Citrus Sinensis ID: 001257
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 1113 | ||||||
| 297745622 | 1477 | unnamed protein product [Vitis vinifera] | 0.450 | 0.339 | 0.611 | 1e-161 | |
| 255539360 | 1553 | conserved hypothetical protein [Ricinus | 0.445 | 0.319 | 0.553 | 1e-143 | |
| 449455738 | 1463 | PREDICTED: uncharacterized protein LOC10 | 0.445 | 0.339 | 0.554 | 1e-143 | |
| 449528207 | 909 | PREDICTED: uncharacterized LOC101219495 | 0.445 | 0.545 | 0.554 | 1e-142 | |
| 356577005 | 1501 | PREDICTED: uncharacterized protein LOC10 | 0.416 | 0.309 | 0.545 | 1e-125 | |
| 356523390 | 1296 | PREDICTED: uncharacterized protein LOC10 | 0.415 | 0.357 | 0.531 | 1e-118 | |
| 24430042 | 1498 | Hypothetical protein [Arabidopsis thalia | 0.425 | 0.316 | 0.521 | 1e-115 | |
| 186478714 | 1364 | uncharacterized protein [Arabidopsis tha | 0.416 | 0.340 | 0.517 | 1e-111 | |
| 297845076 | 1186 | hypothetical protein ARALYDRAFT_472337 [ | 0.418 | 0.392 | 0.520 | 1e-110 | |
| 357438817 | 1290 | hypothetical protein MTR_1g035040 [Medic | 0.419 | 0.362 | 0.478 | 1e-108 |
| >gi|297745622|emb|CBI40787.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
Score = 574 bits (1480), Expect = e-161, Method: Compositional matrix adjust.
Identities = 317/518 (61%), Positives = 390/518 (75%), Gaps = 17/518 (3%)
Query: 595 NRGIQLTGGEDGDR-TFQDVEGIERSDRCETQTSTPEGSTVDASESRNIGVEVVKQPFYF 653
N G Q+T + D+ T Q+ RS +S+ E + DA +S+N+ VEV K+PFYF
Sbjct: 851 NEGDQITSVDSDDKLTCQEA----RSVLGNGTSSSLEFLSTDALDSQNVPVEVGKRPFYF 906
Query: 654 LVKVPRYDDENLREQIKAAQSKVDEKTRSRDAIRDDIQTIRASYKEYAEKLEAAISDERS 713
L++VPRYDDE +RE+IK AQ +VDEKT+SRDAIR +IQ RA KEY+EK EAA+S+ER+
Sbjct: 907 LIRVPRYDDEKVREEIKLAQLQVDEKTKSRDAIRSEIQIKRAVCKEYSEKFEAALSEERA 966
Query: 714 ARESLKSKRQEIDSVQSRINMMKNAISVDDIDGSIRNMEHRIAHETLPLKEEKQIIREIK 773
AR+ LKSK QE+DSVQS IN +KNA+SV DIDG IR+MEH I HETLPLKEEKQ+IR+IK
Sbjct: 967 ARDLLKSKFQEMDSVQSVINRVKNAMSVKDIDGRIRHMEHAIEHETLPLKEEKQLIRDIK 1026
Query: 774 QLKQRREQISSSIGEHDEVQLAFDQKDQIEEKMKFLRKEADSLRENVIKAEAATQAVKKL 833
QL+ REQ+SS++G +EVQ A DQK Q+EE+ K LR+E DSL+ V KAE T+A KK
Sbjct: 1027 QLRNVREQLSSNMGRQEEVQQALDQKSQVEEQSKILREEVDSLKYKVQKAEVITKAAKKK 1086
Query: 834 HREESEKLKRLLGQFKAADEIRQEAYKHWQSLKKQAYDKNQHFWKYKDDTKQANDLASKG 893
+ +E+EKL L +FKAAD+IRQEAY H QSL+K+ +KN++F YKD+ K AND AS G
Sbjct: 1087 YYDENEKLNELQARFKAADDIRQEAYTHLQSLRKKLSEKNKYFRMYKDNLKAANDYASAG 1146
Query: 894 DREALQHLCVNQVERVLELWNNNDEFRKEYVNSNIRSTLRRLKTLDGRSLGPDEEAPLIR 953
D+EALQ LCVN+VE ++ELWNNNDEFRKEYV N RSTLRRL+TLDGRSLGPDEE P+I
Sbjct: 1147 DKEALQRLCVNEVETIMELWNNNDEFRKEYVRCNTRSTLRRLRTLDGRSLGPDEEPPVIP 1206
Query: 954 PFLNDRVAKNI-------SLTQISALEREKTEQVVPIKSEKVDDKPFPEVREQGDQIAKF 1006
FLN+R+ +++ S+ +S +EREK Q+VP +E DDK V Q ++ AK
Sbjct: 1207 NFLNERIGRSLFAPTKDSSVLIVSTVEREK--QMVPATAESADDKSVVNVTNQKNRTAKN 1264
Query: 1007 KKPEKPSRAENVSTTVSGRDDEIEEAKEEVPKLTKEEEEMARKAEEKRKEEATAKLREQR 1066
K P K S VS T+SGR DEIEE KEE K TKEEEE+ARKAEE RKEE AKL+EQR
Sbjct: 1265 KNPTK-SATGAVSATISGR-DEIEETKEE-HKQTKEEEELARKAEELRKEEEAAKLKEQR 1321
Query: 1067 RLEEKAKAQEALERKKRIAEKAQTRAALRAQKEAEQKE 1104
RLEEKAKA+EALERKKR AEKAQ RA LRAQKEAEQK+
Sbjct: 1322 RLEEKAKAKEALERKKRNAEKAQARAELRAQKEAEQKQ 1359
|
Source: Vitis vinifera Species: Vitis vinifera Genus: Vitis Family: Vitaceae Order: Vitales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|255539360|ref|XP_002510745.1| conserved hypothetical protein [Ricinus communis] gi|223551446|gb|EEF52932.1| conserved hypothetical protein [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|449455738|ref|XP_004145608.1| PREDICTED: uncharacterized protein LOC101219495 [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|449528207|ref|XP_004171097.1| PREDICTED: uncharacterized LOC101219495 [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|356577005|ref|XP_003556620.1| PREDICTED: uncharacterized protein LOC100798700 [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|356523390|ref|XP_003530323.1| PREDICTED: uncharacterized protein LOC100820077 [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|24430042|gb|AAD30594.2|AC007369_4 Hypothetical protein [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|186478714|ref|NP_173521.2| uncharacterized protein [Arabidopsis thaliana] gi|332191928|gb|AEE30049.1| uncharacterized protein [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|297845076|ref|XP_002890419.1| hypothetical protein ARALYDRAFT_472337 [Arabidopsis lyrata subsp. lyrata] gi|297336261|gb|EFH66678.1| hypothetical protein ARALYDRAFT_472337 [Arabidopsis lyrata subsp. lyrata] | Back alignment and taxonomy information |
|---|
| >gi|357438817|ref|XP_003589685.1| hypothetical protein MTR_1g035040 [Medicago truncatula] gi|355478733|gb|AES59936.1| hypothetical protein MTR_1g035040 [Medicago truncatula] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 1113 | ||||||
| TAIR|locus:2037365 | 1364 | AT1G20970 "AT1G20970" [Arabido | 0.397 | 0.324 | 0.480 | 5.1e-114 | |
| TAIR|locus:2124019 | 612 | PPI1 "proton pump interactor 1 | 0.394 | 0.717 | 0.237 | 7.8e-28 | |
| TAIR|locus:2087115 | 589 | PPI2 "proton pump interactor 2 | 0.280 | 0.529 | 0.215 | 9.1e-14 | |
| UNIPROTKB|Q8IIG7 | 1070 | PF11_0207 "Uncharacterized pro | 0.285 | 0.297 | 0.194 | 6e-12 | |
| TAIR|locus:504955937 | 734 | AT2G22795 "AT2G22795" [Arabido | 0.545 | 0.826 | 0.217 | 1e-11 | |
| TAIR|locus:2147366 | 576 | AT5G36690 "AT5G36690" [Arabido | 0.319 | 0.618 | 0.214 | 3e-09 | |
| TAIR|locus:2149084 | 576 | AT5G36780 "AT5G36780" [Arabido | 0.319 | 0.618 | 0.214 | 3e-09 | |
| DICTYBASE|DDB_G0271058 | 1528 | vilC "villin-like protein C" [ | 0.381 | 0.278 | 0.207 | 7.9e-09 | |
| TAIR|locus:2098443 | 2081 | AT3G28770 "AT3G28770" [Arabido | 0.709 | 0.379 | 0.195 | 1.1e-08 | |
| UNIPROTKB|Q9X0R4 | 1170 | smc "Chromosome partition prot | 0.307 | 0.292 | 0.225 | 1.7e-08 |
| TAIR|locus:2037365 AT1G20970 "AT1G20970" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 1000 (357.1 bits), Expect = 5.1e-114, Sum P(3) = 5.1e-114
Identities = 221/460 (48%), Positives = 309/460 (67%)
Query: 587 KTCPEVKENRGIQLT-----GGED--GDRTFQDVEG--IERSDRCETQTSTPEGSTVDAS 637
KTC + E++ + T G +D + ++ EG ++R+D + ST E S +DAS
Sbjct: 713 KTCAQDLESKVVTSTDTIHTGAKDCVDSQPAENKEGNVVDRTD--DKVASTGEVSVLDAS 770
Query: 638 ESRNIGVEVVKQPFYFLVKVPRYDDENLREQIKAAQSKVDEKTRSRDAIRDDIQTIRASY 697
E + E+ K+PFYFL +VPRYDDE L EQ+K A+ +VD+KT++RDA+R DIQ IRA
Sbjct: 771 EGLTVAAEIEKRPFYFLPRVPRYDDEKLAEQLKHAEEQVDQKTQNRDALRADIQKIRAIC 830
Query: 698 KEYAEKLEAAISDERSARESLKSKRQEIDSVQSRINMMKNAISVDDIDGSIRNMEHRIAH 757
K+Y +A +++ERSAR+++ SKRQEI+++QS I+ +K+A SVDDID +RNMEH + H
Sbjct: 831 KDYDISYKAVMAEERSARKAMHSKRQEIEALQSMISRVKSAASVDDIDSRVRNMEHTMQH 890
Query: 758 ETLPLKEEKQIIREIKQLKQRREQISSSIGEHDEVQLAFDQKDQIEEKMKFLRKEADSLR 817
TL L EEK +REIKQLKQ REQISSS+G DEV+ A D+K++ EE++K LRKE D+LR
Sbjct: 891 TTLSLNEEKGFMREIKQLKQLREQISSSMGTKDEVKQALDEKEKTEERLKVLRKELDALR 950
Query: 818 ENVIKAEAATQAVKKLHREESEKLKRLLGQFKAADEIRQEAYKHWQSLKKQAYDKNQHFW 877
++ KAE T+A KK E E +L QF+AAD +RQEA+ H Q LKKQ +KN++F+
Sbjct: 951 NDLSKAEEITKAAKKKCDGEWEAQSKLQEQFRAADAVRQEAFVHLQDLKKQQREKNKYFF 1010
Query: 878 KYKDDTKQANDLASKGDREALQHLCVNQVERVLELWNNNDEFRKEYVNSNIRSTLRRLKT 937
KY+D+++ A+++A K DR ALQ LC +QVE + +WNN+DEFRK YV SN RST RRL T
Sbjct: 1011 KYRDNSRAASEMALKKDRAALQSLCSDQVENFMNMWNNDDEFRKYYVKSNTRSTFRRLGT 1070
Query: 938 LDGRSLGPDEEAPLIR--PFLNDRVAKNISLTQISALEREKTEQVVPIKSEKVDD--KPF 993
LDGRSLGPDEE P I P + + + A+ +K E+VV + KV++ K
Sbjct: 1071 LDGRSLGPDEEPPRITYAPRTDKLRTSSDRAEKHEAVPAQK-EKVVKFEGSKVENNGKEV 1129
Query: 994 PEVREQGDQIAKFKKPEKPSRAENVSTT-VSGRDDEIEEA 1032
+ EQ Q K KK KP + ++ T VSG++ EIE++
Sbjct: 1130 AKPTEQKSQTTKSKKAVKPDQPPSIVTELVSGKE-EIEKS 1168
|
|
| TAIR|locus:2124019 PPI1 "proton pump interactor 1" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2087115 PPI2 "proton pump interactor 2" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q8IIG7 PF11_0207 "Uncharacterized protein PF11_0207" [Plasmodium falciparum 3D7 (taxid:36329)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:504955937 AT2G22795 "AT2G22795" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2147366 AT5G36690 "AT5G36690" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2149084 AT5G36780 "AT5G36780" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| DICTYBASE|DDB_G0271058 vilC "villin-like protein C" [Dictyostelium discoideum (taxid:44689)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2098443 AT3G28770 "AT3G28770" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q9X0R4 smc "Chromosome partition protein Smc" [Thermotoga maritima MSB8 (taxid:243274)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
| GSVIVG00002957001 | SubName- Full=Chromosome chr18 scaffold_137, whole genome shotgun sequence; (662 aa) | |||||||
(Vitis vinifera) | ||||||||
| Sorry, there are no predicted associations at the current settings. |
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 1113 | |||
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 2e-08 | |
| PTZ00121 | 2084 | PTZ00121, PTZ00121, MAEBL; Provisional | 2e-08 | |
| PTZ00121 | 2084 | PTZ00121, PTZ00121, MAEBL; Provisional | 4e-08 | |
| TIGR02794 | 346 | TIGR02794, tolA_full, TolA protein | 1e-07 | |
| TIGR02168 | 1179 | TIGR02168, SMC_prok_B, chromosome segregation prot | 2e-07 | |
| PTZ00121 | 2084 | PTZ00121, PTZ00121, MAEBL; Provisional | 5e-07 | |
| PTZ00121 | 2084 | PTZ00121, PTZ00121, MAEBL; Provisional | 8e-07 | |
| PTZ00121 | 2084 | PTZ00121, PTZ00121, MAEBL; Provisional | 2e-06 | |
| COG1340 | 294 | COG1340, COG1340, Uncharacterized archaeal coiled- | 3e-06 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 5e-06 | |
| COG0419 | 908 | COG0419, SbcC, ATPase involved in DNA repair [DNA | 5e-06 | |
| PRK03918 | 880 | PRK03918, PRK03918, chromosome segregation protein | 5e-06 | |
| TIGR02168 | 1179 | TIGR02168, SMC_prok_B, chromosome segregation prot | 1e-05 | |
| TIGR02794 | 346 | TIGR02794, tolA_full, TolA protein | 2e-05 | |
| TIGR02794 | 346 | TIGR02794, tolA_full, TolA protein | 4e-05 | |
| COG0419 | 908 | COG0419, SbcC, ATPase involved in DNA repair [DNA | 4e-05 | |
| pfam07946 | 322 | pfam07946, DUF1682, Protein of unknown function (D | 5e-05 | |
| PRK09510 | 387 | PRK09510, tolA, cell envelope integrity inner memb | 6e-05 | |
| PTZ00121 | 2084 | PTZ00121, PTZ00121, MAEBL; Provisional | 8e-05 | |
| TIGR02168 | 1179 | TIGR02168, SMC_prok_B, chromosome segregation prot | 1e-04 | |
| TIGR02169 | 1164 | TIGR02169, SMC_prok_A, chromosome segregation prot | 3e-04 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 4e-04 | |
| PTZ00121 | 2084 | PTZ00121, PTZ00121, MAEBL; Provisional | 4e-04 | |
| pfam07946 | 322 | pfam07946, DUF1682, Protein of unknown function (D | 4e-04 | |
| TIGR02169 | 1164 | TIGR02169, SMC_prok_A, chromosome segregation prot | 5e-04 | |
| pfam09726 | 680 | pfam09726, Macoilin, Transmembrane protein | 7e-04 | |
| TIGR02169 | 1164 | TIGR02169, SMC_prok_A, chromosome segregation prot | 0.001 | |
| PRK09510 | 387 | PRK09510, tolA, cell envelope integrity inner memb | 0.002 | |
| PRK00409 | 782 | PRK00409, PRK00409, recombination and DNA strand e | 0.002 | |
| PLN02316 | 1036 | PLN02316, PLN02316, synthase/transferase | 0.002 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 0.003 | |
| TIGR02794 | 346 | TIGR02794, tolA_full, TolA protein | 0.003 | |
| PRK00409 | 782 | PRK00409, PRK00409, recombination and DNA strand e | 0.003 | |
| TIGR02794 | 346 | TIGR02794, tolA_full, TolA protein | 0.004 |
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
Score = 58.6 bits (142), Expect = 2e-08
Identities = 39/234 (16%), Positives = 108/234 (46%), Gaps = 7/234 (2%)
Query: 663 ENLREQIKAAQSKVDEKTRSRDAIRDDIQTIRASYKEYAEKLEAAISDERSARESLKSKR 722
E L E++ + +++E + +I+ +++ +E E+LE + +E ++
Sbjct: 242 EELEEELSRLEEELEELQEELEEAEKEIEELKSELEELREELEELQEELLELKEEIEELE 301
Query: 723 QEIDSVQSRINMMKNAISVDDIDGSIRNMEHRIAHETLPLKEEKQIIREIKQLKQRREQI 782
EI ++ R+ ++N + ++++ + ++ +I EE++ + E +L+Q ++
Sbjct: 302 GEISLLRERLEELENEL--EELEERLEELKEKIE-ALKEELEERETLLE--ELEQLLAEL 356
Query: 783 SSSIGEHDEVQLAFDQKDQIEEKMKFLRKEADSLRENVIKAEAATQAVKKLHREESEKLK 842
+ E + + +++EE + LR+E L + + + +K+ E+L+
Sbjct: 357 EEAKEELE--EKLSALLEELEELFEALREELAELEAELAEIRNELEELKREIESLEERLE 414
Query: 843 RLLGQFKAADEIRQEAYKHWQSLKKQAYDKNQHFWKYKDDTKQANDLASKGDRE 896
RL + + E +E + L+ + + N+ + ++ ++ D + +RE
Sbjct: 415 RLSERLEDLKEELKELEAELEELQTELEELNEELEELEEQLEELRDRLKELERE 468
|
Length = 1163 |
| >gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|234017 TIGR02794, tolA_full, TolA protein | Back alignment and domain information |
|---|
| >gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type | Back alignment and domain information |
|---|
| >gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|224259 COG1340, COG1340, Uncharacterized archaeal coiled-coil protein [Function unknown] | Back alignment and domain information |
|---|
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|223496 COG0419, SbcC, ATPase involved in DNA repair [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >gnl|CDD|235175 PRK03918, PRK03918, chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type | Back alignment and domain information |
|---|
| >gnl|CDD|234017 TIGR02794, tolA_full, TolA protein | Back alignment and domain information |
|---|
| >gnl|CDD|234017 TIGR02794, tolA_full, TolA protein | Back alignment and domain information |
|---|
| >gnl|CDD|223496 COG0419, SbcC, ATPase involved in DNA repair [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >gnl|CDD|219655 pfam07946, DUF1682, Protein of unknown function (DUF1682) | Back alignment and domain information |
|---|
| >gnl|CDD|236545 PRK09510, tolA, cell envelope integrity inner membrane protein TolA; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type | Back alignment and domain information |
|---|
| >gnl|CDD|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type | Back alignment and domain information |
|---|
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|219655 pfam07946, DUF1682, Protein of unknown function (DUF1682) | Back alignment and domain information |
|---|
| >gnl|CDD|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type | Back alignment and domain information |
|---|
| >gnl|CDD|220365 pfam09726, Macoilin, Transmembrane protein | Back alignment and domain information |
|---|
| >gnl|CDD|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type | Back alignment and domain information |
|---|
| >gnl|CDD|236545 PRK09510, tolA, cell envelope integrity inner membrane protein TolA; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|234750 PRK00409, PRK00409, recombination and DNA strand exchange inhibitor protein; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|215180 PLN02316, PLN02316, synthase/transferase | Back alignment and domain information |
|---|
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|234017 TIGR02794, tolA_full, TolA protein | Back alignment and domain information |
|---|
| >gnl|CDD|234750 PRK00409, PRK00409, recombination and DNA strand exchange inhibitor protein; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|234017 TIGR02794, tolA_full, TolA protein | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 1113 | |||
| COG1340 | 294 | Uncharacterized archaeal coiled-coil protein [Func | 99.76 | |
| COG1340 | 294 | Uncharacterized archaeal coiled-coil protein [Func | 98.91 | |
| PHA02562 | 562 | 46 endonuclease subunit; Provisional | 98.35 | |
| PRK03918 | 880 | chromosome segregation protein; Provisional | 98.34 | |
| TIGR02169 | 1164 | SMC_prok_A chromosome segregation protein SMC, pri | 98.31 | |
| TIGR02169 | 1164 | SMC_prok_A chromosome segregation protein SMC, pri | 98.26 | |
| TIGR02168 | 1179 | SMC_prok_B chromosome segregation protein SMC, com | 98.22 | |
| PHA02562 | 562 | 46 endonuclease subunit; Provisional | 98.17 | |
| TIGR02168 | 1179 | SMC_prok_B chromosome segregation protein SMC, com | 98.16 | |
| COG1196 | 1163 | Smc Chromosome segregation ATPases [Cell division | 98.15 | |
| PRK02224 | 880 | chromosome segregation protein; Provisional | 98.14 | |
| PRK11637 | 428 | AmiB activator; Provisional | 98.14 | |
| COG1196 | 1163 | Smc Chromosome segregation ATPases [Cell division | 98.11 | |
| KOG0161 | 1930 | consensus Myosin class II heavy chain [Cytoskeleto | 98.11 | |
| PF07888 | 546 | CALCOCO1: Calcium binding and coiled-coil domain ( | 98.11 | |
| PRK03918 | 880 | chromosome segregation protein; Provisional | 98.04 | |
| PF00261 | 237 | Tropomyosin: Tropomyosin; InterPro: IPR000533 Trop | 98.03 | |
| TIGR00606 | 1311 | rad50 rad50. This family is based on the phylogeno | 98.03 | |
| PRK11637 | 428 | AmiB activator; Provisional | 98.01 | |
| PRK02224 | 880 | chromosome segregation protein; Provisional | 97.98 | |
| KOG0964 | 1200 | consensus Structural maintenance of chromosome pro | 97.97 | |
| COG1579 | 239 | Zn-ribbon protein, possibly nucleic acid-binding [ | 97.93 | |
| KOG0964 | 1200 | consensus Structural maintenance of chromosome pro | 97.91 | |
| TIGR00606 | 1311 | rad50 rad50. This family is based on the phylogeno | 97.89 | |
| KOG4673 | 961 | consensus Transcription factor TMF, TATA element m | 97.8 | |
| KOG0996 | 1293 | consensus Structural maintenance of chromosome pro | 97.7 | |
| TIGR03185 | 650 | DNA_S_dndD DNA sulfur modification protein DndD. T | 97.66 | |
| PRK04778 | 569 | septation ring formation regulator EzrA; Provision | 97.61 | |
| PRK01156 | 895 | chromosome segregation protein; Provisional | 97.6 | |
| PRK04778 | 569 | septation ring formation regulator EzrA; Provision | 97.59 | |
| KOG0250 | 1074 | consensus DNA repair protein RAD18 (SMC family pro | 97.59 | |
| PRK01156 | 895 | chromosome segregation protein; Provisional | 97.56 | |
| PF00038 | 312 | Filament: Intermediate filament protein; InterPro: | 97.55 | |
| PF05667 | 594 | DUF812: Protein of unknown function (DUF812); Inte | 97.54 | |
| TIGR03185 | 650 | DNA_S_dndD DNA sulfur modification protein DndD. T | 97.54 | |
| KOG0250 | 1074 | consensus DNA repair protein RAD18 (SMC family pro | 97.53 | |
| PTZ00121 | 2084 | MAEBL; Provisional | 97.49 | |
| KOG0996 | 1293 | consensus Structural maintenance of chromosome pro | 97.49 | |
| PF07888 | 546 | CALCOCO1: Calcium binding and coiled-coil domain ( | 97.47 | |
| KOG0161 | 1930 | consensus Myosin class II heavy chain [Cytoskeleto | 97.41 | |
| PF10174 | 775 | Cast: RIM-binding protein of the cytomatrix active | 97.38 | |
| KOG0979 | 1072 | consensus Structural maintenance of chromosome pro | 97.26 | |
| PF12128 | 1201 | DUF3584: Protein of unknown function (DUF3584); In | 97.25 | |
| PF12128 | 1201 | DUF3584: Protein of unknown function (DUF3584); In | 97.25 | |
| KOG1029 | 1118 | consensus Endocytic adaptor protein intersectin [S | 97.23 | |
| COG4942 | 420 | Membrane-bound metallopeptidase [Cell division and | 97.17 | |
| PF00038 | 312 | Filament: Intermediate filament protein; InterPro: | 97.13 | |
| KOG0933 | 1174 | consensus Structural maintenance of chromosome pro | 97.11 | |
| PF06160 | 560 | EzrA: Septation ring formation regulator, EzrA ; I | 97.05 | |
| KOG0612 | 1317 | consensus Rho-associated, coiled-coil containing p | 97.02 | |
| PF06160 | 560 | EzrA: Septation ring formation regulator, EzrA ; I | 97.01 | |
| KOG4674 | 1822 | consensus Uncharacterized conserved coiled-coil pr | 97.01 | |
| KOG0977 | 546 | consensus Nuclear envelope protein lamin, intermed | 97.0 | |
| PRK04863 | 1486 | mukB cell division protein MukB; Provisional | 96.99 | |
| TIGR02680 | 1353 | conserved hypothetical protein TIGR02680. Members | 96.97 | |
| KOG4673 | 961 | consensus Transcription factor TMF, TATA element m | 96.94 | |
| PRK04863 | 1486 | mukB cell division protein MukB; Provisional | 96.92 | |
| COG1579 | 239 | Zn-ribbon protein, possibly nucleic acid-binding [ | 96.9 | |
| PF09726 | 697 | Macoilin: Transmembrane protein; InterPro: IPR0191 | 96.87 | |
| PF05701 | 522 | WEMBL: Weak chloroplast movement under blue light; | 96.85 | |
| PF15070 | 617 | GOLGA2L5: Putative golgin subfamily A member 2-lik | 96.83 | |
| COG4942 | 420 | Membrane-bound metallopeptidase [Cell division and | 96.82 | |
| KOG0933 | 1174 | consensus Structural maintenance of chromosome pro | 96.77 | |
| PF08317 | 325 | Spc7: Spc7 kinetochore protein; InterPro: IPR01325 | 96.75 | |
| KOG0977 | 546 | consensus Nuclear envelope protein lamin, intermed | 96.75 | |
| KOG4674 | 1822 | consensus Uncharacterized conserved coiled-coil pr | 96.73 | |
| KOG0018 | 1141 | consensus Structural maintenance of chromosome pro | 96.71 | |
| COG0419 | 908 | SbcC ATPase involved in DNA repair [DNA replicatio | 96.71 | |
| KOG0971 | 1243 | consensus Microtubule-associated protein dynactin | 96.68 | |
| PRK09039 | 343 | hypothetical protein; Validated | 96.67 | |
| PF09789 | 319 | DUF2353: Uncharacterized coiled-coil protein (DUF2 | 96.61 | |
| KOG0612 | 1317 | consensus Rho-associated, coiled-coil containing p | 96.53 | |
| PTZ00121 | 2084 | MAEBL; Provisional | 96.51 | |
| KOG1029 | 1118 | consensus Endocytic adaptor protein intersectin [S | 96.45 | |
| KOG0979 | 1072 | consensus Structural maintenance of chromosome pro | 96.43 | |
| PF15070 | 617 | GOLGA2L5: Putative golgin subfamily A member 2-lik | 96.4 | |
| PF00261 | 237 | Tropomyosin: Tropomyosin; InterPro: IPR000533 Trop | 96.4 | |
| TIGR00634 | 563 | recN DNA repair protein RecN. All proteins in this | 96.3 | |
| KOG0962 | 1294 | consensus DNA repair protein RAD50, ABC-type ATPas | 96.28 | |
| COG4372 | 499 | Uncharacterized protein conserved in bacteria with | 96.28 | |
| PF15619 | 194 | Lebercilin: Ciliary protein causing Leber congenit | 96.21 | |
| PRK09039 | 343 | hypothetical protein; Validated | 96.2 | |
| PF05701 | 522 | WEMBL: Weak chloroplast movement under blue light; | 96.17 | |
| COG5185 | 622 | HEC1 Protein involved in chromosome segregation, i | 96.16 | |
| KOG0994 | 1758 | consensus Extracellular matrix glycoprotein Lamini | 96.16 | |
| PF05667 | 594 | DUF812: Protein of unknown function (DUF812); Inte | 96.14 | |
| PF09728 | 309 | Taxilin: Myosin-like coiled-coil protein; InterPro | 96.14 | |
| TIGR01843 | 423 | type_I_hlyD type I secretion membrane fusion prote | 96.08 | |
| smart00787 | 312 | Spc7 Spc7 kinetochore protein. This domain is foun | 96.06 | |
| TIGR03007 | 498 | pepcterm_ChnLen polysaccharide chain length determ | 96.0 | |
| PF09728 | 309 | Taxilin: Myosin-like coiled-coil protein; InterPro | 96.0 | |
| PF10174 | 775 | Cast: RIM-binding protein of the cytomatrix active | 95.86 | |
| TIGR02680 | 1353 | conserved hypothetical protein TIGR02680. Members | 95.83 | |
| PF12718 | 143 | Tropomyosin_1: Tropomyosin like; InterPro: IPR0005 | 95.69 | |
| PF13514 | 1111 | AAA_27: AAA domain | 95.59 | |
| KOG0995 | 581 | consensus Centromere-associated protein HEC1 [Cell | 95.57 | |
| KOG0018 | 1141 | consensus Structural maintenance of chromosome pro | 95.51 | |
| KOG0976 | 1265 | consensus Rho/Rac1-interacting serine/threonine ki | 95.51 | |
| KOG0976 | 1265 | consensus Rho/Rac1-interacting serine/threonine ki | 95.48 | |
| TIGR01000 | 457 | bacteriocin_acc bacteriocin secretion accessory pr | 95.44 | |
| COG0419 | 908 | SbcC ATPase involved in DNA repair [DNA replicatio | 95.4 | |
| COG4477 | 570 | EzrA Negative regulator of septation ring formatio | 95.38 | |
| PF08317 | 325 | Spc7: Spc7 kinetochore protein; InterPro: IPR01325 | 95.35 | |
| PF10168 | 717 | Nup88: Nuclear pore component; InterPro: IPR019321 | 95.24 | |
| KOG0946 | 970 | consensus ER-Golgi vesicle-tethering protein p115 | 95.19 | |
| PF13166 | 712 | AAA_13: AAA domain | 95.19 | |
| PF12718 | 143 | Tropomyosin_1: Tropomyosin like; InterPro: IPR0005 | 95.14 | |
| COG3883 | 265 | Uncharacterized protein conserved in bacteria [Fun | 95.05 | |
| PF13949 | 296 | ALIX_LYPXL_bnd: ALIX V-shaped domain binding to HI | 94.94 | |
| COG3883 | 265 | Uncharacterized protein conserved in bacteria [Fun | 94.92 | |
| PRK10869 | 553 | recombination and repair protein; Provisional | 94.87 | |
| PF04849 | 306 | HAP1_N: HAP1 N-terminal conserved region; InterPro | 94.83 | |
| TIGR03007 | 498 | pepcterm_ChnLen polysaccharide chain length determ | 94.72 | |
| PF12252 | 1439 | SidE: Dot/Icm substrate protein; InterPro: IPR0210 | 94.66 | |
| TIGR01005 | 754 | eps_transp_fam exopolysaccharide transport protein | 94.5 | |
| KOG1850 | 391 | consensus Myosin-like coiled-coil protein [Cytoske | 94.49 | |
| KOG4809 | 654 | consensus Rab6 GTPase-interacting protein involved | 94.46 | |
| PF13851 | 201 | GAS: Growth-arrest specific micro-tubule binding | 94.42 | |
| PF04912 | 388 | Dynamitin: Dynamitin ; InterPro: IPR006996 Dynamit | 94.39 | |
| COG5185 | 622 | HEC1 Protein involved in chromosome segregation, i | 94.37 | |
| KOG0971 | 1243 | consensus Microtubule-associated protein dynactin | 94.34 | |
| PF10146 | 230 | zf-C4H2: Zinc finger-containing protein ; InterPro | 94.24 | |
| smart00787 | 312 | Spc7 Spc7 kinetochore protein. This domain is foun | 94.21 | |
| TIGR01000 | 457 | bacteriocin_acc bacteriocin secretion accessory pr | 94.09 | |
| KOG0994 | 1758 | consensus Extracellular matrix glycoprotein Lamini | 94.05 | |
| PF13166 | 712 | AAA_13: AAA domain | 94.02 | |
| KOG0995 | 581 | consensus Centromere-associated protein HEC1 [Cell | 94.0 | |
| TIGR01843 | 423 | type_I_hlyD type I secretion membrane fusion prote | 93.96 | |
| KOG0999 | 772 | consensus Microtubule-associated protein Bicaudal- | 93.96 | |
| PF09726 | 697 | Macoilin: Transmembrane protein; InterPro: IPR0191 | 93.76 | |
| KOG2072 | 988 | consensus Translation initiation factor 3, subunit | 93.75 | |
| PF07926 | 132 | TPR_MLP1_2: TPR/MLP1/MLP2-like protein; InterPro: | 93.61 | |
| PF05622 | 713 | HOOK: HOOK protein; InterPro: IPR008636 This famil | 93.57 | |
| PLN03229 | 762 | acetyl-coenzyme A carboxylase carboxyl transferase | 93.56 | |
| TIGR01005 | 754 | eps_transp_fam exopolysaccharide transport protein | 93.54 | |
| KOG0963 | 629 | consensus Transcription factor/CCAAT displacement | 93.45 | |
| cd08915 | 342 | V_Alix_like Protein-interacting V-domain of mammal | 93.4 | |
| PF06008 | 264 | Laminin_I: Laminin Domain I; InterPro: IPR009254 L | 93.38 | |
| KOG0962 | 1294 | consensus DNA repair protein RAD50, ABC-type ATPas | 93.38 | |
| KOG0946 | 970 | consensus ER-Golgi vesicle-tethering protein p115 | 93.37 | |
| PRK10869 | 553 | recombination and repair protein; Provisional | 93.32 | |
| PF06008 | 264 | Laminin_I: Laminin Domain I; InterPro: IPR009254 L | 93.21 | |
| KOG0239 | 670 | consensus Kinesin (KAR3 subfamily) [Cytoskeleton] | 92.88 | |
| KOG2751 | 447 | consensus Beclin-like protein [Signal transduction | 92.68 | |
| PRK10929 | 1109 | putative mechanosensitive channel protein; Provisi | 92.56 | |
| PF04111 | 314 | APG6: Autophagy protein Apg6; InterPro: IPR007243 | 92.56 | |
| PF15450 | 531 | DUF4631: Domain of unknown function (DUF4631) | 92.52 | |
| PLN03229 | 762 | acetyl-coenzyme A carboxylase carboxyl transferase | 92.39 | |
| KOG4643 | 1195 | consensus Uncharacterized coiled-coil protein [Fun | 92.34 | |
| PRK11281 | 1113 | hypothetical protein; Provisional | 92.33 | |
| PF05483 | 786 | SCP-1: Synaptonemal complex protein 1 (SCP-1); Int | 92.21 | |
| PF09730 | 717 | BicD: Microtubule-associated protein Bicaudal-D; I | 91.88 | |
| PF09755 | 310 | DUF2046: Uncharacterized conserved protein H4 (DUF | 91.79 | |
| PF06705 | 247 | SF-assemblin: SF-assemblin/beta giardin | 91.76 | |
| KOG1003 | 205 | consensus Actin filament-coating protein tropomyos | 91.69 | |
| KOG1937 | 521 | consensus Uncharacterized conserved protein [Funct | 91.56 | |
| PF10168 | 717 | Nup88: Nuclear pore component; InterPro: IPR019321 | 91.51 | |
| PF09787 | 511 | Golgin_A5: Golgin subfamily A member 5; InterPro: | 91.48 | |
| PF12325 | 120 | TMF_TATA_bd: TATA element modulatory factor 1 TATA | 91.4 | |
| PF06818 | 202 | Fez1: Fez1; InterPro: IPR009638 This family repres | 91.23 | |
| TIGR03017 | 444 | EpsF chain length determinant protein EpsF. Sequen | 91.2 | |
| PF04111 | 314 | APG6: Autophagy protein Apg6; InterPro: IPR007243 | 91.12 | |
| KOG1937 | 521 | consensus Uncharacterized conserved protein [Funct | 91.12 | |
| KOG0163 | 1259 | consensus Myosin class VI heavy chain [Cytoskeleto | 90.95 | |
| COG4372 | 499 | Uncharacterized protein conserved in bacteria with | 90.68 | |
| PF15290 | 305 | Syntaphilin: Golgi-localised syntaxin-1-binding cl | 90.64 | |
| PF14662 | 193 | CCDC155: Coiled-coil region of CCDC155 | 90.61 | |
| PRK10884 | 206 | SH3 domain-containing protein; Provisional | 90.48 | |
| PF10234 | 267 | Cluap1: Clusterin-associated protein-1; InterPro: | 90.37 | |
| PF02403 | 108 | Seryl_tRNA_N: Seryl-tRNA synthetase N-terminal dom | 90.35 | |
| PF03999 | 619 | MAP65_ASE1: Microtubule associated protein (MAP65/ | 90.11 | |
| PRK10929 | 1109 | putative mechanosensitive channel protein; Provisi | 89.97 | |
| KOG1144 | 1064 | consensus Translation initiation factor 5B (eIF-5B | 89.69 | |
| PF07106 | 169 | TBPIP: Tat binding protein 1(TBP-1)-interacting pr | 89.56 | |
| PF04782 | 312 | DUF632: Protein of unknown function (DUF632); Inte | 89.55 | |
| PF12325 | 120 | TMF_TATA_bd: TATA element modulatory factor 1 TATA | 89.3 | |
| KOG0804 | 493 | consensus Cytoplasmic Zn-finger protein BRAP2 (BRC | 89.02 | |
| PF12252 | 1439 | SidE: Dot/Icm substrate protein; InterPro: IPR0210 | 89.01 | |
| PF13514 | 1111 | AAA_27: AAA domain | 88.73 | |
| PF11932 | 251 | DUF3450: Protein of unknown function (DUF3450); In | 88.38 | |
| PF11600 | 216 | CAF-1_p150: Chromatin assembly factor 1 complex p1 | 88.32 | |
| PF07106 | 169 | TBPIP: Tat binding protein 1(TBP-1)-interacting pr | 87.85 | |
| PF05384 | 159 | DegS: Sensor protein DegS; InterPro: IPR008595 Thi | 87.84 | |
| PF04156 | 191 | IncA: IncA protein; InterPro: IPR007285 Chlamydia | 87.78 | |
| PF06818 | 202 | Fez1: Fez1; InterPro: IPR009638 This family repres | 87.45 | |
| PF08614 | 194 | ATG16: Autophagy protein 16 (ATG16); InterPro: IPR | 87.38 | |
| PF04156 | 191 | IncA: IncA protein; InterPro: IPR007285 Chlamydia | 87.38 | |
| TIGR02894 | 161 | DNA_bind_RsfA transcription factor, RsfA family. I | 87.37 | |
| PRK10246 | 1047 | exonuclease subunit SbcC; Provisional | 87.35 | |
| PRK15422 | 79 | septal ring assembly protein ZapB; Provisional | 87.2 | |
| PF10498 | 359 | IFT57: Intra-flagellar transport protein 57 ; Inte | 87.16 | |
| PLN03188 | 1320 | kinesin-12 family protein; Provisional | 87.09 | |
| PF09730 | 717 | BicD: Microtubule-associated protein Bicaudal-D; I | 87.02 | |
| KOG0999 | 772 | consensus Microtubule-associated protein Bicaudal- | 86.89 | |
| PF08614 | 194 | ATG16: Autophagy protein 16 (ATG16); InterPro: IPR | 86.74 | |
| KOG0980 | 980 | consensus Actin-binding protein SLA2/Huntingtin-in | 86.7 | |
| KOG0804 | 493 | consensus Cytoplasmic Zn-finger protein BRAP2 (BRC | 86.66 | |
| KOG4643 | 1195 | consensus Uncharacterized coiled-coil protein [Fun | 86.59 | |
| PF05622 | 713 | HOOK: HOOK protein; InterPro: IPR008636 This famil | 86.36 | |
| cd09234 | 337 | V_HD-PTP_like Protein-interacting V-domain of mamm | 85.79 | |
| PF06005 | 72 | DUF904: Protein of unknown function (DUF904); Inte | 85.57 | |
| cd09235 | 339 | V_Alix Middle V-domain of mammalian Alix and relat | 85.56 | |
| cd07651 | 236 | F-BAR_PombeCdc15_like The F-BAR (FES-CIP4 Homology | 85.53 | |
| PF02403 | 108 | Seryl_tRNA_N: Seryl-tRNA synthetase N-terminal dom | 85.38 | |
| KOG4302 | 660 | consensus Microtubule-associated protein essential | 85.02 | |
| cd07623 | 224 | BAR_SNX1_2 The Bin/Amphiphysin/Rvs (BAR) domain of | 85.02 | |
| cd09238 | 339 | V_Alix_like_1 Protein-interacting V-domain of an u | 84.95 | |
| KOG0239 | 670 | consensus Kinesin (KAR3 subfamily) [Cytoskeleton] | 84.84 | |
| KOG1962 | 216 | consensus B-cell receptor-associated protein and r | 84.81 | |
| PRK10361 | 475 | DNA recombination protein RmuC; Provisional | 84.8 | |
| PF14915 | 305 | CCDC144C: CCDC144C protein coiled-coil region | 84.49 | |
| PF07946 | 321 | DUF1682: Protein of unknown function (DUF1682); In | 84.47 | |
| PF01576 | 859 | Myosin_tail_1: Myosin tail; InterPro: IPR002928 Mu | 84.3 | |
| PF15619 | 194 | Lebercilin: Ciliary protein causing Leber congenit | 84.2 | |
| PF03962 | 188 | Mnd1: Mnd1 family; InterPro: IPR005647 This family | 83.98 | |
| PF11932 | 251 | DUF3450: Protein of unknown function (DUF3450); In | 83.87 | |
| PF03904 | 230 | DUF334: Domain of unknown function (DUF334); Inter | 83.84 | |
| PF15397 | 258 | DUF4618: Domain of unknown function (DUF4618) | 83.63 | |
| PRK10698 | 222 | phage shock protein PspA; Provisional | 83.55 | |
| PF13851 | 201 | GAS: Growth-arrest specific micro-tubule binding | 83.54 | |
| PF11600 | 216 | CAF-1_p150: Chromatin assembly factor 1 complex p1 | 83.46 | |
| PF05911 | 769 | DUF869: Plant protein of unknown function (DUF869) | 83.08 | |
| KOG4302 | 660 | consensus Microtubule-associated protein essential | 82.96 | |
| PF10146 | 230 | zf-C4H2: Zinc finger-containing protein ; InterPro | 82.82 | |
| PF01576 | 859 | Myosin_tail_1: Myosin tail; InterPro: IPR002928 Mu | 82.25 | |
| PF06705 | 247 | SF-assemblin: SF-assemblin/beta giardin | 82.11 | |
| KOG0810 | 297 | consensus SNARE protein Syntaxin 1 and related pro | 82.0 | |
| COG1842 | 225 | PspA Phage shock protein A (IM30), suppresses sigm | 81.92 | |
| PRK10698 | 222 | phage shock protein PspA; Provisional | 81.91 | |
| PF09787 | 511 | Golgin_A5: Golgin subfamily A member 5; InterPro: | 81.87 | |
| cd07653 | 251 | F-BAR_CIP4-like The F-BAR (FES-CIP4 Homology and B | 81.84 | |
| PF15233 | 134 | SYCE1: Synaptonemal complex central element protei | 81.8 | |
| cd07657 | 237 | F-BAR_Fes_Fer The F-BAR (FES-CIP4 Homology and Bin | 81.63 | |
| KOG2129 | 552 | consensus Uncharacterized conserved protein H4 [Fu | 81.39 | |
| PF04849 | 306 | HAP1_N: HAP1 N-terminal conserved region; InterPro | 81.34 | |
| PF15066 | 527 | CAGE1: Cancer-associated gene protein 1 family | 80.46 | |
| TIGR03545 | 555 | conserved hypothetical protein TIGR03545. This mod | 80.36 | |
| KOG0288 | 459 | consensus WD40 repeat protein TipD [General functi | 80.18 | |
| KOG0163 | 1259 | consensus Myosin class VI heavy chain [Cytoskeleto | 80.06 |
| >COG1340 Uncharacterized archaeal coiled-coil protein [Function unknown] | Back alignment and domain information |
|---|
Probab=99.76 E-value=1.2e-15 Score=164.46 Aligned_cols=206 Identities=18% Similarity=0.309 Sum_probs=138.5
Q ss_pred hHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH----------
Q 001257 662 DENLREQIKAAQSKVDEKTRSRDAIRDDIQTIRASYKEYAEKLEAAISDERSARESLKSKRQEIDSVQSR---------- 731 (1113)
Q Consensus 662 DEeLKAKIdeLqKEIeELKQkRdAInaELkakRAERdELiEQLKeLReE~KqlReel~EKIKEIdsLQsa---------- 731 (1113)
...+..++..+...+..++++|+.++.++++++++|++|+.+++.++++.++++..+++..+++..++..
T Consensus 8 ~~E~e~K~~~lk~~~~e~~ekR~El~~~~~~~~ekRdeln~kvrE~~e~~~elr~~rdeineev~elK~kR~ein~kl~e 87 (294)
T COG1340 8 LDELELKRKQLKEEIEELKEKRDELRKEASELAEKRDELNAKVRELREKAQELREERDEINEEVQELKEKRDEINAKLQE 87 (294)
T ss_pred hhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence 4566677778888888888888888888888888888888888888777666666555555444443332
Q ss_pred -----------Hhhcc-cCCCHHHHHHHHHHHHHHhhcCCCChHHHHHHHHHHHHHHHHHHHhhhcccchhHHHHHhhhH
Q 001257 732 -----------INMMK-NAISVDDIDGSIRNMEHRIAHETLPLKEEKQIIREIKQLKQRREQISSSIGEHDEVQLAFDQK 799 (1113)
Q Consensus 732 -----------L~KLR-NAKSVEEIDarIkrLE~RIQTgSLSLvEEKKLLKEIKQLKKqRKkViAnaa~rAkIQESidQK 799 (1113)
++..+ +..++..|.+.|.+|+|.++|.+||+.+|+++|++|++|++....+ ...
T Consensus 88 L~~~~~~l~e~~~~~~~~~~~~~~ler~i~~Le~~~~T~~L~~e~E~~lvq~I~~L~k~le~~--------------~k~ 153 (294)
T COG1340 88 LRKEYRELKEKRNEFNLGGRSIKSLEREIERLEKKQQTSVLTPEEERELVQKIKELRKELEDA--------------KKA 153 (294)
T ss_pred HHHHHHHHHHHhhhhhccCCCHHHHHHHHHHHHHHHHhcCCChHHHHHHHHHHHHHHHHHHHH--------------HHH
Confidence 11110 1369999999999999999999999999999999999999987652 222
Q ss_pred HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHh
Q 001257 800 DQIEEKMKFLRKEADSLRENVIKAEAATQAVKKLHREESEKLKRLLGQFKAADEIRQEAYKHWQSLKKQAYDKNQHFWKY 879 (1113)
Q Consensus 800 EaIqEQIKaLKKELDELRkKLkkLEeklKALkKK~DEIkaEIdELQEELkALdEkRDEAYEeLkeLRKERDEkNkeFYqn 879 (1113)
.....+++.|.+++++++.+...++.++.+|..+.++++.++..+..+.+.+....|++.+.+-.+++..++.|..|-+.
T Consensus 154 ~e~~~~~~el~aei~~lk~~~~e~~eki~~la~eaqe~he~m~k~~~~~De~Rkeade~he~~ve~~~~~~e~~ee~~~~ 233 (294)
T COG1340 154 LEENEKLKELKAEIDELKKKAREIHEKIQELANEAQEYHEEMIKLFEEADELRKEADELHEEFVELSKKIDELHEEFRNL 233 (294)
T ss_pred HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhHHHHHHHHHH
Confidence 34456777888888877777666665555555555555555444444444444444444444444444444444444433
Q ss_pred HH
Q 001257 880 KD 881 (1113)
Q Consensus 880 RR 881 (1113)
+.
T Consensus 234 ~~ 235 (294)
T COG1340 234 QN 235 (294)
T ss_pred HH
Confidence 33
|
|
| >COG1340 Uncharacterized archaeal coiled-coil protein [Function unknown] | Back alignment and domain information |
|---|
| >PHA02562 46 endonuclease subunit; Provisional | Back alignment and domain information |
|---|
| >PRK03918 chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >TIGR02169 SMC_prok_A chromosome segregation protein SMC, primarily archaeal type | Back alignment and domain information |
|---|
| >TIGR02169 SMC_prok_A chromosome segregation protein SMC, primarily archaeal type | Back alignment and domain information |
|---|
| >TIGR02168 SMC_prok_B chromosome segregation protein SMC, common bacterial type | Back alignment and domain information |
|---|
| >PHA02562 46 endonuclease subunit; Provisional | Back alignment and domain information |
|---|
| >TIGR02168 SMC_prok_B chromosome segregation protein SMC, common bacterial type | Back alignment and domain information |
|---|
| >COG1196 Smc Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >PRK02224 chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >PRK11637 AmiB activator; Provisional | Back alignment and domain information |
|---|
| >COG1196 Smc Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >KOG0161 consensus Myosin class II heavy chain [Cytoskeleton] | Back alignment and domain information |
|---|
| >PF07888 CALCOCO1: Calcium binding and coiled-coil domain (CALCOCO1) like; InterPro: IPR012852 Proteins found in this family are similar to the coiled-coil transcriptional coactivator protein expressed by Mus musculus (CoCoA, Q8CGU1 from SWISSPROT) | Back alignment and domain information |
|---|
| >PRK03918 chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >PF00261 Tropomyosin: Tropomyosin; InterPro: IPR000533 Tropomyosins [], are a family of closely related proteins present in muscle and non-muscle cells | Back alignment and domain information |
|---|
| >TIGR00606 rad50 rad50 | Back alignment and domain information |
|---|
| >PRK11637 AmiB activator; Provisional | Back alignment and domain information |
|---|
| >PRK02224 chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >KOG0964 consensus Structural maintenance of chromosome protein 3 (sister chromatid cohesion complex Cohesin, subunit SMC3) [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >COG1579 Zn-ribbon protein, possibly nucleic acid-binding [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0964 consensus Structural maintenance of chromosome protein 3 (sister chromatid cohesion complex Cohesin, subunit SMC3) [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >TIGR00606 rad50 rad50 | Back alignment and domain information |
|---|
| >KOG4673 consensus Transcription factor TMF, TATA element modulatory factor [Transcription] | Back alignment and domain information |
|---|
| >KOG0996 consensus Structural maintenance of chromosome protein 4 (chromosome condensation complex Condensin, subunit C) [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >TIGR03185 DNA_S_dndD DNA sulfur modification protein DndD | Back alignment and domain information |
|---|
| >PRK04778 septation ring formation regulator EzrA; Provisional | Back alignment and domain information |
|---|
| >PRK01156 chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >PRK04778 septation ring formation regulator EzrA; Provisional | Back alignment and domain information |
|---|
| >KOG0250 consensus DNA repair protein RAD18 (SMC family protein) [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >PRK01156 chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >PF00038 Filament: Intermediate filament protein; InterPro: IPR016044 Intermediate filaments (IF) [, , ] are proteins which are primordial components of the cytoskeleton and the nuclear envelope | Back alignment and domain information |
|---|
| >PF05667 DUF812: Protein of unknown function (DUF812); InterPro: IPR008530 This family consists of several eukaryotic proteins of unknown function | Back alignment and domain information |
|---|
| >TIGR03185 DNA_S_dndD DNA sulfur modification protein DndD | Back alignment and domain information |
|---|
| >KOG0250 consensus DNA repair protein RAD18 (SMC family protein) [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >PTZ00121 MAEBL; Provisional | Back alignment and domain information |
|---|
| >KOG0996 consensus Structural maintenance of chromosome protein 4 (chromosome condensation complex Condensin, subunit C) [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >PF07888 CALCOCO1: Calcium binding and coiled-coil domain (CALCOCO1) like; InterPro: IPR012852 Proteins found in this family are similar to the coiled-coil transcriptional coactivator protein expressed by Mus musculus (CoCoA, Q8CGU1 from SWISSPROT) | Back alignment and domain information |
|---|
| >KOG0161 consensus Myosin class II heavy chain [Cytoskeleton] | Back alignment and domain information |
|---|
| >PF10174 Cast: RIM-binding protein of the cytomatrix active zone; InterPro: IPR019323 This entry represents a family of proteins that form part of the CAZ (cytomatrix at the active zone) complex which is involved in determining the site of synaptic vesicle fusion [] | Back alignment and domain information |
|---|
| >KOG0979 consensus Structural maintenance of chromosome protein SMC5/Spr18, SMC superfamily [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning; Replication, recombination and repair] | Back alignment and domain information |
|---|
| >PF12128 DUF3584: Protein of unknown function (DUF3584); InterPro: IPR021979 This family consist of uncharacterised bacterial proteins | Back alignment and domain information |
|---|
| >PF12128 DUF3584: Protein of unknown function (DUF3584); InterPro: IPR021979 This family consist of uncharacterised bacterial proteins | Back alignment and domain information |
|---|
| >KOG1029 consensus Endocytic adaptor protein intersectin [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >COG4942 Membrane-bound metallopeptidase [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >PF00038 Filament: Intermediate filament protein; InterPro: IPR016044 Intermediate filaments (IF) [, , ] are proteins which are primordial components of the cytoskeleton and the nuclear envelope | Back alignment and domain information |
|---|
| >KOG0933 consensus Structural maintenance of chromosome protein 2 (chromosome condensation complex Condensin, subunit E) [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >PF06160 EzrA: Septation ring formation regulator, EzrA ; InterPro: IPR010379 During the bacterial cell cycle, the tubulin-like cell-division protein FtsZ polymerises into a ring structure that establishes the location of the nascent division site | Back alignment and domain information |
|---|
| >KOG0612 consensus Rho-associated, coiled-coil containing protein kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF06160 EzrA: Septation ring formation regulator, EzrA ; InterPro: IPR010379 During the bacterial cell cycle, the tubulin-like cell-division protein FtsZ polymerises into a ring structure that establishes the location of the nascent division site | Back alignment and domain information |
|---|
| >KOG4674 consensus Uncharacterized conserved coiled-coil protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG0977 consensus Nuclear envelope protein lamin, intermediate filament superfamily [Cell cycle control, cell division, chromosome partitioning; Nuclear structure] | Back alignment and domain information |
|---|
| >PRK04863 mukB cell division protein MukB; Provisional | Back alignment and domain information |
|---|
| >TIGR02680 conserved hypothetical protein TIGR02680 | Back alignment and domain information |
|---|
| >KOG4673 consensus Transcription factor TMF, TATA element modulatory factor [Transcription] | Back alignment and domain information |
|---|
| >PRK04863 mukB cell division protein MukB; Provisional | Back alignment and domain information |
|---|
| >COG1579 Zn-ribbon protein, possibly nucleic acid-binding [General function prediction only] | Back alignment and domain information |
|---|
| >PF09726 Macoilin: Transmembrane protein; InterPro: IPR019130 This entry represents the multi-pass transmembrane protein Macoilin, which is highly conserved in eukaryotes | Back alignment and domain information |
|---|
| >PF05701 WEMBL: Weak chloroplast movement under blue light; InterPro: IPR008545 This family consists of several plant proteins of unknown function | Back alignment and domain information |
|---|
| >PF15070 GOLGA2L5: Putative golgin subfamily A member 2-like protein 5 | Back alignment and domain information |
|---|
| >COG4942 Membrane-bound metallopeptidase [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >KOG0933 consensus Structural maintenance of chromosome protein 2 (chromosome condensation complex Condensin, subunit E) [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >PF08317 Spc7: Spc7 kinetochore protein; InterPro: IPR013253 This entry consists of cell division proteins which are required for kinetochore-spindle association [] | Back alignment and domain information |
|---|
| >KOG0977 consensus Nuclear envelope protein lamin, intermediate filament superfamily [Cell cycle control, cell division, chromosome partitioning; Nuclear structure] | Back alignment and domain information |
|---|
| >KOG4674 consensus Uncharacterized conserved coiled-coil protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG0018 consensus Structural maintenance of chromosome protein 1 (sister chromatid cohesion complex Cohesin, subunit SMC1) [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >COG0419 SbcC ATPase involved in DNA repair [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >KOG0971 consensus Microtubule-associated protein dynactin DCTN1/Glued [Cell cycle control, cell division, chromosome partitioning; Cytoskeleton] | Back alignment and domain information |
|---|
| >PRK09039 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >PF09789 DUF2353: Uncharacterized coiled-coil protein (DUF2353); InterPro: IPR019179 Members of this family have been annotated as being coiled-coil domain-containing protein 149, however they currently have no known function | Back alignment and domain information |
|---|
| >KOG0612 consensus Rho-associated, coiled-coil containing protein kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PTZ00121 MAEBL; Provisional | Back alignment and domain information |
|---|
| >KOG1029 consensus Endocytic adaptor protein intersectin [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >KOG0979 consensus Structural maintenance of chromosome protein SMC5/Spr18, SMC superfamily [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning; Replication, recombination and repair] | Back alignment and domain information |
|---|
| >PF15070 GOLGA2L5: Putative golgin subfamily A member 2-like protein 5 | Back alignment and domain information |
|---|
| >PF00261 Tropomyosin: Tropomyosin; InterPro: IPR000533 Tropomyosins [], are a family of closely related proteins present in muscle and non-muscle cells | Back alignment and domain information |
|---|
| >TIGR00634 recN DNA repair protein RecN | Back alignment and domain information |
|---|
| >KOG0962 consensus DNA repair protein RAD50, ABC-type ATPase/SMC superfamily [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >COG4372 Uncharacterized protein conserved in bacteria with the myosin-like domain [Function unknown] | Back alignment and domain information |
|---|
| >PF15619 Lebercilin: Ciliary protein causing Leber congenital amaurosis disease | Back alignment and domain information |
|---|
| >PRK09039 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >PF05701 WEMBL: Weak chloroplast movement under blue light; InterPro: IPR008545 This family consists of several plant proteins of unknown function | Back alignment and domain information |
|---|
| >COG5185 HEC1 Protein involved in chromosome segregation, interacts with SMC proteins [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >KOG0994 consensus Extracellular matrix glycoprotein Laminin subunit beta [Extracellular structures] | Back alignment and domain information |
|---|
| >PF05667 DUF812: Protein of unknown function (DUF812); InterPro: IPR008530 This family consists of several eukaryotic proteins of unknown function | Back alignment and domain information |
|---|
| >PF09728 Taxilin: Myosin-like coiled-coil protein; InterPro: IPR019132 Taxilin contains an extraordinarily long coiled-coil domain in its C-terminal half and is ubiquitously expressed | Back alignment and domain information |
|---|
| >TIGR01843 type_I_hlyD type I secretion membrane fusion protein, HlyD family | Back alignment and domain information |
|---|
| >smart00787 Spc7 Spc7 kinetochore protein | Back alignment and domain information |
|---|
| >TIGR03007 pepcterm_ChnLen polysaccharide chain length determinant protein, PEP-CTERM locus subfamily | Back alignment and domain information |
|---|
| >PF09728 Taxilin: Myosin-like coiled-coil protein; InterPro: IPR019132 Taxilin contains an extraordinarily long coiled-coil domain in its C-terminal half and is ubiquitously expressed | Back alignment and domain information |
|---|
| >PF10174 Cast: RIM-binding protein of the cytomatrix active zone; InterPro: IPR019323 This entry represents a family of proteins that form part of the CAZ (cytomatrix at the active zone) complex which is involved in determining the site of synaptic vesicle fusion [] | Back alignment and domain information |
|---|
| >TIGR02680 conserved hypothetical protein TIGR02680 | Back alignment and domain information |
|---|
| >PF12718 Tropomyosin_1: Tropomyosin like; InterPro: IPR000533 Tropomyosins [], are a family of closely related proteins present in muscle and non-muscle cells | Back alignment and domain information |
|---|
| >PF13514 AAA_27: AAA domain | Back alignment and domain information |
|---|
| >KOG0995 consensus Centromere-associated protein HEC1 [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >KOG0018 consensus Structural maintenance of chromosome protein 1 (sister chromatid cohesion complex Cohesin, subunit SMC1) [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >KOG0976 consensus Rho/Rac1-interacting serine/threonine kinase Citron [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0976 consensus Rho/Rac1-interacting serine/threonine kinase Citron [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >TIGR01000 bacteriocin_acc bacteriocin secretion accessory protein | Back alignment and domain information |
|---|
| >COG0419 SbcC ATPase involved in DNA repair [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >COG4477 EzrA Negative regulator of septation ring formation [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >PF08317 Spc7: Spc7 kinetochore protein; InterPro: IPR013253 This entry consists of cell division proteins which are required for kinetochore-spindle association [] | Back alignment and domain information |
|---|
| >PF10168 Nup88: Nuclear pore component; InterPro: IPR019321 Nup88 can be divided into two structural domains; the N-terminal two-thirds of the protein have no obvious structural motifs | Back alignment and domain information |
|---|
| >KOG0946 consensus ER-Golgi vesicle-tethering protein p115 [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >PF13166 AAA_13: AAA domain | Back alignment and domain information |
|---|
| >PF12718 Tropomyosin_1: Tropomyosin like; InterPro: IPR000533 Tropomyosins [], are a family of closely related proteins present in muscle and non-muscle cells | Back alignment and domain information |
|---|
| >COG3883 Uncharacterized protein conserved in bacteria [Function unknown] | Back alignment and domain information |
|---|
| >PF13949 ALIX_LYPXL_bnd: ALIX V-shaped domain binding to HIV ; PDB: 2XS1_A 2XS8_A 2R03_A 2R02_A 2OEX_B 2OEV_A 2OJQ_A 2R05_A | Back alignment and domain information |
|---|
| >COG3883 Uncharacterized protein conserved in bacteria [Function unknown] | Back alignment and domain information |
|---|
| >PRK10869 recombination and repair protein; Provisional | Back alignment and domain information |
|---|
| >PF04849 HAP1_N: HAP1 N-terminal conserved region; InterPro: IPR006933 This family is defined by an N-terminal conserved region found in several huntingtin-associated protein 1 (HAP1) homologues | Back alignment and domain information |
|---|
| >TIGR03007 pepcterm_ChnLen polysaccharide chain length determinant protein, PEP-CTERM locus subfamily | Back alignment and domain information |
|---|
| >PF12252 SidE: Dot/Icm substrate protein; InterPro: IPR021014 This entry represents bacterial proteins that are typically between 397 and 1543 amino acids in length including SidE protein in the Dot/Icm pathway of Legionella pneumophila bacteria | Back alignment and domain information |
|---|
| >TIGR01005 eps_transp_fam exopolysaccharide transport protein family | Back alignment and domain information |
|---|
| >KOG1850 consensus Myosin-like coiled-coil protein [Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG4809 consensus Rab6 GTPase-interacting protein involved in endosome-to-TGN transport [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >PF13851 GAS: Growth-arrest specific micro-tubule binding | Back alignment and domain information |
|---|
| >PF04912 Dynamitin: Dynamitin ; InterPro: IPR006996 Dynamitin is a subunit of the microtubule-dependent motor complex, it is also implicated in cell adhesion by binding to macrophage-enriched myristoylated alanine-rice C kinase substrate (MacMARCKS) [] | Back alignment and domain information |
|---|
| >COG5185 HEC1 Protein involved in chromosome segregation, interacts with SMC proteins [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >KOG0971 consensus Microtubule-associated protein dynactin DCTN1/Glued [Cell cycle control, cell division, chromosome partitioning; Cytoskeleton] | Back alignment and domain information |
|---|
| >PF10146 zf-C4H2: Zinc finger-containing protein ; InterPro: IPR018482 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule | Back alignment and domain information |
|---|
| >smart00787 Spc7 Spc7 kinetochore protein | Back alignment and domain information |
|---|
| >TIGR01000 bacteriocin_acc bacteriocin secretion accessory protein | Back alignment and domain information |
|---|
| >KOG0994 consensus Extracellular matrix glycoprotein Laminin subunit beta [Extracellular structures] | Back alignment and domain information |
|---|
| >PF13166 AAA_13: AAA domain | Back alignment and domain information |
|---|
| >KOG0995 consensus Centromere-associated protein HEC1 [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >TIGR01843 type_I_hlyD type I secretion membrane fusion protein, HlyD family | Back alignment and domain information |
|---|
| >KOG0999 consensus Microtubule-associated protein Bicaudal-D [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >PF09726 Macoilin: Transmembrane protein; InterPro: IPR019130 This entry represents the multi-pass transmembrane protein Macoilin, which is highly conserved in eukaryotes | Back alignment and domain information |
|---|
| >KOG2072 consensus Translation initiation factor 3, subunit a (eIF-3a) [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >PF07926 TPR_MLP1_2: TPR/MLP1/MLP2-like protein; InterPro: IPR012929 This domain is found in a number of proteins, including TPR protein (P12270 from SWISSPROT) and yeast myosin-like proteins 1 (MLP1, Q02455 from SWISSPROT) and 2 (MLP2, P40457 from SWISSPROT) | Back alignment and domain information |
|---|
| >PF05622 HOOK: HOOK protein; InterPro: IPR008636 This family consists of several HOOK1, 2 and 3 proteins from different eukaryotic organisms | Back alignment and domain information |
|---|
| >PLN03229 acetyl-coenzyme A carboxylase carboxyl transferase subunit alpha; Provisional | Back alignment and domain information |
|---|
| >TIGR01005 eps_transp_fam exopolysaccharide transport protein family | Back alignment and domain information |
|---|
| >KOG0963 consensus Transcription factor/CCAAT displacement protein CDP1 [Transcription] | Back alignment and domain information |
|---|
| >cd08915 V_Alix_like Protein-interacting V-domain of mammalian Alix and related domains | Back alignment and domain information |
|---|
| >PF06008 Laminin_I: Laminin Domain I; InterPro: IPR009254 Laminins are glycoproteins that are major constituents of the basement membrane of cells | Back alignment and domain information |
|---|
| >KOG0962 consensus DNA repair protein RAD50, ABC-type ATPase/SMC superfamily [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >KOG0946 consensus ER-Golgi vesicle-tethering protein p115 [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >PRK10869 recombination and repair protein; Provisional | Back alignment and domain information |
|---|
| >PF06008 Laminin_I: Laminin Domain I; InterPro: IPR009254 Laminins are glycoproteins that are major constituents of the basement membrane of cells | Back alignment and domain information |
|---|
| >KOG0239 consensus Kinesin (KAR3 subfamily) [Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG2751 consensus Beclin-like protein [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PRK10929 putative mechanosensitive channel protein; Provisional | Back alignment and domain information |
|---|
| >PF04111 APG6: Autophagy protein Apg6; InterPro: IPR007243 Macroautophagy is a bulk degradation process induced by starvation in eukaryotic cells | Back alignment and domain information |
|---|
| >PF15450 DUF4631: Domain of unknown function (DUF4631) | Back alignment and domain information |
|---|
| >PLN03229 acetyl-coenzyme A carboxylase carboxyl transferase subunit alpha; Provisional | Back alignment and domain information |
|---|
| >KOG4643 consensus Uncharacterized coiled-coil protein [Function unknown] | Back alignment and domain information |
|---|
| >PRK11281 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PF05483 SCP-1: Synaptonemal complex protein 1 (SCP-1); InterPro: IPR008827 Synaptonemal complex protein 1 (SCP-1) is the major component of the transverse filaments of the synaptonemal complex | Back alignment and domain information |
|---|
| >PF09730 BicD: Microtubule-associated protein Bicaudal-D; InterPro: IPR018477 BicD proteins consist of three coiled-coiled domains and are involved in dynein-mediated minus end-directed transport from the Golgi apparatus to the endoplasmic reticulum (ER) [] | Back alignment and domain information |
|---|
| >PF09755 DUF2046: Uncharacterized conserved protein H4 (DUF2046); InterPro: IPR019152 This is the conserved N-terminal 350 residues of a family of proteins of unknown function possibly containing a coiled-coil domain | Back alignment and domain information |
|---|
| >PF06705 SF-assemblin: SF-assemblin/beta giardin | Back alignment and domain information |
|---|
| >KOG1003 consensus Actin filament-coating protein tropomyosin [Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG1937 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >PF10168 Nup88: Nuclear pore component; InterPro: IPR019321 Nup88 can be divided into two structural domains; the N-terminal two-thirds of the protein have no obvious structural motifs | Back alignment and domain information |
|---|
| >PF09787 Golgin_A5: Golgin subfamily A member 5; InterPro: IPR019177 This entry represents a family of proteins involved in maintaining Golgi structure | Back alignment and domain information |
|---|
| >PF12325 TMF_TATA_bd: TATA element modulatory factor 1 TATA binding; InterPro: IPR022091 This is the C-terminal conserved coiled coil region of a family of TATA element modulatory factor 1 proteins conserved in eukaryotes [] | Back alignment and domain information |
|---|
| >PF06818 Fez1: Fez1; InterPro: IPR009638 This family represents the eukaryotic Fez1 protein | Back alignment and domain information |
|---|
| >TIGR03017 EpsF chain length determinant protein EpsF | Back alignment and domain information |
|---|
| >PF04111 APG6: Autophagy protein Apg6; InterPro: IPR007243 Macroautophagy is a bulk degradation process induced by starvation in eukaryotic cells | Back alignment and domain information |
|---|
| >KOG1937 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG0163 consensus Myosin class VI heavy chain [Cytoskeleton] | Back alignment and domain information |
|---|
| >COG4372 Uncharacterized protein conserved in bacteria with the myosin-like domain [Function unknown] | Back alignment and domain information |
|---|
| >PF15290 Syntaphilin: Golgi-localised syntaxin-1-binding clamp | Back alignment and domain information |
|---|
| >PF14662 CCDC155: Coiled-coil region of CCDC155 | Back alignment and domain information |
|---|
| >PRK10884 SH3 domain-containing protein; Provisional | Back alignment and domain information |
|---|
| >PF10234 Cluap1: Clusterin-associated protein-1; InterPro: IPR019366 This protein of 413 amino acids contains a central coiled-coil domain, possibly the region that binds to clusterin | Back alignment and domain information |
|---|
| >PF02403 Seryl_tRNA_N: Seryl-tRNA synthetase N-terminal domain; InterPro: IPR015866 The aminoacyl-tRNA synthetases (6 | Back alignment and domain information |
|---|
| >PF03999 MAP65_ASE1: Microtubule associated protein (MAP65/ASE1 family); InterPro: IPR007145 This is a family of microtubule associated proteins | Back alignment and domain information |
|---|
| >PRK10929 putative mechanosensitive channel protein; Provisional | Back alignment and domain information |
|---|
| >KOG1144 consensus Translation initiation factor 5B (eIF-5B) [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >PF07106 TBPIP: Tat binding protein 1(TBP-1)-interacting protein (TBPIP); InterPro: IPR010776 This family consists of several eukaryotic TBP-1 interacting protein (TBPIP) sequences | Back alignment and domain information |
|---|
| >PF04782 DUF632: Protein of unknown function (DUF632); InterPro: IPR006867 This conserved region contains a leucine zipper-like domain | Back alignment and domain information |
|---|
| >PF12325 TMF_TATA_bd: TATA element modulatory factor 1 TATA binding; InterPro: IPR022091 This is the C-terminal conserved coiled coil region of a family of TATA element modulatory factor 1 proteins conserved in eukaryotes [] | Back alignment and domain information |
|---|
| >KOG0804 consensus Cytoplasmic Zn-finger protein BRAP2 (BRCA1 associated protein) [General function prediction only] | Back alignment and domain information |
|---|
| >PF12252 SidE: Dot/Icm substrate protein; InterPro: IPR021014 This entry represents bacterial proteins that are typically between 397 and 1543 amino acids in length including SidE protein in the Dot/Icm pathway of Legionella pneumophila bacteria | Back alignment and domain information |
|---|
| >PF13514 AAA_27: AAA domain | Back alignment and domain information |
|---|
| >PF11932 DUF3450: Protein of unknown function (DUF3450); InterPro: IPR016866 There is currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function | Back alignment and domain information |
|---|
| >PF11600 CAF-1_p150: Chromatin assembly factor 1 complex p150 subunit, N-terminal; InterPro: IPR021644 P150 is a polypeptide subunit of CAF-1, which functions in depositing newly synthesised and acetylated histones H3/H4 into chromatin during DNA replication and repair [] | Back alignment and domain information |
|---|
| >PF07106 TBPIP: Tat binding protein 1(TBP-1)-interacting protein (TBPIP); InterPro: IPR010776 This family consists of several eukaryotic TBP-1 interacting protein (TBPIP) sequences | Back alignment and domain information |
|---|
| >PF05384 DegS: Sensor protein DegS; InterPro: IPR008595 This is a group of Bacillus DegS proteins | Back alignment and domain information |
|---|
| >PF04156 IncA: IncA protein; InterPro: IPR007285 Chlamydia trachomatis is an obligate intracellular bacterium that develops within a parasitophorous vacuole termed an inclusion | Back alignment and domain information |
|---|
| >PF06818 Fez1: Fez1; InterPro: IPR009638 This family represents the eukaryotic Fez1 protein | Back alignment and domain information |
|---|
| >PF08614 ATG16: Autophagy protein 16 (ATG16); InterPro: IPR013923 Macroautophagy is a bulk degradation process induced by starvation in eukaryotic cells | Back alignment and domain information |
|---|
| >PF04156 IncA: IncA protein; InterPro: IPR007285 Chlamydia trachomatis is an obligate intracellular bacterium that develops within a parasitophorous vacuole termed an inclusion | Back alignment and domain information |
|---|
| >TIGR02894 DNA_bind_RsfA transcription factor, RsfA family | Back alignment and domain information |
|---|
| >PRK10246 exonuclease subunit SbcC; Provisional | Back alignment and domain information |
|---|
| >PRK15422 septal ring assembly protein ZapB; Provisional | Back alignment and domain information |
|---|
| >PF10498 IFT57: Intra-flagellar transport protein 57 ; InterPro: IPR019530 Eukaryotic cilia and flagella are specialised organelles found at the periphery of cells of diverse organisms | Back alignment and domain information |
|---|
| >PLN03188 kinesin-12 family protein; Provisional | Back alignment and domain information |
|---|
| >PF09730 BicD: Microtubule-associated protein Bicaudal-D; InterPro: IPR018477 BicD proteins consist of three coiled-coiled domains and are involved in dynein-mediated minus end-directed transport from the Golgi apparatus to the endoplasmic reticulum (ER) [] | Back alignment and domain information |
|---|
| >KOG0999 consensus Microtubule-associated protein Bicaudal-D [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >PF08614 ATG16: Autophagy protein 16 (ATG16); InterPro: IPR013923 Macroautophagy is a bulk degradation process induced by starvation in eukaryotic cells | Back alignment and domain information |
|---|
| >KOG0980 consensus Actin-binding protein SLA2/Huntingtin-interacting protein Hip1 [Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG0804 consensus Cytoplasmic Zn-finger protein BRAP2 (BRCA1 associated protein) [General function prediction only] | Back alignment and domain information |
|---|
| >KOG4643 consensus Uncharacterized coiled-coil protein [Function unknown] | Back alignment and domain information |
|---|
| >PF05622 HOOK: HOOK protein; InterPro: IPR008636 This family consists of several HOOK1, 2 and 3 proteins from different eukaryotic organisms | Back alignment and domain information |
|---|
| >cd09234 V_HD-PTP_like Protein-interacting V-domain of mammalian His-Domain type N23 protein tyrosine phosphatase and related domains | Back alignment and domain information |
|---|
| >PF06005 DUF904: Protein of unknown function (DUF904); InterPro: IPR009252 Cell division protein ZapB is a non-essential, abundant cell division factor that is required for proper Z-ring formation | Back alignment and domain information |
|---|
| >cd09235 V_Alix Middle V-domain of mammalian Alix and related domains are dimerization and protein interaction modules | Back alignment and domain information |
|---|
| >cd07651 F-BAR_PombeCdc15_like The F-BAR (FES-CIP4 Homology and Bin/Amphiphysin/Rvs) domain of Schizosaccharomyces pombe Cdc15, and similar proteins | Back alignment and domain information |
|---|
| >PF02403 Seryl_tRNA_N: Seryl-tRNA synthetase N-terminal domain; InterPro: IPR015866 The aminoacyl-tRNA synthetases (6 | Back alignment and domain information |
|---|
| >KOG4302 consensus Microtubule-associated protein essential for anaphase spindle elongation [Cell cycle control, cell division, chromosome partitioning; Cytoskeleton] | Back alignment and domain information |
|---|
| >cd07623 BAR_SNX1_2 The Bin/Amphiphysin/Rvs (BAR) domain of Sorting Nexins 1 and 2 | Back alignment and domain information |
|---|
| >cd09238 V_Alix_like_1 Protein-interacting V-domain of an uncharacterized family of the V_Alix_like superfamily | Back alignment and domain information |
|---|
| >KOG0239 consensus Kinesin (KAR3 subfamily) [Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG1962 consensus B-cell receptor-associated protein and related proteins [Defense mechanisms] | Back alignment and domain information |
|---|
| >PRK10361 DNA recombination protein RmuC; Provisional | Back alignment and domain information |
|---|
| >PF14915 CCDC144C: CCDC144C protein coiled-coil region | Back alignment and domain information |
|---|
| >PF07946 DUF1682: Protein of unknown function (DUF1682); InterPro: IPR012879 The members of this family are all hypothetical eukaryotic proteins of unknown function | Back alignment and domain information |
|---|
| >PF01576 Myosin_tail_1: Myosin tail; InterPro: IPR002928 Muscle contraction is caused by sliding between the thick and thin filaments of the myofibril | Back alignment and domain information |
|---|
| >PF15619 Lebercilin: Ciliary protein causing Leber congenital amaurosis disease | Back alignment and domain information |
|---|
| >PF03962 Mnd1: Mnd1 family; InterPro: IPR005647 This family of proteins includes meiotic nuclear division protein 1 (MND1) from Saccharomyces cerevisiae (Baker's yeast) | Back alignment and domain information |
|---|
| >PF11932 DUF3450: Protein of unknown function (DUF3450); InterPro: IPR016866 There is currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function | Back alignment and domain information |
|---|
| >PF03904 DUF334: Domain of unknown function (DUF334); InterPro: IPR005602 This is a family of proteins found in Staphylococcus aureus plasmid with no characterised function | Back alignment and domain information |
|---|
| >PF15397 DUF4618: Domain of unknown function (DUF4618) | Back alignment and domain information |
|---|
| >PRK10698 phage shock protein PspA; Provisional | Back alignment and domain information |
|---|
| >PF13851 GAS: Growth-arrest specific micro-tubule binding | Back alignment and domain information |
|---|
| >PF11600 CAF-1_p150: Chromatin assembly factor 1 complex p150 subunit, N-terminal; InterPro: IPR021644 P150 is a polypeptide subunit of CAF-1, which functions in depositing newly synthesised and acetylated histones H3/H4 into chromatin during DNA replication and repair [] | Back alignment and domain information |
|---|
| >PF05911 DUF869: Plant protein of unknown function (DUF869); InterPro: IPR008587 This family consists of a number of sequences found in plants | Back alignment and domain information |
|---|
| >KOG4302 consensus Microtubule-associated protein essential for anaphase spindle elongation [Cell cycle control, cell division, chromosome partitioning; Cytoskeleton] | Back alignment and domain information |
|---|
| >PF10146 zf-C4H2: Zinc finger-containing protein ; InterPro: IPR018482 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule | Back alignment and domain information |
|---|
| >PF01576 Myosin_tail_1: Myosin tail; InterPro: IPR002928 Muscle contraction is caused by sliding between the thick and thin filaments of the myofibril | Back alignment and domain information |
|---|
| >PF06705 SF-assemblin: SF-assemblin/beta giardin | Back alignment and domain information |
|---|
| >KOG0810 consensus SNARE protein Syntaxin 1 and related proteins [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >COG1842 PspA Phage shock protein A (IM30), suppresses sigma54-dependent transcription [Transcription / Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PRK10698 phage shock protein PspA; Provisional | Back alignment and domain information |
|---|
| >PF09787 Golgin_A5: Golgin subfamily A member 5; InterPro: IPR019177 This entry represents a family of proteins involved in maintaining Golgi structure | Back alignment and domain information |
|---|
| >cd07653 F-BAR_CIP4-like The F-BAR (FES-CIP4 Homology and Bin/Amphiphysin/Rvs) domain of Cdc42-Interacting Protein 4 and similar proteins | Back alignment and domain information |
|---|
| >PF15233 SYCE1: Synaptonemal complex central element protein 1 | Back alignment and domain information |
|---|
| >cd07657 F-BAR_Fes_Fer The F-BAR (FES-CIP4 Homology and Bin/Amphiphysin/Rvs) domain of Fes (feline sarcoma) and Fer (Fes related) tyrosine kinases | Back alignment and domain information |
|---|
| >KOG2129 consensus Uncharacterized conserved protein H4 [Function unknown] | Back alignment and domain information |
|---|
| >PF04849 HAP1_N: HAP1 N-terminal conserved region; InterPro: IPR006933 This family is defined by an N-terminal conserved region found in several huntingtin-associated protein 1 (HAP1) homologues | Back alignment and domain information |
|---|
| >PF15066 CAGE1: Cancer-associated gene protein 1 family | Back alignment and domain information |
|---|
| >TIGR03545 conserved hypothetical protein TIGR03545 | Back alignment and domain information |
|---|
| >KOG0288 consensus WD40 repeat protein TipD [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0163 consensus Myosin class VI heavy chain [Cytoskeleton] | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
No homologous structure with e-value below 0.005
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 1113 | |||
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 3e-11 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 6e-10 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 8e-10 | |
| 1i84_S | 1184 | Smooth muscle myosin heavy chain; muscle protein, | 4e-08 | |
| 1i84_S | 1184 | Smooth muscle myosin heavy chain; muscle protein, | 1e-06 | |
| 3lvg_D | 190 | LCB, clathrin light chain B; SELF assembly, coated | 6e-06 | |
| 3lvg_D | 190 | LCB, clathrin light chain B; SELF assembly, coated | 4e-05 | |
| 2dfs_A | 1080 | Myosin-5A; myosin-V, inhibited state, cryoelectron | 3e-04 | |
| 2xs1_A | 704 | Programmed cell death 6-interacting protein; prote | 4e-04 |
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
Score = 66.8 bits (162), Expect = 3e-11
Identities = 53/401 (13%), Positives = 112/401 (27%), Gaps = 111/401 (27%)
Query: 788 EHDEVQLAFDQKDQIEEKMKFLRKE------ADSLRENVIKAEAATQAVKKLHREESEKL 841
E E Q + KD + D + +++ E +
Sbjct: 10 ETGEHQYQY--KDILSVFEDAFVDNFDCKDVQDMPK-SILSKEEIDHIIMSKDAVS--GT 64
Query: 842 KRLLGQFKAADEIRQEAYKHW-QSLKKQAYDKNQHFW---KYKDDTKQANDLASKGDREA 897
RL + E E + + + + + Y + K + +Q
Sbjct: 65 LRLFWTLLSKQE---EMVQKFVEEVLRINYK-----FLMSPIKTEQRQ---------PSM 107
Query: 898 LQHLCVNQVERVLELWNNNDEFRKEYVN-----SNIRSTLRRLK-----TLDG------- 940
+ + + Q +R L+N+N F K V+ +R L L+ +DG
Sbjct: 108 MTRMYIEQRDR---LYNDNQVFAKYNVSRLQPYLKLRQALLELRPAKNVLIDGVLGSGKT 164
Query: 941 -------R---------------SLGPDEEAPLIRPFLND---RVAKN-ISLTQISALER 974
+L + L ++ N S + S+ +
Sbjct: 165 WVALDVCLSYKVQCKMDFKIFWLNLKNCNSPETVLEMLQKLLYQIDPNWTSRSDHSSNIK 224
Query: 975 EKTEQVVPIKSEKVDDKPFPE-------VREQGDQIAKFKKPEK---PSRAENVSTTVSG 1024
+ + + KP+ V+ F K +R + V+ +S
Sbjct: 225 LRIHSIQAELRRLLKSKPYENCLLVLLNVQNAKA-WNAFNLSCKILLTTRFKQVTDFLSA 283
Query: 1025 RDDEIEEAKEEVPKLTKEE-EEM-ARKAEEKRK---EEAT-----------AKLREQRRL 1068
LT +E + + + + + + E +R+
Sbjct: 284 ATTTHISLDHHSMTLTPDEVKSLLLKYLDCRPQDLPREVLTTNPRRLSIIAESIRDGLAT 343
Query: 1069 EEKAKAQEALERKKRIAEKAQTRAALRAQKEAEQKEKVRRL 1109
+ K ++ I E ++L + AE ++ RL
Sbjct: 344 WDNWK-HVNCDKLTTIIE-----SSLNVLEPAEYRKMFDRL 378
|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 | Back alignment and structure |
|---|
| >1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 | Back alignment and structure |
|---|
| >3lvg_D LCB, clathrin light chain B; SELF assembly, coated PIT, cytoplasmic vesicle, membrane, Ca structural protein; 7.94A {Bos taurus} Length = 190 | Back alignment and structure |
|---|
| >3lvg_D LCB, clathrin light chain B; SELF assembly, coated PIT, cytoplasmic vesicle, membrane, Ca structural protein; 7.94A {Bos taurus} Length = 190 | Back alignment and structure |
|---|
| >2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080 | Back alignment and structure |
|---|
| >2xs1_A Programmed cell death 6-interacting protein; protein transport-viral protein complex, cell cycle; 2.30A {Homo sapiens} PDB: 2xs8_A 2oev_A 2r05_A 2r02_A 2r03_A 2oex_A 2ojq_A Length = 704 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 1113 | |||
| 1c1g_A | 284 | Tropomyosin; contractIle protein; 7.00A {Sus scrof | 98.67 | |
| 1c1g_A | 284 | Tropomyosin; contractIle protein; 7.00A {Sus scrof | 98.47 | |
| 3na7_A | 256 | HP0958; flagellar biogenesis, flagellum export, C4 | 98.07 | |
| 3na7_A | 256 | HP0958; flagellar biogenesis, flagellum export, C4 | 97.79 | |
| 1i84_S | 1184 | Smooth muscle myosin heavy chain; muscle protein, | 97.61 | |
| 1i84_S | 1184 | Smooth muscle myosin heavy chain; muscle protein, | 97.58 | |
| 2dfs_A | 1080 | Myosin-5A; myosin-V, inhibited state, cryoelectron | 96.12 | |
| 3vkg_A | 3245 | Dynein heavy chain, cytoplasmic; AAA+ protein, mol | 95.84 | |
| 2dfs_A | 1080 | Myosin-5A; myosin-V, inhibited state, cryoelectron | 95.82 | |
| 3oja_B | 597 | Anopheles plasmodium-responsive leucine-rich REPE | 94.86 | |
| 3o0z_A | 168 | RHO-associated protein kinase 1; coiled-coil, tran | 94.33 | |
| 3vkg_A | 3245 | Dynein heavy chain, cytoplasmic; AAA+ protein, mol | 94.25 | |
| 2jee_A | 81 | YIIU; FTSZ, septum, coiled-coil, cell division, ce | 92.81 | |
| 3oja_B | 597 | Anopheles plasmodium-responsive leucine-rich REPE | 92.63 | |
| 3ghg_A | 562 | Fibrinogen alpha chain; triple-stranded coiled coi | 92.46 | |
| 3u59_A | 101 | Tropomyosin beta chain; muscle contraction, actin, | 91.56 | |
| 3u1c_A | 101 | Tropomyosin alpha-1 chain; anti-parallel coiled co | 91.56 | |
| 2v71_A | 189 | Nuclear distribution protein NUDE-like 1; developm | 91.52 | |
| 3u59_A | 101 | Tropomyosin beta chain; muscle contraction, actin, | 91.32 | |
| 2efr_A | 155 | General control protein GCN4 and tropomyosin 1 Al; | 90.6 | |
| 2efr_A | 155 | General control protein GCN4 and tropomyosin 1 Al; | 90.17 | |
| 3q8t_A | 96 | Beclin-1; autophagy, ATG14L uvrag, apoptosis; 1.90 | 89.89 | |
| 3u1c_A | 101 | Tropomyosin alpha-1 chain; anti-parallel coiled co | 89.82 | |
| 1ic2_A | 81 | Tropomyosin alpha chain, skeletal muscle; alpha-he | 89.4 | |
| 3hnw_A | 138 | Uncharacterized protein; coiled-coil, structural g | 89.31 | |
| 2xs1_A | 704 | Programmed cell death 6-interacting protein; prote | 89.2 | |
| 2nrj_A | 346 | HBL B protein; enterotoxin, hemolysis, transmembra | 86.5 | |
| 1l8d_A | 112 | DNA double-strand break repair RAD50 ATPase; zinc | 86.09 | |
| 3ghg_A | 562 | Fibrinogen alpha chain; triple-stranded coiled coi | 85.92 | |
| 3bas_A | 89 | Myosin heavy chain, striated muscle/general contro | 85.22 | |
| 3o0z_A | 168 | RHO-associated protein kinase 1; coiled-coil, tran | 84.53 | |
| 3ol1_A | 119 | Vimentin; structural genomics, PSI-2, protein stru | 84.05 | |
| 3haj_A | 486 | Human pacsin2 F-BAR; pacsin,syndapin,FAP52,F-BAR, | 82.01 | |
| 1deq_A | 390 | Fibrinogen (alpha chain); coiled-coil, blood clott | 80.68 |
| >1c1g_A Tropomyosin; contractIle protein; 7.00A {Sus scrofa} SCOP: h.1.5.1 PDB: 2tma_A 2w49_A 2w4u_A | Back alignment and structure |
|---|
Probab=98.67 E-value=0.00023 Score=69.05 Aligned_cols=71 Identities=8% Similarity=0.233 Sum_probs=48.2
Q ss_pred HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHh
Q 001257 663 ENLREQIKAAQSKVDEKTRSRDAIRDDIQTIRASYKEYAEKLEAAISDERSARESLKSKRQEIDSVQSRIN 733 (1113)
Q Consensus 663 EeLKAKIdeLqKEIeELKQkRdAInaELkakRAERdELiEQLKeLReE~KqlReel~EKIKEIdsLQsaL~ 733 (1113)
+.|++++..+..++..+......+..++..++.....+...+..+..++..++..+.....++..++..+.
T Consensus 2 ~~~~~~~~~l~~~~~~~~~~~~~l~~~l~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ 72 (284)
T 1c1g_A 2 DAIKKKMQMLKLDKENALDRADEAEADKKAAEDRSKQLEDELVSLQKKLKATEDELDKYSEALKDAQEKLE 72 (284)
T ss_dssp HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_pred hHHHHHHHHHHHhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence 46788888888888888777777777777777777777666666666666666555555555555444443
|
| >1c1g_A Tropomyosin; contractIle protein; 7.00A {Sus scrofa} SCOP: h.1.5.1 PDB: 2tma_A 2w49_A 2w4u_A | Back alignment and structure |
|---|
| >3na7_A HP0958; flagellar biogenesis, flagellum export, C4 Zn-ribbon, coiled post-transcriptional, gene regulation, chaperone; HET: EPE; 2.20A {Helicobacter pylori} | Back alignment and structure |
|---|
| >3na7_A HP0958; flagellar biogenesis, flagellum export, C4 Zn-ribbon, coiled post-transcriptional, gene regulation, chaperone; HET: EPE; 2.20A {Helicobacter pylori} | Back alignment and structure |
|---|
| >1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A | Back alignment and structure |
|---|
| >1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A | Back alignment and structure |
|---|
| >2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} | Back alignment and structure |
|---|
| >3vkg_A Dynein heavy chain, cytoplasmic; AAA+ protein, molecular motor, microtubles, motor protein; HET: ADP SPM; 2.81A {Dictyostelium discoideum} PDB: 3vkh_A* | Back alignment and structure |
|---|
| >2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} | Back alignment and structure |
|---|
| >3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} | Back alignment and structure |
|---|
| >3o0z_A RHO-associated protein kinase 1; coiled-coil, transferase; HET: MSE; 2.33A {Homo sapiens} | Back alignment and structure |
|---|
| >3vkg_A Dynein heavy chain, cytoplasmic; AAA+ protein, molecular motor, microtubles, motor protein; HET: ADP SPM; 2.81A {Dictyostelium discoideum} PDB: 3vkh_A* | Back alignment and structure |
|---|
| >2jee_A YIIU; FTSZ, septum, coiled-coil, cell division, cell cycle, hypothetical protein; 2.8A {Escherichia coli} | Back alignment and structure |
|---|
| >3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} | Back alignment and structure |
|---|
| >3ghg_A Fibrinogen alpha chain; triple-stranded coiled coil, beta sheets, alpha helices, AMY amyloidosis, blood coagulation, disease mutation, glycoprot phosphoprotein; HET: NAG NDG BMA MAN GAL SIA; 2.90A {Homo sapiens} PDB: 3h32_A* 2a45_G* | Back alignment and structure |
|---|
| >3u59_A Tropomyosin beta chain; muscle contraction, actin, contractIle protein; 2.50A {Gallus gallus} | Back alignment and structure |
|---|
| >3u1c_A Tropomyosin alpha-1 chain; anti-parallel coiled coil, contractIle protein; 1.80A {Gallus gallus} PDB: 3u1a_A | Back alignment and structure |
|---|
| >2v71_A Nuclear distribution protein NUDE-like 1; developmental protein, nuclear protein, neurogenesis, cytosk LIS1 binding, differentiation; 2.24A {Rattus norvegicus} | Back alignment and structure |
|---|
| >3u59_A Tropomyosin beta chain; muscle contraction, actin, contractIle protein; 2.50A {Gallus gallus} | Back alignment and structure |
|---|
| >2efr_A General control protein GCN4 and tropomyosin 1 Al; destabilizing cluster, hydrophobic core, contractIle protein; 1.80A {Saccharomyces cerevisiae} PDB: 2efs_A 2d3e_A | Back alignment and structure |
|---|
| >2efr_A General control protein GCN4 and tropomyosin 1 Al; destabilizing cluster, hydrophobic core, contractIle protein; 1.80A {Saccharomyces cerevisiae} PDB: 2efs_A 2d3e_A | Back alignment and structure |
|---|
| >3q8t_A Beclin-1; autophagy, ATG14L uvrag, apoptosis; 1.90A {Rattus norvegicus} | Back alignment and structure |
|---|
| >3u1c_A Tropomyosin alpha-1 chain; anti-parallel coiled coil, contractIle protein; 1.80A {Gallus gallus} PDB: 3u1a_A | Back alignment and structure |
|---|
| >1ic2_A Tropomyosin alpha chain, skeletal muscle; alpha-helical coiled coil, alanine, symmetry, axial stagger, BEND, contractIle protein; 2.00A {Gallus gallus} SCOP: h.1.5.1 | Back alignment and structure |
|---|
| >3hnw_A Uncharacterized protein; coiled-coil, structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG; 2.20A {Eubacterium eligens} | Back alignment and structure |
|---|
| >2xs1_A Programmed cell death 6-interacting protein; protein transport-viral protein complex, cell cycle; 2.30A {Homo sapiens} PDB: 2xs8_A 2oev_A 2r05_A 2r02_A 2r03_A 2oex_A 2ojq_A | Back alignment and structure |
|---|
| >2nrj_A HBL B protein; enterotoxin, hemolysis, transmembrane, structural genomics, PSI-2, protein structure initiative; 2.03A {Bacillus cereus} SCOP: h.4.4.2 | Back alignment and structure |
|---|
| >1l8d_A DNA double-strand break repair RAD50 ATPase; zinc finger, DNA repair, recombination, HOOK motif, replication; HET: DNA CIT; 2.20A {Pyrococcus furiosus} SCOP: h.4.12.1 | Back alignment and structure |
|---|
| >3ghg_A Fibrinogen alpha chain; triple-stranded coiled coil, beta sheets, alpha helices, AMY amyloidosis, blood coagulation, disease mutation, glycoprot phosphoprotein; HET: NAG NDG BMA MAN GAL SIA; 2.90A {Homo sapiens} PDB: 3h32_A* 2a45_G* | Back alignment and structure |
|---|
| >3bas_A Myosin heavy chain, striated muscle/general control protein GCN4 chimera; alpha-helical coiled coil, disorder, salt links; 2.30A {Argopecten irradians} SCOP: h.1.26.1 PDB: 1nkn_A 3bat_A | Back alignment and structure |
|---|
| >3o0z_A RHO-associated protein kinase 1; coiled-coil, transferase; HET: MSE; 2.33A {Homo sapiens} | Back alignment and structure |
|---|
| >3haj_A Human pacsin2 F-BAR; pacsin,syndapin,FAP52,F-BAR, alternative splicing, coiled coil, cytoplasmic vesicle, endocytosis, phosphoprotein, polymorphism; 2.78A {Homo sapiens} | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 1113 | ||||
| d1vp4a_ | 420 | c.67.1.1 (A:) Putative aminotransferase TM1131 {Th | 0.001 |
| >d1vp4a_ c.67.1.1 (A:) Putative aminotransferase TM1131 {Thermotoga maritima [TaxId: 2336]} Length = 420 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: PLP-dependent transferase-like superfamily: PLP-dependent transferases family: AAT-like domain: Putative aminotransferase TM1131 species: Thermotoga maritima [TaxId: 2336]
Score = 40.1 bits (92), Expect = 0.001
Identities = 26/134 (19%), Positives = 50/134 (37%), Gaps = 11/134 (8%)
Query: 750 NMEHRIAHETLPLKEEKQIIREIKQLKQRREQISSSIGEHDEVQLAFDQKDQIEEKMKFL 809
N+E +I+ +K IIREI + ++ IS G D F +K+ E + +
Sbjct: 11 NLEGKISKIGQNMKSS--IIREILKFAADKDAISFGGGVPDPE--TFPRKELAEIAKEII 66
Query: 810 RKEADSLRENVIKAEAATQAVKKLHREESEKLKRLLG-QFKAADEIRQEAYKHWQS-LKK 867
KE + T+ L ++ + L+R+ G D + L
Sbjct: 67 EKEYHYTL-----QYSTTEGDPVLKQQILKLLERMYGITGLDEDNLIFTVGSQQALDLIG 121
Query: 868 QAYDKNQHFWKYKD 881
+ + ++ + D
Sbjct: 122 KLFLDDESYCVLDD 135
|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 1113 | |||
| d2efla1 | 288 | Formin-binding protein 1, FNBP1 {Human (Homo sapie | 89.58 | |
| d1seta1 | 110 | Seryl-tRNA synthetase (SerRS) {Thermus thermophilu | 86.32 | |
| d1gqea_ | 362 | Polypeptide chain release factor 2 (RF2) {Escheric | 82.16 |
| >d2efla1 a.238.1.4 (A:1-288) Formin-binding protein 1, FNBP1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
class: All alpha proteins fold: BAR/IMD domain-like superfamily: BAR/IMD domain-like family: FCH domain domain: Formin-binding protein 1, FNBP1 species: Human (Homo sapiens) [TaxId: 9606]
Probab=89.58 E-value=8.5 Score=36.13 Aligned_cols=18 Identities=11% Similarity=0.110 Sum_probs=6.7
Q ss_pred HHHHHHHHHHhHHHHHHH
Q 001257 869 AYDKNQHFWKYKDDTKQA 886 (1113)
Q Consensus 869 RDEkNkeFYqnRR~irKA 886 (1113)
.......|...-..++++
T Consensus 183 ~~~a~~~Y~~~v~~~n~~ 200 (288)
T d2efla1 183 AEDSKADYSSILQKFNHE 200 (288)
T ss_dssp HHHHHHHHHHHHHHHHHH
T ss_pred HHHHHHHHHHHHHHHHHH
Confidence 333333333333333333
|
| >d1seta1 a.2.7.1 (A:1-110) Seryl-tRNA synthetase (SerRS) {Thermus thermophilus, strain hb27 [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1gqea_ e.38.1.1 (A:) Polypeptide chain release factor 2 (RF2) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|