable kinase LmjF30.1890 {Leishmania major [TaxId: 5664]} Length = 174 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query1116
d1lv7a_256 AAA domain of cell division protein FtsH {Escheric 99.96
d1ixza_247 AAA domain of cell division protein FtsH {Thermus 99.95
d1e32a2258 Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu 99.94
d1r7ra3265 Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu 99.93
d1gxca_116 Chk2 kinase {Human (Homo sapiens) [TaxId: 9606]} 99.85
d1d2na_246 Hexamerization domain of N-ethylmalemide-sensitive 99.85
d1w44a_321 NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} 99.84
d1lv7a_256 AAA domain of cell division protein FtsH {Escheric 99.83
d1ofha_ 309 HslU {Haemophilus influenzae [TaxId: 727]} 99.82
d1ixza_247 AAA domain of cell division protein FtsH {Thermus 99.8
d1e32a2258 Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu 99.78
d1lgpa_113 Cell cycle checkpoint protein Chfr {Human (Homo sa 99.75
d1r7ra3265 Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu 99.7
d1in4a2238 Holliday junction helicase RuvB {Thermotoga mariti 99.56
d1ixsb2239 Holliday junction helicase RuvB {Thermus thermophi 99.48
d1iqpa2231 Replication factor C {Archaeon Pyrococcus furiosus 99.36
d1g6ga_127 Phosphotyrosine binding domain of Rad53 {Baker's y 99.33
d1dmza_158 Phosphotyrosine binding domain of Rad53 {Baker's y 99.3
d1r6bx2268 ClpA, an Hsp100 chaperone, AAA+ modules {Escherich 99.28
d1sxjc2227 Replication factor C3 {Baker's yeast (Saccharomyce 99.27
d1jbka_195 ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} 99.26
d2brfa1101 Polynucleotide kinase 3'-phosphatase {Human (Homo 99.25
d1njfa_239 delta prime subunit of DNA polymerase III, N-domai 99.25
d1sxja2253 Replication factor C1 {Baker's yeast (Saccharomyce 99.22
d2piea1127 Ubiquitin ligase protein RNF8 {Human (Homo sapiens 99.21
d1r6bx3 315 ClpA, an Hsp100 chaperone, AAA+ modules {Escherich 99.19
d1sxje2252 Replication factor C5 {Baker's yeast (Saccharomyce 99.17
d2ff4a399 Probable regulatory protein EmbR, C-terminal domai 99.17
d1w44a_321 NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} 99.13
d1qvra3315 ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 99.13
d1g8pa_ 333 ATPase subunit of magnesium chelatase, BchI {Rhodo 99.12
d1sxjb2224 Replication factor C4 {Baker's yeast (Saccharomyce 99.11
d1um8a_ 364 ClpX {Helicobacter pylori [TaxId: 210]} 99.09
d1d2na_246 Hexamerization domain of N-ethylmalemide-sensitive 99.09
d1sxjd2237 Replication factor C2 {Baker's yeast (Saccharomyce 99.06
d2affa198 Antigen ki-67 {Human (Homo sapiens) [TaxId: 9606]} 99.04
d1uhta_118 FHA domain containing protein At4G14490 {Thale cre 99.04
d1qvra2 387 ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 99.0
d1g41a_ 443 HslU {Haemophilus influenzae [TaxId: 727]} 98.98
d1ofha_309 HslU {Haemophilus influenzae [TaxId: 727]} 98.96
d1mzka_122 Kinase associated protein phosphatase {Thale cress 98.94
d2g1la1102 Kinesin-like protein kif1c {Human (Homo sapiens) [ 98.9
d1a5ta2207 delta prime subunit of DNA polymerase III, N-domai 98.89
d1l8qa2213 Chromosomal replication initiation factor DnaA {Aq 98.86
d1fnna2276 CDC6, N-domain {Archaeon Pyrobaculum aerophilum [T 98.85
d1svma_362 Papillomavirus large T antigen helicase domain {Si 98.81
d1r6bx2268 ClpA, an Hsp100 chaperone, AAA+ modules {Escherich 98.74
d1w5sa2287 CDC6-like protein APE0152, N-terminal domain {Aero 98.73
d1gvnb_ 273 Plasmid maintenance system epsilon/zeta, toxin zet 98.68
d1wlna1107 Afadin {Mouse (Mus musculus) [TaxId: 10090]} 98.57
d2gnoa2198 gamma subunit of DNA polymerase III, N-domain {The 98.54
d1ny5a2247 Transcriptional activator sigm54 (NtrC1), C-termin 98.5
d1qvra2387 ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 98.47
d1in4a2238 Holliday junction helicase RuvB {Thermotoga mariti 98.1
d1jbka_195 ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} 98.01
d1ye8a1178 Hypothetical kinase-like protein Aq_1292 {Aquifex 97.98
d1sxja2253 Replication factor C1 {Baker's yeast (Saccharomyce 97.85
d2fnaa2 283 Archaeal ATPase SSO1545 {Sulfolobus solfataricus [ 97.72
d1lw7a2192 Transcriptional regulator NadR, ribosylnicotinamid 97.65
d1sxje2252 Replication factor C5 {Baker's yeast (Saccharomyce 97.62
d1kaga_169 Shikimate kinase (AroK) {Escherichia coli [TaxId: 97.59
d1njfa_239 delta prime subunit of DNA polymerase III, N-domai 97.54
d1rkba_173 Adenylate kinase {Human (Homo sapiens), isoenzyme 97.41
d1r6bx3315 ClpA, an Hsp100 chaperone, AAA+ modules {Escherich 97.32
d1viaa_161 Shikimate kinase (AroK) {Campylobacter jejuni [Tax 97.23
d1zp6a1176 Hypothetical protein Atu3015 {Agrobacterium tumefa 97.19
d1ixsb2239 Holliday junction helicase RuvB {Thermus thermophi 97.13
d1e6ca_170 Shikimate kinase (AroK) {Erwinia chrysanthemi [Tax 97.13
d1iqpa2231 Replication factor C {Archaeon Pyrococcus furiosus 97.1
d1qhxa_178 Chloramphenicol phosphotransferase {Streptomyces v 97.03
d2i3ba1189 Cancer-related NTPase, C1orf57 {Human (Homo sapien 96.98
d1tf7a2242 Circadian clock protein KaiC {Synechococcus sp. st 96.97
d2iyva1165 Shikimate kinase (AroK) {Mycobacterium tuberculosi 96.97
d2bdta1176 Hypothetical protein BH3686 {Bacillus halodurans [ 96.96
d1knqa_171 Gluconate kinase {Escherichia coli [TaxId: 562]} 96.96
d1y63a_174 Probable kinase LmjF30.1890 {Leishmania major [Tax 96.87
d1zina1182 Adenylate kinase {Bacillus stearothermophilus [Tax 96.82
d1g41a_443 HslU {Haemophilus influenzae [TaxId: 727]} 96.81
d1sxjb2224 Replication factor C4 {Baker's yeast (Saccharomyce 96.78
d1zaka1189 Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} 96.73
d1m8pa3183 ATP sulfurylase C-terminal domain {Fungus (Penicil 96.7
d1ak2a1190 Adenylate kinase {Cow (Bos taurus), mitochondrial 96.69
d2cdna1181 Adenylate kinase {Mycobacterium tuberculosis [TaxI 96.66
d1okkd2207 GTPase domain of the signal recognition particle r 96.66
d1p9ra_ 401 Extracellular secretion NTPase EpsE {Vibrio choler 96.63
d1qf9a_194 UMP/CMP kinase {Dictyostelium discoideum [TaxId: 4 96.6
d2qy9a2211 GTPase domain of the signal recognition particle r 96.6
d1a5ta2207 delta prime subunit of DNA polymerase III, N-domai 96.53
d1fnna2276 CDC6, N-domain {Archaeon Pyrobaculum aerophilum [T 96.52
d1sxjc2227 Replication factor C3 {Baker's yeast (Saccharomyce 96.52
d2ak3a1189 Adenylate kinase {Cow (Bos taurus), mitochondrial 96.51
d1s3ga1182 Adenylate kinase {Bacillus globisporus [TaxId: 145 96.48
d1akya1180 Adenylate kinase {Baker's yeast (Saccharomyces cer 96.48
d1w5sa2287 CDC6-like protein APE0152, N-terminal domain {Aero 96.47
d1qvra3315 ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 96.45
d1ckea_225 CMP kinase {Escherichia coli [TaxId: 562]} 96.45
d1ukza_196 Uridylate kinase {Baker's yeast (Saccharomyces cer 96.43
d1sxjd2237 Replication factor C2 {Baker's yeast (Saccharomyce 96.43
d1teva_194 UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606] 96.4
d2a5yb3 277 CED-4, NB-ARC domain {Caenorhabditis elegans [TaxI 96.39
d3adka_194 Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} 96.36
d1vmaa2213 GTPase domain of the signal recognition particle r 96.36
d1x6va3195 Adenosine-5'phosphosulfate kinase (APS kinase) {Hu 96.34
d1e4va1179 Adenylate kinase {Escherichia coli [TaxId: 562]} 96.33
d1xp8a1268 RecA protein, ATPase-domain {Deinococcus radiodura 96.32
d1u94a1263 RecA protein, ATPase-domain {Escherichia coli [Tax 96.28
d1a1va1136 HCV helicase domain {Human hepatitis C virus (HCV) 96.22
d1tf7a1242 Circadian clock protein KaiC {Synechococcus sp. st 96.2
d1bifa1213 6-phosphofructo-2-kinase/fructose-2,6-bisphosphata 96.2
d1q3ta_223 CMP kinase {Streptococcus pneumoniae [TaxId: 1313] 96.16
d1ly1a_152 Polynucleotide kinase, kinase domain {Bacteriophag 96.08
d1cr2a_ 277 Gene 4 protein (g4p, DNA primase), helicase domain 96.04
d1j8yf2211 GTPase domain of the signal sequence recognition p 96.02
d1yksa1140 YFV helicase domain {Yellow fever virus [TaxId: 11 95.9
d1ls1a2207 GTPase domain of the signal sequence recognition p 95.9
d1yj5a2172 5' polynucleotide kinase-3' phosphatase, C-termina 95.86
d1g6oa_323 Hexameric traffic ATPase, HP0525 {Helicobacter pyl 95.77
d1w36d1359 Exodeoxyribonuclease V alpha chain (RecD) {Escheri 95.7
d1lw7a2192 Transcriptional regulator NadR, ribosylnicotinamid 95.69
d1szpa2251 DNA repair protein Rad51, catalytic domain {Baker' 95.54
d1um8a_364 ClpX {Helicobacter pylori [TaxId: 210]} 95.54
d1gvnb_273 Plasmid maintenance system epsilon/zeta, toxin zet 95.48
d1khta_190 Adenylate kinase {Archaeon Methanococcus voltae [T 95.46
d1np6a_170 Molybdopterin-guanine dinucleotide biosynthesis pr 95.32
d1mo6a1269 RecA protein, ATPase-domain {Mycobacterium tubercu 95.21
d1nksa_194 Adenylate kinase {Archaeon Sulfolobus acidocaldari 95.02
d1m7ga_208 Adenosine-5'phosphosulfate kinase (APS kinase) {Fu 94.84
d2gnoa2198 gamma subunit of DNA polymerase III, N-domain {The 94.56
d1nlfa_ 274 Hexameric replicative helicase repA {Escherichia c 94.42
d1wb9a2234 DNA repair protein MutS, the C-terminal domain {Es 94.15
d2fh5b1207 Signal recognition particle receptor beta-subunit 94.1
d2gj8a1161 Probable tRNA modification GTPase TrmE (MnmE), G d 94.03
d1rz3a_198 Hypothetical protein rbstp0775 {Bacillus stearothe 94.0
d1lvga_190 Guanylate kinase {Mouse (Mus musculus) [TaxId: 100 93.62
d1zd9a1164 ADP-ribosylation factor {Human (Homo sapiens), ARL 93.57
d1gkya_186 Guanylate kinase {Baker's yeast (Saccharomyces cer 93.38
d1wf3a1178 GTPase Era, N-terminal domain {Thermus thermophilu 93.34
d1n0wa_242 DNA repair protein Rad51, catalytic domain {Human 93.09
d1l8qa2213 Chromosomal replication initiation factor DnaA {Aq 92.87
d1svma_362 Papillomavirus large T antigen helicase domain {Si 92.84
d1u0ja_267 Rep 40 protein helicase domain {Adeno-associated v 92.82
d1r8sa_160 ADP-ribosylation factor {Human (Homo sapiens), ARF 92.82
d1nrjb_209 Signal recognition particle receptor beta-subunit 92.76
d1kaga_169 Shikimate kinase (AroK) {Escherichia coli [TaxId: 92.56
d1rkba_173 Adenylate kinase {Human (Homo sapiens), isoenzyme 92.45
d1v5wa_258 Meiotic recombination protein DMC1/LIM15 homolog { 92.18
d1ewqa2224 DNA repair protein MutS, the C-terminal domain {Th 92.05
d1ksha_165 ADP-ribosylation factor {Mouse (Mus musculus), ARL 92.03
d1u8za_168 Ras-related protein RalA {Cotton-top tamarin (Sagu 92.03
d2fz4a1206 DNA repair protein RAD25 {Archaeoglobus fulgidus [ 91.99
d2p6ra3202 Hel308 helicase {Archaeoglobus fulgidus [TaxId: 22 91.73
d1tuea_205 Replication protein E1 helicase domain {Human papi 91.6
d1qhxa_178 Chloramphenicol phosphotransferase {Streptomyces v 91.57
d1uj2a_213 Uridine-cytidine kinase 2 {Human (Homo sapiens) [T 91.56
d1pzna2254 DNA repair protein Rad51, catalytic domain {Archae 91.52
d1xjca_165 Molybdopterin-guanine dinucleotide biosynthesis pr 91.47
d1znwa1182 Guanylate kinase {Mycobacterium tuberculosis [TaxI 91.44
d1zp6a1176 Hypothetical protein Atu3015 {Agrobacterium tumefa 91.32
d1ctqa_166 cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9 91.31
d1htwa_158 Hypothetical protein HI0065 {Haemophilus influenza 91.26
d1wp9a1200 putative ATP-dependent RNA helicase PF2015 {Pyroco 91.06
d1e0sa_173 ADP-ribosylation factor {Human (Homo sapiens), ARF 91.04
d1gkub1237 Helicase-like "domain" of reverse gyrase {Archaeon 91.03
d1zj6a1177 ADP-ribosylation factor {Human (Homo sapiens), ARL 90.98
d1kkma_176 HPr kinase HprK C-terminal domain {Lactobacillus c 90.85
d1mkya1171 Probable GTPase Der, N-terminal and middle domains 90.39
d1h65a_257 Chloroplast protein translocon GTPase Toc34 {Garde 90.24
d1ye8a1178 Hypothetical kinase-like protein Aq_1292 {Aquifex 90.18
d1fzqa_176 ADP-ribosylation factor {Mouse (Mus musculus), ARL 90.07
d2a5ja1173 Rab2b {Human (Homo sapiens) [TaxId: 9606]} 89.96
d1wmsa_174 Rab9a {Human (Homo sapiens) [TaxId: 9606]} 89.89
d1kaoa_167 Rap2a {Human (Homo sapiens) [TaxId: 9606]} 89.82
d1uf9a_191 Dephospho-CoA kinase {Thermus thermophilus [TaxId: 89.54
d1viaa_161 Shikimate kinase (AroK) {Campylobacter jejuni [Tax 89.41
d2iyva1165 Shikimate kinase (AroK) {Mycobacterium tuberculosi 89.34
d2i1qa2258 DNA repair protein Rad51, catalytic domain {Archae 89.25
d1ko7a2169 HPr kinase HprK C-terminal domain {Staphylococcus 89.07
d1knxa2177 HPr kinase HprK C-terminal domain {Mycoplasma pneu 88.74
d1kgda_178 Guanylate kinase-like domain of Cask {Human (Homo 88.55
d1moza_182 ADP-ribosylation factor {Baker's yeast (Saccharomy 88.33
d1azta2221 Transducin (alpha subunit) {Cow (Bos taurus) [TaxI 88.26
d1uaaa1 306 DEXX box DNA helicase {Escherichia coli, RepD [Tax 88.25
d1gsia_208 Thymidylate kinase {Mycobacterium tuberculosis [Ta 88.21
d1yrba1 244 ATP(GTP)-binding protein PAB0955 {Pyrococcus abyss 88.13
d1nn5a_209 Thymidylate kinase {Human (Homo sapiens) [TaxId: 9 87.97
d2bmfa2 305 Dengue virus helicase {Dengue virus type 2 [TaxId: 87.66
d1ky3a_175 Rab-related protein ypt7p {Baker's yeast (Saccharo 87.49
d1z06a1165 Rab-33b {Mouse (Mus musculus) [TaxId: 10090]} 87.45
d1r2qa_170 Rab5a {Human (Homo sapiens) [TaxId: 9606]} 87.43
d2f7sa1186 Rab27b {Human (Homo sapiens) [TaxId: 9606]} 87.13
d1pjra1 318 DEXX box DNA helicase {Bacillus stearothermophilus 87.06
d1knqa_171 Gluconate kinase {Escherichia coli [TaxId: 562]} 87.0
d2vp4a1197 Deoxyribonucleoside kinase {Fruit fly (Drosophila 86.96
d1odfa_ 286 Hypothetical protein Ygr205W {Baker's yeast (Sacch 86.78
d1vhta_208 Dephospho-CoA kinase {Escherichia coli [TaxId: 562 86.61
d1f6ba_186 SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: 86.52
d1s96a_205 Guanylate kinase {Escherichia coli [TaxId: 562]} 86.44
d2erya1171 r-Ras2 {Human (Homo sapiens) [TaxId: 9606]} 86.36
d2qtvb1166 SAR1 {Baker's yeast (Saccharomyces cerevisiae) [Ta 86.36
d1jjva_205 Dephospho-CoA kinase {Haemophilus influenzae [TaxI 86.31
d2bdta1176 Hypothetical protein BH3686 {Bacillus halodurans [ 86.12
d1hv8a1208 Putative DEAD box RNA helicase {Archaeon Methanoco 86.06
d1zcba2200 Transducin (alpha subunit) {Mouse (Mus musculus) [ 85.99
d1e6ca_170 Shikimate kinase (AroK) {Erwinia chrysanthemi [Tax 85.98
d1upta_169 ADP-ribosylation factor {Human (Homo sapiens), ARL 85.91
d2p67a1 327 LAO/AO transport system kinase ArgK {Escherichia c 85.67
d1sq5a_308 Pantothenate kinase PanK {Escherichia coli [TaxId: 85.65
d2bmea1174 Rab4a {Human (Homo sapiens) [TaxId: 9606]} 85.45
d4tmka_210 Thymidylate kinase {Escherichia coli [TaxId: 562]} 85.17
d1deka_ 241 Deoxynucleoside monophosphate kinase {Bacteriophag 84.97
d2gjsa1168 Rad {Human (Homo sapiens) [TaxId: 9606]} 84.54
d1m8pa3183 ATP sulfurylase C-terminal domain {Fungus (Penicil 84.28
d1veca_206 DEAD box RNA helicase rck/p54 {Human (Homo sapiens 83.97
d1byia_224 Dethiobiotin synthetase {Escherichia coli [TaxId: 83.55
d2qm8a1 323 Metallochaperone MeaB {Methylobacterium extorquens 83.54
d2ocpa1 241 Deoxyguanosine kinase {Human (Homo sapiens) [TaxId 83.5
d1zina1182 Adenylate kinase {Bacillus stearothermophilus [Tax 83.03
d1x6va3195 Adenosine-5'phosphosulfate kinase (APS kinase) {Hu 82.92
d1e9ra_ 433 Bacterial conjugative coupling protein TrwB {Esche 82.43
d1y63a_174 Probable kinase LmjF30.1890 {Leishmania major [Tax 82.41
d1z0fa1166 Rab14 {Human (Homo sapiens) [TaxId: 9606]} 82.24
d1ihua1 296 Arsenite-translocating ATPase ArsA {Escherichia co 82.08
d1sgwa_200 Putative ABC transporter PF0895 {Pyrococcus furios 81.97
d1z2aa1164 Rab23 {Mouse (Mus musculus) [TaxId: 10090]} 81.48
d2eyqa3233 Transcription-repair coupling factor, TRCF {Escher 81.44
d1i2ma_170 Ran {Human (Homo sapiens) [TaxId: 9606]} 81.35
d1tmka_214 Thymidylate kinase {Baker's yeast (Saccharomyces c 81.18
d1xzpa2160 TrmE GTPase domain {Thermotoga maritima [TaxId: 23 81.07
d2i3ba1189 Cancer-related NTPase, C1orf57 {Human (Homo sapien 81.03
d2onka1240 Molybdate/tungstate import ATP-binding protein Wtp 80.87
d3raba_169 Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} 80.85
d1a7ja_ 288 Phosphoribulokinase {Rhodobacter sphaeroides [TaxI 80.49
d2awna2232 Maltose transport protein MalK, N-terminal domain 80.48
d1p5zb_ 241 Deoxycytidine kinase {Human (Homo sapiens) [TaxId: 80.36
d1g2912240 Maltose transport protein MalK, N-terminal domain 80.06
d1zaka1189 Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} 80.03
>d1lv7a_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Extended AAA-ATPase domain
domain: AAA domain of cell division protein FtsH
species: Escherichia coli [TaxId: 562]
Probab=99.96  E-value=3.8e-29  Score=270.32  Aligned_cols=172  Identities=40%  Similarity=0.610  Sum_probs=149.8

Q ss_pred             CCCCCCCcccccCcHHHHHHHHHHHHccccChhhhhcCCCCCCCeEEEEECCCCCchHHHHHHHHHHhCCeeeEEecccc
Q 001244          941 PSDIGVTFDDIGALENVKDTLKELVMLPLQRPELFCKGQLTKPCKGILLFGPPGTGKTMLAKAVATEAGANFINISMSSI 1020 (1116)
Q Consensus       941 ~~e~~vtfddIgGldevk~~L~e~V~lpl~~pelf~~~~l~~p~~gILL~GPPGTGKT~LArAIA~elg~pfI~Is~seL 1020 (1116)
                      .+++.+||+|++|+++++++|.+.+.+ +.+++.|.+.+. ++++++|||||||||||++|++||++++.+++.++++++
T Consensus         4 ~~~~~~t~~Di~Gl~~~k~~l~e~v~~-~~~~~~~~~~g~-~~~~~iLL~GppGtGKT~la~~iA~~~~~~~~~i~~~~l   81 (256)
T d1lv7a_           4 EDQIKTTFADVAGCDEAKEEVAELVEY-LREPSRFQKLGG-KIPKGVLMVGPPGTGKTLLAKAIAGEAKVPFFTISGSDF   81 (256)
T ss_dssp             ECSSCCCGGGSCSCHHHHHHTHHHHHH-HHCGGGC------CCCCEEEEECCTTSCHHHHHHHHHHHHTCCEEEECSCSS
T ss_pred             CCCCCCCHHHHhchHHHHHHHHHHHHH-HHCHHHHHHcCC-CCCCeEEeeCCCCCCccHHHHHHHHHcCCCEEEEEhHHh
Confidence            456689999999999999999998875 778888887664 455899999999999999999999999999999999999


Q ss_pred             ccccccchHHHHHHHHHHHhcCCCeEEEEccccccccCCCCCc--hhHHHHHHHHHHHHHhcCCCcCCCCCEEEEEEeCC
Q 001244         1021 TSKWFGEGEKYVKAVFSLASKIAPSVVFVDEVDSMLGRRENPG--EHEAMRKMKNEFMVNWDGLRTKDKERVLVLAATNR 1098 (1116)
Q Consensus      1021 ~sk~~GesEk~Ir~lF~~A~k~sPsIIfIDEID~Llg~R~~~~--~~~~lr~IlneLL~~Ldgl~~k~~~kVLVIaTTNr 1098 (1116)
                      .++|+|++++.++++|+.|+.++||||||||||.+++.|....  ......+++++|+..++++..  +.+|+||||||+
T Consensus        82 ~~~~~g~~~~~l~~~f~~A~~~~P~il~iDeiD~l~~~r~~~~~~~~~~~~~~~~~ll~~~d~~~~--~~~v~vIatTn~  159 (256)
T d1lv7a_          82 VEMFVGVGASRVRDMFEQAKKAAPCIIFIDEIDAVGRQRGAGLGGGHDEREQTLNQMLVEMDGFEG--NEGIIVIAATNR  159 (256)
T ss_dssp             TTSCCCCCHHHHHHHHHHHHTTCSEEEEETTHHHHTCCCSTTSCCTTCHHHHHHHHHHHHHHTCCS--SSCEEEEEEESC
T ss_pred             hhcchhHHHHHHHHHHHHHHHcCCEEEEEEChhhhCccCCCCCCCCcHHHHHHHHHHHHHhhCCCC--CCCEEEEEeCCC
Confidence            9999999999999999999999999999999999987765432  234557889999999998854  567999999999


Q ss_pred             CCCCcHHHHh--hcCCeEEC
Q 001244         1099 PFDLDEAVVR--RLPRRTCV 1116 (1116)
Q Consensus      1099 p~~LD~ALlR--RF~r~I~V 1116 (1116)
                      |+.||++++|  ||+++|+|
T Consensus       160 ~~~ld~al~R~gRfd~~i~i  179 (256)
T d1lv7a_         160 PDVLDPALLRPGRFDRQVVV  179 (256)
T ss_dssp             TTTSCGGGGSTTSSCEEEEC
T ss_pred             cccCCHhHcCCCCCCEEEEC
Confidence            9999999998  99999986



>d1ixza_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1e32a2 c.37.1.20 (A:201-458) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1r7ra3 c.37.1.20 (A:471-735) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1gxca_ b.26.1.2 (A:) Chk2 kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1d2na_ c.37.1.20 (A:) Hexamerization domain of N-ethylmalemide-sensitive fusion (NSF) protein {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d1w44a_ c.37.1.11 (A:) NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} Back     information, alignment and structure
>d1lv7a_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ofha_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1ixza_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1e32a2 c.37.1.20 (A:201-458) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1lgpa_ b.26.1.2 (A:) Cell cycle checkpoint protein Chfr {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1r7ra3 c.37.1.20 (A:471-735) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1in4a2 c.37.1.20 (A:17-254) Holliday junction helicase RuvB {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1ixsb2 c.37.1.20 (B:4-242) Holliday junction helicase RuvB {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1iqpa2 c.37.1.20 (A:2-232) Replication factor C {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1g6ga_ b.26.1.2 (A:) Phosphotyrosine binding domain of Rad53 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1dmza_ b.26.1.2 (A:) Phosphotyrosine binding domain of Rad53 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1r6bx2 c.37.1.20 (X:169-436) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1sxjc2 c.37.1.20 (C:12-238) Replication factor C3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1jbka_ c.37.1.20 (A:) ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2brfa1 b.26.1.2 (A:8-108) Polynucleotide kinase 3'-phosphatase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1njfa_ c.37.1.20 (A:) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1sxja2 c.37.1.20 (A:295-547) Replication factor C1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2piea1 b.26.1.2 (A:13-139) Ubiquitin ligase protein RNF8 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1r6bx3 c.37.1.20 (X:437-751) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1sxje2 c.37.1.20 (E:4-255) Replication factor C5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2ff4a3 b.26.1.2 (A:284-382) Probable regulatory protein EmbR, C-terminal domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1w44a_ c.37.1.11 (A:) NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} Back     information, alignment and structure
>d1qvra3 c.37.1.20 (A:536-850) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1g8pa_ c.37.1.20 (A:) ATPase subunit of magnesium chelatase, BchI {Rhodobacter capsulatus [TaxId: 1061]} Back     information, alignment and structure
>d1sxjb2 c.37.1.20 (B:7-230) Replication factor C4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1um8a_ c.37.1.20 (A:) ClpX {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1d2na_ c.37.1.20 (A:) Hexamerization domain of N-ethylmalemide-sensitive fusion (NSF) protein {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d1sxjd2 c.37.1.20 (D:26-262) Replication factor C2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2affa1 b.26.1.2 (A:3-100) Antigen ki-67 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uhta_ b.26.1.2 (A:) FHA domain containing protein At4G14490 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1qvra2 c.37.1.20 (A:149-535) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1g41a_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1ofha_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1mzka_ b.26.1.2 (A:) Kinase associated protein phosphatase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2g1la1 b.26.1.2 (A:498-599) Kinesin-like protein kif1c {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a5ta2 c.37.1.20 (A:1-207) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1l8qa2 c.37.1.20 (A:77-289) Chromosomal replication initiation factor DnaA {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1fnna2 c.37.1.20 (A:1-276) CDC6, N-domain {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d1svma_ c.37.1.20 (A:) Papillomavirus large T antigen helicase domain {Simian virus 40 [TaxId: 10633]} Back     information, alignment and structure
>d1r6bx2 c.37.1.20 (X:169-436) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1w5sa2 c.37.1.20 (A:7-293) CDC6-like protein APE0152, N-terminal domain {Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1gvnb_ c.37.1.21 (B:) Plasmid maintenance system epsilon/zeta, toxin zeta subunit {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1wlna1 b.26.1.2 (A:8-114) Afadin {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2gnoa2 c.37.1.20 (A:11-208) gamma subunit of DNA polymerase III, N-domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1ny5a2 c.37.1.20 (A:138-384) Transcriptional activator sigm54 (NtrC1), C-terminal domain {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1qvra2 c.37.1.20 (A:149-535) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1in4a2 c.37.1.20 (A:17-254) Holliday junction helicase RuvB {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1jbka_ c.37.1.20 (A:) ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ye8a1 c.37.1.11 (A:1-178) Hypothetical kinase-like protein Aq_1292 {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1sxja2 c.37.1.20 (A:295-547) Replication factor C1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2fnaa2 c.37.1.20 (A:1-283) Archaeal ATPase SSO1545 {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1lw7a2 c.37.1.1 (A:220-411) Transcriptional regulator NadR, ribosylnicotinamide kinase domain {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1sxje2 c.37.1.20 (E:4-255) Replication factor C5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1kaga_ c.37.1.2 (A:) Shikimate kinase (AroK) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1njfa_ c.37.1.20 (A:) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1rkba_ c.37.1.1 (A:) Adenylate kinase {Human (Homo sapiens), isoenzyme 6 [TaxId: 9606]} Back     information, alignment and structure
>d1r6bx3 c.37.1.20 (X:437-751) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1viaa_ c.37.1.2 (A:) Shikimate kinase (AroK) {Campylobacter jejuni [TaxId: 197]} Back     information, alignment and structure
>d1zp6a1 c.37.1.25 (A:6-181) Hypothetical protein Atu3015 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1ixsb2 c.37.1.20 (B:4-242) Holliday junction helicase RuvB {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1e6ca_ c.37.1.2 (A:) Shikimate kinase (AroK) {Erwinia chrysanthemi [TaxId: 556]} Back     information, alignment and structure
>d1iqpa2 c.37.1.20 (A:2-232) Replication factor C {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1qhxa_ c.37.1.3 (A:) Chloramphenicol phosphotransferase {Streptomyces venezuelae [TaxId: 54571]} Back     information, alignment and structure
>d2i3ba1 c.37.1.11 (A:1-189) Cancer-related NTPase, C1orf57 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tf7a2 c.37.1.11 (A:256-497) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} Back     information, alignment and structure
>d2iyva1 c.37.1.2 (A:2-166) Shikimate kinase (AroK) {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2bdta1 c.37.1.25 (A:1-176) Hypothetical protein BH3686 {Bacillus halodurans [TaxId: 86665]} Back     information, alignment and structure
>d1knqa_ c.37.1.17 (A:) Gluconate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1y63a_ c.37.1.1 (A:) Probable kinase LmjF30.1890 {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d1zina1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1g41a_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1sxjb2 c.37.1.20 (B:7-230) Replication factor C4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1zaka1 c.37.1.1 (A:3-127,A:159-222) Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} Back     information, alignment and structure
>d1m8pa3 c.37.1.15 (A:391-573) ATP sulfurylase C-terminal domain {Fungus (Penicillium chrysogenum) [TaxId: 5076]} Back     information, alignment and structure
>d1ak2a1 c.37.1.1 (A:14-146,A:177-233) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-2 [TaxId: 9913]} Back     information, alignment and structure
>d2cdna1 c.37.1.1 (A:1-181) Adenylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1okkd2 c.37.1.10 (D:97-303) GTPase domain of the signal recognition particle receptor FtsY {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1p9ra_ c.37.1.11 (A:) Extracellular secretion NTPase EpsE {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1qf9a_ c.37.1.1 (A:) UMP/CMP kinase {Dictyostelium discoideum [TaxId: 44689]} Back     information, alignment and structure
>d2qy9a2 c.37.1.10 (A:285-495) GTPase domain of the signal recognition particle receptor FtsY {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1a5ta2 c.37.1.20 (A:1-207) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1fnna2 c.37.1.20 (A:1-276) CDC6, N-domain {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d1sxjc2 c.37.1.20 (C:12-238) Replication factor C3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2ak3a1 c.37.1.1 (A:0-124,A:162-225) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-3 [TaxId: 9913]} Back     information, alignment and structure
>d1s3ga1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus globisporus [TaxId: 1459]} Back     information, alignment and structure
>d1akya1 c.37.1.1 (A:3-130,A:169-220) Adenylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1w5sa2 c.37.1.20 (A:7-293) CDC6-like protein APE0152, N-terminal domain {Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1qvra3 c.37.1.20 (A:536-850) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1ckea_ c.37.1.1 (A:) CMP kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ukza_ c.37.1.1 (A:) Uridylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1sxjd2 c.37.1.20 (D:26-262) Replication factor C2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1teva_ c.37.1.1 (A:) UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2a5yb3 c.37.1.20 (B:109-385) CED-4, NB-ARC domain {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d3adka_ c.37.1.1 (A:) Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1vmaa2 c.37.1.10 (A:82-294) GTPase domain of the signal recognition particle receptor FtsY {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1x6va3 c.37.1.4 (A:34-228) Adenosine-5'phosphosulfate kinase (APS kinase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1e4va1 c.37.1.1 (A:1-121,A:157-214) Adenylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xp8a1 c.37.1.11 (A:15-282) RecA protein, ATPase-domain {Deinococcus radiodurans [TaxId: 1299]} Back     information, alignment and structure
>d1u94a1 c.37.1.11 (A:6-268) RecA protein, ATPase-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1a1va1 c.37.1.14 (A:190-325) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} Back     information, alignment and structure
>d1tf7a1 c.37.1.11 (A:14-255) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} Back     information, alignment and structure
>d1bifa1 c.37.1.7 (A:37-249) 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase, kinase domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1q3ta_ c.37.1.1 (A:) CMP kinase {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d1ly1a_ c.37.1.1 (A:) Polynucleotide kinase, kinase domain {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d1cr2a_ c.37.1.11 (A:) Gene 4 protein (g4p, DNA primase), helicase domain {Bacteriophage T7 [TaxId: 10760]} Back     information, alignment and structure
>d1j8yf2 c.37.1.10 (F:87-297) GTPase domain of the signal sequence recognition protein Ffh {Archaeon Acidianus ambivalens [TaxId: 2283]} Back     information, alignment and structure
>d1yksa1 c.37.1.14 (A:185-324) YFV helicase domain {Yellow fever virus [TaxId: 11089]} Back     information, alignment and structure
>d1ls1a2 c.37.1.10 (A:89-295) GTPase domain of the signal sequence recognition protein Ffh {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1yj5a2 c.37.1.1 (A:351-522) 5' polynucleotide kinase-3' phosphatase, C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1g6oa_ c.37.1.11 (A:) Hexameric traffic ATPase, HP0525 {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1w36d1 c.37.1.19 (D:2-360) Exodeoxyribonuclease V alpha chain (RecD) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1lw7a2 c.37.1.1 (A:220-411) Transcriptional regulator NadR, ribosylnicotinamide kinase domain {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1szpa2 c.37.1.11 (A:145-395) DNA repair protein Rad51, catalytic domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1um8a_ c.37.1.20 (A:) ClpX {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1gvnb_ c.37.1.21 (B:) Plasmid maintenance system epsilon/zeta, toxin zeta subunit {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1khta_ c.37.1.1 (A:) Adenylate kinase {Archaeon Methanococcus voltae [TaxId: 2188]} Back     information, alignment and structure
>d1np6a_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1mo6a1 c.37.1.11 (A:1-269) RecA protein, ATPase-domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1nksa_ c.37.1.1 (A:) Adenylate kinase {Archaeon Sulfolobus acidocaldarius [TaxId: 2285]} Back     information, alignment and structure
>d1m7ga_ c.37.1.4 (A:) Adenosine-5'phosphosulfate kinase (APS kinase) {Fungus (Penicillium chrysogenum) [TaxId: 5076]} Back     information, alignment and structure
>d2gnoa2 c.37.1.20 (A:11-208) gamma subunit of DNA polymerase III, N-domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1nlfa_ c.37.1.11 (A:) Hexameric replicative helicase repA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1wb9a2 c.37.1.12 (A:567-800) DNA repair protein MutS, the C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2fh5b1 c.37.1.8 (B:63-269) Signal recognition particle receptor beta-subunit {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2gj8a1 c.37.1.8 (A:216-376) Probable tRNA modification GTPase TrmE (MnmE), G domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1rz3a_ c.37.1.6 (A:) Hypothetical protein rbstp0775 {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1lvga_ c.37.1.1 (A:) Guanylate kinase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1zd9a1 c.37.1.8 (A:18-181) ADP-ribosylation factor {Human (Homo sapiens), ARL8A [TaxId: 9606]} Back     information, alignment and structure
>d1gkya_ c.37.1.1 (A:) Guanylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1wf3a1 c.37.1.8 (A:3-180) GTPase Era, N-terminal domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1n0wa_ c.37.1.11 (A:) DNA repair protein Rad51, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1l8qa2 c.37.1.20 (A:77-289) Chromosomal replication initiation factor DnaA {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1svma_ c.37.1.20 (A:) Papillomavirus large T antigen helicase domain {Simian virus 40 [TaxId: 10633]} Back     information, alignment and structure
>d1u0ja_ c.37.1.20 (A:) Rep 40 protein helicase domain {Adeno-associated virus 2, AAV2 [TaxId: 10804]} Back     information, alignment and structure
>d1r8sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF1 [TaxId: 9606]} Back     information, alignment and structure
>d1nrjb_ c.37.1.8 (B:) Signal recognition particle receptor beta-subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1kaga_ c.37.1.2 (A:) Shikimate kinase (AroK) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1rkba_ c.37.1.1 (A:) Adenylate kinase {Human (Homo sapiens), isoenzyme 6 [TaxId: 9606]} Back     information, alignment and structure
>d1v5wa_ c.37.1.11 (A:) Meiotic recombination protein DMC1/LIM15 homolog {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ewqa2 c.37.1.12 (A:542-765) DNA repair protein MutS, the C-terminal domain {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1ksha_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL2 [TaxId: 10090]} Back     information, alignment and structure
>d1u8za_ c.37.1.8 (A:) Ras-related protein RalA {Cotton-top tamarin (Saguinus oedipus) [TaxId: 9490]} Back     information, alignment and structure
>d2fz4a1 c.37.1.19 (A:24-229) DNA repair protein RAD25 {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2p6ra3 c.37.1.19 (A:1-202) Hel308 helicase {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1tuea_ c.37.1.20 (A:) Replication protein E1 helicase domain {Human papillomavirus type 18 [TaxId: 333761]} Back     information, alignment and structure
>d1qhxa_ c.37.1.3 (A:) Chloramphenicol phosphotransferase {Streptomyces venezuelae [TaxId: 54571]} Back     information, alignment and structure
>d1uj2a_ c.37.1.6 (A:) Uridine-cytidine kinase 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pzna2 c.37.1.11 (A:96-349) DNA repair protein Rad51, catalytic domain {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1xjca_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1znwa1 c.37.1.1 (A:20-201) Guanylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1zp6a1 c.37.1.25 (A:6-181) Hypothetical protein Atu3015 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1ctqa_ c.37.1.8 (A:) cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1htwa_ c.37.1.18 (A:) Hypothetical protein HI0065 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1wp9a1 c.37.1.19 (A:1-200) putative ATP-dependent RNA helicase PF2015 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1e0sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF6 [TaxId: 9606]} Back     information, alignment and structure
>d1gkub1 c.37.1.16 (B:1-250) Helicase-like "domain" of reverse gyrase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1zj6a1 c.37.1.8 (A:2-178) ADP-ribosylation factor {Human (Homo sapiens), ARL5A [TaxId: 9606]} Back     information, alignment and structure
>d1kkma_ c.91.1.2 (A:) HPr kinase HprK C-terminal domain {Lactobacillus casei [TaxId: 1582]} Back     information, alignment and structure
>d1mkya1 c.37.1.8 (A:2-172) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1h65a_ c.37.1.8 (A:) Chloroplast protein translocon GTPase Toc34 {Garden pea (Pisum sativum) [TaxId: 3888]} Back     information, alignment and structure
>d1ye8a1 c.37.1.11 (A:1-178) Hypothetical kinase-like protein Aq_1292 {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1fzqa_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL3 [TaxId: 10090]} Back     information, alignment and structure
>d2a5ja1 c.37.1.8 (A:9-181) Rab2b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wmsa_ c.37.1.8 (A:) Rab9a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kaoa_ c.37.1.8 (A:) Rap2a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uf9a_ c.37.1.1 (A:) Dephospho-CoA kinase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1viaa_ c.37.1.2 (A:) Shikimate kinase (AroK) {Campylobacter jejuni [TaxId: 197]} Back     information, alignment and structure
>d2iyva1 c.37.1.2 (A:2-166) Shikimate kinase (AroK) {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2i1qa2 c.37.1.11 (A:65-322) DNA repair protein Rad51, catalytic domain {Archaeon Methanococcus voltae [TaxId: 2188]} Back     information, alignment and structure
>d1ko7a2 c.91.1.2 (A:130-298) HPr kinase HprK C-terminal domain {Staphylococcus xylosus [TaxId: 1288]} Back     information, alignment and structure
>d1knxa2 c.91.1.2 (A:133-309) HPr kinase HprK C-terminal domain {Mycoplasma pneumoniae [TaxId: 2104]} Back     information, alignment and structure
>d1kgda_ c.37.1.1 (A:) Guanylate kinase-like domain of Cask {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1moza_ c.37.1.8 (A:) ADP-ribosylation factor {Baker's yeast (Saccharomyces cerevisiae), ARL1 [TaxId: 4932]} Back     information, alignment and structure
>d1azta2 c.37.1.8 (A:35-65,A:202-391) Transducin (alpha subunit) {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1uaaa1 c.37.1.19 (A:2-307) DEXX box DNA helicase {Escherichia coli, RepD [TaxId: 562]} Back     information, alignment and structure
>d1gsia_ c.37.1.1 (A:) Thymidylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1yrba1 c.37.1.10 (A:1-244) ATP(GTP)-binding protein PAB0955 {Pyrococcus abyssi [TaxId: 29292]} Back     information, alignment and structure
>d1nn5a_ c.37.1.1 (A:) Thymidylate kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bmfa2 c.37.1.14 (A:178-482) Dengue virus helicase {Dengue virus type 2 [TaxId: 11060]} Back     information, alignment and structure
>d1ky3a_ c.37.1.8 (A:) Rab-related protein ypt7p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1z06a1 c.37.1.8 (A:32-196) Rab-33b {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1r2qa_ c.37.1.8 (A:) Rab5a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2f7sa1 c.37.1.8 (A:5-190) Rab27b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pjra1 c.37.1.19 (A:1-318) DEXX box DNA helicase {Bacillus stearothermophilus, PcrA [TaxId: 1422]} Back     information, alignment and structure
>d1knqa_ c.37.1.17 (A:) Gluconate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2vp4a1 c.37.1.1 (A:12-208) Deoxyribonucleoside kinase {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1odfa_ c.37.1.6 (A:) Hypothetical protein Ygr205W {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1vhta_ c.37.1.1 (A:) Dephospho-CoA kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1f6ba_ c.37.1.8 (A:) SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d1s96a_ c.37.1.1 (A:) Guanylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2erya1 c.37.1.8 (A:10-180) r-Ras2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2qtvb1 c.37.1.8 (B:24-189) SAR1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1jjva_ c.37.1.1 (A:) Dephospho-CoA kinase {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d2bdta1 c.37.1.25 (A:1-176) Hypothetical protein BH3686 {Bacillus halodurans [TaxId: 86665]} Back     information, alignment and structure
>d1hv8a1 c.37.1.19 (A:3-210) Putative DEAD box RNA helicase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1zcba2 c.37.1.8 (A:47-75,A:202-372) Transducin (alpha subunit) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1e6ca_ c.37.1.2 (A:) Shikimate kinase (AroK) {Erwinia chrysanthemi [TaxId: 556]} Back     information, alignment and structure
>d1upta_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARL1 [TaxId: 9606]} Back     information, alignment and structure
>d2p67a1 c.37.1.10 (A:1-327) LAO/AO transport system kinase ArgK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1sq5a_ c.37.1.6 (A:) Pantothenate kinase PanK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2bmea1 c.37.1.8 (A:6-179) Rab4a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d4tmka_ c.37.1.1 (A:) Thymidylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1deka_ c.37.1.1 (A:) Deoxynucleoside monophosphate kinase {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d2gjsa1 c.37.1.8 (A:91-258) Rad {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m8pa3 c.37.1.15 (A:391-573) ATP sulfurylase C-terminal domain {Fungus (Penicillium chrysogenum) [TaxId: 5076]} Back     information, alignment and structure
>d1veca_ c.37.1.19 (A:) DEAD box RNA helicase rck/p54 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1byia_ c.37.1.10 (A:) Dethiobiotin synthetase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2qm8a1 c.37.1.10 (A:5-327) Metallochaperone MeaB {Methylobacterium extorquens [TaxId: 408]} Back     information, alignment and structure
>d2ocpa1 c.37.1.1 (A:37-277) Deoxyguanosine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zina1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1x6va3 c.37.1.4 (A:34-228) Adenosine-5'phosphosulfate kinase (APS kinase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1e9ra_ c.37.1.11 (A:) Bacterial conjugative coupling protein TrwB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1y63a_ c.37.1.1 (A:) Probable kinase LmjF30.1890 {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d1z0fa1 c.37.1.8 (A:8-173) Rab14 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ihua1 c.37.1.10 (A:1-296) Arsenite-translocating ATPase ArsA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1sgwa_ c.37.1.12 (A:) Putative ABC transporter PF0895 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1z2aa1 c.37.1.8 (A:8-171) Rab23 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2eyqa3 c.37.1.19 (A:546-778) Transcription-repair coupling factor, TRCF {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1i2ma_ c.37.1.8 (A:) Ran {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tmka_ c.37.1.1 (A:) Thymidylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1xzpa2 c.37.1.8 (A:212-371) TrmE GTPase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2i3ba1 c.37.1.11 (A:1-189) Cancer-related NTPase, C1orf57 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2onka1 c.37.1.12 (A:1-240) Molybdate/tungstate import ATP-binding protein WtpC (ModC) {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d3raba_ c.37.1.8 (A:) Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1a7ja_ c.37.1.6 (A:) Phosphoribulokinase {Rhodobacter sphaeroides [TaxId: 1063]} Back     information, alignment and structure
>d2awna2 c.37.1.12 (A:4-235) Maltose transport protein MalK, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1p5zb_ c.37.1.1 (B:) Deoxycytidine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g2912 c.37.1.12 (1:1-240) Maltose transport protein MalK, N-terminal domain {Archaeon Thermococcus litoralis [TaxId: 2265]} Back     information, alignment and structure
>d1zaka1 c.37.1.1 (A:3-127,A:159-222) Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} Back     information, alignment and structure