Citrus Sinensis ID: 001245


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820-------830-------840-------850-------860-------870-------880-------890-------900-------910-------920-------930-------940-------950-------960-------970-------980-------990------1000------1010------1020------1030------1040------1050------1060------1070------1080------1090------1100------1110-----
MDPPPLIDFSDDVVSSATSHSYTDHQGTRIFDRYSSSLSPSSSEDDETESHPSNSTIKRLDYMMEFLERKLSSSATTTNEKKRFASSSSLPEYIGKGGDIPMFKPPVRAALHPARPPSLEVKPHPLRETQIGCFLRTIVCTEEQLWAGGENGLRVWNLKELYDESESDSVSVSKSKGEDGTAPFKESVKGVSSVMCMVGDEASGVVWSGHRDGRIMCWKMNARLLDSDDGFGEVLSWQAHRGPVLSLCISSYGDLWSGSEGGGIKIWPWEAIEKALSLKPEERHTAALIVERSYIDLRSHLSVNGFSSILTSDIKNLLSDHSRAKVWSAGFLSFALWDARTRELLKVFNIDGQIENRVDMSLLPDFAMEDEFKTKIVTSSKKDKAQSSFGFFQRSRNAIMGAADAVRRVAAKGGFGDDNRRTEALTTSIDGMIWTGGANGLLLQWDPNGNRLQDFQYLPFAVQCLCTFGSQIWVGYMNGIVQVLDLEGNLLGGWVAHSSPVIKMAVGAGYIFTLANHGGIRGWNVTSPGPLDSILCKELAGKEFLYTRMENLKILAGTWNVGQGRASQDALISWLGSAASDVGIVVVGLQEVEMGAGFLAMSAAKETVGLEGSAVGHWWLDMIGKILDDGSTFERVGSRQLAGLLIAVWVRKNLKDYVGDVDVAAVPCGFGRAIGNKGAVGLRVRVYDRIMCFVNCHFAAHLEAVNRRNADFDHVYRTMTFCRPSNLCSAAAAGASSVVQMLRSTNPLSGLTVEGVPELSEADMVIFLGDFNYRLDGITYDEARDFISQRCFDWLRERDQLRAEMEAGNVFQGMREADIKFPPTYKFEKHLAGLAGYDSGEKKRVPAWCDRILYRDSRSDLASECSLECPVASSILRYEACMDVTDSDHKPVRCIFSVDIARVDESVRRQEFGDIMTSNEKVKIILEDLCRIPETIVSTNNIIIQNQDTSILRVTNKCGKKDAFYQINCEGQSTVKDDGQASDRHPRGSFGFPRWLEVTPATGMIKPDRTAEMSVHHEDFQTLEEFVDGVPQNWWCEDTRDQEVVLVLKVRGRYSTETRNHRIRVRHCFSAKTKREDHKPNESAQIPGNVLPRSDYQRLSSSFDVVDQLRNLHSP
ccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHcccccccccccccccEEEEEccccccccccccccccccccccccccccccccccccEEEEEEEccccEEEccccccEEEEEEccccccccccccccccccccccccEEEEEEccccccEEccccccEEEEEHHHHHHHHcccccccccEEEEcccccccccccccccccccccccccccccccccccEEEEEccHHHHHHHccccccEEEEcccccccccccccccccccccccEEEEEEccccccccccccccccHHHHHHccHHHHHHHcccccccccccccEEEEEcccccEEEEEccccEEEEEcccccEEEEEEEEccEEEEEccccccEEEEccccEEEEEEccccccccccccccccEEEEEcccEEEEEccccccccccccccccccHHHHHHHHccccccccccEEEEEEEEEEccccccccHHHHHHHccccccccEEEEEEEEEEccccccccccccccccccccHHHHHHHHHHHccccccccEEEEEEEccccEEEEEEEEcccccccccccccEEccccccccccccEEEEEEEEccEEEEEEEcccccccccHHHHHHHHHHHHHHcccccccccccccccccccHHHHccccccccccccccccccccccEEEEccccccccccccHHHHHHHHHcccHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccEEEcccccccccccccccccccEEEEEcccccccccccccEEEEEEEEEEEEcHHHHHHHHHHHHHHHHHHHHHHHccccccccEEEccEEEEEEccEEEEEEEEEccccccEEEEEcccccccccccccccccccccccccccEEEEcccEEEcccccEEEEEEccccccEEEEEcccccccccccccccEEEEEEEEEcccccccccEEEEEcccccccccccccccccccccccccccccccccccccccHHccccccccc
cccccccccccccEcccccccccccccccEEEcccccccccccccccccccccccccHHHHHHHHHHHHccccccccccccccccccccccHEEcccccccEEccccccccccccccccccccccccccHHHHHHHHHHccccEEEEcccccEEEEcHHHHHccccccccccccccccHccccccccccccccEEEEEEccccEEEEEccccccEEEEEccccccccccccHHHHHHHHccccEEEEEEEccccccccccccEEEEccHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHcccccEEEEEcHHHEEHHHHHHHHHHHHHcccccEccccccccccccccHHHEEEEEEcccccccccccHcHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHEEccccEEEEcccccEEEEEccccccHHHEEcccccHEcEHcHcHHHHcccccEEEEEEEcccccccccccccHHHHEEEEccccEEEHHcccccccccccccccccHHHHHHHHHHHHHHcccccEEEEEEEEEccccccccccHHHHHccccccccEEEEEEEEEEcccHHHHHHcccccccccccHHHHHHHHHHHHHccccccEHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHcccccccccccccEEEEEEEEcccEEEEEcHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccEEccccHccccccccccccccccccHccccEEEEEccccEEcccccHHHHHHHHHHccHHHHHHHHHHHHHHHccccccccEccEEEccccEEEcccccccccccccccccccccccEEEEEcccccccccccccccccccEEEEcccccccccccccEEEEEEEEEEEEcHHHHHHHHHHHHHHHccccccccEEccccccEEccccEEccccHHHHHHHHccccccEEEEEEEcccEEEEcccccccccccccccccccEEEEccccccEccccEEEEEEEEEccccHHHHccccccccccccccccEEEEEEEEEcccEEEEEEEEEEEEccccccccccccccccccccccccccccHcccccccHHHHHHHHHcccc
mdppplidfsddvvssatshsytdhqgtrifdryssslspssseddeteshpsnstIKRLDYMMEFLERKlsssatttnekkrfasssslpeyigkggdipmfkppvraalhparppslevkphplretqigcflrTIVCTEeqlwaggenglRVWNLKElydesesdsvsvskskgedgtapfkeSVKGVSSVMCMVGDeasgvvwsghrdgrIMCWKMNArlldsddgfgEVLSWQAHRGPVLSLCISSygdlwsgsegggikiwPWEAIEKALSLKPEERHTAALIVERSYIDLRshlsvngfsSILTSDIKNLLSDHSRAKVWSAGFLSFALWDARTRELLKVFNIdgqienrvdmsllpdfamedeFKTKIVTsskkdkaqssfgffQRSRNAIMGAADAVRRVAakggfgddnrrteALTTSidgmiwtgganglllqwdpngnrlqdfqylpFAVQCLCTFGSQIWVGYMNGIVQVLDLEGnllggwvahssPVIKMAVGAGYIFTLANhggirgwnvtspgpldsilCKELAGKEFLYTRMENLKILAGtwnvgqgraSQDALISWLGSAASDVGIVVVGLQEVEMGAGFLAMSAAKETVglegsavgHWWLDMIGKIlddgstfervGSRQLAGLLIAVWVRKNLKdyvgdvdvaavpcgfgraignkgavglRVRVYDRIMCFVNCHFAAHLEAVNRRNADFDHVYRtmtfcrpsnlcsaaAAGASSVVQMLRstnplsgltvegvpelseADMVIFLGDfnyrldgitydeARDFISQRCFDWLRERDQLRAEMEAGNvfqgmreadikfpptykfekhlaglagydsgekkrvpawcdrilyrdsrsdlasecslecpvassilRYEAcmdvtdsdhkpvrciFSVDiarvdesvrrqefgdimtsNEKVKIILEDlcripetivstnniiiqnqdtsILRVTnkcgkkdafyqincegqstvkddgqasdrhprgsfgfprwlevtpatgmikpdrtaemsvhhedfQTLEEFvdgvpqnwwcedtrdQEVVLVLKVRGrystetrnhrirvrhcfsaktkredhkpnesaqipgnvlprsdyqrlsssfDVVDQLRNLHSP
mdppplidFSDDVVSSATshsytdhqgtrifDRYSSSLSpssseddeteshpsnstiKRLDYMMEFLERKLsssatttnekkrfasssslpeyiGKGGDIPMFKPPVRAALHPArppslevkphplrETQIGCFLRTIVCTEEQLWAGGENGLRVWNLKELYdesesdsvsvskskgedgtapfkesVKGVSSVMCMVGDEASGVVWSGHRDGRIMCWKMNARLLDSDDGFGEVLSWQAHRGPVLSLCISSYGDLWSGSEGGGIKIWPWEAIEKALSLKPEERHTAALIVERSYIDLRSHLSVNGFSSILTSDIKNLLSDHSRAKVWSAGFLSFALWDARTRELLKVFnidgqienrvDMSLLPDFAMEDEFKTKIvtsskkdkaqssfgffqrsrNAIMGAADAVRRVaakggfgddnrrteALTTSIDGMIWTGGANGLLLQWDPNGNRLQDFQYLPFAVQCLCTFGSQIWVGYMNGIVQVLDLEGNLLGGWVAHSSPVIKMAVGAGYIFTLANHGGIRGWNVTSPGPLDSILCKELAGKEFLYTRMENLKILAGTWNVGQGRASQDALISWLGSAASDVGIVVVGLQEVEMGAGFLAMSAAKETVGLEGSAVGHWWLDMIGKILDDGSTFERVGSRQLAGLLIAVWVRKNLKDYVGDVDVAAVPcgfgraignkgaVGLRVRVYDRIMCFVNCHFAAHLEAVNRRNADFDHVYRTMTFCRPSNLCSAAAAGASSVVQMLRSTNPLSGLTVEGVPELSEADMVIFLGDFNYRLDGITYDEARDFISQRCFDWLRERDQLRAEMEAGNVFQGMREADIKFPPTYKFEKHLAGlagydsgekkrvPAWCDRILYRdsrsdlasecSLECPVASSILRYEACMDVTDSDHKPVRCIFSvdiarvdesvrrqefgdimtsnekvKIILEDLCRIPETivstnniiiqnqdtsiLRVTNKCGKKDAFYQINCEGQSTVKDDGQASDrhprgsfgfprwlevtpATGMIKPDRTAEMSVHHEDFQTLEEFVDGVPQNWWCEDTRDQEVVLVLKVrgrystetrnhrirvrhcfsaktkredhkpnesaqipgnvlprSDYQRLSSSFDVVDQLRNLHSP
MDPPPLIDFSDDVVSSATSHSYTDHQGTRIFDRYssslspssseddeteshpsNSTIKRLDYMMEFLERKLSSSATTTNEKKRFASSSSLPEYIGKGGDIPMFKPPVRAALHPARPPSLEVKPHPLRETQIGCFLRTIVCTEEQLWAGGENGLRVWNLKELYdesesdsvsvskskgedgTAPFKESVKGVSSVMCMVGDEASGVVWSGHRDGRIMCWKMNARLLDSDDGFGEVLSWQAHRGPVLSLCISSYGDLWSGSEGGGIKIWPWEAIEKALSLKPEERHTAALIVERSYIDLRSHLSVNGFSSILTSDIKNLLSDHSRAKVWSAGFLSFALWDARTRELLKVFNIDGQIENRVDMSLLPDFAMEDEFKTKIVTSSKKDKAQSSFGFFQRSRNAIMGAADAVRRVAAKGGFGDDNRRTEALTTSIDGMIWTGGANGLLLQWDPNGNRLQDFQYLPFAVQCLCTFGSQIWVGYMNGIVQVLDLEGNLLGGWVAHSSPVIKMAVGAGYIFTLANHGGIRGWNVTSPGPLDSILCKELAGKEFLYTRMENLKILAGTWNVGQGRASQDALISWLGSAASDVGIVVVGLQEVEMGAGFLAMSAAKETVGLEGSAVGHWWLDMIGKILDDGSTFERVGSRQLAGLLIAVWVRKNLKDYVGDVDVAAVPCGFGRAIGNKGAVGLRVRVYDRIMCFVNCHFAAHLEAVNRRNADFDHVYRTMTFCRPSNLCsaaaagassVVQMLRSTNPLSGLTVEGVPELSEADMVIFLGDFNYRLDGITYDEARDFISQRCFDWLRERDQLRAEMEAGNVFQGMREADIKFPPTYKFEKHLAGLAGYDSGEKKRVPAWCDRILYRDSRSDLASECSLECPVASSILRYEACMDVTDSDHKPVRCIFSVDIARVDESVRRQEFGDIMTSNEKVKIILEDLCRIPETIVSTNNIIIQNQDTSILRVTNKCGKKDAFYQINCEGQSTVKDDGQASDRHPRGSFGFPRWLEVTPATGMIKPDRTAEMSVHHEDFQTLEEFVDGVPQNWWCEDTRDQEVVLVLKVRGRYSTETRNHRIRVRHCFSAKTKREDHKPNESAQIPGNVLPRSDYQRLSSSFDVVDQLRNLHSP
******************************************************************************************************************************RETQIGCFLRTIVCTEEQLWAGGENGLRVWNLKELY****************************VSSVMCMVGDEASGVVWSGHRDGRIMCWKMNARLLDSDDGFGEVLSWQAHRGPVLSLCISSYGDLWSGSEGGGIKIWPWEAIEKALSLKPEERHTAALIVERSYIDLRSHLSVNGFSSILTSDIKNLLSDHSRAKVWSAGFLSFALWDARTRELLKVFNIDGQIENRVDMSLLPDFAMEDEFKTKI*************GFFQRSRNAIMGAADAVRRVAAKGGFGDDNRRTEALTTSIDGMIWTGGANGLLLQWDPNGNRLQDFQYLPFAVQCLCTFGSQIWVGYMNGIVQVLDLEGNLLGGWVAHSSPVIKMAVGAGYIFTLANHGGIRGWNVTSPGPLDSILCKELAGKEFLYTRMENLKILAGTWNVGQGRASQDALISWLGSAASDVGIVVVGLQEVEMGAGFLAMSAAKETVGLEGSAVGHWWLDMIGKILDDGSTFERVGSRQLAGLLIAVWVRKNLKDYVGDVDVAAVPCGFGRAIGNKGAVGLRVRVYDRIMCFVNCHFAAHLEAVNRRNADFDHVYRTMTFCRPSNLCSAAAAGASSVVQMLRSTNPLSGLTVEGVPELSEADMVIFLGDFNYRLDGITYDEARDFISQRCFDWLRERDQLRAEMEAGNVFQGMREADIKFPPTYKFEKHLAGLAGYDSGEKKRVPAWCDRILYRDSRSDLASECSLECPVASSILRYEACMDVTDSDHKPVRCIFSVDIARVDESVRRQEFGDIMTSNEKVKIILEDLCRIPETIVSTNNIIIQNQDTSILRVTNKCGKKDAFYQINCE*******************FGFPRWLEVTPATGMIK******MSVHHEDFQTLEEFVDGVPQNWWCEDTRDQEVVLVLKVRGRYSTETRNHRIRVRHCF**********************************************
************************************************************DYMMEFLER*************************GKGGDIPMFKPPVRAALHPARPPSLEVKPHPLRETQIGCFLRTIVCTEEQLWAGGENGLRVWNLKELYD****************GTAPFKESVKGVSSVMCMVGDEASGVVWSGHRDGRIMCWKMNAR***********LSWQAHRGPVLSLCISSYGDLWSGSEGGGIKIWPWEAIEKALS***********IVERSYIDLRSHLS***FSSILTSDIKNLLSDHSRAKVWSAGFLSFALWDARTRELLKVFN*****************************************FFQRSRNAIMGAADAVRRVAAKGGFGDDNRRTEALTTSIDGMIWTGGANGLLLQWDPNGNRLQDFQYLPFAVQCLCTFGSQIWVGYMNGIVQVLDLEGNLLGGWVAHSSPVIKMAVGAGYIFTLANHGGIRGWNVTSPGPLDSILCKELAGKEFLYTRMENLKILAGTWNVGQGRASQDALISWLGSAASDVGIVVVGLQEVEMGAGFLA***AKETVGLEGSAVGHWWLDMIGKILDDGSTFERVGSRQLAGLLIAVWVRKNLKDYVGDVDVAAVPCGFGRAIGNKGAVGLRVRVYDRIMCFVNCHFAAHLEAVNRRNADFDHVYRTMT**************************P*****VEGVPELSEADMVIFLGDFNYRLDGITYDEARDFISQRCFDWLRERDQLRAEMEAGNVFQGMREADIKFPPTYKFEKHLAGLAGYDSGEKKRVPAWCDRILYRDSRSDLASECSLECPVASSILRYEACMDVTDSDHKPVRCIFSVDIARVDESVRRQEFGDIMTSNEKVKIILED*CRIPETIVSTNNIIIQNQDTSILRVTNKCGKKDAFYQINCEGQSTV**************FGFPRWLEVTPATGMIKPDRTAEMSVHHEDFQTLEEFVDGVPQN****DTRDQEVVLVLKVRGRYSTETRNHRIR***************************************************
MDPPPLIDFSDD***********DHQGTRIFDRY********************STIKRLDYMMEFLERKL*****************SLPEYIGKGGDIPMFKPPVRAALHPARPPSLEVKPHPLRETQIGCFLRTIVCTEEQLWAGGENGLRVWNLKELY********************PFKESVKGVSSVMCMVGDEASGVVWSGHRDGRIMCWKMNARLLDSDDGFGEVLSWQAHRGPVLSLCISSYGDLWSGSEGGGIKIWPWEAIEKALSLKPEERHTAALIVERSYIDLRSHLSVNGFSSILTSDIKNLLSDHSRAKVWSAGFLSFALWDARTRELLKVFNIDGQIENRVDMSLLPDFAMEDEFKTKIV*********SSFGFFQRSRNAIMGAADAVRRVAAKGGFGDDNRRTEALTTSIDGMIWTGGANGLLLQWDPNGNRLQDFQYLPFAVQCLCTFGSQIWVGYMNGIVQVLDLEGNLLGGWVAHSSPVIKMAVGAGYIFTLANHGGIRGWNVTSPGPLDSILCKELAGKEFLYTRMENLKILAGTWNVGQGRASQDALISWLGSAASDVGIVVVGLQEVEMGAGFLAMSAAKETVGLEGSAVGHWWLDMIGKILDDGSTFERVGSRQLAGLLIAVWVRKNLKDYVGDVDVAAVPCGFGRAIGNKGAVGLRVRVYDRIMCFVNCHFAAHLEAVNRRNADFDHVYRTMTFCRPSNLCSAAAAGASSVVQMLRSTNPLSGLTVEGVPELSEADMVIFLGDFNYRLDGITYDEARDFISQRCFDWLRERDQLRAEMEAGNVFQGMREADIKFPPTYKFEKHLAGLAGYDSGEKKRVPAWCDRILYRDSRSDLASECSLECPVASSILRYEACMDVTDSDHKPVRCIFSVDIARVDESVRRQEFGDIMTSNEKVKIILEDLCRIPETIVSTNNIIIQNQDTSILRVTNKCGKKDAFYQINCEGQSTV**********PRGSFGFPRWLEVTPATGMIKPDRTAEMSVHHEDFQTLEEFVDGVPQNWWCEDTRDQEVVLVLKVRGRYSTETRNHRIRVRHCFSA***********SAQIPGNVLPRSDYQRLSSSFDVVDQLRNLHSP
**PPPLIDFSDDVVS*****SYTDHQGTRIF*************************IKRLDYMMEFLERKLS**************SSSLPEYIGKGGDIPMFKPPVRAALHPARPPSLEVKPHPLRETQIGCFLRTIVCTEEQLWAGGENGLRVWNLKELYDESE*D****************KESVKGVSSVMCMVGDEASGVVWSGHRDGRIMCWKMNARLLDSDDGFGEVLSWQAHRGPVLSLCISSYGDLWSGSEGGGIKIWPWEAIEKALSLKPEERHTAALIVERSYIDLRSHLSVNGFSSILTSDIKNLLSDHSRAKVWSAGFLSFALWDARTRELLKVFNIDGQIENRVDMSLLPDFAMEDEFKTKIVTSS*******SFGFFQRSRNAIMGAADAVRRVAAKGGFGDDNRRTEALTTSIDGMIWTGGANGLLLQWDPNGNRLQDFQYLPFAVQCLCTFGSQIWVGYMNGIVQVLDLEGNLLGGWVAHSSPVIKMAVGAGYIFTLANHGGIRGWNVTSPGPLDSILCKELAGKEFLYTRMENLKILAGTWNVGQGRASQDALISWLGSAASDVGIVVVGLQEVEMGAGFLAMSAAKETVGLEGSAVGHWWLDMIGKILDDGSTFERVGSRQLAGLLIAVWVRKNLKDYVGDVDVAAVPCGFGRAIGNKGAVGLRVRVYDRIMCFVNCHFAAHLEAVNRRNADFDHVYRTMTFCRPSNLCSAAAAGASSVVQMLRSTNPL***TVEGVPELSEADMVIFLGDFNYRLDGITYDEARDFISQRCFDWLRERDQLRAEMEAGNVFQGMREADIKFPPTYKFEKHLAGLAGYDSGEKKRVPAWCDRILYRDSRSDLASECSLECPVASSILRYEACMDVTDSDHKPVRCIFSVDIARVDESVRRQEFGDIMTSNEKVKIILEDLCRIPETIVSTNNIIIQNQDTSILRVTNKCGKKDAFYQINCEGQSTVKDDGQASDRHPRGSFGFPRWLEVTPATGMIKPDRTAEMSVHHEDFQTLEEFVDGVPQNWWCEDTRDQEVVLVLKVRGRYSTETRNHRIRVRHCFSAK****************************SSFDVVDQLRNL***
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MDPPPLIDFSDDVVSSATSHSYTDHQGTRIFDRYSSSLSPSSSEDDETESHPSNSTIKRLDYMMEFLERKLSSSATTTNEKKRFASSSSLPEYIGKGGDIPMFKPPVRAALHPARPPSLEVKPHPLRETQIGCFLRTIVCTEEQLWAGGENGLRVWNLKELYDESESDSVSVSKSKGEDGTAPFKESVKGVSSVMCMVGDEASGVVWSGHRDGRIMCWKMNARLLDSDDGFGEVLSWQAHRGPVLSLCISSYGDLWSGSEGGGIKIWPWEAIEKALSLKPEERHTAALIVERSYIDLRSHLSVNGFSSILTSDIKNLLSDHSRAKVWSAGFLSFALWDARTRELLKVFNIDGQIENRVDMSLLPDFAMEDEFKTKIVTSSKKDKAQSSFGFFQRSRNAIMGAADAVRRVAAKGGFGDDNRRTEALTTSIDGMIWTGGANGLLLQWDPNGNRLQDFQYLPFAVQCLCTFGSQIWVGYMNGIVQVLDLEGNLLGGWVAHSSPVIKMAVGAGYIFTLANHGGIRGWNVTSPGPLDSILCKELAGKEFLYTRMENLKILAGTWNVGQGRASQDALISWLGSAASDVGIVVVGLQEVEMGAGFLAMSAAKETVGLEGSAVGHWWLDMIGKILDDGSTFERVGSRQLAGLLIAVWVRKNLKDYVGDVDVAAVPCGFGRAIGNKGAVGLRVRVYDRIMCFVNCHFAAHLEAVNRRNADFDHVYRTMTFCRPSNLCSAAAAGASSVVQMLRSTNPLSGLTVEGVPELSEADMVIFLGDFNYRLDGITYDEARDFISQRCFDWLRERDQLRAEMEAGNVFQGMREADIKFPPTYKFEKHLAGLAGYDSGEKKRVPAWCDRILYRDSRSDLASECSLECPVASSILRYEACMDVTDSDHKPVRCIFSVDIARVDESVRRQEFGDIMTSNEKVKIILEDLCRIPETIVSTNNIIIQNQDTSILRVTNKCGKKDAFYQINCEGQSTVKDDGQASDRHPRGSFGFPRWLEVTPATGMIKPDRTAEMSVHHEDFQTLEEFVDGVPQNWWCEDTRDQEVVLVLKVRGRYSTETRNHRIRVRHCFSAKTKREDHKPNESAQIPGNVLPRSDYQRLSSSFDVVDQLRNLHSP
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query1115 2.2.26 [Sep-21-2011]
Q84W551101 Type II inositol 1,4,5-tr yes no 0.957 0.970 0.681 0.0
O80560 1305 Type I inositol 1,4,5-tri no no 0.886 0.757 0.640 0.0
Q9SYK41136 Type I inositol 1,4,5-tri no no 0.883 0.867 0.625 0.0
Q9SKB71144 Type II inositol 1,4,5-tr no no 0.884 0.861 0.598 0.0
P32019 993 Type II inositol 1,4,5-tr no no 0.373 0.419 0.264 6e-51
Q8K337 993 Type II inositol 1,4,5-tr yes no 0.373 0.419 0.256 2e-48
D3ZGS3 902 Inositol polyphosphate 5- no no 0.365 0.451 0.274 1e-42
Q01968 901 Inositol polyphosphate 5- no no 0.376 0.466 0.266 1e-41
Q6NVF0 900 Inositol polyphosphate 5- no no 0.374 0.464 0.265 3e-41
O43426 1573 Synaptojanin-1 OS=Homo sa no no 0.304 0.215 0.270 5e-36
>sp|Q84W55|IP5P4_ARATH Type II inositol 1,4,5-trisphosphate 5-phosphatase FRA3 OS=Arabidopsis thaliana GN=FRA3 PE=1 SV=2 Back     alignment and function desciption
 Score = 1514 bits (3921), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 744/1092 (68%), Positives = 881/1092 (80%), Gaps = 24/1092 (2%)

Query: 30   IFDRYSSSLSPSSSEDDETESHPS-NSTIKRLDYMMEFLERKLSSSATTTNEKKRFASSS 88
            +F+R + S S SS +D   ES PS + + KR+DYM++FL+R+LS              S 
Sbjct: 28   LFNRSAYSSSSSSGDD---ESQPSVDDSNKRIDYMIQFLDRRLSEDGNHDGIGDG-NGSD 83

Query: 89   SLPEYIGKGGDIPMFKPPVRAALHPARPPSLEVKPHPLRETQIGCFLRTIVCTEEQLWAG 148
            SLPE++GK G+  +FK P+R+A+HP RPPSL+V+PHPLRETQIG FLRT+  TE QLW G
Sbjct: 84   SLPEFVGKCGESGIFKVPIRSAVHPNRPPSLDVRPHPLRETQIGRFLRTMTSTERQLWTG 143

Query: 149  GENG-LRVWNLKELYDESESDSVSVSKSKGEDGTAPFKESVK---GVSSVMCMVGDEASG 204
            GE+G LRVW   ELY       V       ED TAP+KES+    G ++V+CM+GDE S 
Sbjct: 144  GEDGALRVWEFSELYGSGRGLEV-------ED-TAPYKESLGNEFGSAAVVCMIGDEGSR 195

Query: 205  VVWSGHRDGRIMCWKMNARLLDSDDGFGEVLSWQAHRGPVLSLCISSYGDLWSGSEGGGI 264
            VVWSGHRDGRI CW+     L  D G  E LSWQAHRGPVLS+ IS+YGD+WSGSEGG +
Sbjct: 196  VVWSGHRDGRIRCWR-----LRGDHGIEEALSWQAHRGPVLSIAISAYGDIWSGSEGGAL 250

Query: 265  KIWPWE-AIEKALSLKPEERHTAALIVERSYIDLRSHLSVNGFSSILTSDIKNLLSDHSR 323
            K+WPW+ A+ K+LSLK EERH AAL VERSYID R+ +S NGF++ LTSD+  L+SDH+R
Sbjct: 251  KVWPWDGALGKSLSLKMEERHMAALAVERSYIDPRNMVSANGFANTLTSDVTFLVSDHTR 310

Query: 324  AKVWSAGFLSFALWDARTRELLKVFNIDGQIENRVDMSLLPDFAMEDEFKTKIVTSSKKD 383
            A+VWSA  L+FA+WDARTR+L+KVFNIDGQ+ENR + S+ PDF  E+E K K VT+SKK+
Sbjct: 311  ARVWSASPLTFAIWDARTRDLIKVFNIDGQLENRPENSVYPDFGSEEEGKMK-VTASKKE 369

Query: 384  KAQSSFGFFQRSRNAIMGAADAVRRVAAKGGFGDDNRRTEALTTSIDGMIWTGGANGLLL 443
            KAQSS GFFQRSRNAIMGAADAVRR A KGGF DD+R+TEA+  S+DGMIWTG +NG+L+
Sbjct: 370  KAQSSLGFFQRSRNAIMGAADAVRRAATKGGFCDDSRKTEAIVISVDGMIWTGSSNGILM 429

Query: 444  QWDPNGNRLQDFQYLPFAVQCLCTFGSQIWVGYMNGIVQVLDLEGNLLGGWVAHSSPVIK 503
            +WD NGN LQ+F Y    + C+ TF S++WVGY NG VQV DLEG LLGGWVAHS PVIK
Sbjct: 430  RWDGNGNCLQEFAYESSGILCMFTFCSRLWVGYSNGTVQVWDLEGKLLGGWVAHSGPVIK 489

Query: 504  MAVGAGYIFTLANHGGIRGWNVTSPGPLDSILCKELAGKEFLYTRMENLKILAGTWNVGQ 563
            MA+GAGY+FTLANHGGIRGWNVTSPGPLD++L  ELAGKEFLY+R+ENLKILAGTWNVG+
Sbjct: 490  MAIGAGYLFTLANHGGIRGWNVTSPGPLDNVLRAELAGKEFLYSRIENLKILAGTWNVGE 549

Query: 564  GRASQDALISWLGSAASDVGIVVVGLQEVEMGAGFLAMSAAKETVGLEGSAVGHWWLDMI 623
            GRAS D+L+SWLG AA+ V IVVVGLQEVEMGAG LAMSAAKETVGLEGS +G WWLDMI
Sbjct: 550  GRASTDSLVSWLGCAATGVEIVVVGLQEVEMGAGVLAMSAAKETVGLEGSPLGQWWLDMI 609

Query: 624  GKILDDGSTFERVGSRQLAGLLIAVWVRKNLKDYVGDVDVAAVPCGFGRAIGNKGAVGLR 683
            GK LD+GS+F RVGSRQLAGLLI VWVR +LK +VGDVD AAVPCGFGRAIGNKGAVG+R
Sbjct: 610  GKTLDEGSSFVRVGSRQLAGLLICVWVRHDLKPHVGDVDAAAVPCGFGRAIGNKGAVGVR 669

Query: 684  VRVYDRIMCFVNCHFAAHLEAVNRRNADFDHVYRTMTFCRPSNLCSAAAAGASSVVQMLR 743
            +R+YDR++CFVNCHFAAHLEAVNRRNADFDHVYRTMTF R S+  +A  AGAS  V M R
Sbjct: 670  LRMYDRVLCFVNCHFAAHLEAVNRRNADFDHVYRTMTFSRQSSSLNAGVAGASFGVTMPR 729

Query: 744  STNPLSGLTVEGVPELSEADMVIFLGDFNYRLDGITYDEARDFISQRCFDWLRERDQLRA 803
              N L   T+E  PELSEADMVIFLGDFNYRLD ITYDE RDFISQRCFDWLRE+DQL  
Sbjct: 730  GGNALGVNTIEARPELSEADMVIFLGDFNYRLDDITYDETRDFISQRCFDWLREKDQLHT 789

Query: 804  EMEAGNVFQGMREADIKFPPTYKFEKHLAGLAGYDSGEKKRVPAWCDRILYRDSRSDLAS 863
            EMEAGNVFQGMREA I+FPPTYKFE+H AGLAGYDSGEKKR+PAWCDRILYRD++  L +
Sbjct: 790  EMEAGNVFQGMREAIIRFPPTYKFERHQAGLAGYDSGEKKRIPAWCDRILYRDNKKHLGA 849

Query: 864  ECSLECPVASSILRYEACMDVTDSDHKPVRCIFSVDIARVDESVRRQEFGDIMTSNEKVK 923
            ECSL+CPV SSI +Y+ACM+VTDSDHKPVRC+FSV IARVDESVRRQE+G+I+ SN+K+K
Sbjct: 850  ECSLDCPVVSSISQYDACMEVTDSDHKPVRCVFSVKIARVDESVRRQEYGNIINSNKKIK 909

Query: 924  IILEDLCRIPETIVSTNNIIIQNQDTSILRVTNKCGKKDAFYQINCEGQSTVKDDGQASD 983
            ++L +L ++PETIVSTNNII+QNQD++ILR+TNK  K  AF++I CEGQS +++DGQA D
Sbjct: 910  VLLGELSKVPETIVSTNNIILQNQDSTILRITNKSEKNIAFFKIICEGQSKIEEDGQAHD 969

Query: 984  RHPRGSFGFPRWLEVTPATGMIKPDRTAEMSVHHEDFQTLEEFVDGVPQNWWCEDTRDQE 1043
               RGSFGFP+WLEV+P TG IKP++ AE+SVH EDF T+EEFVDGV QN WCEDTRD+E
Sbjct: 970  HRARGSFGFPQWLEVSPGTGTIKPNQIAEVSVHLEDFPTVEEFVDGVAQNSWCEDTRDKE 1029

Query: 1044 VVLVLKVRGRYSTETRNHRIRVRHCFSAKTKREDHKPNESAQIPGNVLPRSDYQRLSSSF 1103
            V+LVL V GR+STETR HRIRVRHC      +             N L RSDY +LS++ 
Sbjct: 1030 VILVLVVHGRFSTETRKHRIRVRHCPRGGPAKNHFNDGTKTSGQINALHRSDYHQLSNTL 1089

Query: 1104 DVVDQLRNLHSP 1115
            DVV+QL+NLHSP
Sbjct: 1090 DVVEQLKNLHSP 1101




Required for secondary wall synthesis and actin organization in fiber cells. Has phosphatase activity toward PtdIns(4,5)P2, PtdIns(3,4,5)P3 and Ins(1,4,5)P3. Has a higher substrate affinity toward PtdIns(4,5)P2.
Arabidopsis thaliana (taxid: 3702)
EC: 3EC: .EC: 1EC: .EC: 3EC: .EC: 3EC: 6
>sp|O80560|IP5PC_ARATH Type I inositol 1,4,5-trisphosphate 5-phosphatase 12 OS=Arabidopsis thaliana GN=5PTASE12 PE=1 SV=1 Back     alignment and function description
>sp|Q9SYK4|IP5PD_ARATH Type I inositol 1,4,5-trisphosphate 5-phosphatase 13 OS=Arabidopsis thaliana GN=5PTASE13 PE=1 SV=1 Back     alignment and function description
>sp|Q9SKB7|IP5PE_ARATH Type II inositol 1,4,5-trisphosphate 5-phosphatase 14 OS=Arabidopsis thaliana GN=5PTASE14 PE=1 SV=1 Back     alignment and function description
>sp|P32019|I5P2_HUMAN Type II inositol 1,4,5-trisphosphate 5-phosphatase OS=Homo sapiens GN=INPP5B PE=1 SV=4 Back     alignment and function description
>sp|Q8K337|I5P2_MOUSE Type II inositol 1,4,5-trisphosphate 5-phosphatase OS=Mus musculus GN=Inpp5b PE=1 SV=1 Back     alignment and function description
>sp|D3ZGS3|OCRL_RAT Inositol polyphosphate 5-phosphatase OCRL-1 OS=Rattus norvegicus GN=Ocrl PE=1 SV=1 Back     alignment and function description
>sp|Q01968|OCRL_HUMAN Inositol polyphosphate 5-phosphatase OCRL-1 OS=Homo sapiens GN=OCRL PE=1 SV=3 Back     alignment and function description
>sp|Q6NVF0|OCRL_MOUSE Inositol polyphosphate 5-phosphatase OCRL-1 OS=Mus musculus GN=Ocrl PE=2 SV=1 Back     alignment and function description
>sp|O43426|SYNJ1_HUMAN Synaptojanin-1 OS=Homo sapiens GN=SYNJ1 PE=1 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query1115
2960834031105 unnamed protein product [Vitis vinifera] 0.974 0.983 0.715 0.0
2555474261102 type II inositol 5-phosphatase, putative 0.944 0.955 0.704 0.0
3565748381138 PREDICTED: type II inositol-1,4,5-trisph 0.954 0.934 0.688 0.0
3565352581100 PREDICTED: type II inositol-1,4,5-trisph 0.938 0.950 0.697 0.0
2978410891103 hypothetical protein ARALYDRAFT_475657 [ 0.975 0.986 0.669 0.0
425629791101 Type II inositol-1,4,5-trisphosphate 5-p 0.957 0.970 0.681 0.0
46885961101 inositol 1,4,5-trisphosphate 5-phosphata 0.957 0.970 0.680 0.0
283936191101 unknown protein [Arabidopsis thaliana] 0.957 0.970 0.680 0.0
4494427811130 PREDICTED: type II inositol 1,4,5-trisph 0.989 0.976 0.656 0.0
2254342151131 PREDICTED: type I inositol-1,4,5-trispho 0.909 0.896 0.679 0.0
>gi|296083403|emb|CBI23358.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
 Score = 1621 bits (4198), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 798/1115 (71%), Positives = 927/1115 (83%), Gaps = 28/1115 (2%)

Query: 11   DDVVSSATSH-SYTDHQGTRIFDRYSSSLSPSSSEDD---------ETESHPSNSTIKRL 60
            DDV  S   H SY+   G+    ++      SSS+DD          + S    +  +RL
Sbjct: 9    DDVFPSLNLHPSYSSDDGSNRTPKFFDRFYDSSSDDDFCPSSSAAAPSISEGVENAGRRL 68

Query: 61   DYMMEFLERKLSSSATTTNEKKRFASSSSLPEYIGKGGDIPMFKPPVRAALHPARPPSLE 120
            DYM++FLERKLSS     +++ R     +LPE++GKGG   MFK PV  ++HP RPPSLE
Sbjct: 69   DYMIQFLERKLSSP---DHDRTR-----ALPEFVGKGGGTGMFKVPVHVSVHPGRPPSLE 120

Query: 121  VKPHPLRETQIGCFLRTIVCTEEQLWAGGENGLRVWNLKELYDESESDSVSVSKSKGEDG 180
            V+PHPLRETQIGCFLR++VCTE QLWAG E G+RVWN  +LY  S   +  V++S G++ 
Sbjct: 121  VRPHPLRETQIGCFLRSVVCTESQLWAGQECGVRVWNFSDLYG-SACGAGGVTRS-GDEE 178

Query: 181  TAPFKESVKGVSSVMCMVGDEASGVVWSGHRDGRIMCWKMNARLLDSDDGFGEVLSWQAH 240
            TAPF ESV+   + +C+V DEA+ +VWSGH+DG++  WKM+ RL D+   F E L+W AH
Sbjct: 179  TAPFCESVQ-TPAAICLVVDEANRLVWSGHKDGKVRAWKMDQRLGDAP--FTECLAWLAH 235

Query: 241  RGPVLSLCISSYGDLWSGSEGGGIKIWPWEAIEKALSLKPEERHTAALIVERSYIDLRSH 300
            R PVLSL ++SYGDLWSGSEGG IKIWPWE+IEK  SL  EERH AAL+VERS+IDLRS 
Sbjct: 236  RTPVLSLVMTSYGDLWSGSEGGVIKIWPWESIEKVFSLTMEERHMAALLVERSFIDLRSQ 295

Query: 301  LSVNGFSSILTSDIKNLLSDHSRAKVWSAGFLSFALWDARTRELLKVFNIDGQIENRVDM 360
            ++VNG  +IL SD+K ++SD+ RAKVWSAG+ SFALWDARTRELLKVFN+DGQ+ENRVD+
Sbjct: 296  VTVNGVCNILASDVKYMISDNCRAKVWSAGYQSFALWDARTRELLKVFNVDGQMENRVDI 355

Query: 361  SLLPDFAMEDEFKTKIVTSSKKDKAQSSFGFFQRSRNAIMGAADAVRRVAAKGGFGDDNR 420
            S + D A ++E+K K V+S KKDK Q+SF F QRSRNAIMGAADAVRRVAAKG FGDD+R
Sbjct: 356  SPVQDPAFDEEWKMKSVSSLKKDKLQASFSFLQRSRNAIMGAADAVRRVAAKGAFGDDSR 415

Query: 421  RTEALTTSIDGMIWTGGANGLLLQWDPNGNRLQDFQYLPFAVQCLCTFGSQIWVGYMNGI 480
            RTEAL  +IDGMIWTG  +GLL+QWD NGNRLQDF Y  FAVQC CTFGS+IWVGY++G 
Sbjct: 416  RTEALVMTIDGMIWTGCTSGLLVQWDGNGNRLQDFHYHSFAVQCFCTFGSRIWVGYVSGT 475

Query: 481  VQVLDLEGNLLGGWVAHSSPVIKMAVGAGYIFTLANHGGIRGWNVTSPGPLDSILCKELA 540
            VQVLDLEGNLLGGW+AH SPVI M  GAGY+FTLAN GGIRGWN TSPGPLDSIL  ELA
Sbjct: 476  VQVLDLEGNLLGGWIAHDSPVINMTSGAGYVFTLANDGGIRGWNTTSPGPLDSILSSELA 535

Query: 541  GKEFLYTRMENLKILAGTWNVGQGRASQDALISWLGSAASDVGIVVVGLQEVEMGAGFLA 600
            GKEFLYTR+ENLKILAGTWNVGQGRAS D+LISWLGSA+SDVGI+VVGLQEVEMGAGFLA
Sbjct: 536  GKEFLYTRLENLKILAGTWNVGQGRASHDSLISWLGSASSDVGIIVVGLQEVEMGAGFLA 595

Query: 601  MSAAKETVGLEGSAVGHWWLDMIGKILDDGSTFERVGSRQLAGLLIAVWVRKNLKDYVGD 660
            MSAAKETVGLEGS+VG WWLDMIG+ LD+GS FERVGSRQLAGLLIAVWVR N++ +VGD
Sbjct: 596  MSAAKETVGLEGSSVGQWWLDMIGRTLDEGSIFERVGSRQLAGLLIAVWVRNNIRAHVGD 655

Query: 661  VDVAAVPCGFGRAIGNKGAVGLRVRVYDRIMCFVNCHFAAHLEAVNRRNADFDHVYRTMT 720
            VD AAVPCGFGRAIGNKGAVGLR+RVY+RIMCFVNCHFAAHLEAVNRRNADFDHVYRTM 
Sbjct: 656  VDAAAVPCGFGRAIGNKGAVGLRMRVYNRIMCFVNCHFAAHLEAVNRRNADFDHVYRTMI 715

Query: 721  FCRPSNLCSAAAAGASSVVQMLRSTNPLSGLTVEGVPELSEADMVIFLGDFNYRLDGITY 780
            F RPSNL +A  AG SS VQMLRS N     +VEG PELSEADMV+FLGDFNYRLDGI+Y
Sbjct: 716  FSRPSNLFNATTAGVSSAVQMLRSAN-----SVEGTPELSEADMVVFLGDFNYRLDGISY 770

Query: 781  DEARDFISQRCFDWLRERDQLRAEMEAGNVFQGMREADIKFPPTYKFEKHLAGLAGYDSG 840
            DEARDF+SQRCFDWL+ERDQLRAEMEAGNVFQGMREA ++FPPTYKFE+H AGLAGYDSG
Sbjct: 771  DEARDFVSQRCFDWLKERDQLRAEMEAGNVFQGMREAVVRFPPTYKFERHQAGLAGYDSG 830

Query: 841  EKKRVPAWCDRILYRDSRSDLASECSLECPVASSILRYEACMDVTDSDHKPVRCIFSVDI 900
            EKKR+PAWCDRILYRDSRS   +EC+LECPV SSIL+YEACMDVTDSDHKPVRC+FSVDI
Sbjct: 831  EKKRIPAWCDRILYRDSRSAAVAECNLECPVVSSILQYEACMDVTDSDHKPVRCMFSVDI 890

Query: 901  ARVDESVRRQEFGDIMTSNEKVKIILEDLCRIPETIVSTNNIIIQNQDTSILRVTNKCGK 960
            ARVDESVRRQEFG+I+ SN+++  +LE+LC+IP+TIVSTNNII+QNQDTSILR+TNK GK
Sbjct: 891  ARVDESVRRQEFGEIIGSNKRIWHMLEELCKIPDTIVSTNNIILQNQDTSILRITNKSGK 950

Query: 961  KDAFYQINCEGQSTVKDDGQASDRHPRGSFGFPRWLEVTPATGMIKPDRTAEMSVHHEDF 1020
             +A ++I CEGQST+K+ G ASD  PRGSFGFPRWLEV PA+ +IKPD  AE++VHHE+F
Sbjct: 951  YEALFEIICEGQSTIKEGGLASDHQPRGSFGFPRWLEVNPASAIIKPDHVAEVAVHHEEF 1010

Query: 1021 QTLEEFVDGVPQNWWCEDTRDQEVVLVLKVRGRYSTETRNHRIRVRHCFSAKTKREDHKP 1080
            QTLEEFVDG+PQNWWCED+RD+EV+LV+K+RG++STETRNHRIRVR+CF+AK    D K 
Sbjct: 1011 QTLEEFVDGIPQNWWCEDSRDKEVILVVKIRGKFSTETRNHRIRVRYCFAAKKLPIDSKS 1070

Query: 1081 NESAQIPGNVLPRSDYQRLSSSFDVVDQLRNLHSP 1115
            N S Q  G VL RSD QRLS S DVV  LRN+HSP
Sbjct: 1071 NSSRQAQGTVLHRSDMQRLSGSSDVVAHLRNMHSP 1105




Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|255547426|ref|XP_002514770.1| type II inositol 5-phosphatase, putative [Ricinus communis] gi|223545821|gb|EEF47324.1| type II inositol 5-phosphatase, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|356574838|ref|XP_003555551.1| PREDICTED: type II inositol-1,4,5-trisphosphate 5-phosphatase FRA3-like [Glycine max] Back     alignment and taxonomy information
>gi|356535258|ref|XP_003536165.1| PREDICTED: type II inositol-1,4,5-trisphosphate 5-phosphatase FRA3-like [Glycine max] Back     alignment and taxonomy information
>gi|297841089|ref|XP_002888426.1| hypothetical protein ARALYDRAFT_475657 [Arabidopsis lyrata subsp. lyrata] gi|297334267|gb|EFH64685.1| hypothetical protein ARALYDRAFT_475657 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|42562979|ref|NP_176736.2| Type II inositol-1,4,5-trisphosphate 5-phosphatase FRA3 [Arabidopsis thaliana] gi|59799523|sp|Q84W55.2|IP5P4_ARATH RecName: Full=Type II inositol 1,4,5-trisphosphate 5-phosphatase FRA3; AltName: Full=Protein FRAGILE FIBER 3 gi|56405846|gb|AAV87313.1| type II inositol polyphosphate 5-phosphatase [Arabidopsis thaliana] gi|56405854|gb|AAV87317.1| type II inositol polyphosphate 5-phosphatase [Arabidopsis thaliana] gi|332196277|gb|AEE34398.1| Type II inositol-1,4,5-trisphosphate 5-phosphatase FRA3 [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|4688596|emb|CAB41466.1| inositol 1,4,5-trisphosphate 5-phosphatase [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|28393619|gb|AAO42229.1| unknown protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|449442781|ref|XP_004139159.1| PREDICTED: type II inositol 1,4,5-trisphosphate 5-phosphatase FRA3-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|225434215|ref|XP_002275762.1| PREDICTED: type I inositol-1,4,5-trisphosphate 5-phosphatase 12 [Vitis vinifera] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query1115
TAIR|locus:20341411101 FRA3 "FRAGILE FIBER3" [Arabido 0.975 0.988 0.660 0.0
TAIR|locus:20319331170 5PTASE13 "inositol-polyphospha 0.566 0.540 0.630 0.0
UNIPROTKB|J9NXN5 743 OCRL "Uncharacterized protein" 0.169 0.254 0.273 2.1e-37
UNIPROTKB|F1P2F3 895 Gga.53675 "Uncharacterized pro 0.168 0.210 0.285 4.8e-37
UNIPROTKB|F1NY08 899 Gga.53675 "Uncharacterized pro 0.168 0.209 0.285 4.9e-37
UNIPROTKB|E2QUW6 898 OCRL "Uncharacterized protein" 0.169 0.210 0.273 5.1e-37
UNIPROTKB|Q01968 901 OCRL "Inositol polyphosphate 5 0.169 0.209 0.268 7.6e-36
UNIPROTKB|K7GR29892 OCRL "Uncharacterized protein" 0.169 0.211 0.283 9e-36
UNIPROTKB|F1RTI8 900 OCRL "Uncharacterized protein" 0.169 0.21 0.283 9.4e-36
UNIPROTKB|K7GRA1 900 OCRL "Uncharacterized protein" 0.169 0.21 0.283 9.4e-36
TAIR|locus:2034141 FRA3 "FRAGILE FIBER3" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 3834 (1354.7 bits), Expect = 0., P = 0.
 Identities = 736/1115 (66%), Positives = 878/1115 (78%)

Query:     8 DFSDDVVSSATSHSYTDHQGTRIFDRYXXXXXXXXXXXXXXXXXXXNSTIKRLDYMMEFL 67
             D +DDV S   S S++    + +F+R                    + + KR+DYM++FL
Sbjct:     7 DQNDDVFSFF-SPSFSAATPSTLFNR--SAYSSSSSSGDDESQPSVDDSNKRIDYMIQFL 63

Query:    68 ERKLSSSATTTNEKKRFASSSSLPEYIGKGGDIPMFKPPVRAALHPARPPSLEVKPHPLR 127
             +R+LS              S SLPE++GK G+  +FK P+R+A+HP RPPSL+V+PHPLR
Sbjct:    64 DRRLSEDGNHDGIGDG-NGSDSLPEFVGKCGESGIFKVPIRSAVHPNRPPSLDVRPHPLR 122

Query:   128 ETQIGCFLRTIVCTEEQLWAGGENG-LRVWNLKELYXXXXXXXXXXXXXXXXXXTAPFKE 186
             ETQIG FLRT+  TE QLW GGE+G LRVW   ELY                  TAP+KE
Sbjct:   123 ETQIGRFLRTMTSTERQLWTGGEDGALRVWEFSELYGSGRGLEVED--------TAPYKE 174

Query:   187 SVK---GVSSVMCMVGDEASGVVWSGHRDGRIMCWKMNARLLDSDDGFGEVLSWQAHRGP 243
             S+    G ++V+CM+GDE S VVWSGHRDGRI CW++       D G  E LSWQAHRGP
Sbjct:   175 SLGNEFGSAAVVCMIGDEGSRVVWSGHRDGRIRCWRLRG-----DHGIEEALSWQAHRGP 229

Query:   244 VLSLCISSYGDLWSGSEGGGIKIWPWE-AIEKALSLKPEERHTAALIVERSYIDLRSHLS 302
             VLS+ IS+YGD+WSGSEGG +K+WPW+ A+ K+LSLK EERH AAL VERSYID R+ +S
Sbjct:   230 VLSIAISAYGDIWSGSEGGALKVWPWDGALGKSLSLKMEERHMAALAVERSYIDPRNMVS 289

Query:   303 VNGFSSILTSDIKNLLSDHSRAKVWSAGFLSFALWDARTRELLKVFNIDGQIENRVDMSL 362
              NGF++ LTSD+  L+SDH+RA+VWSA  L+FA+WDARTR+L+KVFNIDGQ+ENR + S+
Sbjct:   290 ANGFANTLTSDVTFLVSDHTRARVWSASPLTFAIWDARTRDLIKVFNIDGQLENRPENSV 349

Query:   363 LPDFAMEDEFKTKIVTSSKKDKAQSSFGFFQRSRNAIMGAADAVRRVAAKGGFGDDNRRT 422
              PDF  E+E K K VT+SKK+KAQSS GFFQRSRNAIMGAADAVRR A KGGF DD+R+T
Sbjct:   350 YPDFGSEEEGKMK-VTASKKEKAQSSLGFFQRSRNAIMGAADAVRRAATKGGFCDDSRKT 408

Query:   423 EALTTSIDGMIWTGGANGLLLQWDPNGNRLQDFQYLPFAVQCLCTFGSQIWVGYMNGIVQ 482
             EA+  S+DGMIWTG +NG+L++WD NGN LQ+F Y    + C+ TF S++WVGY NG VQ
Sbjct:   409 EAIVISVDGMIWTGSSNGILMRWDGNGNCLQEFAYESSGILCMFTFCSRLWVGYSNGTVQ 468

Query:   483 VLDLEGNLLGGWVAHSSPVIKMAVGAGYIFTLANHGGIRGWNVTSPGPLDSILCKELAGK 542
             V DLEG LLGGWVAHS PVIKMA+GAGY+FTLANHGGIRGWNVTSPGPLD++L  ELAGK
Sbjct:   469 VWDLEGKLLGGWVAHSGPVIKMAIGAGYLFTLANHGGIRGWNVTSPGPLDNVLRAELAGK 528

Query:   543 EFLYTRMENLKILAGTWNVGQGRASQDALISWLGSAASDVGIVVVGLQEVEMGAGFLAMS 602
             EFLY+R+ENLKILAGTWNVG+GRAS D+L+SWLG AA+ V IVVVGLQEVEMGAG LAMS
Sbjct:   529 EFLYSRIENLKILAGTWNVGEGRASTDSLVSWLGCAATGVEIVVVGLQEVEMGAGVLAMS 588

Query:   603 AAKETVGLEGSAVGHWWLDMIGKILDDGSTFERVGSRQLAGLLIAVWVRKNLKDYVGDVD 662
             AAKETVGLEGS +G WWLDMIGK LD+GS+F RVGSRQLAGLLI VWVR +LK +VGDVD
Sbjct:   589 AAKETVGLEGSPLGQWWLDMIGKTLDEGSSFVRVGSRQLAGLLICVWVRHDLKPHVGDVD 648

Query:   663 VAAVPCGFGRAIGNKGAVGLRVRVYDRIMCFVNCHFAAHLEAVNRRNADFDHVYRTMTFC 722
              AAVPCGFGRAIGNKGAVG+R+R+YDR++CFVNCHFAAHLEAVNRRNADFDHVYRTMTF 
Sbjct:   649 AAAVPCGFGRAIGNKGAVGVRLRMYDRVLCFVNCHFAAHLEAVNRRNADFDHVYRTMTFS 708

Query:   723 RPSNLCXXXXXXXXXVVQMLRSTNPLSGLTVEGVPELSEADMVIFLGDFNYRLDGITYDE 782
             R S+            V M R  N L   T+E  PELSEADMVIFLGDFNYRLD ITYDE
Sbjct:   709 RQSSSLNAGVAGASFGVTMPRGGNALGVNTIEARPELSEADMVIFLGDFNYRLDDITYDE 768

Query:   783 ARDFISQRCFDWLRERDQLRAEMEAGNVFQGMREADIKFPPTYKFEKHLAGLAGYDSGEK 842
              RDFISQRCFDWLRE+DQL  EMEAGNVFQGMREA I+FPPTYKFE+H AGLAGYDSGEK
Sbjct:   769 TRDFISQRCFDWLREKDQLHTEMEAGNVFQGMREAIIRFPPTYKFERHQAGLAGYDSGEK 828

Query:   843 KRVPAWCDRILYRDSRSDLASECSLECPVASSILRYEACMDVTDSDHKPVRCIFSVDIAR 902
             KR+PAWCDRILYRD++  L +ECSL+CPV SSI +Y+ACM+VTDSDHKPVRC+FSV IAR
Sbjct:   829 KRIPAWCDRILYRDNKKHLGAECSLDCPVVSSISQYDACMEVTDSDHKPVRCVFSVKIAR 888

Query:   903 VDESVRRQEFGDIMTSNEKVKIILEDLCRIPETIVSTNNIIIQNQDTSILRVTNKCGKKD 962
             VDESVRRQE+G+I+ SN+K+K++L +L ++PETIVSTNNII+QNQD++ILR+TNK  K  
Sbjct:   889 VDESVRRQEYGNIINSNKKIKVLLGELSKVPETIVSTNNIILQNQDSTILRITNKSEKNI 948

Query:   963 AFYQINCEGQSTVKDDGQASDRHPRGSFGFPRWLEVTPATGMIKPDRTAEMSVHHEDFQT 1022
             AF++I CEGQS +++DGQA D   RGSFGFP+WLEV+P TG IKP++ AE+SVH EDF T
Sbjct:   949 AFFKIICEGQSKIEEDGQAHDHRARGSFGFPQWLEVSPGTGTIKPNQIAEVSVHLEDFPT 1008

Query:  1023 LEEFVDGVPQNWWCEDTRDQEVVLVLKVRGRYSTETRNHRIRVRHCFSAKTKREDHKPNE 1082
             +EEFVDGV QN WCEDTRD+EV+LVL V GR+STETR HRIRVRHC      + +H  N+
Sbjct:  1009 VEEFVDGVAQNSWCEDTRDKEVILVLVVHGRFSTETRKHRIRVRHCPRGGPAK-NHF-ND 1066

Query:  1083 SAQIPG--NVLPRSDYQRLSSSFDVVDQLRNLHSP 1115
               +  G  N L RSDY +LS++ DVV+QL+NLHSP
Sbjct:  1067 GTKTSGQINALHRSDYHQLSNTLDVVEQLKNLHSP 1101




GO:0005634 "nucleus" evidence=ISM
GO:0046854 "phosphatidylinositol phosphorylation" evidence=IEA
TAIR|locus:2031933 5PTASE13 "inositol-polyphosphate 5-phosphatase 13" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|J9NXN5 OCRL "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|F1P2F3 Gga.53675 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|F1NY08 Gga.53675 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|E2QUW6 OCRL "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|Q01968 OCRL "Inositol polyphosphate 5-phosphatase OCRL-1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|K7GR29 OCRL "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|F1RTI8 OCRL "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|K7GRA1 OCRL "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q84W55IP5P4_ARATH3, ., 1, ., 3, ., 3, 60.68130.95780.9700yesno

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer3.1.30.976
3rd Layer3.1.3.560.946

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Your Input:
fgenesh2_kg.2__787__AT1G65580.1
annotation not avaliable (1103 aa)
(Arabidopsis lyrata)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query1115
cd09074299 cd09074, INPP5c, Catalytic domain of inositol poly 1e-102
smart00128306 smart00128, IPPc, Inositol polyphosphate phosphata 5e-91
cd09093292 cd09093, INPP5c_INPP5B, Catalytic inositol polypho 1e-71
cd09090291 cd09090, INPP5c_ScInp51p-like, Catalytic inositol 5e-60
cd09094300 cd09094, INPP5c_INPP5J-like, Catalytic inositol po 3e-55
COG5411460 COG5411, COG5411, Phosphatidylinositol 5-phosphate 8e-51
cd09089328 cd09089, INPP5c_Synj, Catalytic inositol polyphosp 2e-46
cd09098336 cd09098, INPP5c_Synj1, Catalytic inositol polyphos 4e-36
cd09099336 cd09099, INPP5c_Synj2, Catalytic inositol polyphos 4e-36
PLN03191621 PLN03191, PLN03191, Type I inositol-1,4,5-trisphos 2e-34
cd09095298 cd09095, INPP5c_INPP5E-like, Catalytic inositol po 6e-31
cd09101304 cd09101, INPP5c_SHIP2-INPPL1, Catalytic inositol p 4e-27
cd09091307 cd09091, INPP5c_SHIP, Catalytic inositol polyphosp 1e-23
cd09100307 cd09100, INPP5c_SHIP1-INPP5D, Catalytic inositol p 5e-21
cd09092383 cd09092, INPP5A, Type I inositol polyphosphate 5-p 3e-09
cd08372241 cd08372, EEP, Exonuclease-Endonuclease-Phosphatase 9e-04
>gnl|CDD|197308 cd09074, INPP5c, Catalytic domain of inositol polyphosphate 5-phosphatases Back     alignment and domain information
 Score =  323 bits (831), Expect = e-102
 Identities = 122/350 (34%), Positives = 164/350 (46%), Gaps = 54/350 (15%)

Query: 552 LKILAGTWNVGQGRASQDALISWLGSA-ASDVGIVVVGLQEVEMGAGFLAMSAAKETVGL 610
           +KI   TWNVG G +  + L +WL         I  VG+QEV+M             VG 
Sbjct: 1   VKIFVVTWNVGGGISPPENLENWLSPKGTEAPDIYAVGVQEVDMSVQGF--------VGN 52

Query: 611 EGSAVGHWWLDMIGKILDDGSTFERVGSRQLAGLLIAVWVRKNLKDYVGDVDVAAVPCGF 670
           + SA    W+D I + L++   +  +GS QL G+ + V+V+K     + D++V  V  G 
Sbjct: 53  DDSAKAREWVDNIQEALNEKENYVLLGSAQLVGIFLFVFVKKEHLPQIKDLEVEGVTVGT 112

Query: 671 GRA--IGNKGAVGLRVRVYDRIMCFVNCHFAAHLEAVNRRNADFDHVYRTMTFCRPSNLC 728
           G    +GNKG V +R ++ D   CFVN H AA  E V RRN D+  +   + F R     
Sbjct: 113 GGGGKLGNKGGVAIRFQINDTSFCFVNSHLAAGQEEVERRNQDYRDILSKLKFYRGDPAI 172

Query: 729 SAAAAGASSVVQMLRSTNPLSGLTVEGVPELSEADMVIFLGDFNYRLDGITYDEARDFIS 788
                                         + + D+V + GD NYR+D  T DE R  IS
Sbjct: 173 D----------------------------SIFDHDVVFWFGDLNYRIDS-TDDEVRKLIS 203

Query: 789 QRCFDWLRERDQLRAEMEAGNVFQGMREADIKFPPTYKFEKHLAGLAGYDSGEKKRVPAW 848
           Q   D L E+DQL+ + E G VF G +E  I FPPTYKF+    G   YD+ +KKR+PAW
Sbjct: 204 QGDLDDLLEKDQLKKQKEKGKVFDGFQELPITFPPTYKFDP---GTDEYDTSDKKRIPAW 260

Query: 849 CDRILYRDSRSDLASECSLECPVASSILRYEACMDVTDSDHKPVRCIFSV 898
           CDRILY+          S           Y +      SDHKPVR  F V
Sbjct: 261 CDRILYKSKAGSEIQPLS-----------YTSVPLYKTSDHKPVRATFRV 299


Inositol polyphosphate 5-phosphatases (5-phosphatases) are signal-modifying enzymes, which hydrolyze the 5-phosphate from the inositol ring of specific 5-position phosphorylated phosphoinositides (PIs) and inositol phosphates (IPs), such as PI(4,5)P2, PI(3,4,5)P3, PI(3,5)P2, I(1,4,5)P3, and I(1,3,4,5)P4. These enzymes are Mg2+-dependent, and belong to the large EEP (exonuclease/endonuclease/phosphatase) superfamily that contains functionally diverse enzymes that share a common catalytic mechanism of cleaving phosphodiester bonds. In addition to this INPP5c domain, 5-phosphatases often contain additional domains and motifs, such as the SH2 domain, the Sac-1 domain, the proline-rich domain (PRD), CAAX, RhoGAP (RhoGTPase-activating protein), and SKICH [SKIP (skeletal muscle- and kidney-enriched inositol phosphatase) carboxyl homology] domains, that are important for protein-protein interactions and/or for the subcellular localization of these enzymes. 5-phosphatases incorporate into large signaling complexes, and regulate diverse cellular processes including postsynaptic vesicular trafficking, insulin signaling, cell growth and survival, and endocytosis. Loss or gain of function of 5-phosphatases is implicated in certain human diseases. This family also contains a functionally unrelated nitric oxide transport protein, Cimex lectularius (bedbug) nitrophorin, which catalyzes a heme-assisted S-nitrosation of a proximal thiolate; the heme however binds at a site distinct from the active site of the 5-phosphatases. Length = 299

>gnl|CDD|214525 smart00128, IPPc, Inositol polyphosphate phosphatase, catalytic domain homologues Back     alignment and domain information
>gnl|CDD|197327 cd09093, INPP5c_INPP5B, Catalytic inositol polyphosphate 5-phosphatase (INPP5c) domain of Type II inositol polyphosphate 5-phosphatase I, Oculocerebrorenal syndrome of Lowe 1, and related proteins Back     alignment and domain information
>gnl|CDD|197324 cd09090, INPP5c_ScInp51p-like, Catalytic inositol polyphosphate 5-phosphatase (INPP5c) domain of Saccharomyces cerevisiae Inp51p, Inp52p, and Inp53p, and related proteins Back     alignment and domain information
>gnl|CDD|197328 cd09094, INPP5c_INPP5J-like, Catalytic inositol polyphosphate 5-phosphatase (INPP5c) domain of inositol polyphosphate 5-phosphatase J and related proteins Back     alignment and domain information
>gnl|CDD|227698 COG5411, COG5411, Phosphatidylinositol 5-phosphate phosphatase [Signal transduction mechanisms] Back     alignment and domain information
>gnl|CDD|197323 cd09089, INPP5c_Synj, Catalytic inositol polyphosphate 5-phosphatase (INPP5c) domain of synaptojanins Back     alignment and domain information
>gnl|CDD|197332 cd09098, INPP5c_Synj1, Catalytic inositol polyphosphate 5-phosphatase (INPP5c) domain of synaptojanin 1 Back     alignment and domain information
>gnl|CDD|197333 cd09099, INPP5c_Synj2, Catalytic inositol polyphosphate 5-phosphatase (INPP5c) domain of synaptojanin 2 Back     alignment and domain information
>gnl|CDD|215624 PLN03191, PLN03191, Type I inositol-1,4,5-trisphosphate 5-phosphatase 2; Provisional Back     alignment and domain information
>gnl|CDD|197329 cd09095, INPP5c_INPP5E-like, Catalytic inositol polyphosphate 5-phosphatase (INPP5c) domain of Inositol polyphosphate-5-phosphatase E and related proteins Back     alignment and domain information
>gnl|CDD|197335 cd09101, INPP5c_SHIP2-INPPL1, Catalytic inositol polyphosphate 5-phosphatase (INPP5c) domain of SH2 domain containing inositol 5-phosphatase-2 and related proteins Back     alignment and domain information
>gnl|CDD|197325 cd09091, INPP5c_SHIP, Catalytic inositol polyphosphate 5-phosphatase (INPP5c) domain of SH2 domain containing inositol polyphosphate 5-phosphatase-1 and -2, and related proteins Back     alignment and domain information
>gnl|CDD|197334 cd09100, INPP5c_SHIP1-INPP5D, Catalytic inositol polyphosphate 5-phosphatase (INPP5c) domain of SH2 domain containing inositol polyphosphate 5-phosphatase-1 and related proteins Back     alignment and domain information
>gnl|CDD|197326 cd09092, INPP5A, Type I inositol polyphosphate 5-phosphatase I Back     alignment and domain information
>gnl|CDD|197306 cd08372, EEP, Exonuclease-Endonuclease-Phosphatase (EEP) domain superfamily Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 1115
KOG05661080 consensus Inositol-1,4,5-triphosphate 5-phosphatas 100.0
PLN03191621 Type I inositol-1,4,5-trisphosphate 5-phosphatase 100.0
smart00128310 IPPc Inositol polyphosphate phosphatase, catalytic 100.0
COG5411460 Phosphatidylinositol 5-phosphate phosphatase [Sign 100.0
KOG0271480 consensus Notchless-like WD40 repeat-containing pr 100.0
KOG0271480 consensus Notchless-like WD40 repeat-containing pr 100.0
KOG0272459 consensus U4/U6 small nuclear ribonucleoprotein Pr 100.0
KOG0281499 consensus Beta-TrCP (transducin repeats containing 100.0
KOG0263707 consensus Transcription initiation factor TFIID, s 100.0
KOG0295406 consensus WD40 repeat-containing protein [Function 99.98
KOG0319775 consensus WD40-repeat-containing subunit of the 18 99.98
KOG0281499 consensus Beta-TrCP (transducin repeats containing 99.97
KOG0286343 consensus G-protein beta subunit [General function 99.97
KOG0319775 consensus WD40-repeat-containing subunit of the 18 99.97
KOG0272459 consensus U4/U6 small nuclear ribonucleoprotein Pr 99.97
KOG0306888 consensus WD40-repeat-containing subunit of the 18 99.97
KOG0315311 consensus G-protein beta subunit-like protein (con 99.96
PTZ00312356 inositol-1,4,5-triphosphate 5-phosphatase; Provisi 99.96
KOG0279315 consensus G protein beta subunit-like protein [Sig 99.96
KOG0285460 consensus Pleiotropic regulator 1 [RNA processing 99.96
KOG0263707 consensus Transcription initiation factor TFIID, s 99.96
KOG0274537 consensus Cdc4 and related F-box and WD-40 protein 99.96
KOG0266456 consensus WD40 repeat-containing protein [General 99.96
KOG0295406 consensus WD40 repeat-containing protein [Function 99.96
KOG0318603 consensus WD40 repeat stress protein/actin interac 99.96
KOG0273524 consensus Beta-transducin family (WD-40 repeat) pr 99.95
KOG0285460 consensus Pleiotropic regulator 1 [RNA processing 99.95
KOG0279315 consensus G protein beta subunit-like protein [Sig 99.95
KOG0266456 consensus WD40 repeat-containing protein [General 99.95
KOG0313423 consensus Microtubule binding protein YTM1 (contai 99.95
KOG0265338 consensus U5 snRNP-specific protein-like factor an 99.95
KOG0291893 consensus WD40-repeat-containing subunit of the 18 99.95
KOG0313423 consensus Microtubule binding protein YTM1 (contai 99.94
KOG0318603 consensus WD40 repeat stress protein/actin interac 99.94
cd00200289 WD40 WD40 domain, found in a number of eukaryotic 99.94
KOG0274537 consensus Cdc4 and related F-box and WD-40 protein 99.94
KOG0291893 consensus WD40-repeat-containing subunit of the 18 99.94
PLN00181793 protein SPA1-RELATED; Provisional 99.94
KOG0645312 consensus WD40 repeat protein [General function pr 99.94
KOG0308735 consensus Conserved WD40 repeat-containing protein 99.93
KOG0286343 consensus G-protein beta subunit [General function 99.93
KOG0284464 consensus Polyadenylation factor I complex, subuni 99.93
KOG0293519 consensus WD40 repeat-containing protein [Function 99.93
KOG0315311 consensus G-protein beta subunit-like protein (con 99.93
KOG0301745 consensus Phospholipase A2-activating protein (con 99.92
KOG0296399 consensus Angio-associated migratory cell protein 99.92
KOG0276794 consensus Vesicle coat complex COPI, beta' subunit 99.92
KOG0282503 consensus mRNA splicing factor [Function unknown] 99.92
KOG0565145 consensus Inositol polyphosphate 5-phosphatase and 99.91
KOG0292 1202 consensus Vesicle coat complex COPI, alpha subunit 99.91
KOG0284464 consensus Polyadenylation factor I complex, subuni 99.91
KOG0300481 consensus WD40 repeat-containing protein [Function 99.91
KOG0645312 consensus WD40 repeat protein [General function pr 99.91
KOG0276794 consensus Vesicle coat complex COPI, beta' subunit 99.91
PLN00181793 protein SPA1-RELATED; Provisional 99.9
KOG0275508 consensus Conserved WD40 repeat-containing protein 99.89
KOG0316307 consensus Conserved WD40 repeat-containing protein 99.89
KOG0316307 consensus Conserved WD40 repeat-containing protein 99.89
PTZ00421493 coronin; Provisional 99.89
cd00200289 WD40 WD40 domain, found in a number of eukaryotic 99.89
KOG0273524 consensus Beta-transducin family (WD-40 repeat) pr 99.89
KOG0265338 consensus U5 snRNP-specific protein-like factor an 99.89
PTZ00421493 coronin; Provisional 99.89
KOG0306888 consensus WD40-repeat-containing subunit of the 18 99.89
KOG0292 1202 consensus Vesicle coat complex COPI, alpha subunit 99.89
PTZ00420568 coronin; Provisional 99.88
KOG0308735 consensus Conserved WD40 repeat-containing protein 99.88
KOG0301745 consensus Phospholipase A2-activating protein (con 99.88
KOG0288459 consensus WD40 repeat protein TipD [General functi 99.88
KOG0275508 consensus Conserved WD40 repeat-containing protein 99.87
PTZ00420568 coronin; Provisional 99.87
KOG0294362 consensus WD40 repeat-containing protein [Function 99.87
KOG0296399 consensus Angio-associated migratory cell protein 99.87
KOG0278334 consensus Serine/threonine kinase receptor-associa 99.86
KOG0278334 consensus Serine/threonine kinase receptor-associa 99.86
KOG0640430 consensus mRNA cleavage stimulating factor complex 99.86
KOG0268433 consensus Sof1-like rRNA processing protein (conta 99.85
KOG0282503 consensus mRNA splicing factor [Function unknown] 99.85
KOG0277311 consensus Peroxisomal targeting signal type 2 rece 99.85
KOG0283712 consensus WD40 repeat-containing protein [Function 99.85
KOG0293519 consensus WD40 repeat-containing protein [Function 99.83
KOG0299479 consensus U3 snoRNP-associated protein (contains W 99.83
KOG0643327 consensus Translation initiation factor 3, subunit 99.82
KOG1446311 consensus Histone H3 (Lys4) methyltransferase comp 99.82
KOG0641350 consensus WD40 repeat protein [General function pr 99.82
KOG0305484 consensus Anaphase promoting complex, Cdc20, Cdh1, 99.82
KOG0288459 consensus WD40 repeat protein TipD [General functi 99.81
KOG0310487 consensus Conserved WD40 repeat-containing protein 99.81
KOG14081080 consensus WD40 repeat protein [Function unknown] 99.81
KOG0641350 consensus WD40 repeat protein [General function pr 99.81
KOG0310487 consensus Conserved WD40 repeat-containing protein 99.8
KOG0647347 consensus mRNA export protein (contains WD40 repea 99.8
KOG0973942 consensus Histone transcription regulator HIRA, WD 99.8
KOG1407313 consensus WD40 repeat protein [Function unknown] 99.79
KOG0277311 consensus Peroxisomal targeting signal type 2 rece 99.79
KOG0300481 consensus WD40 repeat-containing protein [Function 99.78
KOG2445361 consensus Nuclear pore complex component (sc Seh1) 99.78
KOG1539910 consensus WD repeat protein [General function pred 99.78
KOG1976391 consensus Inositol polyphosphate 5-phosphatase, ty 99.78
KOG0289506 consensus mRNA splicing factor [General function p 99.77
TIGR03866300 PQQ_ABC_repeats PQQ-dependent catabolism-associate 99.77
KOG0647347 consensus mRNA export protein (contains WD40 repea 99.76
KOG0973942 consensus Histone transcription regulator HIRA, WD 99.76
KOG2096420 consensus WD40 repeat protein [General function pr 99.76
KOG0646476 consensus WD40 repeat protein [General function pr 99.76
KOG0299479 consensus U3 snoRNP-associated protein (contains W 99.76
KOG0267825 consensus Microtubule severing protein katanin p80 99.75
KOG0321720 consensus WD40 repeat-containing protein L2DTL [Fu 99.74
KOG0305484 consensus Anaphase promoting complex, Cdc20, Cdh1, 99.74
KOG0640430 consensus mRNA cleavage stimulating factor complex 99.74
KOG0639705 consensus Transducin-like enhancer of split protei 99.74
KOG1407313 consensus WD40 repeat protein [Function unknown] 99.74
KOG1036323 consensus Mitotic spindle checkpoint protein BUB3, 99.74
KOG1446311 consensus Histone H3 (Lys4) methyltransferase comp 99.73
KOG2048691 consensus WD40 repeat protein [General function pr 99.72
KOG1063764 consensus RNA polymerase II elongator complex, sub 99.72
KOG2106626 consensus Uncharacterized conserved protein, conta 99.72
KOG1332299 consensus Vesicle coat complex COPII, subunit SEC1 99.72
KOG0264422 consensus Nucleosome remodeling factor, subunit CA 99.72
KOG0646476 consensus WD40 repeat protein [General function pr 99.71
KOG0283712 consensus WD40 repeat-containing protein [Function 99.71
KOG0267825 consensus Microtubule severing protein katanin p80 99.71
KOG2096420 consensus WD40 repeat protein [General function pr 99.71
KOG0294362 consensus WD40 repeat-containing protein [Function 99.71
KOG0639705 consensus Transducin-like enhancer of split protei 99.7
KOG1036323 consensus Mitotic spindle checkpoint protein BUB3, 99.7
KOG4283397 consensus Transcription-coupled repair protein CSA 99.69
KOG0772641 consensus Uncharacterized conserved protein, conta 99.69
KOG2048691 consensus WD40 repeat protein [General function pr 99.68
KOG0643327 consensus Translation initiation factor 3, subunit 99.68
KOG0772641 consensus Uncharacterized conserved protein, conta 99.67
KOG14081080 consensus WD40 repeat protein [Function unknown] 99.67
KOG0642577 consensus Cell-cycle nuclear protein, contains WD- 99.67
KOG0270463 consensus WD40 repeat-containing protein [Function 99.65
KOG0650733 consensus WD40 repeat nucleolar protein Bop1, invo 99.65
KOG1332299 consensus Vesicle coat complex COPII, subunit SEC1 99.65
TIGR03866300 PQQ_ABC_repeats PQQ-dependent catabolism-associate 99.64
KOG0269839 consensus WD40 repeat-containing protein [Function 99.62
KOG0302440 consensus Ribosome Assembly protein [General funct 99.62
KOG0264422 consensus Nucleosome remodeling factor, subunit CA 99.62
KOG0268433 consensus Sof1-like rRNA processing protein (conta 99.61
KOG1539910 consensus WD repeat protein [General function pred 99.6
KOG0321720 consensus WD40 repeat-containing protein L2DTL [Fu 99.6
KOG0649325 consensus WD40 repeat protein [General function pr 99.6
KOG1274933 consensus WD40 repeat protein [General function pr 99.57
KOG0270463 consensus WD40 repeat-containing protein [Function 99.54
KOG0289506 consensus mRNA splicing factor [General function p 99.54
KOG0269839 consensus WD40 repeat-containing protein [Function 99.54
KOG06441113 consensus Uncharacterized conserved protein, conta 99.53
COG2319466 FOG: WD40 repeat [General function prediction only 99.52
KOG1273405 consensus WD40 repeat protein [General function pr 99.52
KOG4283397 consensus Transcription-coupled repair protein CSA 99.52
COG2319466 FOG: WD40 repeat [General function prediction only 99.51
KOG2445361 consensus Nuclear pore complex component (sc Seh1) 99.51
KOG0307 1049 consensus Vesicle coat complex COPII, subunit SEC3 99.51
KOG1063764 consensus RNA polymerase II elongator complex, sub 99.5
KOG0642577 consensus Cell-cycle nuclear protein, contains WD- 99.49
KOG4328498 consensus WD40 protein [Function unknown] 99.48
KOG2919406 consensus Guanine nucleotide-binding protein [Gene 99.47
KOG1274933 consensus WD40 repeat protein [General function pr 99.47
KOG0303472 consensus Actin-binding protein Coronin, contains 99.47
KOG1538 1081 consensus Uncharacterized conserved protein WDR10, 99.47
KOG4378673 consensus Nuclear protein COP1 [Signal transductio 99.45
KOG0302440 consensus Ribosome Assembly protein [General funct 99.45
KOG2106626 consensus Uncharacterized conserved protein, conta 99.45
KOG0650733 consensus WD40 repeat nucleolar protein Bop1, invo 99.43
KOG14451012 consensus Tumor-specific antigen (contains WD repe 99.42
PRK11028330 6-phosphogluconolactonase; Provisional 99.4
KOG2055514 consensus WD40 repeat protein [General function pr 99.4
KOG0303472 consensus Actin-binding protein Coronin, contains 99.39
KOG2055514 consensus WD40 repeat protein [General function pr 99.39
KOG0649325 consensus WD40 repeat protein [General function pr 99.38
KOG0322323 consensus G-protein beta subunit-like protein GNB1 99.38
KOG15171387 consensus Guanine nucleotide binding protein MIP1 99.37
KOG1034385 consensus Transcriptional repressor EED/ESC/FIE, r 99.37
KOG1188376 consensus WD40 repeat protein [General function pr 99.35
KOG1009434 consensus Chromatin assembly complex 1 subunit B/C 99.34
KOG1007370 consensus WD repeat protein TSSC1, WD repeat super 99.34
KOG06441113 consensus Uncharacterized conserved protein, conta 99.34
KOG0322323 consensus G-protein beta subunit-like protein GNB1 99.34
KOG2919406 consensus Guanine nucleotide-binding protein [Gene 99.33
KOG0771398 consensus Prolactin regulatory element-binding pro 99.27
KOG1334559 consensus WD40 repeat protein [General function pr 99.27
KOG1538 1081 consensus Uncharacterized conserved protein WDR10, 99.27
KOG4227609 consensus WD40 repeat protein [General function pr 99.25
KOG1034385 consensus Transcriptional repressor EED/ESC/FIE, r 99.23
PRK01742429 tolB translocation protein TolB; Provisional 99.23
KOG4328498 consensus WD40 protein [Function unknown] 99.22
KOG1587555 consensus Cytoplasmic dynein intermediate chain [C 99.19
KOG03071049 consensus Vesicle coat complex COPII, subunit SEC3 99.18
KOG4378673 consensus Nuclear protein COP1 [Signal transductio 99.15
PRK01742429 tolB translocation protein TolB; Provisional 99.15
KOG1963792 consensus WD40 repeat protein [General function pr 99.14
KOG15171387 consensus Guanine nucleotide binding protein MIP1 99.1
KOG0771398 consensus Prolactin regulatory element-binding pro 99.09
KOG1007370 consensus WD repeat protein TSSC1, WD repeat super 99.08
KOG14451012 consensus Tumor-specific antigen (contains WD repe 99.07
KOG1009434 consensus Chromatin assembly complex 1 subunit B/C 99.06
KOG0974967 consensus WD-repeat protein WDR6, WD repeat superf 99.06
PRK11028330 6-phosphogluconolactonase; Provisional 99.05
KOG12401431 consensus Protein kinase containing WD40 repeats [ 99.04
PRK03629429 tolB translocation protein TolB; Provisional 99.03
KOG1273405 consensus WD40 repeat protein [General function pr 99.03
KOG0974967 consensus WD-repeat protein WDR6, WD repeat superf 98.95
PRK04922433 tolB translocation protein TolB; Provisional 98.95
KOG0290364 consensus Conserved WD40 repeat-containing protein 98.95
KOG4227609 consensus WD40 repeat protein [General function pr 98.94
KOG12401431 consensus Protein kinase containing WD40 repeats [ 98.93
KOG1310758 consensus WD40 repeat protein [General function pr 98.91
KOG1310758 consensus WD40 repeat protein [General function pr 98.87
KOG1524737 consensus WD40 repeat-containing protein CHE-2 [Ge 98.86
KOG2110391 consensus Uncharacterized conserved protein, conta 98.82
KOG1188376 consensus WD40 repeat protein [General function pr 98.81
KOG1963792 consensus WD40 repeat protein [General function pr 98.81
PRK05137435 tolB translocation protein TolB; Provisional 98.8
PF03372249 Exo_endo_phos: Endonuclease/Exonuclease/phosphatas 98.78
TIGR03395283 sphingomy sphingomyelin phosphodiesterase. Members 98.77
KOG0290364 consensus Conserved WD40 repeat-containing protein 98.72
PRK05421263 hypothetical protein; Provisional 98.71
PRK03629429 tolB translocation protein TolB; Provisional 98.71
PRK05137435 tolB translocation protein TolB; Provisional 98.67
KOG3881412 consensus Uncharacterized conserved protein [Funct 98.67
TIGR03300377 assembly_YfgL outer membrane assembly lipoprotein 98.66
PRK02889427 tolB translocation protein TolB; Provisional 98.66
KOG1272545 consensus WD40-repeat-containing subunit of the 18 98.66
TIGR02800417 propeller_TolB tol-pal system beta propeller repea 98.66
KOG1334559 consensus WD40 repeat protein [General function pr 98.64
PRK11756268 exonuclease III; Provisional 98.64
KOG2394636 consensus WD40 protein DMR-N9 [General function pr 98.64
KOG2111346 consensus Uncharacterized conserved protein, conta 98.63
KOG41901034 consensus Uncharacterized conserved protein [Funct 98.62
PF02239369 Cytochrom_D1: Cytochrome D1 heme domain; PDB: 1NNO 98.59
KOG4547541 consensus WD40 repeat-containing protein [General 98.59
TIGR00633255 xth exodeoxyribonuclease III (xth). This family is 98.57
PRK04922433 tolB translocation protein TolB; Provisional 98.57
KOG1409404 consensus Uncharacterized conserved protein, conta 98.55
KOG1523361 consensus Actin-related protein Arp2/3 complex, su 98.54
KOG1587555 consensus Cytoplasmic dynein intermediate chain [C 98.52
PRK00178430 tolB translocation protein TolB; Provisional 98.46
TIGR02800417 propeller_TolB tol-pal system beta propeller repea 98.46
KOG2110391 consensus Uncharacterized conserved protein, conta 98.46
TIGR03300377 assembly_YfgL outer membrane assembly lipoprotein 98.43
PF08662194 eIF2A: Eukaryotic translation initiation factor eI 98.42
PF08662194 eIF2A: Eukaryotic translation initiation factor eI 98.41
PRK04792448 tolB translocation protein TolB; Provisional 98.4
PRK02889427 tolB translocation protein TolB; Provisional 98.39
COG3568259 ElsH Metal-dependent hydrolase [General function p 98.39
KOG1354433 consensus Serine/threonine protein phosphatase 2A, 98.38
KOG1272545 consensus WD40-repeat-containing subunit of the 18 98.37
KOG41901034 consensus Uncharacterized conserved protein [Funct 98.33
KOG2394636 consensus WD40 protein DMR-N9 [General function pr 98.32
PF02239369 Cytochrom_D1: Cytochrome D1 heme domain; PDB: 1NNO 98.26
KOG10642439 consensus RAVE (regulator of V-ATPase assembly) co 98.26
PF0040039 WD40: WD domain, G-beta repeat; InterPro: IPR01978 98.25
PLN029191057 haloacid dehalogenase-like hydrolase family protei 98.23
KOG2139445 consensus WD40 repeat protein [General function pr 98.23
KOG10642439 consensus RAVE (regulator of V-ATPase assembly) co 98.22
KOG1524737 consensus WD40 repeat-containing protein CHE-2 [Ge 98.22
PLN029191057 haloacid dehalogenase-like hydrolase family protei 98.2
KOG3914390 consensus WD repeat protein WDR4 [Function unknown 98.18
KOG2321703 consensus WD40 repeat protein [General function pr 98.18
TIGR00195254 exoDNase_III exodeoxyribonuclease III. The model b 98.16
KOG2111346 consensus Uncharacterized conserved protein, conta 98.11
PRK13911250 exodeoxyribonuclease III; Provisional 98.08
PRK11138394 outer membrane biogenesis protein BamB; Provisiona 98.08
KOG0309 1081 consensus Conserved WD40 repeat-containing protein 98.08
PRK00178430 tolB translocation protein TolB; Provisional 98.06
KOG2315566 consensus Predicted translation initiation factor 98.05
PF0040039 WD40: WD domain, G-beta repeat; InterPro: IPR01978 97.99
TIGR02658352 TTQ_MADH_Hv methylamine dehydrogenase heavy chain. 97.97
KOG4547541 consensus WD40 repeat-containing protein [General 97.97
PF10282345 Lactonase: Lactonase, 7-bladed beta-propeller; Int 97.91
PF13360238 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 97.89
KOG1409404 consensus Uncharacterized conserved protein, conta 97.86
COG5170460 CDC55 Serine/threonine protein phosphatase 2A, reg 97.86
KOG4497447 consensus Uncharacterized conserved protein WDR8, 97.85
KOG3881412 consensus Uncharacterized conserved protein [Funct 97.84
PRK04792448 tolB translocation protein TolB; Provisional 97.83
KOG1523361 consensus Actin-related protein Arp2/3 complex, su 97.82
PF13360238 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 97.79
KOG3914390 consensus WD repeat protein WDR4 [Function unknown 97.79
COG2706346 3-carboxymuconate cyclase [Carbohydrate transport 97.79
PLN03144606 Carbon catabolite repressor protein 4 homolog; Pro 97.78
PRK01029428 tolB translocation protein TolB; Provisional 97.71
PF14874102 PapD-like: Flagellar-associated PapD-like 97.71
KOG2321703 consensus WD40 repeat protein [General function pr 97.68
KOG2139445 consensus WD40 repeat protein [General function pr 97.62
COG5354561 Uncharacterized protein, contains Trp-Asp (WD) rep 97.59
PRK01029428 tolB translocation protein TolB; Provisional 97.58
KOG2695425 consensus WD40 repeat protein [General function pr 97.57
KOG0280339 consensus Uncharacterized conserved protein [Amino 97.56
TIGR02658352 TTQ_MADH_Hv methylamine dehydrogenase heavy chain. 97.56
COG0708261 XthA Exonuclease III [DNA replication, recombinati 97.51
KOG2041 1189 consensus WD40 repeat protein [General function pr 97.4
PF08450246 SGL: SMP-30/Gluconolaconase/LRE-like region; Inter 97.39
PF10282345 Lactonase: Lactonase, 7-bladed beta-propeller; Int 97.39
KOG2314698 consensus Translation initiation factor 3, subunit 97.33
KOG2695425 consensus WD40 repeat protein [General function pr 97.3
KOG4497447 consensus Uncharacterized conserved protein WDR8, 97.29
PRK11138394 outer membrane biogenesis protein BamB; Provisiona 97.28
PTZ00297 1452 pantothenate kinase; Provisional 97.28
KOG1354433 consensus Serine/threonine protein phosphatase 2A, 97.18
KOG0280339 consensus Uncharacterized conserved protein [Amino 97.14
smart00476276 DNaseIc deoxyribonuclease I. Deoxyribonuclease I c 97.11
PRK04043419 tolB translocation protein TolB; Provisional 97.08
KOG2315566 consensus Predicted translation initiation factor 96.96
COG4946668 Uncharacterized protein related to the periplasmic 96.83
KOG2114933 consensus Vacuolar assembly/sorting protein PEP5/V 96.74
PRK15251271 cytolethal distending toxin subunit CdtB; Provisio 96.71
smart0032040 WD40 WD40 repeats. Note that these repeats are per 96.66
COG4946668 Uncharacterized protein related to the periplasmic 96.66
KOG0309 1081 consensus Conserved WD40 repeat-containing protein 96.57
COG2706346 3-carboxymuconate cyclase [Carbohydrate transport 96.55
KOG2756349 consensus Predicted Mg2+-dependent phosphodiestera 96.13
PF14783111 BBS2_Mid: Ciliary BBSome complex subunit 2, middle 96.08
PRK04043419 tolB translocation protein TolB; Provisional 96.06
smart0032040 WD40 WD40 repeats. Note that these repeats are per 96.06
COG5354561 Uncharacterized protein, contains Trp-Asp (WD) rep 96.03
PF08450246 SGL: SMP-30/Gluconolaconase/LRE-like region; Inter 95.86
PF11768545 DUF3312: Protein of unknown function (DUF3312); In 95.85
KOG4532344 consensus WD40-like repeat containing protein [Gen 95.83
PF15492282 Nbas_N: Neuroblastoma-amplified sequence, N termin 95.81
PF00635109 Motile_Sperm: MSP (Major sperm protein) domain; In 95.8
KOG0882558 consensus Cyclophilin-related peptidyl-prolyl cis- 95.8
KOG3873422 consensus Sphingomyelinase family protein [Signal 95.71
KOG4714319 consensus Nucleoporin [Nuclear structure] 95.68
KOG2444238 consensus WD40 repeat protein [General function pr 95.68
PF15492282 Nbas_N: Neuroblastoma-amplified sequence, N termin 95.61
PF07433305 DUF1513: Protein of unknown function (DUF1513); In 95.53
KOG0882558 consensus Cyclophilin-related peptidyl-prolyl cis- 95.52
PF07433305 DUF1513: Protein of unknown function (DUF1513); In 95.45
KOG1645463 consensus RING-finger-containing E3 ubiquitin liga 95.22
COG5170460 CDC55 Serine/threonine protein phosphatase 2A, reg 95.17
KOG4714319 consensus Nucleoporin [Nuclear structure] 95.16
PF04762928 IKI3: IKI3 family; InterPro: IPR006849 Members of 95.11
KOG2041 1189 consensus WD40 repeat protein [General function pr 95.08
KOG2338495 consensus Transcriptional effector CCR4-related pr 95.0
KOG1275 1118 consensus PAB-dependent poly(A) ribonuclease, subu 94.98
KOG2066846 consensus Vacuolar assembly/sorting protein VPS41 94.94
PF11768545 DUF3312: Protein of unknown function (DUF3312); In 94.74
cd00216488 PQQ_DH Dehydrogenases with pyrrolo-quinoline quino 94.65
COG3386307 Gluconolactonase [Carbohydrate transport and metab 94.61
cd00216488 PQQ_DH Dehydrogenases with pyrrolo-quinoline quino 94.27
KOG2066846 consensus Vacuolar assembly/sorting protein VPS41 93.46
PF08553794 VID27: VID27 cytoplasmic protein; InterPro: IPR013 93.42
KOG18321516 consensus HIV-1 Vpr-binding protein [Cell cycle co 93.1
KOG12751118 consensus PAB-dependent poly(A) ribonuclease, subu 92.69
KOG2079 1206 consensus Vacuolar assembly/sorting protein VPS8 [ 92.3
KOG4640665 consensus Anaphase-promoting complex (APC), subuni 92.23
PF04762928 IKI3: IKI3 family; InterPro: IPR006849 Members of 92.21
KOG1645463 consensus RING-finger-containing E3 ubiquitin liga 92.17
KOG1912 1062 consensus WD40 repeat protein [General function pr 91.6
KOG2444238 consensus WD40 repeat protein [General function pr 91.44
KOG2395644 consensus Protein involved in vacuole import and d 91.39
PF14783111 BBS2_Mid: Ciliary BBSome complex subunit 2, middle 89.85
KOG18321516 consensus HIV-1 Vpr-binding protein [Cell cycle co 89.81
KOG4532344 consensus WD40-like repeat containing protein [Gen 89.64
KOG2114933 consensus Vacuolar assembly/sorting protein PEP5/V 89.39
PF00780275 CNH: CNH domain; InterPro: IPR001180 Based on sequ 89.17
PF04841410 Vps16_N: Vps16, N-terminal region; InterPro: IPR00 89.03
KOG2079 1206 consensus Vacuolar assembly/sorting protein VPS8 [ 88.97
KOG1912 1062 consensus WD40 repeat protein [General function pr 88.69
COG3292671 Predicted periplasmic ligand-binding sensor domain 88.33
PF08553794 VID27: VID27 cytoplasmic protein; InterPro: IPR013 88.24
KOG1920 1265 consensus IkappaB kinase complex, IKAP component [ 87.59
KOG3621726 consensus WD40 repeat-containing protein [General 87.04
COG3386307 Gluconolactonase [Carbohydrate transport and metab 86.68
KOG4649354 consensus PQQ (pyrrolo-quinoline quinone) repeat p 86.41
KOG3617 1416 consensus WD40 and TPR repeat-containing protein [ 85.98
COG3292671 Predicted periplasmic ligand-binding sensor domain 85.6
PF14529119 Exo_endo_phos_2: Endonuclease-reverse transcriptas 84.59
PF04053443 Coatomer_WDAD: Coatomer WD associated region ; Int 83.64
PRK13616591 lipoprotein LpqB; Provisional 81.29
TIGR03118336 PEPCTERM_chp_1 conserved hypothetical protein TIGR 80.3
>KOG0566 consensus Inositol-1,4,5-triphosphate 5-phosphatase (synaptojanin), INP51/INP52/INP53 family [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
Probab=100.00  E-value=1.2e-87  Score=790.56  Aligned_cols=339  Identities=35%  Similarity=0.626  Sum_probs=308.9

Q ss_pred             CCCceEEeeecCCCCCchhhHHHhhccccccceecccceEEEEEEeCCCCCC-chhhhccccCC--C---CCceeEEEEE
Q 001245          516 NHGGIRGWNVTSPGPLDSILCKELAGKEFLYTRMENLKILAGTWNVGQGRAS-QDALISWLGSA--A---SDVGIVVVGL  589 (1115)
Q Consensus       516 ~DgtIRlWdl~~p~pld~~i~~~l~~re~~yt~~~~irI~v~TWNv~~~~~~-~~~L~~wl~~~--~---~~~Di~viGl  589 (1115)
                      .|..+.+.|     |+...+.++|++|+.+|+..++|+||||||||||+.+. .++|.+||.+.  .   ..+|||||||
T Consensus       506 ~q~~v~L~d-----pv~~yv~~~L~er~~eyt~~k~i~IfvgTfNvNG~s~~~k~~L~~WLfp~s~~~~~~~aDIyviG~  580 (1080)
T KOG0566|consen  506 AQSAVILYD-----PVHEYVLKELRERRSEYTEPKDISIFVGTFNVNGRSAAFKDDLSDWLFPISRGKEFSPADIYVIGF  580 (1080)
T ss_pred             ccchhhhcC-----chhHHHHHHHHHhhhhhccccceEEEEEeeeccCccccchhhHHhhccccccCCcCCcCcEEEEee
Confidence            466666665     46788999999999999999999999999999985443 36899999854  2   2589999999


Q ss_pred             ecc-cCccchhhhhhhhhhhcCCCCcchhhHHHHHhcccCC-CCceEEEeeeccccEEEEEEEeccccCccCceeeeeee
Q 001245          590 QEV-EMGAGFLAMSAAKETVGLEGSAVGHWWLDMIGKILDD-GSTFERVGSRQLAGLLIAVWVRKNLKDYVGDVDVAAVP  667 (1115)
Q Consensus       590 QEi-~~~~~~~~~~~~ke~~~~~~s~~~~~W~~~l~~~L~~-~~~y~~v~s~~L~Gi~l~vfvr~~l~~~i~~v~~~~v~  667 (1115)
                      ||| +++++++...         +..+.+.|++.|++.|+. +.+|+++.|.||+|++|++|+|+++.++|++|..++++
T Consensus       581 eEvVeLnag~iv~A---------s~tk~~~Wee~i~~~Ln~~~~kYvlL~s~QlvGv~L~iF~r~~~~p~Ik~V~~~tkK  651 (1080)
T KOG0566|consen  581 EEVVELNAGNIVSA---------STTKRRFWEEKILKTLNRYKNKYVLLRSEQLVGVCLLLFIRPDHAPYIKDVAGDTKK  651 (1080)
T ss_pred             hhhhhcCccceecc---------ChHHHHHHHHHHHHHhcCCCCceEEEehhhhheeeEEEEEcccccchhhhcccceee
Confidence            997 7998876321         234568899999999987 88999999999999999999999999999999999999


Q ss_pred             eeccccccCcceEEEEEEEecEEEEEEeecccccchhHHHHHHHHHHHHHhcccCCCCCccchhhcCCchhhhhcccCCC
Q 001245          668 CGFGRAIGNKGAVGLRVRVYDRIMCFVNCHFAAHLEAVNRRNADFDHVYRTMTFCRPSNLCSAAAAGASSVVQMLRSTNP  747 (1115)
Q Consensus       668 tG~~g~~gNKGaV~ir~~i~~t~l~FVn~HLaA~~~~~~~Rn~d~~~I~~~l~F~~~~~~~~~~~~~~~~~~~~~~~~~~  747 (1115)
                      |||||+.||||||||||.+++|+|||||+|||||++|+++||.||.+|.++|+|+++.                      
T Consensus       652 TGfGG~tgNKGAVAIrf~~~~TsfCFv~SHlAAG~snv~ERn~DY~tI~r~l~Fp~Gr----------------------  709 (1080)
T KOG0566|consen  652 TGFGGATGNKGAVAIRFVYHATSFCFVCSHLAAGQSNVEERNEDYKTIARKLRFPRGR----------------------  709 (1080)
T ss_pred             cccccccCCCceEEEEEEeccccEEEEecccccccchHhhhhhhHHHHHHhccccCCc----------------------
Confidence            9999999999999999999999999999999999999999999999999999998753                      


Q ss_pred             CCCCcccCCCCcCCcceEEEecccccccCCCChHHHHHHHhhcChhHHhcchHHHHHHhcCCcccCccccCcccCCCccc
Q 001245          748 LSGLTVEGVPELSEADMVIFLGDFNYRLDGITYDEARDFISQRCFDWLRERDQLRAEMEAGNVFQGMREADIKFPPTYKF  827 (1115)
Q Consensus       748 ~~~~~~~~~~~i~~~D~vfw~GDlNyRi~~~~~~~v~~~i~~~~~~~Ll~~DQL~~~~~~~~~f~gf~E~~I~F~PTYKy  827 (1115)
                                +|.+||+|||||||||||++ ++|||+++|.+++|+.|+++|||++||.+|++|.||.|++|+|+|||||
T Consensus       710 ----------~I~~HD~ifW~GDFNYRI~l-~nEEVr~~v~~~d~~kL~e~DQL~~q~~~G~vF~gF~E~~ltF~PTYKy  778 (1080)
T KOG0566|consen  710 ----------MIFSHDYIFWLGDFNYRIDL-SNEEVRRLVRNQDLDKLLEYDQLTQQMNAGQVFPGFHEGQLTFPPTYKY  778 (1080)
T ss_pred             ----------cccCCceEEEecccceeecC-CHHHHHHHHHhccHHHHhhHHHHHHHHhcCcccccccccccccCCcccc
Confidence                      37899999999999999996 9999999999999999999999999999999999999999999999999


Q ss_pred             cccccCCcccccCCccccccccceeeeecCCCcccccccCCCccccceeeeeeccccccCCCCceeeEEEEEeeccCHHH
Q 001245          828 EKHLAGLAGYDSGEKKRVPAWCDRILYRDSRSDLASECSLECPVASSILRYEACMDVTDSDHKPVRCIFSVDIARVDESV  907 (1115)
Q Consensus       828 d~~~~g~~~yDts~k~R~PsWcDRIL~~~~~~~~~~~~~~~~p~~~~~~~Y~s~~~~~~SDHkPV~a~f~v~v~~v~~~~  907 (1115)
                      |.   ||+.||||||+|+||||||||||+...              .++.|.+++ +++||||||+|+|+++|..||+++
T Consensus       779 D~---gTd~YDTSeK~R~PAWTDRIL~r~e~~--------------~~l~Y~~~e-l~~SDHRPV~A~~~a~i~~Vd~~k  840 (1080)
T KOG0566|consen  779 DP---GTDDYDTSEKCRTPAWTDRILWRGEKL--------------ELLSYKRAE-LKTSDHRPVYAIFRAEIFEVDEQK  840 (1080)
T ss_pred             cC---CCCccccchhccCccchhhheeccccc--------------ccccccccc-ccccCCCceEEEEEEEEEEEcHHH
Confidence            96   568999999999999999999998753              247898865 999999999999999999999999


Q ss_pred             HHHHHHHHhhcc
Q 001245          908 RRQEFGDIMTSN  919 (1115)
Q Consensus       908 ~~~~~~ei~~~~  919 (1115)
                      |.++|+|+++.+
T Consensus       841 k~~l~eev~~~~  852 (1080)
T KOG0566|consen  841 KLRLFEEVKERL  852 (1080)
T ss_pred             HHHHHHHHHHHc
Confidence            999999999864



>PLN03191 Type I inositol-1,4,5-trisphosphate 5-phosphatase 2; Provisional Back     alignment and domain information
>smart00128 IPPc Inositol polyphosphate phosphatase, catalytic domain homologues Back     alignment and domain information
>COG5411 Phosphatidylinositol 5-phosphate phosphatase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0271 consensus Notchless-like WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0271 consensus Notchless-like WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0272 consensus U4/U6 small nuclear ribonucleoprotein Prp4 (contains WD40 repeats) [RNA processing and modification] Back     alignment and domain information
>KOG0281 consensus Beta-TrCP (transducin repeats containing)/Slimb proteins [Function unknown] Back     alignment and domain information
>KOG0263 consensus Transcription initiation factor TFIID, subunit TAF5 (also component of histone acetyltransferase SAGA) [Transcription] Back     alignment and domain information
>KOG0295 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0319 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification] Back     alignment and domain information
>KOG0281 consensus Beta-TrCP (transducin repeats containing)/Slimb proteins [Function unknown] Back     alignment and domain information
>KOG0286 consensus G-protein beta subunit [General function prediction only] Back     alignment and domain information
>KOG0319 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification] Back     alignment and domain information
>KOG0272 consensus U4/U6 small nuclear ribonucleoprotein Prp4 (contains WD40 repeats) [RNA processing and modification] Back     alignment and domain information
>KOG0306 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification] Back     alignment and domain information
>KOG0315 consensus G-protein beta subunit-like protein (contains WD40 repeats) [General function prediction only] Back     alignment and domain information
>PTZ00312 inositol-1,4,5-triphosphate 5-phosphatase; Provisional Back     alignment and domain information
>KOG0279 consensus G protein beta subunit-like protein [Signal transduction mechanisms] Back     alignment and domain information
>KOG0285 consensus Pleiotropic regulator 1 [RNA processing and modification] Back     alignment and domain information
>KOG0263 consensus Transcription initiation factor TFIID, subunit TAF5 (also component of histone acetyltransferase SAGA) [Transcription] Back     alignment and domain information
>KOG0274 consensus Cdc4 and related F-box and WD-40 proteins [General function prediction only] Back     alignment and domain information
>KOG0266 consensus WD40 repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG0295 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0318 consensus WD40 repeat stress protein/actin interacting protein [Cytoskeleton] Back     alignment and domain information
>KOG0273 consensus Beta-transducin family (WD-40 repeat) protein [Chromatin structure and dynamics] Back     alignment and domain information
>KOG0285 consensus Pleiotropic regulator 1 [RNA processing and modification] Back     alignment and domain information
>KOG0279 consensus G protein beta subunit-like protein [Signal transduction mechanisms] Back     alignment and domain information
>KOG0266 consensus WD40 repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG0313 consensus Microtubule binding protein YTM1 (contains WD40 repeats) [Cytoskeleton] Back     alignment and domain information
>KOG0265 consensus U5 snRNP-specific protein-like factor and related proteins [RNA processing and modification] Back     alignment and domain information
>KOG0291 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification] Back     alignment and domain information
>KOG0313 consensus Microtubule binding protein YTM1 (contains WD40 repeats) [Cytoskeleton] Back     alignment and domain information
>KOG0318 consensus WD40 repeat stress protein/actin interacting protein [Cytoskeleton] Back     alignment and domain information
>cd00200 WD40 WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and botto Back     alignment and domain information
>KOG0274 consensus Cdc4 and related F-box and WD-40 proteins [General function prediction only] Back     alignment and domain information
>KOG0291 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification] Back     alignment and domain information
>PLN00181 protein SPA1-RELATED; Provisional Back     alignment and domain information
>KOG0645 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0308 consensus Conserved WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0286 consensus G-protein beta subunit [General function prediction only] Back     alignment and domain information
>KOG0284 consensus Polyadenylation factor I complex, subunit PFS2 [RNA processing and modification] Back     alignment and domain information
>KOG0293 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0315 consensus G-protein beta subunit-like protein (contains WD40 repeats) [General function prediction only] Back     alignment and domain information
>KOG0301 consensus Phospholipase A2-activating protein (contains WD40 repeats) [Lipid transport and metabolism] Back     alignment and domain information
>KOG0296 consensus Angio-associated migratory cell protein (contains WD40 repeats) [Function unknown] Back     alignment and domain information
>KOG0276 consensus Vesicle coat complex COPI, beta' subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0282 consensus mRNA splicing factor [Function unknown] Back     alignment and domain information
>KOG0565 consensus Inositol polyphosphate 5-phosphatase and related proteins [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0292 consensus Vesicle coat complex COPI, alpha subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0284 consensus Polyadenylation factor I complex, subunit PFS2 [RNA processing and modification] Back     alignment and domain information
>KOG0300 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0645 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0276 consensus Vesicle coat complex COPI, beta' subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PLN00181 protein SPA1-RELATED; Provisional Back     alignment and domain information
>KOG0275 consensus Conserved WD40 repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG0316 consensus Conserved WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0316 consensus Conserved WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>PTZ00421 coronin; Provisional Back     alignment and domain information
>cd00200 WD40 WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and botto Back     alignment and domain information
>KOG0273 consensus Beta-transducin family (WD-40 repeat) protein [Chromatin structure and dynamics] Back     alignment and domain information
>KOG0265 consensus U5 snRNP-specific protein-like factor and related proteins [RNA processing and modification] Back     alignment and domain information
>PTZ00421 coronin; Provisional Back     alignment and domain information
>KOG0306 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification] Back     alignment and domain information
>KOG0292 consensus Vesicle coat complex COPI, alpha subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PTZ00420 coronin; Provisional Back     alignment and domain information
>KOG0308 consensus Conserved WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0301 consensus Phospholipase A2-activating protein (contains WD40 repeats) [Lipid transport and metabolism] Back     alignment and domain information
>KOG0288 consensus WD40 repeat protein TipD [General function prediction only] Back     alignment and domain information
>KOG0275 consensus Conserved WD40 repeat-containing protein [General function prediction only] Back     alignment and domain information
>PTZ00420 coronin; Provisional Back     alignment and domain information
>KOG0294 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0296 consensus Angio-associated migratory cell protein (contains WD40 repeats) [Function unknown] Back     alignment and domain information
>KOG0278 consensus Serine/threonine kinase receptor-associated protein [Lipid transport and metabolism] Back     alignment and domain information
>KOG0278 consensus Serine/threonine kinase receptor-associated protein [Lipid transport and metabolism] Back     alignment and domain information
>KOG0640 consensus mRNA cleavage stimulating factor complex; subunit 1 [RNA processing and modification] Back     alignment and domain information
>KOG0268 consensus Sof1-like rRNA processing protein (contains WD40 repeats) [RNA processing and modification] Back     alignment and domain information
>KOG0282 consensus mRNA splicing factor [Function unknown] Back     alignment and domain information
>KOG0277 consensus Peroxisomal targeting signal type 2 receptor [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0283 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0293 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0299 consensus U3 snoRNP-associated protein (contains WD40 repeats) [RNA processing and modification] Back     alignment and domain information
>KOG0643 consensus Translation initiation factor 3, subunit i (eIF-3i)/TGF-beta receptor-interacting protein (TRIP-1) [Translation, ribosomal structure and biogenesis; Signal transduction mechanisms] Back     alignment and domain information
>KOG1446 consensus Histone H3 (Lys4) methyltransferase complex and RNA cleavage factor II complex, subunit SWD2 [RNA processing and modification; Chromatin structure and dynamics; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0641 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0305 consensus Anaphase promoting complex, Cdc20, Cdh1, and Ama1 subunits [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0288 consensus WD40 repeat protein TipD [General function prediction only] Back     alignment and domain information
>KOG0310 consensus Conserved WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG1408 consensus WD40 repeat protein [Function unknown] Back     alignment and domain information
>KOG0641 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0310 consensus Conserved WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0647 consensus mRNA export protein (contains WD40 repeats) [RNA processing and modification] Back     alignment and domain information
>KOG0973 consensus Histone transcription regulator HIRA, WD repeat superfamily [Cell cycle control, cell division, chromosome partitioning; Transcription] Back     alignment and domain information
>KOG1407 consensus WD40 repeat protein [Function unknown] Back     alignment and domain information
>KOG0277 consensus Peroxisomal targeting signal type 2 receptor [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0300 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG2445 consensus Nuclear pore complex component (sc Seh1) [Nuclear structure; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1539 consensus WD repeat protein [General function prediction only] Back     alignment and domain information
>KOG1976 consensus Inositol polyphosphate 5-phosphatase, type I [Lipid transport and metabolism] Back     alignment and domain information
>KOG0289 consensus mRNA splicing factor [General function prediction only] Back     alignment and domain information
>TIGR03866 PQQ_ABC_repeats PQQ-dependent catabolism-associated beta-propeller protein Back     alignment and domain information
>KOG0647 consensus mRNA export protein (contains WD40 repeats) [RNA processing and modification] Back     alignment and domain information
>KOG0973 consensus Histone transcription regulator HIRA, WD repeat superfamily [Cell cycle control, cell division, chromosome partitioning; Transcription] Back     alignment and domain information
>KOG2096 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0646 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0299 consensus U3 snoRNP-associated protein (contains WD40 repeats) [RNA processing and modification] Back     alignment and domain information
>KOG0267 consensus Microtubule severing protein katanin p80 subunit B (contains WD40 repeats) [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0321 consensus WD40 repeat-containing protein L2DTL [Function unknown] Back     alignment and domain information
>KOG0305 consensus Anaphase promoting complex, Cdc20, Cdh1, and Ama1 subunits [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0640 consensus mRNA cleavage stimulating factor complex; subunit 1 [RNA processing and modification] Back     alignment and domain information
>KOG0639 consensus Transducin-like enhancer of split protein (contains WD40 repeats) [Chromatin structure and dynamics] Back     alignment and domain information
>KOG1407 consensus WD40 repeat protein [Function unknown] Back     alignment and domain information
>KOG1036 consensus Mitotic spindle checkpoint protein BUB3, WD repeat superfamily [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG1446 consensus Histone H3 (Lys4) methyltransferase complex and RNA cleavage factor II complex, subunit SWD2 [RNA processing and modification; Chromatin structure and dynamics; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2048 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG1063 consensus RNA polymerase II elongator complex, subunit ELP2, WD repeat superfamily [Chromatin structure and dynamics; Transcription] Back     alignment and domain information
>KOG2106 consensus Uncharacterized conserved protein, contains HELP and WD40 domains [Function unknown] Back     alignment and domain information
>KOG1332 consensus Vesicle coat complex COPII, subunit SEC13 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0264 consensus Nucleosome remodeling factor, subunit CAF1/NURF55/MSI1 [Chromatin structure and dynamics] Back     alignment and domain information
>KOG0646 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0283 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0267 consensus Microtubule severing protein katanin p80 subunit B (contains WD40 repeats) [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG2096 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0294 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0639 consensus Transducin-like enhancer of split protein (contains WD40 repeats) [Chromatin structure and dynamics] Back     alignment and domain information
>KOG1036 consensus Mitotic spindle checkpoint protein BUB3, WD repeat superfamily [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG4283 consensus Transcription-coupled repair protein CSA, contains WD40 domain [Transcription; Replication, recombination and repair] Back     alignment and domain information
>KOG0772 consensus Uncharacterized conserved protein, contains WD40 repeat [Function unknown] Back     alignment and domain information
>KOG2048 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0643 consensus Translation initiation factor 3, subunit i (eIF-3i)/TGF-beta receptor-interacting protein (TRIP-1) [Translation, ribosomal structure and biogenesis; Signal transduction mechanisms] Back     alignment and domain information
>KOG0772 consensus Uncharacterized conserved protein, contains WD40 repeat [Function unknown] Back     alignment and domain information
>KOG1408 consensus WD40 repeat protein [Function unknown] Back     alignment and domain information
>KOG0642 consensus Cell-cycle nuclear protein, contains WD-40 repeats [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0270 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0650 consensus WD40 repeat nucleolar protein Bop1, involved in ribosome biogenesis [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG1332 consensus Vesicle coat complex COPII, subunit SEC13 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>TIGR03866 PQQ_ABC_repeats PQQ-dependent catabolism-associated beta-propeller protein Back     alignment and domain information
>KOG0269 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0302 consensus Ribosome Assembly protein [General function prediction only] Back     alignment and domain information
>KOG0264 consensus Nucleosome remodeling factor, subunit CAF1/NURF55/MSI1 [Chromatin structure and dynamics] Back     alignment and domain information
>KOG0268 consensus Sof1-like rRNA processing protein (contains WD40 repeats) [RNA processing and modification] Back     alignment and domain information
>KOG1539 consensus WD repeat protein [General function prediction only] Back     alignment and domain information
>KOG0321 consensus WD40 repeat-containing protein L2DTL [Function unknown] Back     alignment and domain information
>KOG0649 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG1274 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0270 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0289 consensus mRNA splicing factor [General function prediction only] Back     alignment and domain information
>KOG0269 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0644 consensus Uncharacterized conserved protein, contains WD40 repeat and BROMO domains [General function prediction only] Back     alignment and domain information
>COG2319 FOG: WD40 repeat [General function prediction only] Back     alignment and domain information
>KOG1273 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG4283 consensus Transcription-coupled repair protein CSA, contains WD40 domain [Transcription; Replication, recombination and repair] Back     alignment and domain information
>COG2319 FOG: WD40 repeat [General function prediction only] Back     alignment and domain information
>KOG2445 consensus Nuclear pore complex component (sc Seh1) [Nuclear structure; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0307 consensus Vesicle coat complex COPII, subunit SEC31 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1063 consensus RNA polymerase II elongator complex, subunit ELP2, WD repeat superfamily [Chromatin structure and dynamics; Transcription] Back     alignment and domain information
>KOG0642 consensus Cell-cycle nuclear protein, contains WD-40 repeats [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG4328 consensus WD40 protein [Function unknown] Back     alignment and domain information
>KOG2919 consensus Guanine nucleotide-binding protein [General function prediction only] Back     alignment and domain information
>KOG1274 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0303 consensus Actin-binding protein Coronin, contains WD40 repeats [Cytoskeleton] Back     alignment and domain information
>KOG1538 consensus Uncharacterized conserved protein WDR10, contains WD40 repeats [General function prediction only] Back     alignment and domain information
>KOG4378 consensus Nuclear protein COP1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0302 consensus Ribosome Assembly protein [General function prediction only] Back     alignment and domain information
>KOG2106 consensus Uncharacterized conserved protein, contains HELP and WD40 domains [Function unknown] Back     alignment and domain information
>KOG0650 consensus WD40 repeat nucleolar protein Bop1, involved in ribosome biogenesis [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG1445 consensus Tumor-specific antigen (contains WD repeats) [Cytoskeleton] Back     alignment and domain information
>PRK11028 6-phosphogluconolactonase; Provisional Back     alignment and domain information
>KOG2055 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0303 consensus Actin-binding protein Coronin, contains WD40 repeats [Cytoskeleton] Back     alignment and domain information
>KOG2055 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0649 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0322 consensus G-protein beta subunit-like protein GNB1L, contains WD repeats [General function prediction only] Back     alignment and domain information
>KOG1517 consensus Guanine nucleotide binding protein MIP1 [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG1034 consensus Transcriptional repressor EED/ESC/FIE, required for transcriptional silencing, WD repeat superfamily [Transcription] Back     alignment and domain information
>KOG1188 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG1009 consensus Chromatin assembly complex 1 subunit B/CAC2 (contains WD40 repeats) [Chromatin structure and dynamics; Replication, recombination and repair] Back     alignment and domain information
>KOG1007 consensus WD repeat protein TSSC1, WD repeat superfamily [Function unknown] Back     alignment and domain information
>KOG0644 consensus Uncharacterized conserved protein, contains WD40 repeat and BROMO domains [General function prediction only] Back     alignment and domain information
>KOG0322 consensus G-protein beta subunit-like protein GNB1L, contains WD repeats [General function prediction only] Back     alignment and domain information
>KOG2919 consensus Guanine nucleotide-binding protein [General function prediction only] Back     alignment and domain information
>KOG0771 consensus Prolactin regulatory element-binding protein/Protein transport protein SEC12p [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1334 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG1538 consensus Uncharacterized conserved protein WDR10, contains WD40 repeats [General function prediction only] Back     alignment and domain information
>KOG4227 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG1034 consensus Transcriptional repressor EED/ESC/FIE, required for transcriptional silencing, WD repeat superfamily [Transcription] Back     alignment and domain information
>PRK01742 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG4328 consensus WD40 protein [Function unknown] Back     alignment and domain information
>KOG1587 consensus Cytoplasmic dynein intermediate chain [Cytoskeleton] Back     alignment and domain information
>KOG0307 consensus Vesicle coat complex COPII, subunit SEC31 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG4378 consensus Nuclear protein COP1 [Signal transduction mechanisms] Back     alignment and domain information
>PRK01742 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG1963 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG1517 consensus Guanine nucleotide binding protein MIP1 [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0771 consensus Prolactin regulatory element-binding protein/Protein transport protein SEC12p [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1007 consensus WD repeat protein TSSC1, WD repeat superfamily [Function unknown] Back     alignment and domain information
>KOG1445 consensus Tumor-specific antigen (contains WD repeats) [Cytoskeleton] Back     alignment and domain information
>KOG1009 consensus Chromatin assembly complex 1 subunit B/CAC2 (contains WD40 repeats) [Chromatin structure and dynamics; Replication, recombination and repair] Back     alignment and domain information
>KOG0974 consensus WD-repeat protein WDR6, WD repeat superfamily [General function prediction only] Back     alignment and domain information
>PRK11028 6-phosphogluconolactonase; Provisional Back     alignment and domain information
>KOG1240 consensus Protein kinase containing WD40 repeats [Signal transduction mechanisms] Back     alignment and domain information
>PRK03629 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG1273 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0974 consensus WD-repeat protein WDR6, WD repeat superfamily [General function prediction only] Back     alignment and domain information
>PRK04922 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG0290 consensus Conserved WD40 repeat-containing protein AN11 [Function unknown] Back     alignment and domain information
>KOG4227 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG1240 consensus Protein kinase containing WD40 repeats [Signal transduction mechanisms] Back     alignment and domain information
>KOG1310 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG1310 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG1524 consensus WD40 repeat-containing protein CHE-2 [General function prediction only] Back     alignment and domain information
>KOG2110 consensus Uncharacterized conserved protein, contains WD40 repeats [Function unknown] Back     alignment and domain information
>KOG1188 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG1963 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PRK05137 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PF03372 Exo_endo_phos: Endonuclease/Exonuclease/phosphatase family Subset of Pfam family Subset of Pfam family; InterPro: IPR005135 This domain is found in a large number of proteins including magnesium dependent endonucleases and phosphatases involved in intracellular signalling [] Back     alignment and domain information
>TIGR03395 sphingomy sphingomyelin phosphodiesterase Back     alignment and domain information
>KOG0290 consensus Conserved WD40 repeat-containing protein AN11 [Function unknown] Back     alignment and domain information
>PRK05421 hypothetical protein; Provisional Back     alignment and domain information
>PRK03629 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK05137 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG3881 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>TIGR03300 assembly_YfgL outer membrane assembly lipoprotein YfgL Back     alignment and domain information
>PRK02889 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG1272 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification] Back     alignment and domain information
>TIGR02800 propeller_TolB tol-pal system beta propeller repeat protein TolB Back     alignment and domain information
>KOG1334 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PRK11756 exonuclease III; Provisional Back     alignment and domain information
>KOG2394 consensus WD40 protein DMR-N9 [General function prediction only] Back     alignment and domain information
>KOG2111 consensus Uncharacterized conserved protein, contains WD40 repeats [Function unknown] Back     alignment and domain information
>KOG4190 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF02239 Cytochrom_D1: Cytochrome D1 heme domain; PDB: 1NNO_B 1HZU_A 1N15_B 1N50_A 1GJQ_A 1BL9_B 1NIR_B 1N90_B 1HZV_A 1AOQ_A Back     alignment and domain information
>KOG4547 consensus WD40 repeat-containing protein [General function prediction only] Back     alignment and domain information
>TIGR00633 xth exodeoxyribonuclease III (xth) Back     alignment and domain information
>PRK04922 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG1409 consensus Uncharacterized conserved protein, contains WD40 repeats and FYVE domains [Function unknown] Back     alignment and domain information
>KOG1523 consensus Actin-related protein Arp2/3 complex, subunit ARPC1/p41-ARC [Cytoskeleton] Back     alignment and domain information
>KOG1587 consensus Cytoplasmic dynein intermediate chain [Cytoskeleton] Back     alignment and domain information
>PRK00178 tolB translocation protein TolB; Provisional Back     alignment and domain information
>TIGR02800 propeller_TolB tol-pal system beta propeller repeat protein TolB Back     alignment and domain information
>KOG2110 consensus Uncharacterized conserved protein, contains WD40 repeats [Function unknown] Back     alignment and domain information
>TIGR03300 assembly_YfgL outer membrane assembly lipoprotein YfgL Back     alignment and domain information
>PF08662 eIF2A: Eukaryotic translation initiation factor eIF2A; InterPro: IPR013979 This entry contains beta propellor domains found in eukaryotic translation initiation factors and TolB domain-containing proteins Back     alignment and domain information
>PF08662 eIF2A: Eukaryotic translation initiation factor eIF2A; InterPro: IPR013979 This entry contains beta propellor domains found in eukaryotic translation initiation factors and TolB domain-containing proteins Back     alignment and domain information
>PRK04792 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK02889 tolB translocation protein TolB; Provisional Back     alignment and domain information
>COG3568 ElsH Metal-dependent hydrolase [General function prediction only] Back     alignment and domain information
>KOG1354 consensus Serine/threonine protein phosphatase 2A, regulatory subunit [Signal transduction mechanisms] Back     alignment and domain information
>KOG1272 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification] Back     alignment and domain information
>KOG4190 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2394 consensus WD40 protein DMR-N9 [General function prediction only] Back     alignment and domain information
>PF02239 Cytochrom_D1: Cytochrome D1 heme domain; PDB: 1NNO_B 1HZU_A 1N15_B 1N50_A 1GJQ_A 1BL9_B 1NIR_B 1N90_B 1HZV_A 1AOQ_A Back     alignment and domain information
>KOG1064 consensus RAVE (regulator of V-ATPase assembly) complex subunit RAV1/DMX protein, WD repeat superfamily [General function prediction only] Back     alignment and domain information
>PF00400 WD40: WD domain, G-beta repeat; InterPro: IPR019781 WD-40 repeats (also known as WD or beta-transducin repeats) are short ~40 amino acid motifs, often terminating in a Trp-Asp (W-D) dipeptide Back     alignment and domain information
>PLN02919 haloacid dehalogenase-like hydrolase family protein Back     alignment and domain information
>KOG2139 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG1064 consensus RAVE (regulator of V-ATPase assembly) complex subunit RAV1/DMX protein, WD repeat superfamily [General function prediction only] Back     alignment and domain information
>KOG1524 consensus WD40 repeat-containing protein CHE-2 [General function prediction only] Back     alignment and domain information
>PLN02919 haloacid dehalogenase-like hydrolase family protein Back     alignment and domain information
>KOG3914 consensus WD repeat protein WDR4 [Function unknown] Back     alignment and domain information
>KOG2321 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>TIGR00195 exoDNase_III exodeoxyribonuclease III Back     alignment and domain information
>KOG2111 consensus Uncharacterized conserved protein, contains WD40 repeats [Function unknown] Back     alignment and domain information
>PRK13911 exodeoxyribonuclease III; Provisional Back     alignment and domain information
>PRK11138 outer membrane biogenesis protein BamB; Provisional Back     alignment and domain information
>KOG0309 consensus Conserved WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>PRK00178 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG2315 consensus Predicted translation initiation factor related to eIF-3a [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PF00400 WD40: WD domain, G-beta repeat; InterPro: IPR019781 WD-40 repeats (also known as WD or beta-transducin repeats) are short ~40 amino acid motifs, often terminating in a Trp-Asp (W-D) dipeptide Back     alignment and domain information
>TIGR02658 TTQ_MADH_Hv methylamine dehydrogenase heavy chain Back     alignment and domain information
>KOG4547 consensus WD40 repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF10282 Lactonase: Lactonase, 7-bladed beta-propeller; InterPro: IPR019405 6-phosphogluconolactonases (6PGL) 3 Back     alignment and domain information
>PF13360 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 3Q54_A 2YH3_A 3PRW_A 3P1L_A 3Q7M_A 3Q7O_A 3Q7N_A Back     alignment and domain information
>KOG1409 consensus Uncharacterized conserved protein, contains WD40 repeats and FYVE domains [Function unknown] Back     alignment and domain information
>COG5170 CDC55 Serine/threonine protein phosphatase 2A, regulatory subunit [Signal transduction mechanisms] Back     alignment and domain information
>KOG4497 consensus Uncharacterized conserved protein WDR8, contains WD repeats [General function prediction only] Back     alignment and domain information
>KOG3881 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK04792 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG1523 consensus Actin-related protein Arp2/3 complex, subunit ARPC1/p41-ARC [Cytoskeleton] Back     alignment and domain information
>PF13360 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 3Q54_A 2YH3_A 3PRW_A 3P1L_A 3Q7M_A 3Q7O_A 3Q7N_A Back     alignment and domain information
>KOG3914 consensus WD repeat protein WDR4 [Function unknown] Back     alignment and domain information
>COG2706 3-carboxymuconate cyclase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PLN03144 Carbon catabolite repressor protein 4 homolog; Provisional Back     alignment and domain information
>PRK01029 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PF14874 PapD-like: Flagellar-associated PapD-like Back     alignment and domain information
>KOG2321 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG2139 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>COG5354 Uncharacterized protein, contains Trp-Asp (WD) repeat [General function prediction only] Back     alignment and domain information
>PRK01029 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG2695 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0280 consensus Uncharacterized conserved protein [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR02658 TTQ_MADH_Hv methylamine dehydrogenase heavy chain Back     alignment and domain information
>COG0708 XthA Exonuclease III [DNA replication, recombination, and repair] Back     alignment and domain information
>KOG2041 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PF08450 SGL: SMP-30/Gluconolaconase/LRE-like region; InterPro: IPR013658 This family describes a region that is found in proteins expressed by a variety of eukaryotic and prokaryotic species Back     alignment and domain information
>PF10282 Lactonase: Lactonase, 7-bladed beta-propeller; InterPro: IPR019405 6-phosphogluconolactonases (6PGL) 3 Back     alignment and domain information
>KOG2314 consensus Translation initiation factor 3, subunit b (eIF-3b) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG2695 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG4497 consensus Uncharacterized conserved protein WDR8, contains WD repeats [General function prediction only] Back     alignment and domain information
>PRK11138 outer membrane biogenesis protein BamB; Provisional Back     alignment and domain information
>PTZ00297 pantothenate kinase; Provisional Back     alignment and domain information
>KOG1354 consensus Serine/threonine protein phosphatase 2A, regulatory subunit [Signal transduction mechanisms] Back     alignment and domain information
>KOG0280 consensus Uncharacterized conserved protein [Amino acid transport and metabolism] Back     alignment and domain information
>smart00476 DNaseIc deoxyribonuclease I Back     alignment and domain information
>PRK04043 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG2315 consensus Predicted translation initiation factor related to eIF-3a [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>COG4946 Uncharacterized protein related to the periplasmic component of the Tol biopolymer transport system [Function unknown] Back     alignment and domain information
>KOG2114 consensus Vacuolar assembly/sorting protein PEP5/VPS11 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PRK15251 cytolethal distending toxin subunit CdtB; Provisional Back     alignment and domain information
>smart00320 WD40 WD40 repeats Back     alignment and domain information
>COG4946 Uncharacterized protein related to the periplasmic component of the Tol biopolymer transport system [Function unknown] Back     alignment and domain information
>KOG0309 consensus Conserved WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>COG2706 3-carboxymuconate cyclase [Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG2756 consensus Predicted Mg2+-dependent phosphodiesterase TTRAP [Signal transduction mechanisms] Back     alignment and domain information
>PF14783 BBS2_Mid: Ciliary BBSome complex subunit 2, middle region Back     alignment and domain information
>PRK04043 tolB translocation protein TolB; Provisional Back     alignment and domain information
>smart00320 WD40 WD40 repeats Back     alignment and domain information
>COG5354 Uncharacterized protein, contains Trp-Asp (WD) repeat [General function prediction only] Back     alignment and domain information
>PF08450 SGL: SMP-30/Gluconolaconase/LRE-like region; InterPro: IPR013658 This family describes a region that is found in proteins expressed by a variety of eukaryotic and prokaryotic species Back     alignment and domain information
>PF11768 DUF3312: Protein of unknown function (DUF3312); InterPro: IPR024511 This is a eukaryotic family of uncharacterised proteins that contain WD40 repeats Back     alignment and domain information
>KOG4532 consensus WD40-like repeat containing protein [General function prediction only] Back     alignment and domain information
>PF15492 Nbas_N: Neuroblastoma-amplified sequence, N terminal Back     alignment and domain information
>PF00635 Motile_Sperm: MSP (Major sperm protein) domain; InterPro: IPR000535 Major sperm proteins (MSP) are central components in molecular interactions underlying sperm motility in Caenorhabditis elegans, whose sperm employ an amoebae-like crawling motion using a MSP-containing lamellipod, rather than the flagellar-based swimming motion associated with other sperm Back     alignment and domain information
>KOG0882 consensus Cyclophilin-related peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3873 consensus Sphingomyelinase family protein [Signal transduction mechanisms] Back     alignment and domain information
>KOG4714 consensus Nucleoporin [Nuclear structure] Back     alignment and domain information
>KOG2444 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PF15492 Nbas_N: Neuroblastoma-amplified sequence, N terminal Back     alignment and domain information
>PF07433 DUF1513: Protein of unknown function (DUF1513); InterPro: IPR008311 There are currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function Back     alignment and domain information
>KOG0882 consensus Cyclophilin-related peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF07433 DUF1513: Protein of unknown function (DUF1513); InterPro: IPR008311 There are currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function Back     alignment and domain information
>KOG1645 consensus RING-finger-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5170 CDC55 Serine/threonine protein phosphatase 2A, regulatory subunit [Signal transduction mechanisms] Back     alignment and domain information
>KOG4714 consensus Nucleoporin [Nuclear structure] Back     alignment and domain information
>PF04762 IKI3: IKI3 family; InterPro: IPR006849 Members of this family are components of the elongator multi-subunit component of a novel RNA polymerase II holoenzyme for transcriptional elongation [] Back     alignment and domain information
>KOG2041 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG2338 consensus Transcriptional effector CCR4-related protein [Transcription] Back     alignment and domain information
>KOG1275 consensus PAB-dependent poly(A) ribonuclease, subunit PAN2 [Replication, recombination and repair] Back     alignment and domain information
>KOG2066 consensus Vacuolar assembly/sorting protein VPS41 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF11768 DUF3312: Protein of unknown function (DUF3312); InterPro: IPR024511 This is a eukaryotic family of uncharacterised proteins that contain WD40 repeats Back     alignment and domain information
>cd00216 PQQ_DH Dehydrogenases with pyrrolo-quinoline quinone (PQQ) as cofactor, like ethanol, methanol, and membrane bound glucose dehydrogenases Back     alignment and domain information
>COG3386 Gluconolactonase [Carbohydrate transport and metabolism] Back     alignment and domain information
>cd00216 PQQ_DH Dehydrogenases with pyrrolo-quinoline quinone (PQQ) as cofactor, like ethanol, methanol, and membrane bound glucose dehydrogenases Back     alignment and domain information
>KOG2066 consensus Vacuolar assembly/sorting protein VPS41 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF08553 VID27: VID27 cytoplasmic protein; InterPro: IPR013863 This entry represents fungal and plant proteins and contains many hypothetical proteins Back     alignment and domain information
>KOG1832 consensus HIV-1 Vpr-binding protein [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG1275 consensus PAB-dependent poly(A) ribonuclease, subunit PAN2 [Replication, recombination and repair] Back     alignment and domain information
>KOG2079 consensus Vacuolar assembly/sorting protein VPS8 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG4640 consensus Anaphase-promoting complex (APC), subunit 4 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF04762 IKI3: IKI3 family; InterPro: IPR006849 Members of this family are components of the elongator multi-subunit component of a novel RNA polymerase II holoenzyme for transcriptional elongation [] Back     alignment and domain information
>KOG1645 consensus RING-finger-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1912 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG2444 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG2395 consensus Protein involved in vacuole import and degradation [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF14783 BBS2_Mid: Ciliary BBSome complex subunit 2, middle region Back     alignment and domain information
>KOG1832 consensus HIV-1 Vpr-binding protein [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG4532 consensus WD40-like repeat containing protein [General function prediction only] Back     alignment and domain information
>KOG2114 consensus Vacuolar assembly/sorting protein PEP5/VPS11 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF00780 CNH: CNH domain; InterPro: IPR001180 Based on sequence similarities a domain of homology has been identified in the following proteins []: Citron and Citron kinase Back     alignment and domain information
>PF04841 Vps16_N: Vps16, N-terminal region; InterPro: IPR006926 This protein forms part of the Class C vacuolar protein sorting (Vps) complex Back     alignment and domain information
>KOG2079 consensus Vacuolar assembly/sorting protein VPS8 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1912 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>COG3292 Predicted periplasmic ligand-binding sensor domain [Signal transduction mechanisms] Back     alignment and domain information
>PF08553 VID27: VID27 cytoplasmic protein; InterPro: IPR013863 This entry represents fungal and plant proteins and contains many hypothetical proteins Back     alignment and domain information
>KOG1920 consensus IkappaB kinase complex, IKAP component [Transcription] Back     alignment and domain information
>KOG3621 consensus WD40 repeat-containing protein [General function prediction only] Back     alignment and domain information
>COG3386 Gluconolactonase [Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG4649 consensus PQQ (pyrrolo-quinoline quinone) repeat protein [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>KOG3617 consensus WD40 and TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>COG3292 Predicted periplasmic ligand-binding sensor domain [Signal transduction mechanisms] Back     alignment and domain information
>PF14529 Exo_endo_phos_2: Endonuclease-reverse transcriptase ; PDB: 2EI9_A 1WDU_B Back     alignment and domain information
>PF04053 Coatomer_WDAD: Coatomer WD associated region ; InterPro: IPR006692 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>PRK13616 lipoprotein LpqB; Provisional Back     alignment and domain information
>TIGR03118 PEPCTERM_chp_1 conserved hypothetical protein TIGR03118 Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query1115
3mtc_A313 Crystal Structure Of Inpp5b In Complex With Phospha 5e-45
3n9v_A313 Crystal Structure Of Inpp5b Length = 313 8e-44
1i9y_A347 Crystal Structure Of Inositol Polyphosphate 5-Phosp 3e-34
3nr8_B316 Crystal Structure Of Human Ship2 Length = 316 6e-24
2xsw_A357 Crystal Structure Of Human Inpp5e Length = 357 7e-22
1ntf_A282 Crystal Structure Of Cimex Nitrophorin Length = 282 2e-07
>pdb|3MTC|A Chain A, Crystal Structure Of Inpp5b In Complex With Phosphatidylinositol 4- Phosphate Length = 313 Back     alignment and structure

Iteration: 1

Score = 180 bits (456), Expect = 5e-45, Method: Compositional matrix adjust. Identities = 101/359 (28%), Positives = 176/359 (49%), Gaps = 53/359 (14%) Query: 545 LYTRMENLKILAGTWNVGQGRASQDALISWLGSAASDVGIVVVGLQEVEMGAGFLAMSAA 604 +YT ++N + AGT+NV G++ ++ L WL + + VG QE+++ + Sbjct: 1 MYTYIQNFRFFAGTYNVN-GQSPKECLRLWLSNGIQAPDVYCVGFQELDL---------S 50 Query: 605 KETVGLEGSAVGHWWLDMIGKILDDGSTFERVGSRQLAGLLIAVWVRKNLKDYVGDVDVA 664 KE + W + + L + + +V +L G+++ ++V++ Y+ +V+ Sbjct: 51 KEAFFFHDTPKEEEWFKAVSEGLHPDAKYAKVKLIRLVGIMLLLYVKQEHAAYISEVEAE 110 Query: 665 AVPCGFGRAIGNKGAVGLRVRVYDRIMCFVNCHFAAHLEAVNRRNADFDHVYRTMTFCRP 724 V G +GNKG V +R + ++ +C VN H AAH+E RRN D+ + M FC+P Sbjct: 111 TVGTGIMGRMGNKGGVAIRFQFHNTSICVVNSHLAAHIEEYERRNQDYKDICSRMQFCQP 170 Query: 725 SNLCXXXXXXXXXVVQMLRSTNPLSGLTVEGVPELSEADMVIFLGDFNYRLDGITYDEAR 784 S PL+ +S D++++LGD NYR++ + ++ + Sbjct: 171 DP-----------------SLPPLT---------ISNHDVILWLGDLNYRIEELDVEKVK 204 Query: 785 DFISQRCFDWLRERDQLRAEMEAGNVFQGMREADIKFPPTYKFEKHLAGLAGYDSGEKKR 844 I ++ F L DQL+ ++ A VF+G E ++ F PTYK++ G +D+ EK R Sbjct: 205 KLIEEKDFQMLYAYDQLKIQVAAKTVFEGFTEGELTFQPTYKYD---TGSDDWDTSEKCR 261 Query: 845 VPAWCDRILYRDSRSDLASECSLECPVASSILRYEACMDVTDSDHKPVRCIFSVDIARV 903 PAWCDRIL++ + L Y++ M + SDHKPV +F + + V Sbjct: 262 APAWCDRILWKGKN--------------ITQLSYQSHMALKTSDHKPVSSVFDIGVRVV 306
>pdb|3N9V|A Chain A, Crystal Structure Of Inpp5b Length = 313 Back     alignment and structure
>pdb|1I9Y|A Chain A, Crystal Structure Of Inositol Polyphosphate 5-Phosphatase Domain (Ipp5c) Of Spsynaptojanin Length = 347 Back     alignment and structure
>pdb|3NR8|B Chain B, Crystal Structure Of Human Ship2 Length = 316 Back     alignment and structure
>pdb|2XSW|A Chain A, Crystal Structure Of Human Inpp5e Length = 357 Back     alignment and structure
>pdb|1NTF|A Chain A, Crystal Structure Of Cimex Nitrophorin Length = 282 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query1115
3mtc_A313 Type II inositol-1,4,5-trisphosphate 5-phosphatas; 1e-114
1i9z_A347 Synaptojanin, phosphatidylinositol phosphate phosp 1e-100
4a9c_A316 Phosphatidylinositol-3,4,5-trisphosphate 5-phosph; 1e-96
2xsw_A357 72 kDa inositol polyphosphate 5-phosphatase; inosi 5e-95
2imq_X282 Salivary nitrophorin; ferrous heme, beta-sandwich, 6e-82
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-06
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-05
4a2l_A795 BT_4663, two-component system sensor histidine kin 8e-05
2oaj_A902 Protein SNI1; WD40 repeat, beta propeller, endocyt 4e-04
3qbt_B140 Inositol polyphosphate 5-phosphatase OCRL-1; prote 4e-04
>3mtc_A Type II inositol-1,4,5-trisphosphate 5-phosphatas; INPP5BA,phosphoinositide 5-phosphatase, inositol signalling, phosphatase, magnesium; HET: PIF; 2.40A {Homo sapiens} PDB: 3n9v_A Length = 313 Back     alignment and structure
 Score =  356 bits (914), Expect = e-114
 Identities = 96/366 (26%), Positives = 170/366 (46%), Gaps = 53/366 (14%)

Query: 545 LYTRMENLKILAGTWNVGQGRASQDALISWLGSAASDVGIVVVGLQEVEMGAGFLAMSAA 604
           +YT ++N +  AGT+NV  G++ ++ L  WL +      +  VG QE+++          
Sbjct: 1   MYTYIQNFRFFAGTYNVN-GQSPKECLRLWLSNGIQAPDVYCVGFQELDLSKE------- 52

Query: 605 KETVGLEGSAVGHWWLDMIGKILDDGSTFERVGSRQLAGLLIAVWVRKNLKDYVGDVDVA 664
                   +     W   + + L   + + +V   +L G+++ ++V++    Y+ +V+  
Sbjct: 53  --AFFFHDTPKEEEWFKAVSEGLHPDAKYAKVKLIRLVGIMLLLYVKQEHAAYISEVEAE 110

Query: 665 AVPCGFGRAIGNKGAVGLRVRVYDRIMCFVNCHFAAHLEAVNRRNADFDHVYRTMTFCRP 724
            V  G    +GNKG V +R + ++  +C VN H AAH+E   RRN D+  +   M FC+P
Sbjct: 111 TVGTGIMGRMGNKGGVAIRFQFHNTSICVVNSHLAAHIEEYERRNQDYKDICSRMQFCQP 170

Query: 725 SNLCSAAAAGASSVVQMLRSTNPLSGLTVEGVPELSEADMVIFLGDFNYRLDGITYDEAR 784
                                             +S  D++++LGD NYR++ +  ++ +
Sbjct: 171 DPSLPP--------------------------LTISNHDVILWLGDLNYRIEELDVEKVK 204

Query: 785 DFISQRCFDWLRERDQLRAEMEAGNVFQGMREADIKFPPTYKFEKHLAGLAGYDSGEKKR 844
             I ++ F  L   DQL+ ++ A  VF+G  E ++ F PTYK++    G   +D+ EK R
Sbjct: 205 KLIEEKDFQMLYAYDQLKIQVAAKTVFEGFTEGELTFQPTYKYDT---GSDDWDTSEKCR 261

Query: 845 VPAWCDRILYRDSRSDLASECSLECPVASSILRYEACMDVTDSDHKPVRCIFSVDIARVD 904
            PAWCDRIL++          ++        L Y++ M +  SDHKPV  +F + +  V 
Sbjct: 262 APAWCDRILWKGK--------NITQ------LSYQSHMALKTSDHKPVSSVFDIGVRVVA 307

Query: 905 ESVRRQ 910
                 
Sbjct: 308 HHHHHH 313


>1i9z_A Synaptojanin, phosphatidylinositol phosphate phosphatase; spsynaptojanin, IPP5C, IP3, IP2,, hydrolase; HET: 2IP; 1.80A {Schizosaccharomyces pombe} SCOP: d.151.1.2 PDB: 1i9y_A* Length = 347 Back     alignment and structure
>4a9c_A Phosphatidylinositol-3,4,5-trisphosphate 5-phosph; SGC, signalling, structural genomics consortium stockholm, magnesium binding, hydrolase; HET: B5F; 2.10A {Homo sapiens} PDB: 3nr8_B* Length = 316 Back     alignment and structure
>2xsw_A 72 kDa inositol polyphosphate 5-phosphatase; inositol signalling, SGC stockholm, structural genomics CONS hydrolase; 1.90A {Homo sapiens} Length = 357 Back     alignment and structure
>2imq_X Salivary nitrophorin; ferrous heme, beta-sandwich, transport protein; HET: HEM; 1.30A {Cimex lectularius} SCOP: d.151.1.2 PDB: 1ntf_A* 1y21_A* 1yjh_A* 1si6_X* Length = 282 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>4a2l_A BT_4663, two-component system sensor histidine kinase/RESP; transcription, beta-propeller; HET: PGE PG4 MES 2PE; 2.60A {Bacteroides thetaiotaomicron} PDB: 4a2m_A* Length = 795 Back     alignment and structure
>2oaj_A Protein SNI1; WD40 repeat, beta propeller, endocytosis/exocytosis complex; 2.40A {Saccharomyces cerevisiae} Length = 902 Back     alignment and structure
>3qbt_B Inositol polyphosphate 5-phosphatase OCRL-1; protein transport, vesicular trafficking, GTPase, LOWE syndr immunoglobulin fold, RAB8A, endocytosis; HET: GNP; 2.00A {Homo sapiens} Length = 140 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query1115
3mtc_A313 Type II inositol-1,4,5-trisphosphate 5-phosphatas; 100.0
4a9c_A316 Phosphatidylinositol-3,4,5-trisphosphate 5-phosph; 100.0
1i9z_A347 Synaptojanin, phosphatidylinositol phosphate phosp 100.0
2xsw_A357 72 kDa inositol polyphosphate 5-phosphatase; inosi 100.0
2imq_X282 Salivary nitrophorin; ferrous heme, beta-sandwich, 100.0
1nr0_A611 Actin interacting protein 1; beta propeller, WD40 100.0
2ymu_A577 WD-40 repeat protein; unknown function, two domain 100.0
1vyh_C410 Platelet-activating factor acetylhydrolase IB alph 100.0
1nr0_A611 Actin interacting protein 1; beta propeller, WD40 100.0
4gqb_B344 Methylosome protein 50; TIM barrel, beta-propeller 100.0
4g56_B357 MGC81050 protein; protein arginine methyltransfera 100.0
2ymu_A577 WD-40 repeat protein; unknown function, two domain 100.0
1got_B340 GT-beta; complex (GTP-binding/transducer), G prote 100.0
3ow8_A321 WD repeat-containing protein 61; structural genomi 100.0
1erj_A393 Transcriptional repressor TUP1; beta-propeller, tr 100.0
3fm0_A345 Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD r 100.0
2ynn_A304 Coatomer subunit beta'; protein transport, peptide 100.0
3iz6_a380 40S ribosomal protein RACK1 (RACK1); eukaryotic ri 100.0
2pbi_B354 Guanine nucleotide-binding protein subunit beta 5; 100.0
2hes_X330 YDR267CP; beta-propeller, WD40 repeat, biosyntheti 100.0
3frx_A319 Guanine nucleotide-binding protein subunit beta- l 100.0
1vyh_C410 Platelet-activating factor acetylhydrolase IB alph 100.0
4ery_A312 WD repeat-containing protein 5; WD40, WIN motif, b 100.0
2oaj_A902 Protein SNI1; WD40 repeat, beta propeller, endocyt 100.0
2pm9_A416 Protein WEB1, protein transport protein SEC31; bet 100.0
2xzm_R343 RACK1; ribosome, translation; 3.93A {Tetrahymena t 100.0
3ow8_A321 WD repeat-containing protein 61; structural genomi 100.0
4h5i_A365 Guanine nucleotide-exchange factor SEC12; copii ve 100.0
3sfz_A1249 APAF-1, apoptotic peptidase activating factor 1; a 100.0
1r5m_A425 SIR4-interacting protein SIF2; transcription corep 100.0
2pm7_B297 Protein transport protein SEC13, protein transport 100.0
4gqb_B344 Methylosome protein 50; TIM barrel, beta-propeller 100.0
3vl1_A420 26S proteasome regulatory subunit RPN14; beta-prop 100.0
4aow_A340 Guanine nucleotide-binding protein subunit beta-2; 100.0
1pgu_A615 Actin interacting protein 1; WD repeat, seven-blad 100.0
1got_B340 GT-beta; complex (GTP-binding/transducer), G prote 99.98
1p22_A435 F-BOX/WD-repeat protein 1A; ubiquitination, degrad 99.98
2oaj_A902 Protein SNI1; WD40 repeat, beta propeller, endocyt 99.97
4ggc_A318 P55CDC, cell division cycle protein 20 homolog; ce 99.97
2pbi_B354 Guanine nucleotide-binding protein subunit beta 5; 99.97
2j04_B524 YDR362CP, TAU91; beta propeller, type 2 promoters, 99.97
3bg1_A316 Protein SEC13 homolog; NPC, transport, WD repeat, 99.97
2ynn_A304 Coatomer subunit beta'; protein transport, peptide 99.97
3k26_A366 Polycomb protein EED; WD40, structural genomics, N 99.97
4gga_A420 P55CDC, cell division cycle protein 20 homolog; ce 99.97
2ovr_B445 FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 99.97
3dm0_A694 Maltose-binding periplasmic protein fused with RAC 99.97
3fm0_A345 Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD r 99.97
2hes_X330 YDR267CP; beta-propeller, WD40 repeat, biosyntheti 99.97
4g56_B357 MGC81050 protein; protein arginine methyltransfera 99.97
1gxr_A337 ESG1, transducin-like enhancer protein 1; transcri 99.97
1erj_A393 Transcriptional repressor TUP1; beta-propeller, tr 99.97
3zwl_B369 Eukaryotic translation initiation factor 3 subuni; 99.97
3i2n_A357 WD repeat-containing protein 92; WD40 repeats, str 99.97
4ery_A312 WD repeat-containing protein 5; WD40, WIN motif, b 99.97
1k8k_C372 P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta- 99.97
3v7d_B464 Cell division control protein 4; WD 40 domain, pho 99.97
3odt_A313 Protein DOA1; ubiquitin, nuclear protein; HET: MSE 99.97
3ei3_B383 DNA damage-binding protein 2; UV-damage, DDB, nucl 99.97
1sq9_A397 Antiviral protein SKI8; WD repeat, beta-transducin 99.97
3dwl_C377 Actin-related protein 2/3 complex subunit 1; prope 99.97
2xzm_R343 RACK1; ribosome, translation; 3.93A {Tetrahymena t 99.97
3iz6_a380 40S ribosomal protein RACK1 (RACK1); eukaryotic ri 99.97
1r5m_A425 SIR4-interacting protein SIF2; transcription corep 99.97
3v7d_B464 Cell division control protein 4; WD 40 domain, pho 99.97
3f3f_A351 Nucleoporin SEH1; structural protein, protein comp 99.97
3sfz_A1249 APAF-1, apoptotic peptidase activating factor 1; a 99.97
4aez_A401 CDC20, WD repeat-containing protein SLP1; cell cyc 99.96
3gre_A437 Serine/threonine-protein kinase VPS15; seven-blade 99.96
4e54_B435 DNA damage-binding protein 2; beta barrel, double 99.96
1pgu_A615 Actin interacting protein 1; WD repeat, seven-blad 99.96
2ovr_B445 FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 99.96
4a11_B408 DNA excision repair protein ERCC-8; DNA binding pr 99.96
3frx_A319 Guanine nucleotide-binding protein subunit beta- l 99.96
1yfq_A342 Cell cycle arrest protein BUB3; WD repeat WD40 rep 99.96
3jrp_A379 Fusion protein of protein transport protein SEC13 99.96
3vl1_A420 26S proteasome regulatory subunit RPN14; beta-prop 99.96
3dw8_B447 Serine/threonine-protein phosphatase 2A 55 kDa RE 99.96
2pm9_A416 Protein WEB1, protein transport protein SEC31; bet 99.96
3mmy_A368 MRNA export factor; mRNA export, nuclear protein; 99.96
3dm0_A694 Maltose-binding periplasmic protein fused with RAC 99.96
4h5i_A365 Guanine nucleotide-exchange factor SEC12; copii ve 99.96
1gxr_A337 ESG1, transducin-like enhancer protein 1; transcri 99.96
2pm7_B297 Protein transport protein SEC13, protein transport 99.95
1p22_A435 F-BOX/WD-repeat protein 1A; ubiquitination, degrad 99.95
3bg1_A316 Protein SEC13 homolog; NPC, transport, WD repeat, 99.95
4aow_A340 Guanine nucleotide-binding protein subunit beta-2; 99.95
2aq5_A402 Coronin-1A; WD40 repeat, 7-bladed beta-propeller, 99.95
2j04_B524 YDR362CP, TAU91; beta propeller, type 2 promoters, 99.95
3ei3_B383 DNA damage-binding protein 2; UV-damage, DDB, nucl 99.95
1sq9_A397 Antiviral protein SKI8; WD repeat, beta-transducin 99.95
4gq1_A393 NUP37; propeller, transport protein; 2.40A {Schizo 99.95
3mkq_A814 Coatomer beta'-subunit; beta-propeller, alpha-sole 99.95
3mkq_A814 Coatomer beta'-subunit; beta-propeller, alpha-sole 99.95
3dw8_B447 Serine/threonine-protein phosphatase 2A 55 kDa RE 99.95
3odt_A313 Protein DOA1; ubiquitin, nuclear protein; HET: MSE 99.95
3zwl_B369 Eukaryotic translation initiation factor 3 subuni; 99.94
3gre_A437 Serine/threonine-protein kinase VPS15; seven-blade 99.94
3k26_A366 Polycomb protein EED; WD40, structural genomics, N 99.94
3jro_A753 Fusion protein of protein transport protein SEC13 99.94
3i2n_A357 WD repeat-containing protein 92; WD40 repeats, str 99.94
1k8k_C372 P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta- 99.94
2w18_A356 PALB2, fancn, partner and localizer of BRCA2; fanc 99.94
2j04_A588 TAU60, YPL007P, hypothetical protein YPL007C; beta 99.94
2vdu_B450 TRNA (guanine-N(7)-)-methyltransferase- associated 99.94
4a11_B408 DNA excision repair protein ERCC-8; DNA binding pr 99.94
3f3f_A351 Nucleoporin SEH1; structural protein, protein comp 99.93
4e54_B435 DNA damage-binding protein 2; beta barrel, double 99.93
3dwl_C377 Actin-related protein 2/3 complex subunit 1; prope 99.93
3vu4_A355 KMHSV2; beta-propeller fold, protein transport; 2. 99.93
2xyi_A430 Probable histone-binding protein CAF1; transcripti 99.93
4gq1_A393 NUP37; propeller, transport protein; 2.40A {Schizo 99.93
2aq5_A402 Coronin-1A; WD40 repeat, 7-bladed beta-propeller, 99.93
4gga_A420 P55CDC, cell division cycle protein 20 homolog; ce 99.92
3mmy_A368 MRNA export factor; mRNA export, nuclear protein; 99.92
1yfq_A342 Cell cycle arrest protein BUB3; WD repeat WD40 rep 99.92
3jrp_A379 Fusion protein of protein transport protein SEC13 99.92
1l0q_A391 Surface layer protein; SLP, S-layer, 7-bladed beta 99.92
2j04_A588 TAU60, YPL007P, hypothetical protein YPL007C; beta 99.92
3lrv_A343 PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiqu 99.92
3lrv_A343 PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiqu 99.92
4aez_A401 CDC20, WD repeat-containing protein SLP1; cell cyc 99.92
3bws_A433 Protein LP49; two-domain, immunoglobulin-like, 7-b 99.91
2vdu_B450 TRNA (guanine-N(7)-)-methyltransferase- associated 99.91
4ggc_A318 P55CDC, cell division cycle protein 20 homolog; ce 99.91
3vu4_A355 KMHSV2; beta-propeller fold, protein transport; 2. 99.89
2w18_A356 PALB2, fancn, partner and localizer of BRCA2; fanc 99.89
2xyi_A430 Probable histone-binding protein CAF1; transcripti 99.89
1l0q_A391 Surface layer protein; SLP, S-layer, 7-bladed beta 99.88
3jro_A753 Fusion protein of protein transport protein SEC13 99.88
1nir_A543 Nitrite reductase; hemoprotein, denitrification, d 99.86
3bws_A433 Protein LP49; two-domain, immunoglobulin-like, 7-b 99.85
2hqs_A415 Protein TOLB; TOLB, PAL, TOL, transport protein-li 99.85
3qbt_B140 Inositol polyphosphate 5-phosphatase OCRL-1; prote 99.83
1k32_A1045 Tricorn protease; protein degradation, substrate g 99.82
3qis_A 366 Inositol polyphosphate 5-phosphatase OCRL-1; DENT 99.82
1nir_A543 Nitrite reductase; hemoprotein, denitrification, d 99.82
2ecf_A741 Dipeptidyl peptidase IV; prolyl oligopeptidase fam 99.77
2hqs_A415 Protein TOLB; TOLB, PAL, TOL, transport protein-li 99.77
1k32_A1045 Tricorn protease; protein degradation, substrate g 99.76
2ojh_A297 Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 99.74
1ri6_A343 Putative isomerase YBHE; 7-bladed propeller, enzym 99.73
3u4y_A331 Uncharacterized protein; structural genomics, PSI- 99.73
1xfd_A723 DIP, dipeptidyl aminopeptidase-like protein 6, dip 99.73
1pby_B337 Quinohemoprotein amine dehydrogenase 40 kDa subuni 99.72
3o4h_A582 Acylamino-acid-releasing enzyme; alpha/beta hydrol 99.72
2z3z_A706 Dipeptidyl aminopeptidase IV; peptidase family S9, 99.71
2ecf_A741 Dipeptidyl peptidase IV; prolyl oligopeptidase fam 99.71
3vgz_A353 Uncharacterized protein YNCE; beta-propeller, prot 99.7
3u4y_A331 Uncharacterized protein; structural genomics, PSI- 99.68
3hfq_A347 Uncharacterized protein LP_2219; Q88V64_lacpl, NES 99.68
1jmx_B349 Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 99.66
3vgz_A353 Uncharacterized protein YNCE; beta-propeller, prot 99.66
1pby_B337 Quinohemoprotein amine dehydrogenase 40 kDa subuni 99.66
1xfd_A723 DIP, dipeptidyl aminopeptidase-like protein 6, dip 99.64
2ojh_A297 Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 99.64
1z68_A719 Fibroblast activation protein, alpha subunit; sepr 99.63
2z3z_A706 Dipeptidyl aminopeptidase IV; peptidase family S9, 99.63
1z68_A719 Fibroblast activation protein, alpha subunit; sepr 99.62
2oit_A434 Nucleoporin 214KDA; NH2 terminal domain of NUP214/ 99.61
1jmx_B349 Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 99.6
3pe7_A388 Oligogalacturonate lyase; seven-bladed beta-propel 99.59
2oit_A434 Nucleoporin 214KDA; NH2 terminal domain of NUP214/ 99.59
1q7f_A286 NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL 99.58
3scy_A361 Hypothetical bacterial 6-phosphogluconolactonase; 99.58
3hfq_A347 Uncharacterized protein LP_2219; Q88V64_lacpl, NES 99.55
1ri6_A343 Putative isomerase YBHE; 7-bladed propeller, enzym 99.54
3fvz_A329 Peptidyl-glycine alpha-amidating monooxygenase; be 99.5
1jof_A365 Carboxy-CIS,CIS-muconate cyclase; beta-propeller, 99.48
3o4h_A582 Acylamino-acid-releasing enzyme; alpha/beta hydrol 99.47
4a5s_A740 Dipeptidyl peptidase 4 soluble form; hydrolase, ty 99.43
1jof_A365 Carboxy-CIS,CIS-muconate cyclase; beta-propeller, 99.41
3scy_A361 Hypothetical bacterial 6-phosphogluconolactonase; 99.41
4a5s_A740 Dipeptidyl peptidase 4 soluble form; hydrolase, ty 99.41
3fvz_A329 Peptidyl-glycine alpha-amidating monooxygenase; be 99.41
3azo_A662 Aminopeptidase; POP family, hydrolase; 2.00A {Stre 99.4
2oiz_A361 Aromatic amine dehydrogenase, large subunit; oxido 99.36
3c5m_A396 Oligogalacturonate lyase; blade-shaped beta-propel 99.35
3e5z_A296 Putative gluconolactonase; X-RAY NESG Q9RXN3 gluco 99.35
4gz1_A256 Tyrosyl-DNA phosphodiesterase 2; protein-DNA compl 99.33
1q7f_A286 NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL 99.33
2gop_A347 Trilobed protease; beta propeller, open velcro, hy 99.32
2oiz_A361 Aromatic amine dehydrogenase, large subunit; oxido 99.31
2dg1_A333 DRP35, lactonase; beta propeller, hydrolase; 1.72A 99.27
4fva_A256 5'-tyrosyl-DNA phosphodiesterase; 5'-phosphotyrosy 99.2
4f1h_A250 Tyrosyl-DNA phosphodiesterase 2; hydrolase-DNA com 99.19
2dg1_A333 DRP35, lactonase; beta propeller, hydrolase; 1.72A 99.19
2gop_A347 Trilobed protease; beta propeller, open velcro, hy 99.18
3azo_A662 Aminopeptidase; POP family, hydrolase; 2.00A {Stre 99.17
3pe7_A388 Oligogalacturonate lyase; seven-bladed beta-propel 99.16
2bkl_A695 Prolyl endopeptidase; mechanistic study, celiac sp 99.13
3dsm_A328 Uncharacterized protein bacuni_02894; seven_blated 99.12
2z2n_A299 Virginiamycin B lyase; seven-bladed beta-propeller 99.11
2bkl_A695 Prolyl endopeptidase; mechanistic study, celiac sp 99.11
3teb_A266 Endonuclease/exonuclease/phosphatase; PSI-biology, 99.11
1pjx_A314 Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotries 99.11
3no2_A276 Uncharacterized protein; six-bladed beta-propeller 99.11
4gew_A362 5'-tyrosyl-DNA phosphodiesterase; 5'-phosphotyrosy 99.1
2xdw_A710 Prolyl endopeptidase; alpha/beta-hydrolase, amnesi 99.1
1ako_A268 Exonuclease III; AP-endonuclease, DNA repair; 1.70 99.09
1rwi_B270 Serine/threonine-protein kinase PKND; beta propell 99.09
3dsm_A328 Uncharacterized protein bacuni_02894; seven_blated 99.09
3e5z_A296 Putative gluconolactonase; X-RAY NESG Q9RXN3 gluco 99.07
2xdw_A710 Prolyl endopeptidase; alpha/beta-hydrolase, amnesi 98.98
1rwi_B270 Serine/threonine-protein kinase PKND; beta propell 98.95
2z2n_A299 Virginiamycin B lyase; seven-bladed beta-propeller 98.95
1zwx_A301 SMCL, sphingomyelinase-C; dnase1-like fold, beta-h 98.94
3q7m_A376 Lipoprotein YFGL, BAMB; beta-propeller, BAM comple 98.94
3no2_A276 Uncharacterized protein; six-bladed beta-propeller 98.9
3i41_A317 Beta-hemolysin; beta toxin, sphingomyelinase, toxi 98.89
1qks_A567 Cytochrome CD1 nitrite reductase; enzyme, oxidored 98.88
2qc5_A300 Streptogramin B lactonase; beta propeller, lyase; 98.88
3c5m_A396 Oligogalacturonate lyase; blade-shaped beta-propel 98.86
1yr2_A741 Prolyl oligopeptidase; prolyl endopeptidase, mecha 98.85
3g6s_A267 Putative endonuclease/exonuclease/phosphatase fami 98.84
3hrp_A409 Uncharacterized protein; NP_812590.1, structural g 98.83
3hxj_A330 Pyrrolo-quinoline quinone; all beta protein. incom 98.83
3l1w_A257 Uncharacterized protein; APC29019.2, conserved pro 98.77
3dr2_A305 Exported gluconolactonase; gluconolactonase SMP-30 98.75
1yr2_A741 Prolyl oligopeptidase; prolyl endopeptidase, mecha 98.73
2qe8_A343 Uncharacterized protein; structural genomics, join 98.71
3g4e_A297 Regucalcin; six bladed beta-propeller, gluconolcat 98.71
3mpr_A298 Putative endonuclease/exonuclease/phosphatase FAM 98.71
1qks_A567 Cytochrome CD1 nitrite reductase; enzyme, oxidored 98.7
2ddr_A306 Sphingomyelin phosphodiesterase; DNAse I like fold 98.69
1pjx_A314 Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotries 98.67
2jc4_A256 Exodeoxyribonuclease III; hydrolase, repair phosph 98.67
2hz6_A369 Endoplasmic reticulum to nucleus signalling 1 isof 98.67
1xip_A388 Nucleoporin NUP159; beta-propeller, transport prot 98.67
2ghs_A326 AGR_C_1268P; regucalcin, structural genomics, join 98.65
2qc5_A300 Streptogramin B lactonase; beta propeller, lyase; 98.65
3sjl_D386 Methylamine dehydrogenase heavy chain; MAUG, C-hem 98.62
3iuj_A693 Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas 98.58
3g4e_A297 Regucalcin; six bladed beta-propeller, gluconolcat 98.53
3q7m_A376 Lipoprotein YFGL, BAMB; beta-propeller, BAM comple 98.51
4a2l_A795 BT_4663, two-component system sensor histidine kin 98.5
2mad_H373 Methylamine dehydrogenase (heavy subunit); oxidore 98.5
3sjl_D386 Methylamine dehydrogenase heavy chain; MAUG, C-hem 98.46
2mad_H373 Methylamine dehydrogenase (heavy subunit); oxidore 98.45
3hxj_A330 Pyrrolo-quinoline quinone; all beta protein. incom 98.44
2j63_A467 AP-endonuclease; base excision repair, lyase; 2.48 98.43
1vyb_A238 ORF2 contains A reverse transcriptase domain; endo 98.43
3hrp_A409 Uncharacterized protein; NP_812590.1, structural g 98.43
4a2l_A795 BT_4663, two-component system sensor histidine kin 98.43
3iuj_A693 Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas 98.36
2jc5_A259 Exodeoxyribonuclease; hydrolase, repair phosphodie 98.36
2o3h_A285 DNA-(apurinic or apyrimidinic site) lyase; APE, en 98.36
1wdu_A245 TRAS1 ORF2P; four-layered alpha/beta sandwich, RNA 98.36
2ghs_A326 AGR_C_1268P; regucalcin, structural genomics, join 98.35
2voa_A257 AF_EXO, XTHA, exodeoxyribonuclease III; EXOIII, AP 98.35
1yiq_A689 Quinohemoprotein alcohol dehydrogenase; electron t 98.34
3v9f_A781 Two-component system sensor histidine kinase/RESP 98.34
1yiq_A689 Quinohemoprotein alcohol dehydrogenase; electron t 98.3
2hz6_A369 Endoplasmic reticulum to nucleus signalling 1 isof 98.3
1kb0_A677 Quinohemoprotein alcohol dehydrogenase; beta-prope 98.3
1hd7_A318 DNA-(apurinic or apyrimidinic site) lyase; DNA rep 98.3
3v9f_A781 Two-component system sensor histidine kinase/RESP 98.29
3dr2_A305 Exported gluconolactonase; gluconolactonase SMP-30 98.23
1mda_H368 Methylamine dehydrogenase (heavy subunit); electro 98.19
2fp8_A322 Strictosidine synthase; six bladed beta propeller 98.17
1xip_A388 Nucleoporin NUP159; beta-propeller, transport prot 98.12
3c75_H426 MADH, methylamine dehydrogenase heavy chain; coppe 98.1
3c75_H426 MADH, methylamine dehydrogenase heavy chain; coppe 98.06
3g91_A265 MTH0212, exodeoxyribonuclease; double-strand speci 98.06
1kb0_A677 Quinohemoprotein alcohol dehydrogenase; beta-prope 97.9
2qe8_A343 Uncharacterized protein; structural genomics, join 97.88
1mda_H368 Methylamine dehydrogenase (heavy subunit); electro 97.79
1npe_A267 Nidogen, entactin; glycoprotein, basement membrane 97.68
1kv9_A668 Type II quinohemoprotein alcohol dehydrogenase; el 97.52
4b8c_D727 Glucose-repressible alcohol dehydrogenase transcr 97.39
3ngq_A398 CCR4-NOT transcription complex subunit 6-like; alp 97.36
1kv9_A668 Type II quinohemoprotein alcohol dehydrogenase; el 97.36
1npe_A267 Nidogen, entactin; glycoprotein, basement membrane 97.32
2ad6_A571 Methanol dehydrogenase subunit 1; PQQ configuratio 97.31
2a40_B260 Deoxyribonuclease-1; WAVE, WH2, WAsp, actin, DNAse 97.28
3nol_A262 Glutamine cyclotransferase; beta-propeller, glutam 97.16
1w6s_A599 Methanol dehydrogenase subunit 1; anisotropic, ele 97.16
2iwa_A266 Glutamine cyclotransferase; pyroglutamate, acyltra 97.07
2e6j_A112 Hydin protein; PAPD, structural genomics, NPPSFA, 97.04
3nok_A268 Glutaminyl cyclase; beta-propeller, cyclotransfera 96.96
2fp8_A322 Strictosidine synthase; six bladed beta propeller 96.93
2ys4_A122 Hydrocephalus-inducing protein homolog; hydin, PAP 96.93
1flg_A582 Protein (quinoprotein ethanol dehydrogenase); supe 96.87
2ei9_A240 Non-LTR retrotransposon R1BMKS ORF2 protein; four 96.84
2ece_A462 462AA long hypothetical selenium-binding protein; 96.8
3mbr_X243 Glutamine cyclotransferase; beta-propeller; 1.44A 96.7
3ott_A758 Two-component system sensor histidine kinase; beta 96.63
3nol_A262 Glutamine cyclotransferase; beta-propeller, glutam 96.57
2p4o_A306 Hypothetical protein; putative lactonase, structur 96.52
1flg_A582 Protein (quinoprotein ethanol dehydrogenase); supe 96.51
1k3i_A656 Galactose oxidase precursor; blade beta propeller, 96.47
3v65_B386 Low-density lipoprotein receptor-related protein; 96.46
1w6s_A599 Methanol dehydrogenase subunit 1; anisotropic, ele 96.32
2ad6_A571 Methanol dehydrogenase subunit 1; PQQ configuratio 96.31
3nok_A268 Glutaminyl cyclase; beta-propeller, cyclotransfera 96.21
2iwa_A266 Glutamine cyclotransferase; pyroglutamate, acyltra 96.2
3p5b_L400 Low density lipoprotein receptor variant; B-propel 96.14
1fwx_A595 Nitrous oxide reductase; beta-propeller domain, cu 96.13
1ijq_A316 LDL receptor, low-density lipoprotein receptor; be 96.12
3sov_A318 LRP-6, low-density lipoprotein receptor-related pr 96.03
3ott_A758 Two-component system sensor histidine kinase; beta 95.98
1sr4_B261 CDT B, cytolethal distending toxin protein B; bact 95.85
3v64_C349 Agrin; beta propeller, laminin-G, signaling, prote 95.76
1msp_A126 MSP, major sperm protein; cytoskeletal protein, ce 95.39
3mbr_X243 Glutamine cyclotransferase; beta-propeller; 1.44A 95.32
2xbg_A327 YCF48-like protein; photosynthesis, photosystem II 95.28
3m0c_C791 LDL receptor, low-density lipoprotein receptor; pr 95.28
3tc9_A430 Hypothetical hydrolase; 6-bladed beta-propeller, i 95.25
1m1s_A116 WR4; structural genomics, major sperm protein, bio 95.2
1row_A109 SSP-19, MSP-domain protein like family member; bet 95.15
2p4o_A306 Hypothetical protein; putative lactonase, structur 95.03
2xe4_A751 Oligopeptidase B; hydrolase-inhibitor complex, hyd 94.78
2xe4_A751 Oligopeptidase B; hydrolase-inhibitor complex, hyd 94.67
2f1n_A262 CDT B, cytolethal distending toxin subunit B; E.co 94.54
1z9l_A128 Vesicle-associated membrane protein-associated pro 94.42
3p5b_L400 Low density lipoprotein receptor variant; B-propel 94.39
3v65_B386 Low-density lipoprotein receptor-related protein; 94.39
2cri_A147 Vesicle-associated membrane protein-associated pro 94.14
3v64_C349 Agrin; beta propeller, laminin-G, signaling, prote 93.83
4hw6_A433 Hypothetical protein, IPT/TIG domain protein; puta 93.77
1wic_A152 Hypothetical protein riken cDNA 6030424E15; beta s 93.71
2xbg_A327 YCF48-like protein; photosynthesis, photosystem II 92.96
3m0c_C791 LDL receptor, low-density lipoprotein receptor; pr 92.69
1ijq_A316 LDL receptor, low-density lipoprotein receptor; be 92.03
1k3i_A656 Galactose oxidase precursor; blade beta propeller, 91.66
1fwx_A595 Nitrous oxide reductase; beta-propeller domain, cu 91.61
4a0p_A628 LRP6, LRP-6, low-density lipoprotein receptor-rela 89.79
2ece_A462 462AA long hypothetical selenium-binding protein; 89.52
2qsv_A220 Uncharacterized protein; MCSG, structural genomics 89.0
1n7d_A699 LDL receptor, low-density lipoprotein receptor; fa 86.02
3tc9_A430 Hypothetical hydrolase; 6-bladed beta-propeller, i 84.3
3ei3_A1158 DNA damage-binding protein 1; UV-damage, DDB, nucl 83.72
2p9w_A334 MAL S 1 allergenic protein; beta propeller; 1.35A 83.59
3amr_A355 3-phytase; beta-propeller, phytate, MYO-inositol h 83.54
3sov_A318 LRP-6, low-density lipoprotein receptor-related pr 82.03
4hw6_A433 Hypothetical protein, IPT/TIG domain protein; puta 81.09
>3mtc_A Type II inositol-1,4,5-trisphosphate 5-phosphatas; INPP5BA,phosphoinositide 5-phosphatase, inositol signalling, phosphatase, magnesium; HET: PIF; 2.40A {Homo sapiens} PDB: 3n9v_A Back     alignment and structure
Probab=100.00  E-value=2.9e-87  Score=746.64  Aligned_cols=306  Identities=31%  Similarity=0.657  Sum_probs=277.0

Q ss_pred             cceecccceEEEEEEeCCCCCCchhhhccccCCCCCceeEEEEEecccCccchhhhhhhhhhhcCCCCcchhhHHHHHhc
Q 001245          546 YTRMENLKILAGTWNVGQGRASQDALISWLGSAASDVGIVVVGLQEVEMGAGFLAMSAAKETVGLEGSAVGHWWLDMIGK  625 (1115)
Q Consensus       546 yt~~~~irI~v~TWNv~~~~~~~~~L~~wl~~~~~~~Di~viGlQEi~~~~~~~~~~~~ke~~~~~~s~~~~~W~~~l~~  625 (1115)
                      ||..++++|+|||||||+..| .++|.+||.....+||||||||||+++++..+..         .+++..+.|.+.|.+
T Consensus         2 yt~~~~~~i~v~TwNvng~~~-~~~l~~wL~~~~~~pDI~viGlQE~~l~~~~~~~---------~~~~~~~~W~~~i~~   71 (313)
T 3mtc_A            2 YTYIQNFRFFAGTYNVNGQSP-KECLRLWLSNGIQAPDVYCVGFQELDLSKEAFFF---------HDTPKEEEWFKAVSE   71 (313)
T ss_dssp             CEEEEEEEEEEEEEECTTCCC-CSCTHHHHSSSCCCCSEEEEEEECSCCSHHHHTT---------CCCHHHHHHHHHHHH
T ss_pred             CceeeccEEEEEEEEcCCccC-chhHHHHhcccCCCCCeEEEEEEecccchhhhcc---------cCcchHHHHHHHHHH
Confidence            899999999999999998876 5789999987667899999999999987654321         233446789999999


Q ss_pred             ccCCCCceEEEeeeccccEEEEEEEeccccCccCceeeeeeeeeccccccCcceEEEEEEEecEEEEEEeecccccchhH
Q 001245          626 ILDDGSTFERVGSRQLAGLLIAVWVRKNLKDYVGDVDVAAVPCGFGRAIGNKGAVGLRVRVYDRIMCFVNCHFAAHLEAV  705 (1115)
Q Consensus       626 ~L~~~~~y~~v~s~~L~Gi~l~vfvr~~l~~~i~~v~~~~v~tG~~g~~gNKGaV~ir~~i~~t~l~FVn~HLaA~~~~~  705 (1115)
                      +|+++.+|++|+++||+||+|+||||+++.++|++|++++|+||+||++||||||+|||.+++++|||||||||||++++
T Consensus        72 ~L~~~~~Y~~v~s~~lvGl~l~Vfvr~~~~~~i~~v~~~~v~tG~~g~~GNKGaV~ir~~~~~ts~cFVnsHLaA~~~~~  151 (313)
T 3mtc_A           72 GLHPDAKYAKVKLIRLVGIMLLLYVKQEHAAYISEVEAETVGTGIMGRMGNKGGVAIRFQFHNTSICVVNSHLAAHIEEY  151 (313)
T ss_dssp             HSCTTSCEEEEEEEEETTEEEEEEEEGGGGGGEEEEEEEEEECSGGGTSTTSEEEEEEEEETTEEEEEEEEECCCSGGGH
T ss_pred             hcCCCCCEEEEEEechhhhhhhhhhhhhhhhhcceeEeeeecccccccccCCceEEEEEEECCcEEEEEeeccCCCchHH
Confidence            99887889999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHHHHHHHhcccCCCCCccchhhcCCchhhhhcccCCCCCCCcccCCCCcCCcceEEEecccccccCCCChHHHHH
Q 001245          706 NRRNADFDHVYRTMTFCRPSNLCSAAAAGASSVVQMLRSTNPLSGLTVEGVPELSEADMVIFLGDFNYRLDGITYDEARD  785 (1115)
Q Consensus       706 ~~Rn~d~~~I~~~l~F~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~i~~~D~vfw~GDlNyRi~~~~~~~v~~  785 (1115)
                      ++||+||.+|++++.|+.....                          .....|.+||+|||||||||||+.++++++++
T Consensus       152 ~~Rn~d~~~I~~~l~f~~~~~~--------------------------~~~~~i~~~d~vfw~GDLNyRi~~~~~~~v~~  205 (313)
T 3mtc_A          152 ERRNQDYKDICSRMQFCQPDPS--------------------------LPPLTISNHDVILWLGDLNYRIEELDVEKVKK  205 (313)
T ss_dssp             HHHHHHHHHHHHHCCBCCSCSS--------------------------SCCBCTTSSSEEEEEEECCCCBCSSCHHHHHH
T ss_pred             HHHHHHHHHHHHhcccCCCCCc--------------------------cCCccccCCceEEEeccccccccCCCHHHHHH
Confidence            9999999999999999754221                          00124679999999999999998779999999


Q ss_pred             HHhhcChhHHhcchHHHHHHhcCCcccCccccCcccCCCccccccccCCcccccCCccccccccceeeeecCCCcccccc
Q 001245          786 FISQRCFDWLRERDQLRAEMEAGNVFQGMREADIKFPPTYKFEKHLAGLAGYDSGEKKRVPAWCDRILYRDSRSDLASEC  865 (1115)
Q Consensus       786 ~i~~~~~~~Ll~~DQL~~~~~~~~~f~gf~E~~I~F~PTYKyd~~~~g~~~yDts~k~R~PsWcDRIL~~~~~~~~~~~~  865 (1115)
                      +|++++|+.|+++|||++||++|++|.||+|++|+|||||||++|+   +.||||+|+|+|||||||||++..       
T Consensus       206 ~i~~~~~~~Ll~~DQL~~~~~~g~~f~gf~E~~I~F~PTYKyd~~s---~~ydts~k~R~PsWcDRIL~~~~~-------  275 (313)
T 3mtc_A          206 LIEEKDFQMLYAYDQLKIQVAAKTVFEGFTEGELTFQPTYKYDTGS---DDWDTSEKCRAPAWCDRILWKGKN-------  275 (313)
T ss_dssp             HHHTTCHHHHHTTBHHHHHHHTTSSCTTCBCCCCCSCCCBCBCTTS---SSBCCSTTCCCCBCCEEEEEEESS-------
T ss_pred             HHhcCCHHHHHHhHHHHHHHHcCCccCCcccCCcCcCCCccCcCCC---cccccccCEecccccceEEEecCC-------
Confidence            9999999999999999999999999999999999999999999854   689999999999999999999753       


Q ss_pred             cCCCccccceeeeeeccccccCCCCceeeEEEEEeeccC
Q 001245          866 SLECPVASSILRYEACMDVTDSDHKPVRCIFSVDIARVD  904 (1115)
Q Consensus       866 ~~~~p~~~~~~~Y~s~~~~~~SDHkPV~a~f~v~v~~v~  904 (1115)
                             ..++.|.|++++++||||||+|.|.+++++|-
T Consensus       276 -------i~~~~Y~s~~~~~~SDHrPV~a~f~~~~~~~~  307 (313)
T 3mtc_A          276 -------ITQLSYQSHMALKTSDHKPVSSVFDIGVRVVA  307 (313)
T ss_dssp             -------EEEEEEEECTTCCSSSSCCEEEEEEEEEEEEC
T ss_pred             -------eEEEeeeeccCccCCCccCeEEEEEEEEEEee
Confidence                   24689999999999999999999999998773



>4a9c_A Phosphatidylinositol-3,4,5-trisphosphate 5-phosph; SGC, signalling, structural genomics consortium stockholm, magnesium binding, hydrolase; HET: B5F; 2.10A {Homo sapiens} PDB: 3nr8_B* Back     alignment and structure
>1i9z_A Synaptojanin, phosphatidylinositol phosphate phosphatase; spsynaptojanin, IPP5C, IP3, IP2,, hydrolase; HET: 2IP; 1.80A {Schizosaccharomyces pombe} SCOP: d.151.1.2 PDB: 1i9y_A* Back     alignment and structure
>2xsw_A 72 kDa inositol polyphosphate 5-phosphatase; inositol signalling, SGC stockholm, structural genomics CONS hydrolase; 1.90A {Homo sapiens} Back     alignment and structure
>2imq_X Salivary nitrophorin; ferrous heme, beta-sandwich, transport protein; HET: HEM; 1.30A {Cimex lectularius} SCOP: d.151.1.2 PDB: 1ntf_A* 1y21_A* 1yjh_A* 1si6_X* Back     alignment and structure
>1nr0_A Actin interacting protein 1; beta propeller, WD40 repeat, ADF, cofilin, structural genomics, PSI, protein structure initiative; 1.70A {Caenorhabditis elegans} SCOP: b.69.4.1 b.69.4.1 PDB: 1pev_A Back     alignment and structure
>2ymu_A WD-40 repeat protein; unknown function, two domains; 1.79A {Nostoc punctiforme} Back     alignment and structure
>1vyh_C Platelet-activating factor acetylhydrolase IB alpha subunit; lissencephaly, platelet activacting factor, regulator of cytoplasmic dynein; 3.4A {Mus musculus} SCOP: b.69.4.1 Back     alignment and structure
>1nr0_A Actin interacting protein 1; beta propeller, WD40 repeat, ADF, cofilin, structural genomics, PSI, protein structure initiative; 1.70A {Caenorhabditis elegans} SCOP: b.69.4.1 b.69.4.1 PDB: 1pev_A Back     alignment and structure
>4gqb_B Methylosome protein 50; TIM barrel, beta-propeller, methyltransferase, methylation, transferase-protein binding complex; HET: 0XU; 2.06A {Homo sapiens} Back     alignment and structure
>4g56_B MGC81050 protein; protein arginine methyltransferase, protein complexes, histo methylation, transferase; HET: SAH; 2.95A {Xenopus laevis} Back     alignment and structure
>2ymu_A WD-40 repeat protein; unknown function, two domains; 1.79A {Nostoc punctiforme} Back     alignment and structure
>1got_B GT-beta; complex (GTP-binding/transducer), G protein, heterotrimer signal transduction; HET: GDP; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1b9y_A 1b9x_A* 2trc_B 1tbg_A 1gg2_B* 1omw_B 1gp2_B 1xhm_A 2qns_A 3ah8_B* 3cik_B 3kj5_A 3krw_B* 3krx_B* 3psc_B 3pvu_B* 3pvw_B* 1a0r_B* 2bcj_B* 3sn6_B* Back     alignment and structure
>3ow8_A WD repeat-containing protein 61; structural genomics consortium, SGC, transcriptio; 2.30A {Homo sapiens} Back     alignment and structure
>1erj_A Transcriptional repressor TUP1; beta-propeller, transcription inhibitor; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 Back     alignment and structure
>3fm0_A Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD repeat, biosynthetic prote structural genomics, structural genomics consortium; 1.70A {Homo sapiens} Back     alignment and structure
>2ynn_A Coatomer subunit beta'; protein transport, peptide binding protein, membrane traffic COPI-mediated trafficking, dilysine motifs; 1.78A {Saccharomyces cerevisiae} PDB: 2yno_A Back     alignment and structure
>3iz6_a 40S ribosomal protein RACK1 (RACK1); eukaryotic ribosome,homology modeling,de novo modeling,ribos proteins,novel ribosomal proteins, ribosome; 5.50A {Triticum aestivum} Back     alignment and structure
>2pbi_B Guanine nucleotide-binding protein subunit beta 5; helix WRAP, RGS domain, DEP domain, DHEX domain, GGL domain, propeller, signaling protein; 1.95A {Mus musculus} Back     alignment and structure
>2hes_X YDR267CP; beta-propeller, WD40 repeat, biosynthetic protein; 1.70A {Saccharomyces cerevisiae} Back     alignment and structure
>3frx_A Guanine nucleotide-binding protein subunit beta- like protein; RACK1, WD40, beta propeller, ribosome, translation, acetylation; 2.13A {Saccharomyces cerevisiae} PDB: 3izb_a 3o2z_T 3o30_T 3u5c_g 3u5g_g 3rfg_A 3rfh_A 1trj_A 3jyv_R* Back     alignment and structure
>1vyh_C Platelet-activating factor acetylhydrolase IB alpha subunit; lissencephaly, platelet activacting factor, regulator of cytoplasmic dynein; 3.4A {Mus musculus} SCOP: b.69.4.1 Back     alignment and structure
>4ery_A WD repeat-containing protein 5; WD40, WIN motif, beta propeller, 3-10 helix, lysine methyltransferase, RBBP5, ASH2L, core complex; 1.30A {Homo sapiens} PDB: 2h6k_A* 2h68_A* 2h6q_A* 3eg6_A 4erq_A 2h6n_A 4erz_A 4es0_A 4esg_A 4ewr_A 2gnq_A 2xl2_A 2xl3_A 3uvk_A* 3psl_A* 3uvl_A 3uvm_A 3uvn_A 3uvo_A 2h14_A ... Back     alignment and structure
>2oaj_A Protein SNI1; WD40 repeat, beta propeller, endocytosis/exocytosis complex; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2pm9_A Protein WEB1, protein transport protein SEC31; beta propeller; 3.30A {Saccharomyces cerevisiae} Back     alignment and structure
>2xzm_R RACK1; ribosome, translation; 3.93A {Tetrahymena thermophila} PDB: 2xzn_R Back     alignment and structure
>3ow8_A WD repeat-containing protein 61; structural genomics consortium, SGC, transcriptio; 2.30A {Homo sapiens} Back     alignment and structure
>4h5i_A Guanine nucleotide-exchange factor SEC12; copii vesicle budding, potassium binding site, beta propelle protein transport; 1.36A {Saccharomyces cerevisiae} PDB: 4h5j_A Back     alignment and structure
>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* Back     alignment and structure
>1r5m_A SIR4-interacting protein SIF2; transcription corepressor, WD40 repeat, beta propeller; 1.55A {Saccharomyces cerevisiae} Back     alignment and structure
>2pm7_B Protein transport protein SEC13, protein transport protein SEC31; beta propeller, alpha solenoid; 2.35A {Saccharomyces cerevisiae} PDB: 2pm9_B 2pm6_B 3iko_A 3mzk_A 3mzl_A Back     alignment and structure
>4gqb_B Methylosome protein 50; TIM barrel, beta-propeller, methyltransferase, methylation, transferase-protein binding complex; HET: 0XU; 2.06A {Homo sapiens} Back     alignment and structure
>3vl1_A 26S proteasome regulatory subunit RPN14; beta-propeller, chaperone, RPT6; 1.60A {Saccharomyces cerevisiae} PDB: 3acp_A Back     alignment and structure
>4aow_A Guanine nucleotide-binding protein subunit beta-2; receptor, WD-repeat, beta-propeller; 2.45A {Homo sapiens} PDB: 2zkq_a Back     alignment and structure
>1pgu_A Actin interacting protein 1; WD repeat, seven-bladed beta-propeller, protein binding; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 b.69.4.1 PDB: 1pi6_A Back     alignment and structure
>1got_B GT-beta; complex (GTP-binding/transducer), G protein, heterotrimer signal transduction; HET: GDP; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1b9y_A 1b9x_A* 2trc_B 1tbg_A 1gg2_B* 1omw_B 1gp2_B 1xhm_A 2qns_A 3ah8_B* 3cik_B 3kj5_A 3krw_B* 3krx_B* 3psc_B 3pvu_B* 3pvw_B* 1a0r_B* 2bcj_B* 3sn6_B* Back     alignment and structure
>1p22_A F-BOX/WD-repeat protein 1A; ubiquitination, degradation, signaling protein; HET: SEP; 2.95A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 Back     alignment and structure
>2oaj_A Protein SNI1; WD40 repeat, beta propeller, endocytosis/exocytosis complex; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4ggc_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; HET: MRD; 1.35A {Homo sapiens} Back     alignment and structure
>2pbi_B Guanine nucleotide-binding protein subunit beta 5; helix WRAP, RGS domain, DEP domain, DHEX domain, GGL domain, propeller, signaling protein; 1.95A {Mus musculus} Back     alignment and structure
>2j04_B YDR362CP, TAU91; beta propeller, type 2 promoters, transcription, hypothetica protein, preinitiation complex, yeast RNA polymerase III; 3.2A {Saccharomyces cerevisiae} Back     alignment and structure
>3bg1_A Protein SEC13 homolog; NPC, transport, WD repeat, autocatalytic cleavage, mRNA transport, nuclear pore complex, nucleus, phosphoprotein; 3.00A {Homo sapiens} PDB: 3bg0_A Back     alignment and structure
>2ynn_A Coatomer subunit beta'; protein transport, peptide binding protein, membrane traffic COPI-mediated trafficking, dilysine motifs; 1.78A {Saccharomyces cerevisiae} PDB: 2yno_A Back     alignment and structure
>3k26_A Polycomb protein EED; WD40, structural genomics, NPPSFA, national project on prote structural and functional analysis, structural genomics CON SGC; HET: M3L; 1.58A {Homo sapiens} PDB: 3jzn_A* 3k27_A* 3jpx_A* 3jzg_A* 3jzh_A* 3iiw_A* 3ijc_A* 3iiy_A* 3ij0_A* 3ij1_A* 2qxv_A Back     alignment and structure
>4gga_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; 2.04A {Homo sapiens} PDB: 4ggd_A Back     alignment and structure
>2ovr_B FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 domains, double phosphorylation, transcription-C complex; HET: TPO; 2.50A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 PDB: 2ovp_B* 2ovq_B* Back     alignment and structure
>3dm0_A Maltose-binding periplasmic protein fused with RACK1; MBP RACK1A, receptor for activiated protein C-kinase 1, beta-propeller WD40 repeat; HET: GLC; 2.40A {Escherichia coli} Back     alignment and structure
>3fm0_A Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD repeat, biosynthetic prote structural genomics, structural genomics consortium; 1.70A {Homo sapiens} Back     alignment and structure
>2hes_X YDR267CP; beta-propeller, WD40 repeat, biosynthetic protein; 1.70A {Saccharomyces cerevisiae} Back     alignment and structure
>4g56_B MGC81050 protein; protein arginine methyltransferase, protein complexes, histo methylation, transferase; HET: SAH; 2.95A {Xenopus laevis} Back     alignment and structure
>1gxr_A ESG1, transducin-like enhancer protein 1; transcriptional CO-repressor, WD40, transcription repressor, WD repeat; 1.65A {Homo sapiens} SCOP: b.69.4.1 PDB: 2ce8_A 2ce9_A Back     alignment and structure
>1erj_A Transcriptional repressor TUP1; beta-propeller, transcription inhibitor; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 Back     alignment and structure
>3zwl_B Eukaryotic translation initiation factor 3 subuni; 2.20A {Saccharomyces cerevisiae} Back     alignment and structure
>3i2n_A WD repeat-containing protein 92; WD40 repeats, structural genomics, structural genomic consortium, SGC, apoptosis, transcription; 1.95A {Homo sapiens} Back     alignment and structure
>4ery_A WD repeat-containing protein 5; WD40, WIN motif, beta propeller, 3-10 helix, lysine methyltransferase, RBBP5, ASH2L, core complex; 1.30A {Homo sapiens} PDB: 2h6k_A* 2h68_A* 2h6q_A* 3eg6_A 4erq_A 2h6n_A 4erz_A 4es0_A 4esg_A 4ewr_A 2gnq_A 2xl2_A 2xl3_A 3uvk_A* 3psl_A* 3uvl_A 3uvm_A 3uvn_A 3uvo_A 2h14_A ... Back     alignment and structure
>1k8k_C P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta-propeller, structural protein; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1tyq_C* 1u2v_C* 2p9i_C* 2p9k_C* 2p9l_C 2p9n_C* 2p9p_C* 2p9s_C* 2p9u_C* 3rse_C 3dxm_C* 3dxk_C Back     alignment and structure
>3v7d_B Cell division control protein 4; WD 40 domain, phospho-peptide complex, E3 ubiquitin ligase, cell cycle, phospho binding protein, phosphorylation; HET: SEP; 2.31A {Saccharomyces cerevisiae} PDB: 1nex_B* 3mks_B* Back     alignment and structure
>3odt_A Protein DOA1; ubiquitin, nuclear protein; HET: MSE MES; 1.35A {Saccharomyces cerevisiae} Back     alignment and structure
>3ei3_B DNA damage-binding protein 2; UV-damage, DDB, nucleotide excision repair, xeroderma pigmentosum, cytoplasm, DNA repair; HET: DNA PG4; 2.30A {Danio rerio} PDB: 3ei1_B* 3ei2_B* 4a08_B* 4a09_B* 4a0a_B* 4a0b_B* 4a0k_D* 4a0l_B* Back     alignment and structure
>1sq9_A Antiviral protein SKI8; WD repeat, beta-transducin repeat, WD40 repeat, beta propeller, recombination; 1.90A {Saccharomyces cerevisiae} SCOP: b.69.4.1 PDB: 1s4u_X Back     alignment and structure
>3dwl_C Actin-related protein 2/3 complex subunit 1; propellor, actin-binding, ATP-binding, cytoskeleton, nucleot binding, WD repeat; HET: ATP; 3.78A {Schizosaccharomyces pombe} Back     alignment and structure
>2xzm_R RACK1; ribosome, translation; 3.93A {Tetrahymena thermophila} PDB: 2xzn_R Back     alignment and structure
>3iz6_a 40S ribosomal protein RACK1 (RACK1); eukaryotic ribosome,homology modeling,de novo modeling,ribos proteins,novel ribosomal proteins, ribosome; 5.50A {Triticum aestivum} Back     alignment and structure
>1r5m_A SIR4-interacting protein SIF2; transcription corepressor, WD40 repeat, beta propeller; 1.55A {Saccharomyces cerevisiae} Back     alignment and structure
>3v7d_B Cell division control protein 4; WD 40 domain, phospho-peptide complex, E3 ubiquitin ligase, cell cycle, phospho binding protein, phosphorylation; HET: SEP; 2.31A {Saccharomyces cerevisiae} PDB: 1nex_B* 3mks_B* Back     alignment and structure
>3f3f_A Nucleoporin SEH1; structural protein, protein complex, nucleopori complex, nuclear pore complex, macromolecular assembly, MEM coat; 2.90A {Saccharomyces cerevisiae} PDB: 3f3g_A 3f3p_A 3ewe_A Back     alignment and structure
>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* Back     alignment and structure
>4aez_A CDC20, WD repeat-containing protein SLP1; cell cycle, KEN-BOX, D-BOX, APC/C; 2.30A {Schizosaccharomyces pombe} Back     alignment and structure
>3gre_A Serine/threonine-protein kinase VPS15; seven-bladed propeller, WD repeat, scaffold protein, ATP- binding, endosome, golgi apparatus; 1.80A {Saccharomyces cerevisiae} Back     alignment and structure
>4e54_B DNA damage-binding protein 2; beta barrel, double helix, DDB1:WD40 beta-barrel fold, DNA D DNA repair, HOST-virus interactions; HET: DNA 3DR; 2.85A {Homo sapiens} PDB: 3ei4_B* Back     alignment and structure
>1pgu_A Actin interacting protein 1; WD repeat, seven-bladed beta-propeller, protein binding; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 b.69.4.1 PDB: 1pi6_A Back     alignment and structure
>2ovr_B FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 domains, double phosphorylation, transcription-C complex; HET: TPO; 2.50A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 PDB: 2ovp_B* 2ovq_B* Back     alignment and structure
>4a11_B DNA excision repair protein ERCC-8; DNA binding protein, DNA damage repair; HET: DNA; 3.31A {Homo sapiens} Back     alignment and structure
>3frx_A Guanine nucleotide-binding protein subunit beta- like protein; RACK1, WD40, beta propeller, ribosome, translation, acetylation; 2.13A {Saccharomyces cerevisiae} PDB: 3izb_a 3o2z_T 3o30_T 3u5c_g 3u5g_g 3rfg_A 3rfh_A 1trj_A 3jyv_R* Back     alignment and structure
>1yfq_A Cell cycle arrest protein BUB3; WD repeat WD40 repeat beta transducin repeat all beta, signaling protein; 1.10A {Saccharomyces cerevisiae} SCOP: b.69.4.2 PDB: 1u4c_A 2i3s_A 2i3t_A Back     alignment and structure
>3jrp_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3vl1_A 26S proteasome regulatory subunit RPN14; beta-propeller, chaperone, RPT6; 1.60A {Saccharomyces cerevisiae} PDB: 3acp_A Back     alignment and structure
>3dw8_B Serine/threonine-protein phosphatase 2A 55 kDa RE subunit B alpha isoform; holoenzyme, PR55, WD repeat, hydrolase, iron, manganese binding, methylation, phosphoprotein, protein phosphatase; HET: 1ZN; 2.85A {Homo sapiens} Back     alignment and structure
>2pm9_A Protein WEB1, protein transport protein SEC31; beta propeller; 3.30A {Saccharomyces cerevisiae} Back     alignment and structure
>3mmy_A MRNA export factor; mRNA export, nuclear protein; HET: MES; 1.65A {Homo sapiens} Back     alignment and structure
>3dm0_A Maltose-binding periplasmic protein fused with RACK1; MBP RACK1A, receptor for activiated protein C-kinase 1, beta-propeller WD40 repeat; HET: GLC; 2.40A {Escherichia coli} Back     alignment and structure
>4h5i_A Guanine nucleotide-exchange factor SEC12; copii vesicle budding, potassium binding site, beta propelle protein transport; 1.36A {Saccharomyces cerevisiae} PDB: 4h5j_A Back     alignment and structure
>1gxr_A ESG1, transducin-like enhancer protein 1; transcriptional CO-repressor, WD40, transcription repressor, WD repeat; 1.65A {Homo sapiens} SCOP: b.69.4.1 PDB: 2ce8_A 2ce9_A Back     alignment and structure
>2pm7_B Protein transport protein SEC13, protein transport protein SEC31; beta propeller, alpha solenoid; 2.35A {Saccharomyces cerevisiae} PDB: 2pm9_B 2pm6_B 3iko_A 3mzk_A 3mzl_A Back     alignment and structure
>1p22_A F-BOX/WD-repeat protein 1A; ubiquitination, degradation, signaling protein; HET: SEP; 2.95A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 Back     alignment and structure
>3bg1_A Protein SEC13 homolog; NPC, transport, WD repeat, autocatalytic cleavage, mRNA transport, nuclear pore complex, nucleus, phosphoprotein; 3.00A {Homo sapiens} PDB: 3bg0_A Back     alignment and structure
>4aow_A Guanine nucleotide-binding protein subunit beta-2; receptor, WD-repeat, beta-propeller; 2.45A {Homo sapiens} PDB: 2zkq_a Back     alignment and structure
>2aq5_A Coronin-1A; WD40 repeat, 7-bladed beta-propeller, structural protein; HET: CME; 1.75A {Mus musculus} PDB: 2b4e_A Back     alignment and structure
>2j04_B YDR362CP, TAU91; beta propeller, type 2 promoters, transcription, hypothetica protein, preinitiation complex, yeast RNA polymerase III; 3.2A {Saccharomyces cerevisiae} Back     alignment and structure
>3ei3_B DNA damage-binding protein 2; UV-damage, DDB, nucleotide excision repair, xeroderma pigmentosum, cytoplasm, DNA repair; HET: DNA PG4; 2.30A {Danio rerio} PDB: 3ei1_B* 3ei2_B* 4a08_B* 4a09_B* 4a0a_B* 4a0b_B* 4a0k_D* 4a0l_B* Back     alignment and structure
>1sq9_A Antiviral protein SKI8; WD repeat, beta-transducin repeat, WD40 repeat, beta propeller, recombination; 1.90A {Saccharomyces cerevisiae} SCOP: b.69.4.1 PDB: 1s4u_X Back     alignment and structure
>4gq1_A NUP37; propeller, transport protein; 2.40A {Schizosaccharomyces pombe} PDB: 4gq2_P 4fhl_A 4fhm_A 4fhn_A Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>3dw8_B Serine/threonine-protein phosphatase 2A 55 kDa RE subunit B alpha isoform; holoenzyme, PR55, WD repeat, hydrolase, iron, manganese binding, methylation, phosphoprotein, protein phosphatase; HET: 1ZN; 2.85A {Homo sapiens} Back     alignment and structure
>3odt_A Protein DOA1; ubiquitin, nuclear protein; HET: MSE MES; 1.35A {Saccharomyces cerevisiae} Back     alignment and structure
>3zwl_B Eukaryotic translation initiation factor 3 subuni; 2.20A {Saccharomyces cerevisiae} Back     alignment and structure
>3gre_A Serine/threonine-protein kinase VPS15; seven-bladed propeller, WD repeat, scaffold protein, ATP- binding, endosome, golgi apparatus; 1.80A {Saccharomyces cerevisiae} Back     alignment and structure
>3k26_A Polycomb protein EED; WD40, structural genomics, NPPSFA, national project on prote structural and functional analysis, structural genomics CON SGC; HET: M3L; 1.58A {Homo sapiens} PDB: 3jzn_A* 3k27_A* 3jpx_A* 3jzg_A* 3jzh_A* 3iiw_A* 3ijc_A* 3iiy_A* 3ij0_A* 3ij1_A* 2qxv_A Back     alignment and structure
>3jro_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum, transport, membrane, mRNA transport; 4.00A {Saccharomyces cerevisiae} Back     alignment and structure
>3i2n_A WD repeat-containing protein 92; WD40 repeats, structural genomics, structural genomic consortium, SGC, apoptosis, transcription; 1.95A {Homo sapiens} Back     alignment and structure
>1k8k_C P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta-propeller, structural protein; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1tyq_C* 1u2v_C* 2p9i_C* 2p9k_C* 2p9l_C 2p9n_C* 2p9p_C* 2p9s_C* 2p9u_C* 3rse_C 3dxm_C* 3dxk_C Back     alignment and structure
>2w18_A PALB2, fancn, partner and localizer of BRCA2; fanconi anemia, homologous recomination, polymorphism, phosphoprotein, beta-propeller, WD40, nucleus; 1.90A {Homo sapiens} PDB: 3eu7_A Back     alignment and structure
>2j04_A TAU60, YPL007P, hypothetical protein YPL007C; beta propeller, type 2 promoters, transcription, hypothetica protein, preinitiation complex, yeast RNA polymerase III; 3.2A {Saccharomyces cerevisiae} Back     alignment and structure
>2vdu_B TRNA (guanine-N(7)-)-methyltransferase- associated WD repeat protein TRM82; S-adenosyl-L-methionine, tRNA processing, phosphorylation, M7G, spout MT, WD repeat; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4a11_B DNA excision repair protein ERCC-8; DNA binding protein, DNA damage repair; HET: DNA; 3.31A {Homo sapiens} Back     alignment and structure
>3f3f_A Nucleoporin SEH1; structural protein, protein complex, nucleopori complex, nuclear pore complex, macromolecular assembly, MEM coat; 2.90A {Saccharomyces cerevisiae} PDB: 3f3g_A 3f3p_A 3ewe_A Back     alignment and structure
>4e54_B DNA damage-binding protein 2; beta barrel, double helix, DDB1:WD40 beta-barrel fold, DNA D DNA repair, HOST-virus interactions; HET: DNA 3DR; 2.85A {Homo sapiens} PDB: 3ei4_B* Back     alignment and structure
>3dwl_C Actin-related protein 2/3 complex subunit 1; propellor, actin-binding, ATP-binding, cytoskeleton, nucleot binding, WD repeat; HET: ATP; 3.78A {Schizosaccharomyces pombe} Back     alignment and structure
>3vu4_A KMHSV2; beta-propeller fold, protein transport; 2.60A {Kluyveromyces marxianus} PDB: 4av9_A 4av8_A 4exv_A Back     alignment and structure
>2xyi_A Probable histone-binding protein CAF1; transcription, repressor, phosphoprotein, WD-repeat; HET: PG4; 1.75A {Drosophila melanogaster} PDB: 3c99_A 3c9c_A 2yb8_B 2yba_A 2xu7_A* 3gfc_A 3cfs_B 3cfv_B Back     alignment and structure
>4gq1_A NUP37; propeller, transport protein; 2.40A {Schizosaccharomyces pombe} PDB: 4gq2_P 4fhl_A 4fhm_A 4fhn_A Back     alignment and structure
>2aq5_A Coronin-1A; WD40 repeat, 7-bladed beta-propeller, structural protein; HET: CME; 1.75A {Mus musculus} PDB: 2b4e_A Back     alignment and structure
>4gga_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; 2.04A {Homo sapiens} PDB: 4ggd_A Back     alignment and structure
>3mmy_A MRNA export factor; mRNA export, nuclear protein; HET: MES; 1.65A {Homo sapiens} Back     alignment and structure
>1yfq_A Cell cycle arrest protein BUB3; WD repeat WD40 repeat beta transducin repeat all beta, signaling protein; 1.10A {Saccharomyces cerevisiae} SCOP: b.69.4.2 PDB: 1u4c_A 2i3s_A 2i3t_A Back     alignment and structure
>3jrp_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>1l0q_A Surface layer protein; SLP, S-layer, 7-bladed beta-propeller superfamily, protein binding; HET: YCM; 2.40A {Methanosarcina mazei} SCOP: b.1.3.1 b.69.2.3 Back     alignment and structure
>2j04_A TAU60, YPL007P, hypothetical protein YPL007C; beta propeller, type 2 promoters, transcription, hypothetica protein, preinitiation complex, yeast RNA polymerase III; 3.2A {Saccharomyces cerevisiae} Back     alignment and structure
>3lrv_A PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiquitin ligase, spliceosome, DNA damage, D repair, mRNA processing, nucleus; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3lrv_A PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiquitin ligase, spliceosome, DNA damage, D repair, mRNA processing, nucleus; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>4aez_A CDC20, WD repeat-containing protein SLP1; cell cycle, KEN-BOX, D-BOX, APC/C; 2.30A {Schizosaccharomyces pombe} Back     alignment and structure
>3bws_A Protein LP49; two-domain, immunoglobulin-like, 7-bladed beta propeller, unknown function; 1.99A {Leptospira interrogans} Back     alignment and structure
>2vdu_B TRNA (guanine-N(7)-)-methyltransferase- associated WD repeat protein TRM82; S-adenosyl-L-methionine, tRNA processing, phosphorylation, M7G, spout MT, WD repeat; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4ggc_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; HET: MRD; 1.35A {Homo sapiens} Back     alignment and structure
>3vu4_A KMHSV2; beta-propeller fold, protein transport; 2.60A {Kluyveromyces marxianus} PDB: 4av9_A 4av8_A 4exv_A Back     alignment and structure
>2w18_A PALB2, fancn, partner and localizer of BRCA2; fanconi anemia, homologous recomination, polymorphism, phosphoprotein, beta-propeller, WD40, nucleus; 1.90A {Homo sapiens} PDB: 3eu7_A Back     alignment and structure
>2xyi_A Probable histone-binding protein CAF1; transcription, repressor, phosphoprotein, WD-repeat; HET: PG4; 1.75A {Drosophila melanogaster} PDB: 3c99_A 3c9c_A 2yb8_B 2yba_A 2xu7_A* 3gfc_A 3cfs_B 3cfv_B Back     alignment and structure
>1l0q_A Surface layer protein; SLP, S-layer, 7-bladed beta-propeller superfamily, protein binding; HET: YCM; 2.40A {Methanosarcina mazei} SCOP: b.1.3.1 b.69.2.3 Back     alignment and structure
>3jro_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum, transport, membrane, mRNA transport; 4.00A {Saccharomyces cerevisiae} Back     alignment and structure
>1nir_A Nitrite reductase; hemoprotein, denitrification, domain swapping; HET: HEC DHE; 2.15A {Pseudomonas aeruginosa} SCOP: a.3.1.2 b.70.2.1 PDB: 1bl9_A* 1n15_A* 1n50_A* 1n90_A* 1gjq_A* 1nno_A* 1hzv_A* 1hzu_A* Back     alignment and structure
>3bws_A Protein LP49; two-domain, immunoglobulin-like, 7-bladed beta propeller, unknown function; 1.99A {Leptospira interrogans} Back     alignment and structure
>2hqs_A Protein TOLB; TOLB, PAL, TOL, transport protein-lipoprotein complex; 1.50A {Escherichia coli} SCOP: b.68.4.1 c.51.2.1 PDB: 3iax_A 1c5k_A 2ivz_A 2w8b_B 2w8b_A 1crz_A Back     alignment and structure
>3qbt_B Inositol polyphosphate 5-phosphatase OCRL-1; protein transport, vesicular trafficking, GTPase, LOWE syndr immunoglobulin fold, RAB8A, endocytosis; HET: GNP; 2.00A {Homo sapiens} Back     alignment and structure
>1k32_A Tricorn protease; protein degradation, substrate gating, serine protease, beta propeller, proteasome, hydrolase; 2.00A {Thermoplasma acidophilum} SCOP: b.36.1.3 b.68.7.1 b.69.9.1 c.14.1.2 PDB: 1n6e_A 1n6d_A 1n6f_A* Back     alignment and structure
>3qis_A Inositol polyphosphate 5-phosphatase OCRL-1; DENT disease, RAC1, RAB gtpases, APPL1, endocytic PATH golgi complex, hydrolase-protein binding complex; 2.30A {Homo sapiens} PDB: 2qv2_A Back     alignment and structure
>1nir_A Nitrite reductase; hemoprotein, denitrification, domain swapping; HET: HEC DHE; 2.15A {Pseudomonas aeruginosa} SCOP: a.3.1.2 b.70.2.1 PDB: 1bl9_A* 1n15_A* 1n50_A* 1n90_A* 1gjq_A* 1nno_A* 1hzv_A* 1hzu_A* Back     alignment and structure
>2ecf_A Dipeptidyl peptidase IV; prolyl oligopeptidase family, peptidase family S9, hydrolase; 2.80A {Stenotrophomonas maltophilia} Back     alignment and structure
>2hqs_A Protein TOLB; TOLB, PAL, TOL, transport protein-lipoprotein complex; 1.50A {Escherichia coli} SCOP: b.68.4.1 c.51.2.1 PDB: 3iax_A 1c5k_A 2ivz_A 2w8b_B 2w8b_A 1crz_A Back     alignment and structure
>1k32_A Tricorn protease; protein degradation, substrate gating, serine protease, beta propeller, proteasome, hydrolase; 2.00A {Thermoplasma acidophilum} SCOP: b.36.1.3 b.68.7.1 b.69.9.1 c.14.1.2 PDB: 1n6e_A 1n6d_A 1n6f_A* Back     alignment and structure
>2ojh_A Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 6-stranded beta-propeller, structural genomics, PSI-2; 1.85A {Agrobacterium tumefaciens str} Back     alignment and structure
>1ri6_A Putative isomerase YBHE; 7-bladed propeller, enzyme, PSI, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.00A {Escherichia coli} SCOP: b.69.11.1 Back     alignment and structure
>3u4y_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomi CS, MCSG; 2.99A {Desulfotomaculum acetoxidans} Back     alignment and structure
>1xfd_A DIP, dipeptidyl aminopeptidase-like protein 6, dipeptidylpeptidase 6; DPPX, DPP6, KV4, KV, KAF, membrane protein; HET: NDG NAG BMA MAN; 3.00A {Homo sapiens} SCOP: b.70.3.1 c.69.1.24 Back     alignment and structure
>1pby_B Quinohemoprotein amine dehydrogenase 40 kDa subunit; oxidoreductase; HET: TRW HEM; 1.70A {Paracoccus denitrificans} SCOP: b.69.2.2 PDB: 1jju_B* Back     alignment and structure
>3o4h_A Acylamino-acid-releasing enzyme; alpha/beta hydrolase fold, beta propeller, hydrolase, oligop SIZE selectivity; HET: GOL; 1.82A {Aeropyrum pernix} PDB: 3o4i_A 3o4j_A 2hu5_A* 1ve7_A* 1ve6_A* 2hu7_A* 3o4g_A 2hu8_A* 2qr5_A 2qzp_A Back     alignment and structure
>2z3z_A Dipeptidyl aminopeptidase IV; peptidase family S9, prolyl oligopeptidase family, serine PR proline-specific peptidase, hydrolase; HET: AIO; 1.95A {Porphyromonas gingivalis} PDB: 2z3w_A* 2d5l_A 2eep_A* 2dcm_A* Back     alignment and structure
>2ecf_A Dipeptidyl peptidase IV; prolyl oligopeptidase family, peptidase family S9, hydrolase; 2.80A {Stenotrophomonas maltophilia} Back     alignment and structure
>3vgz_A Uncharacterized protein YNCE; beta-propeller, protein binding; 1.70A {Escherichia coli} PDB: 3vh0_A* Back     alignment and structure
>3u4y_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomi CS, MCSG; 2.99A {Desulfotomaculum acetoxidans} Back     alignment and structure
>3hfq_A Uncharacterized protein LP_2219; Q88V64_lacpl, NESG, LPR118, structural genomics, PSI-2, protein structure initiative; 1.96A {Lactobacillus plantarum} Back     alignment and structure
>1jmx_B Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 1.90A {Pseudomonas putida} SCOP: b.69.2.2 PDB: 1jmz_B* Back     alignment and structure
>3vgz_A Uncharacterized protein YNCE; beta-propeller, protein binding; 1.70A {Escherichia coli} PDB: 3vh0_A* Back     alignment and structure
>1pby_B Quinohemoprotein amine dehydrogenase 40 kDa subunit; oxidoreductase; HET: TRW HEM; 1.70A {Paracoccus denitrificans} SCOP: b.69.2.2 PDB: 1jju_B* Back     alignment and structure
>1xfd_A DIP, dipeptidyl aminopeptidase-like protein 6, dipeptidylpeptidase 6; DPPX, DPP6, KV4, KV, KAF, membrane protein; HET: NDG NAG BMA MAN; 3.00A {Homo sapiens} SCOP: b.70.3.1 c.69.1.24 Back     alignment and structure
>2ojh_A Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 6-stranded beta-propeller, structural genomics, PSI-2; 1.85A {Agrobacterium tumefaciens str} Back     alignment and structure
>1z68_A Fibroblast activation protein, alpha subunit; seprase, fibroblast activation protein alpha,fapalpha, dipeptidylpeptidase,S9B; HET: NAG NDG; 2.60A {Homo sapiens} Back     alignment and structure
>2z3z_A Dipeptidyl aminopeptidase IV; peptidase family S9, prolyl oligopeptidase family, serine PR proline-specific peptidase, hydrolase; HET: AIO; 1.95A {Porphyromonas gingivalis} PDB: 2z3w_A* 2d5l_A 2eep_A* 2dcm_A* Back     alignment and structure
>1z68_A Fibroblast activation protein, alpha subunit; seprase, fibroblast activation protein alpha,fapalpha, dipeptidylpeptidase,S9B; HET: NAG NDG; 2.60A {Homo sapiens} Back     alignment and structure
>2oit_A Nucleoporin 214KDA; NH2 terminal domain of NUP214/CAN, X-RAY crystallography, beta-propeller, structure, mRNA export, NPC assembly, leukemia; HET: MES; 1.65A {Homo sapiens} PDB: 3fmo_A* 3fmp_A* 3fhc_A Back     alignment and structure
>1jmx_B Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 1.90A {Pseudomonas putida} SCOP: b.69.2.2 PDB: 1jmz_B* Back     alignment and structure
>3pe7_A Oligogalacturonate lyase; seven-bladed beta-propeller; 1.65A {Yersinia enterocolitica subsp} Back     alignment and structure
>2oit_A Nucleoporin 214KDA; NH2 terminal domain of NUP214/CAN, X-RAY crystallography, beta-propeller, structure, mRNA export, NPC assembly, leukemia; HET: MES; 1.65A {Homo sapiens} PDB: 3fmo_A* 3fmp_A* 3fhc_A Back     alignment and structure
>1q7f_A NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL repeat, beta-propeller, translation; 1.95A {Drosophila melanogaster} SCOP: b.68.9.1 Back     alignment and structure
>3scy_A Hypothetical bacterial 6-phosphogluconolactonase; 7-bladed beta-propeller, structural genomics, joint center F structural genomics, JCSG; HET: MSE; 1.50A {Bacteroides fragilis} PDB: 3fgb_A Back     alignment and structure
>3hfq_A Uncharacterized protein LP_2219; Q88V64_lacpl, NESG, LPR118, structural genomics, PSI-2, protein structure initiative; 1.96A {Lactobacillus plantarum} Back     alignment and structure
>1ri6_A Putative isomerase YBHE; 7-bladed propeller, enzyme, PSI, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.00A {Escherichia coli} SCOP: b.69.11.1 Back     alignment and structure
>3fvz_A Peptidyl-glycine alpha-amidating monooxygenase; beta propeller, lyase, peptide amidation, HG-MAD, Zn-MAD, CL PAIR of basic residues; 2.35A {Rattus norvegicus} PDB: 3fw0_A* Back     alignment and structure
>1jof_A Carboxy-CIS,CIS-muconate cyclase; beta-propeller, homotetramer, seMet-protein, isomerase; HET: PIN; 2.50A {Neurospora crassa} SCOP: b.69.10.1 Back     alignment and structure
>3o4h_A Acylamino-acid-releasing enzyme; alpha/beta hydrolase fold, beta propeller, hydrolase, oligop SIZE selectivity; HET: GOL; 1.82A {Aeropyrum pernix} PDB: 3o4i_A 3o4j_A 2hu5_A* 1ve7_A* 1ve6_A* 2hu7_A* 3o4g_A 2hu8_A* 2qr5_A 2qzp_A Back     alignment and structure
>4a5s_A Dipeptidyl peptidase 4 soluble form; hydrolase, type 2 diabetes, novartis compound NVP-BIV988; HET: N7F NAG MAN; 1.62A {Homo sapiens} PDB: 2qjr_A* 3f8s_A* 2qt9_A* 2qtb_A* 2rip_A* 1tk3_A* 1n1m_A* 1nu8_A* 1rwq_A* 1nu6_A* 1tkr_A* 1w1i_A* 2ajl_I* 2bgn_A* 2bub_A* 2ogz_A* 2ole_A* 2oqi_A* 3bjm_A* 3eio_A* ... Back     alignment and structure
>1jof_A Carboxy-CIS,CIS-muconate cyclase; beta-propeller, homotetramer, seMet-protein, isomerase; HET: PIN; 2.50A {Neurospora crassa} SCOP: b.69.10.1 Back     alignment and structure
>3scy_A Hypothetical bacterial 6-phosphogluconolactonase; 7-bladed beta-propeller, structural genomics, joint center F structural genomics, JCSG; HET: MSE; 1.50A {Bacteroides fragilis} PDB: 3fgb_A Back     alignment and structure
>4a5s_A Dipeptidyl peptidase 4 soluble form; hydrolase, type 2 diabetes, novartis compound NVP-BIV988; HET: N7F NAG MAN; 1.62A {Homo sapiens} PDB: 2qjr_A* 3f8s_A* 2qt9_A* 2qtb_A* 2rip_A* 1tk3_A* 1n1m_A* 1nu8_A* 1rwq_A* 1nu6_A* 1tkr_A* 1w1i_A* 2ajl_I* 2bgn_A* 2bub_A* 2ogz_A* 2ole_A* 2oqi_A* 3bjm_A* 3eio_A* ... Back     alignment and structure
>3fvz_A Peptidyl-glycine alpha-amidating monooxygenase; beta propeller, lyase, peptide amidation, HG-MAD, Zn-MAD, CL PAIR of basic residues; 2.35A {Rattus norvegicus} PDB: 3fw0_A* Back     alignment and structure
>3azo_A Aminopeptidase; POP family, hydrolase; 2.00A {Streptomyces morookaensis} PDB: 3azp_A 3azq_A Back     alignment and structure
>2oiz_A Aromatic amine dehydrogenase, large subunit; oxidoreductase, tryptophan tryptophyl quinone, H-tunneling; HET: TRQ TSR PG4; 1.05A {Alcaligenes faecalis} PDB: 2agw_A* 2agx_A* 2agl_A* 2agz_A* 2ah0_A* 2ah1_A* 2hj4_A* 2hjb_A* 2i0t_A* 2iup_A* 2iuq_A* 2iur_A* 2iuv_A* 2agy_A* 2ok4_A* 2ok6_A* 2iaa_A* 2h47_A* 2h3x_A* 2hkr_A* ... Back     alignment and structure
>3c5m_A Oligogalacturonate lyase; blade-shaped beta-propeller, structural genomics, PSI-2, protein structure initiative; 2.60A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>3e5z_A Putative gluconolactonase; X-RAY NESG Q9RXN3 gluconolactonase, structural genomics, PSI protein structure initiative; 2.01A {Deinococcus radiodurans} Back     alignment and structure
>4gz1_A Tyrosyl-DNA phosphodiesterase 2; protein-DNA complex, DNA repair, 5'-DNA END processing, endonuclease/exonuclease/phosphatase domain; HET: DNA EPE; 1.50A {Mus musculus} PDB: 4gyz_A* 4gz0_A* 4gz2_A* Back     alignment and structure
>1q7f_A NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL repeat, beta-propeller, translation; 1.95A {Drosophila melanogaster} SCOP: b.68.9.1 Back     alignment and structure
>2gop_A Trilobed protease; beta propeller, open velcro, hydrolase; 2.00A {Pyrococcus furiosus} Back     alignment and structure
>2oiz_A Aromatic amine dehydrogenase, large subunit; oxidoreductase, tryptophan tryptophyl quinone, H-tunneling; HET: TRQ TSR PG4; 1.05A {Alcaligenes faecalis} PDB: 2agw_A* 2agx_A* 2agl_A* 2agz_A* 2ah0_A* 2ah1_A* 2hj4_A* 2hjb_A* 2i0t_A* 2iup_A* 2iuq_A* 2iur_A* 2iuv_A* 2agy_A* 2ok4_A* 2ok6_A* 2iaa_A* 2h47_A* 2h3x_A* 2hkr_A* ... Back     alignment and structure
>2dg1_A DRP35, lactonase; beta propeller, hydrolase; 1.72A {Staphylococcus aureus} SCOP: b.68.6.1 PDB: 2dg0_A 2dso_A Back     alignment and structure
>4fva_A 5'-tyrosyl-DNA phosphodiesterase; 5'-phosphotyrosyl-DNA diesterase, hydrolase; HET: EDO; 2.07A {Caenorhabditis elegans} Back     alignment and structure
>4f1h_A Tyrosyl-DNA phosphodiesterase 2; hydrolase-DNA complex; HET: DNA; 1.66A {Danio rerio} PDB: 4fpv_A* 4f1h_B* Back     alignment and structure
>2dg1_A DRP35, lactonase; beta propeller, hydrolase; 1.72A {Staphylococcus aureus} SCOP: b.68.6.1 PDB: 2dg0_A 2dso_A Back     alignment and structure
>2gop_A Trilobed protease; beta propeller, open velcro, hydrolase; 2.00A {Pyrococcus furiosus} Back     alignment and structure
>3azo_A Aminopeptidase; POP family, hydrolase; 2.00A {Streptomyces morookaensis} PDB: 3azp_A 3azq_A Back     alignment and structure
>3pe7_A Oligogalacturonate lyase; seven-bladed beta-propeller; 1.65A {Yersinia enterocolitica subsp} Back     alignment and structure
>2bkl_A Prolyl endopeptidase; mechanistic study, celiac sprue, hydrolase, protease; HET: ZAH MES; 1.5A {Myxococcus xanthus} Back     alignment and structure
>3dsm_A Uncharacterized protein bacuni_02894; seven_blated beta propeller, structural genomics, PSI-2, Pro structure initiative; 1.90A {Bacteroides uniformis} Back     alignment and structure
>2z2n_A Virginiamycin B lyase; seven-bladed beta-propeller, antibiotic resistance, E mechanism, virginiamycin B hydrolase streptogramin; HET: MSE; 1.65A {Staphylococcus aureus} PDB: 2z2o_A 2z2p_A* Back     alignment and structure
>2bkl_A Prolyl endopeptidase; mechanistic study, celiac sprue, hydrolase, protease; HET: ZAH MES; 1.5A {Myxococcus xanthus} Back     alignment and structure
>3teb_A Endonuclease/exonuclease/phosphatase; PSI-biology, MCSG, midwest center for structural genomics; 2.99A {Leptotrichia buccalis c-1013-b} Back     alignment and structure
>1pjx_A Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotriesterase (PTE), nitrogen-calcium coordination, BET propeller; HET: ME2 MES PGE; 0.85A {Loligo vulgaris} SCOP: b.68.6.1 PDB: 1e1a_A* 2gvv_A* 2gvw_A 3byc_A 3kgg_A 3o4p_A* 3li3_A 2gvx_A 2gvu_A 3li4_A 2iaq_A 3li5_A* 2iao_A 2iap_A 2iau_A 2iax_A 2iaw_A 2ias_A 2iat_A 2iar_A ... Back     alignment and structure
>3no2_A Uncharacterized protein; six-bladed beta-propeller, structural genomics, joint center structural genomics, JCSG, protein structure initiative; HET: MSE CIT PEG; 1.35A {Bacteroides caccae} Back     alignment and structure
>4gew_A 5'-tyrosyl-DNA phosphodiesterase; 5'-phosphotyrosyl-DNA diesterase, hydrolase; 2.35A {Caenorhabditis elegans} PDB: 4f1i_A Back     alignment and structure
>2xdw_A Prolyl endopeptidase; alpha/beta-hydrolase, amnesia, beta-propeller, hydrolase, in; HET: PHQ TAM; 1.35A {Sus scrofa} PDB: 1qfm_A 1qfs_A* 1h2w_A* 3eq7_A* 3eq8_A* 3eq9_A* 1e8m_A* 1e8n_A 1h2z_A 1uoo_A 1uop_A 1uoq_A 1o6f_A 1h2x_A 1h2y_A* 1o6g_A 1vz3_A 1e5t_A 1vz2_A 3ddu_A* Back     alignment and structure
>1ako_A Exonuclease III; AP-endonuclease, DNA repair; 1.70A {Escherichia coli} SCOP: d.151.1.1 Back     alignment and structure
>1rwi_B Serine/threonine-protein kinase PKND; beta propeller, structural genomics, PSI, protein structure initiative; 1.80A {Mycobacterium tuberculosis} SCOP: b.68.9.1 PDB: 1rwl_A Back     alignment and structure
>3dsm_A Uncharacterized protein bacuni_02894; seven_blated beta propeller, structural genomics, PSI-2, Pro structure initiative; 1.90A {Bacteroides uniformis} Back     alignment and structure
>3e5z_A Putative gluconolactonase; X-RAY NESG Q9RXN3 gluconolactonase, structural genomics, PSI protein structure initiative; 2.01A {Deinococcus radiodurans} Back     alignment and structure
>2xdw_A Prolyl endopeptidase; alpha/beta-hydrolase, amnesia, beta-propeller, hydrolase, in; HET: PHQ TAM; 1.35A {Sus scrofa} PDB: 1qfm_A 1qfs_A* 1h2w_A* 3eq7_A* 3eq8_A* 3eq9_A* 1e8m_A* 1e8n_A 1h2z_A 1uoo_A 1uop_A 1uoq_A 1o6f_A 1h2x_A 1h2y_A* 1o6g_A 1vz3_A 1e5t_A 1vz2_A 3ddu_A* Back     alignment and structure
>1rwi_B Serine/threonine-protein kinase PKND; beta propeller, structural genomics, PSI, protein structure initiative; 1.80A {Mycobacterium tuberculosis} SCOP: b.68.9.1 PDB: 1rwl_A Back     alignment and structure
>2z2n_A Virginiamycin B lyase; seven-bladed beta-propeller, antibiotic resistance, E mechanism, virginiamycin B hydrolase streptogramin; HET: MSE; 1.65A {Staphylococcus aureus} PDB: 2z2o_A 2z2p_A* Back     alignment and structure
>1zwx_A SMCL, sphingomyelinase-C; dnase1-like fold, beta-hairpin, hydrolase; 1.90A {Listeria ivanovii} SCOP: d.151.1.3 Back     alignment and structure
>3q7m_A Lipoprotein YFGL, BAMB; beta-propeller, BAM complex, outer membrane protein folding, negative, BAMA, protein binding; 1.65A {Escherichia coli} PDB: 3q7n_A 3q7o_A 3p1l_A 3prw_A 2yh3_A 3q54_A Back     alignment and structure
>3no2_A Uncharacterized protein; six-bladed beta-propeller, structural genomics, joint center structural genomics, JCSG, protein structure initiative; HET: MSE CIT PEG; 1.35A {Bacteroides caccae} Back     alignment and structure
>3i41_A Beta-hemolysin; beta toxin, sphingomyelinase, toxin; 1.75A {Staphylococcus aureus} PDB: 3i46_A 3i48_A 3i5v_A* 3k55_A Back     alignment and structure
>1qks_A Cytochrome CD1 nitrite reductase; enzyme, oxidoreductase, denitrification, electron transport, periplasmic; HET: HEC DHE; 1.28A {Paracoccus pantotrophus} SCOP: a.3.1.2 b.70.2.1 PDB: 1aof_A* 1aoq_A* 1aom_A* 1e2r_A* 1hj5_A* 1h9x_A* 1h9y_A* 1hcm_A* 1hj3_A* 1hj4_A* 1dy7_A* 1gq1_A* Back     alignment and structure
>2qc5_A Streptogramin B lactonase; beta propeller, lyase; 1.80A {Staphylococcus cohnii} Back     alignment and structure
>3c5m_A Oligogalacturonate lyase; blade-shaped beta-propeller, structural genomics, PSI-2, protein structure initiative; 2.60A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>1yr2_A Prolyl oligopeptidase; prolyl endopeptidase, mechanistic study, celiac sprue, hydro; 1.80A {Novosphingobium capsulatum} Back     alignment and structure
>3g6s_A Putative endonuclease/exonuclease/phosphatase family protein; alpha-beta protein, structural genomics, PSI-2; 2.50A {Bacteroides vulgatus atcc 8482} Back     alignment and structure
>3hrp_A Uncharacterized protein; NP_812590.1, structural genomics protein of unknown function structural genomics; HET: MSE; 1.70A {Bacteroides thetaiotaomicron vpi-5482} Back     alignment and structure
>3hxj_A Pyrrolo-quinoline quinone; all beta protein. incomplete 8-blade beta-propeller., struct genomics, PSI-2, protein structure initiative; 2.00A {Methanococcus maripaludis} Back     alignment and structure
>3l1w_A Uncharacterized protein; APC29019.2, conserved protein, enterococcus faecalis V583, PSI-2, MCSG, structural genomics; 1.60A {Enterococcus faecalis} Back     alignment and structure
>3dr2_A Exported gluconolactonase; gluconolactonase SMP-30, six-bladed-propeller dimer, vitamin C, hydrolase; 1.67A {Xanthomonas campestris PV} Back     alignment and structure
>1yr2_A Prolyl oligopeptidase; prolyl endopeptidase, mechanistic study, celiac sprue, hydro; 1.80A {Novosphingobium capsulatum} Back     alignment and structure
>2qe8_A Uncharacterized protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE UNL PG4; 1.35A {Anabaena variabilis atcc 29413} Back     alignment and structure
>3g4e_A Regucalcin; six bladed beta-propeller, gluconolcatonase, organophosphate hydrolase, calcium bound, alternative splicing, cytoplasm, phosphoprotein; 1.42A {Homo sapiens} PDB: 3g4h_B Back     alignment and structure
>3mpr_A Putative endonuclease/exonuclease/phosphatase FAM protein; structural genomics, PSI-2, protein structure initiative; HET: MSE PEG; 1.90A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1qks_A Cytochrome CD1 nitrite reductase; enzyme, oxidoreductase, denitrification, electron transport, periplasmic; HET: HEC DHE; 1.28A {Paracoccus pantotrophus} SCOP: a.3.1.2 b.70.2.1 PDB: 1aof_A* 1aoq_A* 1aom_A* 1e2r_A* 1hj5_A* 1h9x_A* 1h9y_A* 1hcm_A* 1hj3_A* 1hj4_A* 1dy7_A* 1gq1_A* Back     alignment and structure
>2ddr_A Sphingomyelin phosphodiesterase; DNAse I like folding, riken structural genomics/proteomics initiative, RSGI, structural genomics, hydrolase; 1.40A {Bacillus cereus} SCOP: d.151.1.3 PDB: 2dds_A 2ddt_A* 2uyr_X Back     alignment and structure
>1pjx_A Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotriesterase (PTE), nitrogen-calcium coordination, BET propeller; HET: ME2 MES PGE; 0.85A {Loligo vulgaris} SCOP: b.68.6.1 PDB: 1e1a_A* 2gvv_A* 2gvw_A 3byc_A 3kgg_A 3o4p_A* 3li3_A 2gvx_A 2gvu_A 3li4_A 2iaq_A 3li5_A* 2iao_A 2iap_A 2iau_A 2iax_A 2iaw_A 2ias_A 2iat_A 2iar_A ... Back     alignment and structure
>2jc4_A Exodeoxyribonuclease III; hydrolase, repair phosphodiesterase, DNA repair, exonuclease, endonuclease; HET: 1PE; 1.90A {Neisseria meningitidis} Back     alignment and structure
>2hz6_A Endoplasmic reticulum to nucleus signalling 1 isoform 1 variant; triangular beta-sheet cluster, signaling protein; 3.10A {Homo sapiens} Back     alignment and structure
>1xip_A Nucleoporin NUP159; beta-propeller, transport protein; 2.50A {Saccharomyces cerevisiae} SCOP: b.69.14.1 PDB: 3pez_C* 3rrm_C* Back     alignment and structure
>2ghs_A AGR_C_1268P; regucalcin, structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PSI-2; 1.55A {Agrobacterium tumefaciens str} SCOP: b.68.6.1 Back     alignment and structure
>2qc5_A Streptogramin B lactonase; beta propeller, lyase; 1.80A {Staphylococcus cohnii} Back     alignment and structure
>3sjl_D Methylamine dehydrogenase heavy chain; MAUG, C-heme, quinone cofactor, oxidoreductase-electron transport complex; HET: 0AF HEC MES; 1.63A {Paracoccus denitrificans} PDB: 2gc7_A* 2j55_H* 2j56_H* 2j57_G* 3l4m_D* 3l4o_D* 3orv_D* 3pxs_D* 3pxt_D* 3rlm_D* 2gc4_A* 3rn0_D* 3rn1_D* 3rmz_D* 3svw_D* 3sws_D* 3sxt_D* 3pxw_D* 3sle_D* 1mg2_A* ... Back     alignment and structure
>3iuj_A Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas punctata} PDB: 3iul_A 3ium_A 3ivm_A* 3iur_A* 3iun_A* 3iuq_A* 3muo_A* 3mun_A* Back     alignment and structure
>3g4e_A Regucalcin; six bladed beta-propeller, gluconolcatonase, organophosphate hydrolase, calcium bound, alternative splicing, cytoplasm, phosphoprotein; 1.42A {Homo sapiens} PDB: 3g4h_B Back     alignment and structure
>3q7m_A Lipoprotein YFGL, BAMB; beta-propeller, BAM complex, outer membrane protein folding, negative, BAMA, protein binding; 1.65A {Escherichia coli} PDB: 3q7n_A 3q7o_A 3p1l_A 3prw_A 2yh3_A 3q54_A Back     alignment and structure
>4a2l_A BT_4663, two-component system sensor histidine kinase/RESP; transcription, beta-propeller; HET: PGE PG4 MES 2PE; 2.60A {Bacteroides thetaiotaomicron} PDB: 4a2m_A* Back     alignment and structure
>2mad_H Methylamine dehydrogenase (heavy subunit); oxidoreductase(CHNH2(D)-deaminating); HET: TRQ; 2.25A {Paracoccus versutus} SCOP: b.69.2.1 PDB: 1mae_H* 1maf_H* Back     alignment and structure
>3sjl_D Methylamine dehydrogenase heavy chain; MAUG, C-heme, quinone cofactor, oxidoreductase-electron transport complex; HET: 0AF HEC MES; 1.63A {Paracoccus denitrificans} PDB: 2gc7_A* 2j55_H* 2j56_H* 2j57_G* 3l4m_D* 3l4o_D* 3orv_D* 3pxs_D* 3pxt_D* 3rlm_D* 2gc4_A* 3rn0_D* 3rn1_D* 3rmz_D* 3svw_D* 3sws_D* 3sxt_D* 3pxw_D* 3sle_D* 1mg2_A* ... Back     alignment and structure
>2mad_H Methylamine dehydrogenase (heavy subunit); oxidoreductase(CHNH2(D)-deaminating); HET: TRQ; 2.25A {Paracoccus versutus} SCOP: b.69.2.1 PDB: 1mae_H* 1maf_H* Back     alignment and structure
>3hxj_A Pyrrolo-quinoline quinone; all beta protein. incomplete 8-blade beta-propeller., struct genomics, PSI-2, protein structure initiative; 2.00A {Methanococcus maripaludis} Back     alignment and structure
>2j63_A AP-endonuclease; base excision repair, lyase; 2.48A {Leishmania major} Back     alignment and structure
>1vyb_A ORF2 contains A reverse transcriptase domain; endonuclease, APE-1 type, retrotransposition, retrotransposon, transferase; 1.8A {Homo sapiens} SCOP: d.151.1.1 PDB: 2v0s_A 2v0r_A Back     alignment and structure
>3hrp_A Uncharacterized protein; NP_812590.1, structural genomics protein of unknown function structural genomics; HET: MSE; 1.70A {Bacteroides thetaiotaomicron vpi-5482} Back     alignment and structure
>4a2l_A BT_4663, two-component system sensor histidine kinase/RESP; transcription, beta-propeller; HET: PGE PG4 MES 2PE; 2.60A {Bacteroides thetaiotaomicron} PDB: 4a2m_A* Back     alignment and structure
>3iuj_A Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas punctata} PDB: 3iul_A 3ium_A 3ivm_A* 3iur_A* 3iun_A* 3iuq_A* 3muo_A* 3mun_A* Back     alignment and structure
>2jc5_A Exodeoxyribonuclease; hydrolase, repair phosphodiesterase, DNA repair, exonuclease, endonuclease; HET: BCN DIO GOL; 1.50A {Neisseria meningitidis} Back     alignment and structure
>2o3h_A DNA-(apurinic or apyrimidinic site) lyase; APE, endonuclease; 1.90A {Homo sapiens} PDB: 1bix_A 1dew_A* 1de8_B* 1de9_A* 2o3c_A Back     alignment and structure
>1wdu_A TRAS1 ORF2P; four-layered alpha/beta sandwich, RNA binding protein; 2.40A {Bombyx mori} SCOP: d.151.1.1 Back     alignment and structure
>2ghs_A AGR_C_1268P; regucalcin, structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PSI-2; 1.55A {Agrobacterium tumefaciens str} SCOP: b.68.6.1 Back     alignment and structure
>2voa_A AF_EXO, XTHA, exodeoxyribonuclease III; EXOIII, AP endonuclease, lyase; 1.7A {Archaeoglobus fulgidus} Back     alignment and structure
>1yiq_A Quinohemoprotein alcohol dehydrogenase; electron transfer, oxidoreductase; HET: PQQ HEM; 2.20A {Pseudomonas putida} Back     alignment and structure
>3v9f_A Two-component system sensor histidine kinase/RESP regulator, hybrid (ONE-component...; beta-propeller, beta-sandwich; 3.30A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1yiq_A Quinohemoprotein alcohol dehydrogenase; electron transfer, oxidoreductase; HET: PQQ HEM; 2.20A {Pseudomonas putida} Back     alignment and structure
>2hz6_A Endoplasmic reticulum to nucleus signalling 1 isoform 1 variant; triangular beta-sheet cluster, signaling protein; 3.10A {Homo sapiens} Back     alignment and structure
>1kb0_A Quinohemoprotein alcohol dehydrogenase; beta-propeller fold, cytochrome C, oxidoreductase; HET: TRO HEC PQQ; 1.44A {Comamonas testosteroni} SCOP: a.3.1.6 b.70.1.1 Back     alignment and structure
>1hd7_A DNA-(apurinic or apyrimidinic site) lyase; DNA repair, endonuclease, APE1, HAP1, REF-1; 1.95A {Homo sapiens} SCOP: d.151.1.1 PDB: 1e9n_A 3u8u_A 2isi_A Back     alignment and structure
>3v9f_A Two-component system sensor histidine kinase/RESP regulator, hybrid (ONE-component...; beta-propeller, beta-sandwich; 3.30A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3dr2_A Exported gluconolactonase; gluconolactonase SMP-30, six-bladed-propeller dimer, vitamin C, hydrolase; 1.67A {Xanthomonas campestris PV} Back     alignment and structure
>1mda_H Methylamine dehydrogenase (heavy subunit); electron transport; HET: TRQ; 2.50A {Paracoccus denitrificans} SCOP: b.69.2.1 Back     alignment and structure
>2fp8_A Strictosidine synthase; six bladed beta propeller fold, lyase; 2.30A {Rauvolfia serpentina} PDB: 2fp9_A* 2fpc_A* 2vaq_A* 3v1s_A* 2fpb_A* 2v91_A* Back     alignment and structure
>1xip_A Nucleoporin NUP159; beta-propeller, transport protein; 2.50A {Saccharomyces cerevisiae} SCOP: b.69.14.1 PDB: 3pez_C* 3rrm_C* Back     alignment and structure
>3c75_H MADH, methylamine dehydrogenase heavy chain; copper proteins, electron transfer complex, TTQ, electron transport, oxidoreductase, periplasm, transport, metal- binding; HET: TRQ; 2.50A {Paracoccus versutus} Back     alignment and structure
>3c75_H MADH, methylamine dehydrogenase heavy chain; copper proteins, electron transfer complex, TTQ, electron transport, oxidoreductase, periplasm, transport, metal- binding; HET: TRQ; 2.50A {Paracoccus versutus} Back     alignment and structure
>3g91_A MTH0212, exodeoxyribonuclease; double-strand specific 3'-5' exonuclease, AP endonuclease; HET: PG4; 1.23A {Methanothermobacter thermautotrophicusorganism_taxid} PDB: 3fzi_A 3g0a_A 3g1k_A 3g2c_A 3g3c_A* 3g3y_A* 3g4t_A* 3g00_A 3g0r_A* 3g2d_A* 3g38_A 3g8v_A* 3ga6_A Back     alignment and structure
>1kb0_A Quinohemoprotein alcohol dehydrogenase; beta-propeller fold, cytochrome C, oxidoreductase; HET: TRO HEC PQQ; 1.44A {Comamonas testosteroni} SCOP: a.3.1.6 b.70.1.1 Back     alignment and structure
>2qe8_A Uncharacterized protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE UNL PG4; 1.35A {Anabaena variabilis atcc 29413} Back     alignment and structure
>1mda_H Methylamine dehydrogenase (heavy subunit); electron transport; HET: TRQ; 2.50A {Paracoccus denitrificans} SCOP: b.69.2.1 Back     alignment and structure
>1npe_A Nidogen, entactin; glycoprotein, basement membrane, beta-propeller, EGF-like, structural protein; 2.30A {Mus musculus} SCOP: b.68.5.1 Back     alignment and structure
>1kv9_A Type II quinohemoprotein alcohol dehydrogenase; electron transfer, oxidoreductase; HET: PQQ HEM EPE; 1.90A {Pseudomonas putida} SCOP: a.3.1.6 b.70.1.1 Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>3ngq_A CCR4-NOT transcription complex subunit 6-like; alpha/beta sandwich fold, hydrolase; HET: 1PS; 1.80A {Homo sapiens} PDB: 3ngo_A 3ngn_A Back     alignment and structure
>1kv9_A Type II quinohemoprotein alcohol dehydrogenase; electron transfer, oxidoreductase; HET: PQQ HEM EPE; 1.90A {Pseudomonas putida} SCOP: a.3.1.6 b.70.1.1 Back     alignment and structure
>1npe_A Nidogen, entactin; glycoprotein, basement membrane, beta-propeller, EGF-like, structural protein; 2.30A {Mus musculus} SCOP: b.68.5.1 Back     alignment and structure
>2ad6_A Methanol dehydrogenase subunit 1; PQQ configuration, native, oxidoredu; HET: PQQ; 1.50A {Methylophilus methylotrophus} SCOP: b.70.1.1 PDB: 2ad7_A* 2ad8_A* 4aah_A* 1g72_A* Back     alignment and structure
>2a40_B Deoxyribonuclease-1; WAVE, WH2, WAsp, actin, DNAse I, ARP2/3, structural protein; HET: HIC NAG ATP; 1.80A {Bos taurus} SCOP: d.151.1.1 PDB: 1dnk_A* 2a3z_B* 2a41_B* 2a42_B* 2d1k_B* 2dnj_A* 3cjc_D* 3dni_A* 1atn_D* Back     alignment and structure
>3nol_A Glutamine cyclotransferase; beta-propeller, glutaminyl cyclase, pyrogl transferase; 1.70A {Zymomonas mobilis} PDB: 3nom_A Back     alignment and structure
>1w6s_A Methanol dehydrogenase subunit 1; anisotropic, electron transfer, oxidoreductase, calcium- binding, methanol utilization, PQQ; HET: PQQ; 1.2A {Methylobacterium extorquens} SCOP: b.70.1.1 PDB: 1h4i_A* 1h4j_A* 2d0v_A* 1lrw_A* Back     alignment and structure
>2iwa_A Glutamine cyclotransferase; pyroglutamate, acyltransferase, glutaminyl CYCL N-terminal cyclisation; HET: NAG; 1.6A {Carica papaya} PDB: 2faw_A* Back     alignment and structure
>2e6j_A Hydin protein; PAPD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3nok_A Glutaminyl cyclase; beta-propeller, cyclotransferase, pyrogl transferase; HET: MES DDQ; 1.65A {Myxococcus xanthus} Back     alignment and structure
>2fp8_A Strictosidine synthase; six bladed beta propeller fold, lyase; 2.30A {Rauvolfia serpentina} PDB: 2fp9_A* 2fpc_A* 2vaq_A* 3v1s_A* 2fpb_A* 2v91_A* Back     alignment and structure
>2ys4_A Hydrocephalus-inducing protein homolog; hydin, PAPD-like, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1flg_A Protein (quinoprotein ethanol dehydrogenase); superbarrel, oxidoreductase; HET: PQQ; 2.60A {Pseudomonas aeruginosa} SCOP: b.70.1.1 Back     alignment and structure
>2ei9_A Non-LTR retrotransposon R1BMKS ORF2 protein; four layered alpha beta sandwich, gene regulation; 2.00A {Bombyx mori} Back     alignment and structure
>2ece_A 462AA long hypothetical selenium-binding protein; beta propeller, structural genomics, unknown function; 2.00A {Sulfolobus tokodaii} Back     alignment and structure
>3mbr_X Glutamine cyclotransferase; beta-propeller; 1.44A {Xanthomonas campestris} Back     alignment and structure
>3ott_A Two-component system sensor histidine kinase; beta-propeller, beta-sandwich, transcription; HET: TBR; 2.30A {Bacteroides thetaiotaomicron} PDB: 3va6_A Back     alignment and structure
>3nol_A Glutamine cyclotransferase; beta-propeller, glutaminyl cyclase, pyrogl transferase; 1.70A {Zymomonas mobilis} PDB: 3nom_A Back     alignment and structure
>2p4o_A Hypothetical protein; putative lactonase, structural genomics, joint center for ST genomics, JCSG, protein structure initiative, PSI-2; HET: MSE; 1.90A {Nostoc punctiforme} SCOP: b.68.6.3 Back     alignment and structure
>1flg_A Protein (quinoprotein ethanol dehydrogenase); superbarrel, oxidoreductase; HET: PQQ; 2.60A {Pseudomonas aeruginosa} SCOP: b.70.1.1 Back     alignment and structure
>1k3i_A Galactose oxidase precursor; blade beta propeller, prosequence form, precursor of copper enzyme., oxidoreductase; 1.40A {Fusarium SP} SCOP: b.1.18.2 b.18.1.1 b.69.1.1 PDB: 1gof_A 1gog_A 1goh_A 2eie_A 2jkx_A 2vz1_A 2vz3_A 2eic_A 2eib_A 1t2x_A 2eid_A 2wq8_A Back     alignment and structure
>3v65_B Low-density lipoprotein receptor-related protein; laminin-G, beta-propeller, protein binding; 3.30A {Rattus norvegicus} Back     alignment and structure
>1w6s_A Methanol dehydrogenase subunit 1; anisotropic, electron transfer, oxidoreductase, calcium- binding, methanol utilization, PQQ; HET: PQQ; 1.2A {Methylobacterium extorquens} SCOP: b.70.1.1 PDB: 1h4i_A* 1h4j_A* 2d0v_A* 1lrw_A* Back     alignment and structure
>2ad6_A Methanol dehydrogenase subunit 1; PQQ configuration, native, oxidoredu; HET: PQQ; 1.50A {Methylophilus methylotrophus} SCOP: b.70.1.1 PDB: 2ad7_A* 2ad8_A* 4aah_A* 1g72_A* Back     alignment and structure
>3nok_A Glutaminyl cyclase; beta-propeller, cyclotransferase, pyrogl transferase; HET: MES DDQ; 1.65A {Myxococcus xanthus} Back     alignment and structure
>2iwa_A Glutamine cyclotransferase; pyroglutamate, acyltransferase, glutaminyl CYCL N-terminal cyclisation; HET: NAG; 1.6A {Carica papaya} PDB: 2faw_A* Back     alignment and structure
>3p5b_L Low density lipoprotein receptor variant; B-propellor, convertase, hydrolase-lipid binding P complex; 3.30A {Homo sapiens} PDB: 3p5c_L Back     alignment and structure
>1fwx_A Nitrous oxide reductase; beta-propeller domain, cupredoxin domain, CUZ site, CUA site oxidoreductase; 1.60A {Paracoccus denitrificans} SCOP: b.6.1.4 b.69.3.1 PDB: 2iwk_A 2iwf_A Back     alignment and structure
>1ijq_A LDL receptor, low-density lipoprotein receptor; beta-propeller, lipid transport; 1.50A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 Back     alignment and structure
>3sov_A LRP-6, low-density lipoprotein receptor-related protein; beta propeller, protein binding-antagonist complex; HET: NAG FUC; 1.27A {Homo sapiens} PDB: 3soq_A* 3sob_B Back     alignment and structure
>3ott_A Two-component system sensor histidine kinase; beta-propeller, beta-sandwich, transcription; HET: TBR; 2.30A {Bacteroides thetaiotaomicron} PDB: 3va6_A Back     alignment and structure
>1sr4_B CDT B, cytolethal distending toxin protein B; bacterial, virulence, DNA damage, genotoxin, cytotoxins, cell cycle, apoptosis, lectin; 2.00A {Haemophilus ducreyi} SCOP: d.151.1.1 PDB: 2f2f_B Back     alignment and structure
>3v64_C Agrin; beta propeller, laminin-G, signaling, protein binding; HET: NAG; 2.85A {Rattus norvegicus} Back     alignment and structure
>1msp_A MSP, major sperm protein; cytoskeletal protein, cell motility protein; 2.50A {Ascaris suum} SCOP: b.1.11.2 PDB: 3msp_A 2bvu_A 2msp_A 1grw_A Back     alignment and structure
>3mbr_X Glutamine cyclotransferase; beta-propeller; 1.44A {Xanthomonas campestris} Back     alignment and structure
>2xbg_A YCF48-like protein; photosynthesis, photosystem II, beta-propeller, assembly FAC; 1.50A {Thermosynechococcus elongatus} Back     alignment and structure
>3m0c_C LDL receptor, low-density lipoprotein receptor; protein complex, beta propeller, cholesterol clearance, PCSK autocatalytic cleavage; 7.01A {Homo sapiens} Back     alignment and structure
>3tc9_A Hypothetical hydrolase; 6-bladed beta-propeller, immunoglobulin-like, structural GEN joint center for structural genomics, JCSG; 2.23A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1m1s_A WR4; structural genomics, major sperm protein, bioinformatics, PSI, protein structure initiative; 1.80A {Caenorhabditis elegans} SCOP: b.1.11.2 Back     alignment and structure
>1row_A SSP-19, MSP-domain protein like family member; beta barrel, structural genomics, PSI, protein structure initiative; 2.00A {Caenorhabditis elegans} SCOP: b.1.11.2 Back     alignment and structure
>2p4o_A Hypothetical protein; putative lactonase, structural genomics, joint center for ST genomics, JCSG, protein structure initiative, PSI-2; HET: MSE; 1.90A {Nostoc punctiforme} SCOP: b.68.6.3 Back     alignment and structure
>2xe4_A Oligopeptidase B; hydrolase-inhibitor complex, hydrolase, protease inhibitor trypanosomes, CLAN SC; HET: FC0 RGL; 1.65A {Leishmania major} Back     alignment and structure
>2xe4_A Oligopeptidase B; hydrolase-inhibitor complex, hydrolase, protease inhibitor trypanosomes, CLAN SC; HET: FC0 RGL; 1.65A {Leishmania major} Back     alignment and structure
>2f1n_A CDT B, cytolethal distending toxin subunit B; E.coli, DNAse I, microbatch; 1.73A {Escherichia coli} SCOP: d.151.1.1 Back     alignment and structure
>1z9l_A Vesicle-associated membrane protein-associated protein A; VAP-A, cytoplasmic domain, protein binding; HET: MSE; 1.70A {Rattus norvegicus} PDB: 1z9o_A 2rr3_A 3ikk_A Back     alignment and structure
>3p5b_L Low density lipoprotein receptor variant; B-propellor, convertase, hydrolase-lipid binding P complex; 3.30A {Homo sapiens} PDB: 3p5c_L Back     alignment and structure
>3v65_B Low-density lipoprotein receptor-related protein; laminin-G, beta-propeller, protein binding; 3.30A {Rattus norvegicus} Back     alignment and structure
>2cri_A Vesicle-associated membrane protein-associated protein A; VAP-A, VAP-33, beta sandwitch fold, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>3v64_C Agrin; beta propeller, laminin-G, signaling, protein binding; HET: NAG; 2.85A {Rattus norvegicus} Back     alignment and structure
>4hw6_A Hypothetical protein, IPT/TIG domain protein; putative carbohydrate bindning two domains protein, IPT/TIG (PF01833), 6-beta-propeller; HET: MSE; 1.70A {Bacteroides ovatus} Back     alignment and structure
>1wic_A Hypothetical protein riken cDNA 6030424E15; beta sandwich fold, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: b.1.11.2 Back     alignment and structure
>2xbg_A YCF48-like protein; photosynthesis, photosystem II, beta-propeller, assembly FAC; 1.50A {Thermosynechococcus elongatus} Back     alignment and structure
>3m0c_C LDL receptor, low-density lipoprotein receptor; protein complex, beta propeller, cholesterol clearance, PCSK autocatalytic cleavage; 7.01A {Homo sapiens} Back     alignment and structure
>1ijq_A LDL receptor, low-density lipoprotein receptor; beta-propeller, lipid transport; 1.50A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 Back     alignment and structure
>1k3i_A Galactose oxidase precursor; blade beta propeller, prosequence form, precursor of copper enzyme., oxidoreductase; 1.40A {Fusarium SP} SCOP: b.1.18.2 b.18.1.1 b.69.1.1 PDB: 1gof_A 1gog_A 1goh_A 2eie_A 2jkx_A 2vz1_A 2vz3_A 2eic_A 2eib_A 1t2x_A 2eid_A 2wq8_A Back     alignment and structure
>1fwx_A Nitrous oxide reductase; beta-propeller domain, cupredoxin domain, CUZ site, CUA site oxidoreductase; 1.60A {Paracoccus denitrificans} SCOP: b.6.1.4 b.69.3.1 PDB: 2iwk_A 2iwf_A Back     alignment and structure
>4a0p_A LRP6, LRP-6, low-density lipoprotein receptor-related protein; signaling, WNT signalling, WNT3A, DKK1, MESD; HET: NAG; 1.90A {Homo sapiens} PDB: 3s2k_A* 3s8z_A* 3s8v_A* Back     alignment and structure
>2ece_A 462AA long hypothetical selenium-binding protein; beta propeller, structural genomics, unknown function; 2.00A {Sulfolobus tokodaii} Back     alignment and structure
>2qsv_A Uncharacterized protein; MCSG, structural genomics, porphyromonas gingivalis W83, PSI protein structure initiative; 2.10A {Porphyromonas gingivalis} Back     alignment and structure
>1n7d_A LDL receptor, low-density lipoprotein receptor; familial hypercholesterolemia, cholestero metabolism, lipid transport; HET: NAG BMA MAN KEG; 3.70A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 g.3.11.1 g.3.11.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 PDB: 2lgp_A 1xfe_A 1f5y_A 1ldl_A 1ldr_A 1d2j_A 1f8z_A Back     alignment and structure
>3tc9_A Hypothetical hydrolase; 6-bladed beta-propeller, immunoglobulin-like, structural GEN joint center for structural genomics, JCSG; 2.23A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3ei3_A DNA damage-binding protein 1; UV-damage, DDB, nucleotide excision repair, xeroderma pigmentosum, cytoplasm, DNA repair; HET: DNA PG4; 2.30A {Homo sapiens} PDB: 3ei1_A* 3ei2_A* 3ei4_A* 4a0l_A* 3e0c_A* 3i7k_A* 3i7h_A* 3i7l_A* 3i7n_A* 3i7o_A* 3i7p_A* 3i89_A* 3i8c_A* 3i8e_A* 2b5l_A 2b5m_A 2hye_A* 4a11_A* 4a0k_C* 4a0a_A* ... Back     alignment and structure
>2p9w_A MAL S 1 allergenic protein; beta propeller; 1.35A {Malassezia sympodialis} Back     alignment and structure
>3amr_A 3-phytase; beta-propeller, phytate, MYO-inositol hexasulfate, hydrolase-hydrolase inhibitor complex; HET: IHS; 1.25A {Bacillus subtilis} PDB: 3ams_A* 2poo_A 1poo_A 1qlg_A 1h6l_A 1cvm_A Back     alignment and structure
>3sov_A LRP-6, low-density lipoprotein receptor-related protein; beta propeller, protein binding-antagonist complex; HET: NAG FUC; 1.27A {Homo sapiens} PDB: 3soq_A* 3sob_B Back     alignment and structure
>4hw6_A Hypothetical protein, IPT/TIG domain protein; putative carbohydrate bindning two domains protein, IPT/TIG (PF01833), 6-beta-propeller; HET: MSE; 1.70A {Bacteroides ovatus} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 1115
d1i9za_345 d.151.1.2 (A:) Synaptojanin, IPP5C domain {Fission 2e-83
d2imqx1280 d.151.1.2 (X:3-282) Salivary nitrophorin {Bedbug ( 7e-44
d1vyhc1317 b.69.4.1 (C:92-408) Platelet-activating factor ace 2e-05
d1vyhc1317 b.69.4.1 (C:92-408) Platelet-activating factor ace 4e-04
d1pgua2287 b.69.4.1 (A:327-613) Actin interacting protein 1 { 2e-04
d2ddra1299 d.151.1.3 (A:7-305) Sphingomyelin phosphodiesteras 5e-04
d1tbga_340 b.69.4.1 (A:) beta1-subunit of the signal-transduc 5e-04
d1zwxa1293 d.151.1.3 (A:41-333) Sphingomyelin phosphodiestera 6e-04
d1p22a2293 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (be 8e-04
d1k8kc_371 b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 0.002
d1gxra_337 b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Hum 0.002
d1erja_388 b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yea 0.003
>d1i9za_ d.151.1.2 (A:) Synaptojanin, IPP5C domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 345 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: DNase I-like
superfamily: DNase I-like
family: Inositol polyphosphate 5-phosphatase (IPP5)
domain: Synaptojanin, IPP5C domain
species: Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]
 Score =  272 bits (697), Expect = 2e-83
 Identities = 100/397 (25%), Positives = 165/397 (41%), Gaps = 66/397 (16%)

Query: 530 PLDSILCKELAGKEFLYTRMENLKILAGTWNVGQGRASQDALISWLGSAASDVG-IVVVG 588
           P+   +  EL  +E  ++  +N+KI   ++N+    A+   L +WL    + +  I VVG
Sbjct: 3   PIHEYVNHELRKRENEFSEHKNVKIFVASYNLNGCSATTK-LENWLFPENTPLADIYVVG 61

Query: 589 LQEVEMGAGFLAMSAAKETVGLEGSAVGHWWLDMIG----KILDDGSTFERVGSRQLAGL 644
            QE+        +    + V     A    W   +          G  + ++ S QL G 
Sbjct: 62  FQEI--------VQLTPQQVISADPAKRREWESCVKRLLNGKCTSGPGYVQLRSGQLVGT 113

Query: 645 LIAVWVRKNLKDYVGDVDVAAVPCGFGRAIGNKGAVGLRVRVYDRIMCFVNCHFAAHLEA 704
            + ++ +++    + +V+      G G   GNKGAV +R    D  +CF+  H AA    
Sbjct: 114 ALMIFCKESCLPSIKNVEGTVKKTGLGGVSGNKGAVAIRFDYEDTGLCFITSHLAAGYTN 173

Query: 705 VNRRNADFDHVYRTMTFCRPSNLCSAAAAGASSVVQMLRSTNPLSGLTVEGVPELSEADM 764
            + R+ D+  +   + F R  ++                                   D 
Sbjct: 174 YDERDHDYRTIASGLRFRRGRSI--------------------------------FNHDY 201

Query: 765 VIFLGDFNYRLDGITYDEARDFISQRCFDWLRERDQLRAEMEAGNVFQGMREADIKFPPT 824
           V++ GDFNYR+  +TY+E    I+Q    +L E DQL  +M  G VF    E  I FPPT
Sbjct: 202 VVWFGDFNYRIS-LTYEEVVPCIAQGKLSYLFEYDQLNKQMLTGKVFPFFSELPITFPPT 260

Query: 825 YKFEKHLAGLAGYDSGEKKRVPAWCDRILYRDSRSDLASECSLECPVASSILRYEACMDV 884
           YKF+    G   YD+ +K RVPAW DRILYR                   +      + +
Sbjct: 261 YKFDI---GTDIYDTSDKHRVPAWTDRILYRGEL----------------VPHSYQSVPL 301

Query: 885 TDSDHKPVRCIFSVDIARVDESVRRQEFGDIMTSNEK 921
             SDH+P+   +  +I +VD   ++  F ++    ++
Sbjct: 302 YYSDHRPIYATYEANIVKVDREKKKILFEELYNQRKQ 338


>d2imqx1 d.151.1.2 (X:3-282) Salivary nitrophorin {Bedbug (Cimex lectularius) [TaxId: 79782]} Length = 280 Back     information, alignment and structure
>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Length = 317 Back     information, alignment and structure
>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Length = 317 Back     information, alignment and structure
>d1pgua2 b.69.4.1 (A:327-613) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 287 Back     information, alignment and structure
>d2ddra1 d.151.1.3 (A:7-305) Sphingomyelin phosphodiesterase C {Bacillus cereus [TaxId: 1396]} Length = 299 Back     information, alignment and structure
>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Length = 340 Back     information, alignment and structure
>d1zwxa1 d.151.1.3 (A:41-333) Sphingomyelin phosphodiesterase C {Listeria ivanovii [TaxId: 1638]} Length = 293 Back     information, alignment and structure
>d1p22a2 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} Length = 293 Back     information, alignment and structure
>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} Length = 371 Back     information, alignment and structure
>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 337 Back     information, alignment and structure
>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 388 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query1115
d1i9za_345 Synaptojanin, IPP5C domain {Fission yeast (Schizos 100.0
d2imqx1280 Salivary nitrophorin {Bedbug (Cimex lectularius) [ 100.0
d1vyhc1317 Platelet-activating factor acetylhydrolase IB subu 100.0
d1erja_388 Tup1, C-terminal domain {Baker's yeast (Saccharomy 100.0
d1gxra_337 Groucho/tle1, C-terminal domain {Human (Homo sapie 100.0
d1nr0a1311 Actin interacting protein 1 {Nematode (Caenorhabdi 100.0
d1tbga_340 beta1-subunit of the signal-transducing G protein 99.97
d1nr0a2299 Actin interacting protein 1 {Nematode (Caenorhabdi 99.97
d2ovrb2342 F-box/WD repeat-containing protein 7, FBXW7 {Human 99.97
d1k8kc_371 Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taur 99.97
d1nexb2355 Cdc4 propeller domain {Baker's yeast (Saccharomyce 99.97
d1vyhc1317 Platelet-activating factor acetylhydrolase IB subu 99.96
d1p22a2293 F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Hom 99.96
d1nexb2355 Cdc4 propeller domain {Baker's yeast (Saccharomyce 99.96
d1pgua2287 Actin interacting protein 1 {Baker's yeast (Saccha 99.96
d1gxra_337 Groucho/tle1, C-terminal domain {Human (Homo sapie 99.96
d1nr0a1311 Actin interacting protein 1 {Nematode (Caenorhabdi 99.96
d1erja_388 Tup1, C-terminal domain {Baker's yeast (Saccharomy 99.96
d1pgua1325 Actin interacting protein 1 {Baker's yeast (Saccha 99.95
d1tbga_340 beta1-subunit of the signal-transducing G protein 99.95
d1nr0a2299 Actin interacting protein 1 {Nematode (Caenorhabdi 99.94
d2ovrb2342 F-box/WD repeat-containing protein 7, FBXW7 {Human 99.94
d1yfqa_342 Cell cycle arrest protein BUB3 {Baker's yeast (Sac 99.93
d1sq9a_393 Antiviral protein Ski8 (Ski8p) {Baker's yeast (Sac 99.93
d1k8kc_371 Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taur 99.93
d1sq9a_393 Antiviral protein Ski8 (Ski8p) {Baker's yeast (Sac 99.92
d1p22a2293 F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Hom 99.91
d1pgua1325 Actin interacting protein 1 {Baker's yeast (Saccha 99.91
d1k32a3360 Tricorn protease domain 2 {Archaeon Thermoplasma a 99.89
d1yfqa_342 Cell cycle arrest protein BUB3 {Baker's yeast (Sac 99.89
d1qksa2432 C-terminal (heme d1) domain of cytochrome cd1-nitr 99.88
d1hzua2426 C-terminal (heme d1) domain of cytochrome cd1-nitr 99.87
d1pgua2287 Actin interacting protein 1 {Baker's yeast (Saccha 99.85
d1l0qa2301 Surface layer protein {Archaeon Methanosarcina maz 99.8
d1k32a3360 Tricorn protease domain 2 {Archaeon Thermoplasma a 99.77
d1hzua2426 C-terminal (heme d1) domain of cytochrome cd1-nitr 99.77
d1pbyb_337 Quinohemoprotein amine dehydrogenase B chain {Para 99.75
d1qksa2432 C-terminal (heme d1) domain of cytochrome cd1-nitr 99.7
d1pbyb_337 Quinohemoprotein amine dehydrogenase B chain {Para 99.69
d1jmxb_346 Quinohemoprotein amine dehydrogenase B chain {Pseu 99.69
d1jmxb_346 Quinohemoprotein amine dehydrogenase B chain {Pseu 99.69
d1l0qa2301 Surface layer protein {Archaeon Methanosarcina maz 99.61
d2madh_373 Methylamine dehydrogenase, H-chain {Gram negative 99.57
d2bbkh_355 Methylamine dehydrogenase, H-chain {Paracoccus den 99.54
d2madh_373 Methylamine dehydrogenase, H-chain {Gram negative 99.51
d1ri6a_333 Putative isomerase YbhE {Escherichia coli [TaxId: 99.5
d2bbkh_355 Methylamine dehydrogenase, H-chain {Paracoccus den 99.41
d2bgra1470 Dipeptidyl peptidase IV/CD26, N-terminal domain {P 99.25
d2ddra1299 Sphingomyelin phosphodiesterase C {Bacillus cereus 99.23
d1ri6a_333 Putative isomerase YbhE {Escherichia coli [TaxId: 99.15
d1zwxa1293 Sphingomyelin phosphodiesterase C {Listeria ivanov 99.12
d1mdah_368 Methylamine dehydrogenase, H-chain {Paracoccus den 99.09
d1mdah_368 Methylamine dehydrogenase, H-chain {Paracoccus den 99.07
d1wdua_228 Endonuclease domain of TRAS1 retrotransposon (ORF2 98.86
d1qnia2441 Nitrous oxide reductase, N-terminal domain {Pseudo 98.76
d1qnia2441 Nitrous oxide reductase, N-terminal domain {Pseudo 98.5
d1q7fa_279 Brain tumor cg10719-pa {Fruit fly (Drosophila mela 98.46
d2p4oa1302 Hypothetical protein All0351 homologue {Nostoc pun 98.41
d1vyba_236 Endonuclease domain of LINE-1 reverse transcriptas 98.4
d2bgra1470 Dipeptidyl peptidase IV/CD26, N-terminal domain {P 98.29
d2f1na1250 Cytolethal distending toxin subunit B {Escherichia 98.16
d2a40b1260 Deoxyribonuclease I {Cow (Bos taurus) [TaxId: 9913 98.08
d2p4oa1302 Hypothetical protein All0351 homologue {Nostoc pun 97.95
d1q7fa_279 Brain tumor cg10719-pa {Fruit fly (Drosophila mela 97.77
d1sr4b_261 Cytolethal distending toxin subunit B {Haemophilus 97.71
d1hd7a_275 DNA repair endonuclease Hap1 {Human (Homo sapiens) 97.7
d1pjxa_314 Diisopropylfluorophosphatase (phosphotriesterase, 97.51
d1rwia_260 Serine/threonine-protein kinase PknD {Mycobacteriu 97.5
d2dg1a1319 Lactonase Drp35 {Staphylococcus aureus [TaxId: 128 97.48
d1akoa_268 DNA-repair enzyme exonuclease III {Escherichia col 97.46
d2hqsa1269 TolB, C-terminal domain {Escherichia coli [TaxId: 97.28
d2ghsa1295 Regucalcin {Agrobacterium tumefaciens [TaxId: 358] 97.21
d1k32a2281 Tricorn protease N-terminal domain {Archaeon Therm 97.15
d1pjxa_314 Diisopropylfluorophosphatase (phosphotriesterase, 97.12
d1jofa_365 3-carboxy-cis,cis-mucoante lactonizing enzyme {Neu 97.09
d1jofa_365 3-carboxy-cis,cis-mucoante lactonizing enzyme {Neu 96.98
d1rwia_260 Serine/threonine-protein kinase PknD {Mycobacteriu 96.73
d2dg1a1319 Lactonase Drp35 {Staphylococcus aureus [TaxId: 128 96.67
d2hqsa1269 TolB, C-terminal domain {Escherichia coli [TaxId: 96.26
d1grwa_124 Major sperm protein, MSP {Nematode (Caenorhabditis 95.86
d1rowa_107 SSP-19 {Nematode (Caenorhabditis elegans) [TaxId: 95.54
d1m1sa_109 WR4 {Nematode (Caenorhabditis elegans) [TaxId: 623 95.39
d2ghsa1295 Regucalcin {Agrobacterium tumefaciens [TaxId: 358] 95.08
d1wica_152 MSP domain containing protein 2, Mospd2 {Mouse (Mu 93.88
d1xfda1465 Dipeptidyl aminopeptidase-like protein 6, DPP6, N- 91.62
d1xfda1465 Dipeptidyl aminopeptidase-like protein 6, DPP6, N- 89.55
d2ad6a1571 Methanol dehydrogenase, heavy chain {Methylophilus 87.58
d1kb0a2573 Quinoprotein alcohol dehydrogenase, N-terminal dom 85.72
>d1i9za_ d.151.1.2 (A:) Synaptojanin, IPP5C domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: DNase I-like
superfamily: DNase I-like
family: Inositol polyphosphate 5-phosphatase (IPP5)
domain: Synaptojanin, IPP5C domain
species: Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]
Probab=100.00  E-value=5.1e-75  Score=665.50  Aligned_cols=330  Identities=30%  Similarity=0.549  Sum_probs=288.9

Q ss_pred             CCCchhhHHHhhccccccceecccceEEEEEEeCCCCCCchhhhccccCCC-CCceeEEEEEecc-cCccchhhhhhhhh
Q 001245          529 GPLDSILCKELAGKEFLYTRMENLKILAGTWNVGQGRASQDALISWLGSAA-SDVGIVVVGLQEV-EMGAGFLAMSAAKE  606 (1115)
Q Consensus       529 ~pld~~i~~~l~~re~~yt~~~~irI~v~TWNv~~~~~~~~~L~~wl~~~~-~~~Di~viGlQEi-~~~~~~~~~~~~ke  606 (1115)
                      +|+.++++++|++|+.+|+..++++|+|+|||||+.+|+ ++|.+||.... ..||||||||||+ ++++..+..     
T Consensus         2 d~~~~~~~~~l~~r~~~~~~~~~l~I~v~TWNv~~~~~~-~~l~~~l~~~~~~~~DI~viglQEi~~~~~~~~~~-----   75 (345)
T d1i9za_           2 DPIHEYVNHELRKRENEFSEHKNVKIFVASYNLNGCSAT-TKLENWLFPENTPLADIYVVGFQEIVQLTPQQVIS-----   75 (345)
T ss_dssp             CHHHHHHHHHHHHTGGGTEEEEEEEEEEEEEECTTCCCC-SCCHHHHSCSSSCCCSEEEEEEECSSCCC-----C-----
T ss_pred             CcHHHHHHHHHHHHHHhhcCCCceEEEEEEEcCCCccCC-cchHHhhccCCCCCCCEEEEEcccCCccchhhhcc-----
Confidence            467889999999999999999999999999999988775 58999997543 4589999999997 666544321     


Q ss_pred             hhcCCCCcchhhHHHHHhcccC----CCCceEEEeeeccccEEEEEEEeccccCccCceeeeeeeeeccccccCcceEEE
Q 001245          607 TVGLEGSAVGHWWLDMIGKILD----DGSTFERVGSRQLAGLLIAVWVRKNLKDYVGDVDVAAVPCGFGRAIGNKGAVGL  682 (1115)
Q Consensus       607 ~~~~~~s~~~~~W~~~l~~~L~----~~~~y~~v~s~~L~Gi~l~vfvr~~l~~~i~~v~~~~v~tG~~g~~gNKGaV~i  682 (1115)
                          .++...+.|.+.+...++    .+..|.+|.+.+|+|++|+||+|+++.++|++|++++++||++|.+||||||++
T Consensus        76 ----~~~~~~~~w~~~~~~~~~~~~~~~~~Y~~v~~~~~~g~~l~vf~r~~~~~~i~~v~~~~~~~g~~g~~gnKGaV~v  151 (345)
T d1i9za_          76 ----ADPAKRREWESCVKRLLNGKCTSGPGYVQLRSGQLVGTALMIFCKESCLPSIKNVEGTVKKTGLGGVSGNKGAVAI  151 (345)
T ss_dssp             ----CCHHHHHHHHHHHHHHHHHTCCSSCCEEEEEEEEETTEEEEEEEEGGGGGGEEEEEEEEEECCCC----CCEEEEE
T ss_pred             ----cCchhhHHHHHHHHHhccccccCCCCeEEEEEecccCcEEEEEEcchhccccccceeEEEecCcCCcccCCceEEE
Confidence                122335679998887764    356899999999999999999999999999999999999999999999999999


Q ss_pred             EEEEecEEEEEEeecccccchhHHHHHHHHHHHHHhcccCCCCCccchhhcCCchhhhhcccCCCCCCCcccCCCCcCCc
Q 001245          683 RVRVYDRIMCFVNCHFAAHLEAVNRRNADFDHVYRTMTFCRPSNLCSAAAAGASSVVQMLRSTNPLSGLTVEGVPELSEA  762 (1115)
Q Consensus       683 r~~i~~t~l~FVn~HLaA~~~~~~~Rn~d~~~I~~~l~F~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~i~~~  762 (1115)
                      ||.+++++||||||||+||++++++||+||..|+++|.|....                                .+.++
T Consensus       152 r~~i~~t~l~fvn~HL~ag~~~~~~R~~~~~~i~~~l~~~~~~--------------------------------~~~~~  199 (345)
T d1i9za_         152 RFDYEDTGLCFITSHLAAGYTNYDERDHDYRTIASGLRFRRGR--------------------------------SIFNH  199 (345)
T ss_dssp             EEEETTEEEEEEEEECCCCSSCHHHHHHHHHHHHHHCCCGGGC--------------------------------CTTSS
T ss_pred             EEEECCEEEEEEEecccCcccchHHHHHHHHHHHHhhcccccc--------------------------------ccccC
Confidence            9999999999999999999999999999999999999875421                                25679


Q ss_pred             ceEEEecccccccCCCChHHHHHHHhhcChhHHhcchHHHHHHhcCCcccCccccCcccCCCccccccccCCcccccCCc
Q 001245          763 DMVIFLGDFNYRLDGITYDEARDFISQRCFDWLRERDQLRAEMEAGNVFQGMREADIKFPPTYKFEKHLAGLAGYDSGEK  842 (1115)
Q Consensus       763 D~vfw~GDlNyRi~~~~~~~v~~~i~~~~~~~Ll~~DQL~~~~~~~~~f~gf~E~~I~F~PTYKyd~~~~g~~~yDts~k  842 (1115)
                      |++|||||||||++. +.+++.+++..++|..|+++|||+.+++.+.+|.+|.|++|+|||||||+.++   +.||++.|
T Consensus       200 d~v~~~GDlN~R~~~-~~~~~~~~i~~~~~~~l~~~dql~~~~~~~~~~~~~~E~~I~F~PTyk~~~~~---~~yd~~~k  275 (345)
T d1i9za_         200 DYVVWFGDFNYRISL-TYEEVVPCIAQGKLSYLFEYDQLNKQMLTGKVFPFFSELPITFPPTYKFDIGT---DIYDTSDK  275 (345)
T ss_dssp             SEEEEEEECCCCBSS-CHHHHHHHHHTTCHHHHHTTBHHHHHHHTTSSSTTCBCCCCCSCCCBCBCTTS---SCBCCSTT
T ss_pred             ceeEEeccccccccC-chhhhHhhhhccchhHHHHHHHHHhhhhccCcccCcccCCCCCCCCCeEECCC---CccCCCCC
Confidence            999999999999995 99999999999999999999999999999999999999999999999999754   68999999


Q ss_pred             cccccccceeeeecCCCcccccccCCCccccceeeeeeccccccCCCCceeeEEEEEeeccCHHHHHHHHHHHhhcch
Q 001245          843 KRVPAWCDRILYRDSRSDLASECSLECPVASSILRYEACMDVTDSDHKPVRCIFSVDIARVDESVRRQEFGDIMTSNE  920 (1115)
Q Consensus       843 ~R~PsWcDRIL~~~~~~~~~~~~~~~~p~~~~~~~Y~s~~~~~~SDHkPV~a~f~v~v~~v~~~~~~~~~~ei~~~~~  920 (1115)
                      +|+|||||||||++..               .++.|.++ ++..||||||+|.|+++++.+|+++|+++++|++++.+
T Consensus       276 ~RiPsWcDRIL~~~~~---------------~~~~Y~s~-~~~~SDH~PV~a~f~v~v~~~~~~~~~~~~~~~~~~~~  337 (345)
T d1i9za_         276 HRVPAWTDRILYRGEL---------------VPHSYQSV-PLYYSDHRPIYATYEANIVKVDREKKKILFEELYNQRK  337 (345)
T ss_dssp             CCCCBCCEEEEEESSC---------------EEEEEEEC-CCCSSSBCCEEEEEEEEEEEECHHHHHHHHHHHHHHHH
T ss_pred             eeCccccceEEeeCce---------------eeeeeecc-CCCCCCcccEEEEEEEEEEEECHHHHHHHHHHHHHHHH
Confidence            9999999999999642               34789985 78899999999999999999999999999999998644



>d2imqx1 d.151.1.2 (X:3-282) Salivary nitrophorin {Bedbug (Cimex lectularius) [TaxId: 79782]} Back     information, alignment and structure
>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d2ovrb2 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1p22a2 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1pgua2 b.69.4.1 (A:327-613) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1pgua1 b.69.4.1 (A:2-326) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d2ovrb2 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yfqa_ b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1sq9a_ b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1sq9a_ b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1p22a2 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pgua1 b.69.4.1 (A:2-326) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1k32a3 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1yfqa_ b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1qksa2 b.70.2.1 (A:136-567) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1hzua2 b.70.2.1 (A:118-543) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1pgua2 b.69.4.1 (A:327-613) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1l0qa2 b.69.2.3 (A:1-301) Surface layer protein {Archaeon Methanosarcina mazei [TaxId: 2209]} Back     information, alignment and structure
>d1k32a3 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1hzua2 b.70.2.1 (A:118-543) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1pbyb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1qksa2 b.70.2.1 (A:136-567) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1pbyb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1jmxb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1jmxb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1l0qa2 b.69.2.3 (A:1-301) Surface layer protein {Archaeon Methanosarcina mazei [TaxId: 2209]} Back     information, alignment and structure
>d2madh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Gram negative methylotrophic bacteria (Thiobacillus versutus) [TaxId: 34007]} Back     information, alignment and structure
>d2bbkh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d2madh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Gram negative methylotrophic bacteria (Thiobacillus versutus) [TaxId: 34007]} Back     information, alignment and structure
>d1ri6a_ b.69.11.1 (A:) Putative isomerase YbhE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2bbkh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d2bgra1 b.70.3.1 (A:39-508) Dipeptidyl peptidase IV/CD26, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d2ddra1 d.151.1.3 (A:7-305) Sphingomyelin phosphodiesterase C {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d1ri6a_ b.69.11.1 (A:) Putative isomerase YbhE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1zwxa1 d.151.1.3 (A:41-333) Sphingomyelin phosphodiesterase C {Listeria ivanovii [TaxId: 1638]} Back     information, alignment and structure
>d1mdah_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1mdah_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1wdua_ d.151.1.1 (A:) Endonuclease domain of TRAS1 retrotransposon (ORF2) {Silkworm (Bombyx mori) [TaxId: 7091]} Back     information, alignment and structure
>d1qnia2 b.69.3.1 (A:10-450) Nitrous oxide reductase, N-terminal domain {Pseudomonas nautica [TaxId: 2743]} Back     information, alignment and structure
>d1qnia2 b.69.3.1 (A:10-450) Nitrous oxide reductase, N-terminal domain {Pseudomonas nautica [TaxId: 2743]} Back     information, alignment and structure
>d1q7fa_ b.68.9.1 (A:) Brain tumor cg10719-pa {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2p4oa1 b.68.6.3 (A:4-305) Hypothetical protein All0351 homologue {Nostoc punctiforme [TaxId: 272131]} Back     information, alignment and structure
>d1vyba_ d.151.1.1 (A:) Endonuclease domain of LINE-1 reverse transcriptase homolog {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bgra1 b.70.3.1 (A:39-508) Dipeptidyl peptidase IV/CD26, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d2f1na1 d.151.1.1 (A:1-250) Cytolethal distending toxin subunit B {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2a40b1 d.151.1.1 (B:1-260) Deoxyribonuclease I {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2p4oa1 b.68.6.3 (A:4-305) Hypothetical protein All0351 homologue {Nostoc punctiforme [TaxId: 272131]} Back     information, alignment and structure
>d1q7fa_ b.68.9.1 (A:) Brain tumor cg10719-pa {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1sr4b_ d.151.1.1 (B:) Cytolethal distending toxin subunit B {Haemophilus ducreyi [TaxId: 730]} Back     information, alignment and structure
>d1hd7a_ d.151.1.1 (A:) DNA repair endonuclease Hap1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pjxa_ b.68.6.1 (A:) Diisopropylfluorophosphatase (phosphotriesterase, DFP) {Squid (Loligo vulgaris) [TaxId: 6622]} Back     information, alignment and structure
>d1rwia_ b.68.9.1 (A:) Serine/threonine-protein kinase PknD {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2dg1a1 b.68.6.1 (A:6-324) Lactonase Drp35 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1akoa_ d.151.1.1 (A:) DNA-repair enzyme exonuclease III {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2hqsa1 b.68.4.1 (A:163-431) TolB, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2ghsa1 b.68.6.1 (A:20-314) Regucalcin {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1k32a2 b.68.7.1 (A:39-319) Tricorn protease N-terminal domain {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1pjxa_ b.68.6.1 (A:) Diisopropylfluorophosphatase (phosphotriesterase, DFP) {Squid (Loligo vulgaris) [TaxId: 6622]} Back     information, alignment and structure
>d1jofa_ b.69.10.1 (A:) 3-carboxy-cis,cis-mucoante lactonizing enzyme {Neurospora crassa [TaxId: 5141]} Back     information, alignment and structure
>d1jofa_ b.69.10.1 (A:) 3-carboxy-cis,cis-mucoante lactonizing enzyme {Neurospora crassa [TaxId: 5141]} Back     information, alignment and structure
>d1rwia_ b.68.9.1 (A:) Serine/threonine-protein kinase PknD {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2dg1a1 b.68.6.1 (A:6-324) Lactonase Drp35 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d2hqsa1 b.68.4.1 (A:163-431) TolB, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1grwa_ b.1.11.2 (A:) Major sperm protein, MSP {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1rowa_ b.1.11.2 (A:) SSP-19 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1m1sa_ b.1.11.2 (A:) WR4 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d2ghsa1 b.68.6.1 (A:20-314) Regucalcin {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1wica_ b.1.11.2 (A:) MSP domain containing protein 2, Mospd2 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1xfda1 b.70.3.1 (A:127-591) Dipeptidyl aminopeptidase-like protein 6, DPP6, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xfda1 b.70.3.1 (A:127-591) Dipeptidyl aminopeptidase-like protein 6, DPP6, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ad6a1 b.70.1.1 (A:1-571) Methanol dehydrogenase, heavy chain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} Back     information, alignment and structure
>d1kb0a2 b.70.1.1 (A:1-573) Quinoprotein alcohol dehydrogenase, N-terminal domain {Comamonas testosteroni [TaxId: 285]} Back     information, alignment and structure