Citrus Sinensis ID: 001313


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820-------830-------840-------850-------860-------870-------880-------890-------900-------910-------920-------930-------940-------950-------960-------970-------980-------990------1000------1010------1020------1030------1040------1050------1060------1070------1080------1090------1100--
MGGSKSKMVVMFVLLLIIFEGGWSEGCLNHERFALLQLKLFFIDPYNYLLDWVDDEGATDCCQWERVSCNNTMGRVVVLDLSQTHRGEYWYLNASLFTPFQQLESLDLRDNDIAGCVENEGLERLSRLSNLKMLNLVGNLFNNSILSSLARLSSLTSLDLSANRLKGSIDIKELDSLRDLEKLNIGRNMIDKFVVSKGPKRLSRLNNLKVFDLSGNLFNNSILSSLARLSSLRSLLLYDNRLEGSIDVKEFDSLSNLEELDMSYNEIDNFEVPQACSGLRKLSYLHLLRVGIRDGSKLLQSMGSFPSLNTLDLSYNNFTETVTTTTQGFPHFKSLKELYMDDARIALNTSFLQIIGESMPSIQYLSLSNSSVSNNSRTLDQGLCPLVHLQELHMADNDLRGSLPWCLANMTSLRILDVSSNQLIGSISSSPLIHLTSIEDLILSDNHFQIPISLEPLFNHSRLKIFDAENNEINAEIIESHSLTTPNFQLQSLLLSSGYRDGITFPKFLYNQHDLEYVRLSHIKMNEEFPNWLLENNTKLRQLSLVNDSLVGPFRLPIHSHKQLRLLDVSKNNFQGHIPLEIGDILSRLTVFNISMNALDGSIPSSFGNMNFLQFLDLSNNQLTGEIPEHLAMGCVSLRSLALSNNNLEGHMFSRNFNLTNLIWLQLEGNHFVGEIPQSLSKCSSLQGLFLSNNSLSGKIPRWLGNLTVLRHIIMPKNHIEGPIPLEFCQLRILQILDISDNNISGSLPSCYDFVCIEQVHLSKNMLHGQLKEGTFFNCLTLMILDLSYNHLNGNIPDRVDGLSQLSYLILAHNNLEGEVPIQLCRLNQLQLLDLSNNNLHGHIPSCFDNTTLHERYNNGSSLQPFETSFVIMGGMDVDPKKQILESFDFTTKSITYTYQGRVPSLLSGLDLSCNRLIGHIPPQIGNLTKIQTLNLSHNNLAGPIPSTFSNLRNIESLDLSYNKLSWKIPYQLVELNTLAVFSVAYNNLSGKIPERAAQFATFNESSYEGNPFLCGPPLPICISPTTMPEASPSNEGDNNLIDMDIFFITFTTSYVIVIFGIVAVLYVNARWRRRWFYLVEMWTTSCYYFVIDNLIPTRFCH
ccccHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHccccccccccccccccccccccccccEEEccccccEEEEEccccccccccccccccccccccccEEEcccccccccccccccccccccccccEEEcccccccccccHHHcccccccEEEcccccccccccHHHHcccccccEEEcccccccccccccccccccccccccEEEcccccccccccccccccccccEEEcccccccccccHHHHcccccccEEEccccccccccccccccccccccEEEcccccccccccccccccccccccEEEccccccccccccccccccccccccEEEccccccccccccHHHHHHccccccEEEccccccccccccccccccccccccEEEcccccccccccccccccccccEEEccccccccccccccccccccccEEEccccccEEEccHHcccccccccEEEcccccccEEcccccccccccccccEEEccccccccccccHHccccccccEEEcccccccccccHHHHHccccccEEEccccccEEEccccccccccccEEEccccEEEEEcccccccccccccEEEcccccccccccccccccccccEEEcccccccccccHHHHHccccccEEEccccEEcccccccccccccccEEEcccccccccccccccccccccEEEcccccccccccccccccccccEEEcccccccccccccccccccccEEEccccccEEEcccccccccccEEEccccccEEcccHHHHHccccccEEEcccccccccccHHHHccccccEEEccccEEEEcccccccccccccEEEcccccccccccHHHHHHccccccccccccccccccEEEcccccccccccEEEEEEEEEcccEEEEccccccccEEEEcccccccccccHHHHccccccccccccccccccccccccccccccEEccccccccccccHHHHcccccccccccccccEEcccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEEHHHHHHHHHHHHEEEEEEEcccHHHHHHHHHHHHccEEEEEEEEEEEcccccc
ccHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHccccccccccccccccccccccEEEEEEcccccEEEEEEccccccccccccccHHHcccHcccEEEcccccccccccccccHHHcccccccEEEcccccccccccHHHccccccEEEEcccccccccccHHHHHccccccEEEcccccccccccccccHHHccccccEEEEcccccccccccHHHcccccccEEEcccccccccccHHHHHccccccEEEccccccccccccHHHHccccccEEEEccccccccccccHHHccccccEEEEEccccccccccHHHcccccccEEEEEEcccccccccccccccccHHHccccccEEEEcccccccccccHHHcccccccEEEcccccccccccHHHcccccccEEEcccccccccccHHHHHccccccEEEEccccccccccHHHHccccccEEEEEccccccccccHHHccccccccEEEEEccccccccccccHHHHccccccEEEcccccccccccHHHHHHcccccEEEEccccccccccHHHcccccccEEEEccccccccccHHHHHHHHcccEEEcccccccccccHHHcccccccEEEcccccccccccHHHHHHcccccEEEcccccEEccccHHHHHcccccEEEEEEEccEEEccHHHHHcccccEEEccccEEEccccHHHHHcccccEEEccccccEEEccHHHHcccccEEEEccccccccccccHccccccEEEEEccccccccccHHHHccccccEEEEcccccEEccccHHHHHcccccEEEEEEEccEEEccHHHHHcccccEEEccccEEEccccHHHcccHHHHHHccccccccccccHHHccccccccccccEEEEEcccccccccccHHHHHHccEEEcccccEEccccHHHHHcccccEEEEEEEccEEEccHHHHHcccccEEEccccEEEccccHHHHHcccccEEEccccccEEEccHHHHccccccHHHccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHccccccc
MGGSKSKMVVMFVLLLIIFeggwsegclnHERFALLQLKLFfidpynylldwvddegatdccqwervscnntmGRVVVLDlsqthrgeywylnaslftpfqqlesldlrdndiagcveneglerlsrlSNLKMLNLVGNLFNNSILSSLARLssltsldlsanrlkgsidikeldslrdleklnigrnmidkfvvskgpkrlsrlnnlkvfdlsgnlfnnSILSSLARLSSLRSLLLydnrlegsidvkefdslsnleeldmsyneidnfevpqacsglrklSYLHLLRVGIRDGSKLlqsmgsfpslntldlsynnftetvttttqgfphfksLKELYMDDARIALNTSFLQIIGesmpsiqylslsnssvsnnsrtldqglcplvhlqelhmadndlrgslpwclanmtslrildvssnqligsisssplihltsiedlilsdnhfqipisleplfnhsrlkifdaENNEINAEIIeshslttpnFQLQSLLLssgyrdgitfpkflynqhdleyVRLSHIKmneefpnwllenntklrQLSLvndslvgpfrlpihshkqlrlldvsknnfqghipleIGDILSRLTVFNIsmnaldgsipssfgnmnflqfldlsnnqltgeipehLAMGCVSLRSLALsnnnleghmfsrnfnLTNLIWLQLEgnhfvgeipqslskcsslqglflsnnslsgkiprwlgNLTVLRHIimpknhiegpiplefCQLRILQIldisdnnisgslpscydfvciEQVHLSKnmlhgqlkegtffnCLTLMILDLSynhlngnipdrvdgLSQLSYLILAHNnlegevpiQLCRLNQLQLldlsnnnlhghipscfdnttlherynngsslqpfetSFVImggmdvdpkkqiLESFDFTTKSItytyqgrvpsllsgldlscnrlighippqignltkIQTLnlshnnlagpipstfsnlrniesldlsynklswkipyqlVELNTLAVFSVAYNnlsgkipeRAAQFAtfnessyegnpflcgpplpicispttmpeaspsnegdnnlidmdIFFITFTTSYVIVIFGIVAVLYVNARWRRRWFYLVEMWTTSCYYFVidnliptrfch
MGGSKSKMVVMFVLLLIIFEGGWSEGCLNHERFALLQLKLFFIDPYNYLLDWVDDEGATDCCQWErvscnntmgRVVVLDLSQTHRGEYWYLNASLFTPFQQLESLDLRDNDIAGCVENEGLERLSRLSNLKMLNLVGNLFNNSILSSLARLSSLTSLdlsanrlkgsidikeldslrdleklnigrnmidkfvvskgpkrlsrLNNLKVFDLSGNLFNNSILSSLARLSSLRSLLLYDNRlegsidvkefdslSNLEELDMSYNEIDNFEVPQACSGLRKLSYLHLLRVGIRDGSKLLQSMGSFPSLNTLDLSYNNFTETVTtttqgfphFKSLKELYMDDARIALNTSFLQIIGESMPSIQYLSLSNSSVSNNSRTLDQGLCPLVHLQELHMADNDLRGSLPWCLANMTSLRILDVSSNQLIGSISSSPLIHLTSIEDLILSDNHFQIPISLEPLFNHSRLKIFDAENNEINAEIIESHSLTTPNFQLQSLLLSSGYRDGITFPKFLYNQHDLEYVRLSHIKMNEEFPNWLLENNTKLRQLSLVNDSLVGPFRLPIHSHKQLRLLDVSKNNFQGHIPLEIGDILSRLTVFNISMNALDGSIPSSFGNMNFLQFLDLSNNQLTGEIPEHLAMGCVSLRSLALSNNNLEGHMFSRNFNLTNLIWLQLEGNHFVGEIPQSLSKCSSLQGLFLSnnslsgkipRWLGNLTVLRHIIMPKNHIEGPIPLEFCQLRILQILDISDNNISGSLPSCYDFVCIEQVHLSKNMLHGQLKEGTFFNCLTLMILDLSYNHLNGNIPDRVDGLSQLSYLILAHNNLEGEVPIQLCRLNQLQLLDLSNNNLHGHIPSCFDNTTLHERYNNGSSLQPFETSFVIMGGMDVDPKKQILESFDFTTKSITYTYQGRVPSLLSGLDLSCNRLIGHIPPQIGNLTKIQTLNLSHNNLAGPIPSTFSNLRNIESLDLSYNKLSWKIPYQLVELNTLAVFSVAYNNLSGKIPERAAQFATFNESSYEGNPFLCGPPLPICISPTTMPEASPSNEGDNNLIDMDIFFITFTTSYVIVIFGIVAVLYVNARWRRRWFYLVEMWTTSCYYFVIDNLIPTRFCH
MGGSKSKMVVMFVLLLIIFEGGWSEGCLNHERFALLQLKLFFIDPYNYLLDWVDDEGATDCCQWERVSCNNTMGRVVVLDLSQTHRGEYWYLNASLFTPFQQLESLDLRDNDIAGCVENEGLERLSRLSNLKMLNLVGNLFNNsilsslarlssltsldlsANRLKGSIDIKELDSLRDLEKLNIGRNMIDKFVVSKGPKRLSRLNNLKVFDLSGNLFNNsilsslarlsslrslllYDNRLEGSIDVKEFDSLSNLEELDMSYNEIDNFEVPQACSGLRKLSYLHLLRVGIRDGSKLLQSMGSFPSLNTLDLSYNNFtetvttttQGFPHFKSLKELYMDDARIALNTSFLQIIGESMPSIQYlslsnssvsnnsRTLDQGLCPLVHLQELHMADNDLRGSLPWCLANMTSLRILDVssnqligsisssPLIHLTSIEDLILSDNHFQIPISLEPLFNHSRLKIFDaenneinaeiieSHSLTTPNFQLQSLLLSSGYRDGITFPKFLYNQHDLEYVRLSHIKMNEEFPNWLLENNTKLRQLSLVNDSLVGPFRLPIHSHKQLRLLDVSKNNFQGHIPLEIGDILSRLTVFNISMNALDGSIPSSFGNMNFLQFLDLSNNQLTGEIPEHLAMGCVslrslalsnnnlEGHMFSRNFNLTNLIWLQLEGNHFVGEIPQSLSKCSSLQGLFLSNNSLSGKIPRWLGNLTVLRHIIMPKNHIEGPIPLEFCQLRILQILDISDNNISGSLPSCYDFVCIEQVHLSKNMLHGQLKEGTFFNCLTLMILDLSYNHLNGNIPDRVDGLSQLSYLILAHNNLEGEVPIqlcrlnqlqlldlsnnnlHGHIPSCFDNTTLHERYNNGSSLQPFETSFVIMGGMDVDPKKQILESFDFTTKSITYTYQGRVPSLLSGLDLSCNRLIGHIPPQIGNLTKIQTLNLSHNNLAGPIPSTFSNLRNIESLDLSYNKLSWKIPYQLVELNTLAVFSVAYNNLSGKIPERAAQFATFNESSYEGNPFLCGPPLPICISPTTMPEASPSNEGDNNLIDMDIFFITFTTSYVIVIFGIVAVLYVNARWRRRWFYLVEMWTTSCYYFVIDNLIPTRFCH
*******MVVMFVLLLIIFEGGWSEGCLNHERFALLQLKLFFIDPYNYLLDWVDDEGATDCCQWERVSCNNTMGRVVVLDLSQTHRGEYWYLNASLFTPFQQLESLDLRDNDIAGCVENEGLERLSRLSNLKMLNLVGNLFNNSILSSLARLSSLTSLDLSANRLKGSIDIKELDSLRDLEKLNIGRNMIDKFVVSKGPKRLSRLNNLKVFDLSGNLFNNSILSSLARLSSLRSLLLYDNRLEGSIDVKEFDSLSNLEELDMSYNEIDNFEVPQACSGLRKLSYLHLLRVGIRDGSKLLQSMGSFPSLNTLDLSYNNFTETVTTTTQGFPHFKSLKELYMDDARIALNTSFLQIIGESMPSIQYLSL**********TLDQGLCPLVHLQELHMADNDLRGSLPWCLANMTSLRILDVSSNQLIGSISSSPLIHLTSIEDLILSDNHFQIPISLEPLFNHSRLKIFDAENNEINAEIIESHSLTTPNFQLQSLLLSSGYRDGITFPKFLYNQHDLEYVRLSHIKMNEEFPNWLLENNTKLRQLSLVNDSLVGPFRLPIHSHKQLRLLDVSKNNFQGHIPLEIGDILSRLTVFNISMNALDGSIPSSFGNMNFLQFLDLSNNQLTGEIPEHLAMGCVSLRSLALSNNNLEGHMFSRNFNLTNLIWLQLEGNHFVGEIPQSLSKCSSLQGLFLSNNSLSGKIPRWLGNLTVLRHIIMPKNHIEGPIPLEFCQLRILQILDISDNNISGSLPSCYDFVCIEQVHLSKNMLHGQLKEGTFFNCLTLMILDLSYNHLNGNIPDRVDGLSQLSYLILAHNNLEGEVPIQLCRLNQLQLLDLSNNNLHGHIPSCFDNTTLHERYNNGSSLQPFETSFVIMGGMDVDPKKQILESFDFTTKSITYTYQGRVPSLLSGLDLSCNRLIGHIPPQIGNLTKIQTLNLSHNNLAGPIPSTFSNLRNIESLDLSYNKLSWKIPYQLVELNTLAVFSVAYNNLSGKIPERAAQFATFNESSYEGNPFLCGPPLPICIS***************NLIDMDIFFITFTTSYVIVIFGIVAVLYVNARWRRRWFYLVEMWTTSCYYFVIDNLIPTRFC*
****KSK*VVMFVLLLIIFEGGWSEGCLNHERFALLQLKLFFIDPYNYLLDWVDDEGATDCCQWERVSCNNTMGRVVVLDLSQTHRGEYWYLNASLFTPFQQLESLDLRDNDIAGCVENEGLERLSRLSNLKMLNLVGNLFNNSILSSLARLSSLTSLDLSANRLKGSIDIKELDSLRDLEKLNIGRNMIDKFVVSKGPKRLSRLNNLKVFDLSGNLFNNSILSSLARLSSLRSLLLYDNRLEGSIDVKEFDSLSNLEELDMSYNEIDNFEVPQACSGLRKLSYLHLLRVGIRDGSKLLQSMGSFPSLNTLDLSYNNFTETVTTTTQGFPHFKSLKELYMDDARIALNTSFLQIIGESMPSIQYLSLSNSSVSNNSRTLDQGLCPLVHLQELHMADNDLRGSLPWCLANMTSLRILDVSSNQLIGSISSSPLIHLTSIEDLILSDNHFQIPISLEPLFNHSRLKIFDAENNEINAEIIESHSLTTPNFQLQSLLLSSGYRDGITFPKFLYNQHDLEYVRLSHIKMNEEFPNWLLENNTKLRQLSLVNDSLVGPFRLPIHSHKQLRLLDVSKNNFQGHIPLEIGDILSRLTVFNISMNALDGSIPSSFGNMNFLQFLDLSNNQLTGEIPEHLAMGCVSLRSLALSNNNLEGHMFSRNFNLTNLIWLQLEGNHFVGEIPQSLSKCSSLQGLFLSNNSLSGKIPRWLGNLTVLRHIIMPKNHIEGPIPLEFCQLRILQILDISDNNISGSLPSCYDFVCIEQVHLSKNMLHGQLKEGTFFNCLTLMILDLSYNHLNGNIPDRVDGLSQLSYLILAHNNLEGEVPIQLCRLNQLQLLDLSNNNLHGHIPSCFDNTTLHER********PFETSFVIMGGMDVDPKKQILESFDFTTKSITYTYQGRVPSLLSGLDLSCNRLIGHIPPQIGNLTKIQTLNLSHNNLAGPIPSTFSNLRNIESLDLSYNKLSWKIPYQLVELNTLAVFSVAYNNLSGKIPERAAQFATFNESSYEGNPFLCG****************************DIFFITFTTSYVIVIFGIVAVLYVNARWRRRWFYLVEMWTTSCYYFVIDNLIPTRFCH
MGGSKSKMVVMFVLLLIIFEGGWSEGCLNHERFALLQLKLFFIDPYNYLLDWVDDEGATDCCQWERVSCNNTMGRVVVLDLSQTHRGEYWYLNASLFTPFQQLESLDLRDNDIAGCVENEGLERLSRLSNLKMLNLVGNLFNNSILSSLARLSSLTSLDLSANRLKGSIDIKELDSLRDLEKLNIGRNMIDKFVVSKGPKRLSRLNNLKVFDLSGNLFNNSILSSLARLSSLRSLLLYDNRLEGSIDVKEFDSLSNLEELDMSYNEIDNFEVPQACSGLRKLSYLHLLRVGIRDGSKLLQSMGSFPSLNTLDLSYNNFTETVTTTTQGFPHFKSLKELYMDDARIALNTSFLQIIGESMPSIQYLSLSNSSVSNNSRTLDQGLCPLVHLQELHMADNDLRGSLPWCLANMTSLRILDVSSNQLIGSISSSPLIHLTSIEDLILSDNHFQIPISLEPLFNHSRLKIFDAENNEINAEIIESHSLTTPNFQLQSLLLSSGYRDGITFPKFLYNQHDLEYVRLSHIKMNEEFPNWLLENNTKLRQLSLVNDSLVGPFRLPIHSHKQLRLLDVSKNNFQGHIPLEIGDILSRLTVFNISMNALDGSIPSSFGNMNFLQFLDLSNNQLTGEIPEHLAMGCVSLRSLALSNNNLEGHMFSRNFNLTNLIWLQLEGNHFVGEIPQSLSKCSSLQGLFLSNNSLSGKIPRWLGNLTVLRHIIMPKNHIEGPIPLEFCQLRILQILDISDNNISGSLPSCYDFVCIEQVHLSKNMLHGQLKEGTFFNCLTLMILDLSYNHLNGNIPDRVDGLSQLSYLILAHNNLEGEVPIQLCRLNQLQLLDLSNNNLHGHIPSCFDNTTLHERYNNGSSLQPFETSFVIMGGMDVDPKKQILESFDFTTKSITYTYQGRVPSLLSGLDLSCNRLIGHIPPQIGNLTKIQTLNLSHNNLAGPIPSTFSNLRNIESLDLSYNKLSWKIPYQLVELNTLAVFSVAYNNLSGKIPERAAQFATFNESSYEGNPFLCGPPLPICISPTTMPEASPSNEGDNNLIDMDIFFITFTTSYVIVIFGIVAVLYVNARWRRRWFYLVEMWTTSCYYFVIDNLIPTRFCH
**GSKSKMVVMFVLLLIIFEGGWSEGCLNHERFALLQLKLFFIDPYNYLLDWVDDEGATDCCQWERVSCNNTMGRVVVLDLSQTHRGEYWYLNASLFTPFQQLESLDLRDNDIAGCVENEGLERLSRLSNLKMLNLVGNLFNNSILSSLARLSSLTSLDLSANRLKGSIDIKELDSLRDLEKLNIGRNMIDKFVVSKGPKRLSRLNNLKVFDLSGNLFNNSILSSLARLSSLRSLLLYDNRLEGSIDVKEFDSLSNLEELDMSYNEIDNFEVPQACSGLRKLSYLHLLRVGIRDGSKLLQSMGSFPSLNTLDLSYNNFTETVTTTTQGFPHFKSLKELYMDDARIALNTSFLQIIGESMPSIQYLSLSNSSVSNNSRTLDQGLCPLVHLQELHMADNDLRGSLPWCLANMTSLRILDVSSNQLIGSISSSPLIHLTSIEDLILSDNHFQIPISLEPLFNHSRLKIFDAENNEINAEIIESHSLTTPNFQLQSLLLSSGYRDGITFPKFLYNQHDLEYVRLSHIKMNEEFPNWLLENNTKLRQLSLVNDSLVGPFRLPIHSHKQLRLLDVSKNNFQGHIPLEIGDILSRLTVFNISMNALDGSIPSSFGNMNFLQFLDLSNNQLTGEIPEHLAMGCVSLRSLALSNNNLEGHMFSRNFNLTNLIWLQLEGNHFVGEIPQSLSKCSSLQGLFLSNNSLSGKIPRWLGNLTVLRHIIMPKNHIEGPIPLEFCQLRILQILDISDNNISGSLPSCYDFVCIEQVHLSKNMLHGQLKEGTFFNCLTLMILDLSYNHLNGNIPDRVDGLSQLSYLILAHNNLEGEVPIQLCRLNQLQLLDLSNNNLHGHIPSCFDNTTLHERYNNGSSLQPFETSFVIMGGMDVDPKKQILESFDFTTKSITYTYQGRVPSLLSGLDLSCNRLIGHIPPQIGNLTKIQTLNLSHNNLAGPIPSTFSNLRNIESLDLSYNKLSWKIPYQLVELNTLAVFSVAYNNLSGKIPERAAQFATFNESSYEGNPFLCGPPLPICIS***************NLIDMDIFFITFTTSYVIVIFGIVAVLYVNARWRRRWFYLVEMWTTSCYYFVIDNLIPTRFC*
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiHHHHHHHHHHHHHHHHHHHHoooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooHHHHHHHHHHHHHHHHiiii
SSSSSSSSSSSSSSSSSSSSSSSSoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGGSKSKMVVMFVLLLIIFEGGWSEGCLNHERFALLQLKLFFIDPYNYLLDWVDDEGATDCCQWERVSCNNTMGRVVVLDLSQTHRGEYWYLNASLFTPFQQLESLDLRDNDIAGCVENEGLERLSRLSNLKMLNLVGNLFNNSILSSLARLSSLTSLDLSANRLKGSIDIKELDSLRDLEKLNIGRNMIDKFVVSKGPKRLSRLNNLKVFDLSGNLFNNSILSSLARLSSLRSLLLYDNRLEGSIDVKEFDSLSNLEELDMSYNEIDNFEVPQACSGLRKLSYLHLLRVGIRDGSKLLQSMGSFPSLNTLDLSYNNFTETVTTTTQGFPHFKSLKELYMDDARIALNTSFLQIIGESMPSIQYLSLSNSSVSNNSRTLDQGLCPLVHLQELHMADNDLRGSLPWCLANMTSLRILDVSSNQLIGSISSSPLIHLTSIEDLILSDNHFQIPISLEPLFNHSRLKIFDAENNEINAEIIESHSLTTPNFQLQSLLLSSGYRDGITFPKFLYNQHDLEYVRLSHIKMNEEFPNWLLENNTKLRQLSLVNDSLVGPFRLPIHSHKQLRLLDVSKNNFQGHIPLEIGDILSRLTVFNISMNALDGSIPSSFGNMNFLQFLDLSNNQLTGEIPEHLAMGCVSLRSLALSNNNLEGHMFSRNFNLTNLIWLQLEGNHFVGEIPQSLSKCSSLQGLFLSNNSLSGKIPRWLGNLTVLRHIIMPKNHIEGPIPLEFCQLRILQILDISDNNISGSLPSCYDFVCIEQVHLSKNMLHGQLKEGTFFNCLTLMILDLSYNHLNGNIPDRVDGLSQLSYLILAHNNLEGEVPIQLCRLNQLQLLDLSNNNLHGHIPSCFDNTTLHERYNNGSSLQPFETSFVIMGGMDVDPKKQILESFDFTTKSITYTYQGRVPSLLSGLDLSCNRLIGHIPPQIGNLTKIQTLNLSHNNLAGPIPSTFSNLRNIESLDLSYNKLSWKIPYQLVELNTLAVFSVAYNNLSGKIPERAAQFATFNESSYEGNPFLCGPPLPICISPTTMPEASPSNEGDNNLIDMDIFFITFTTSYVIVIFGIVAVLYVNARWRRRWFYLVEMWTTSCYYFVIDNLIPTRFCH
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query1102 2.2.26 [Sep-21-2011]
Q9FL28 1173 LRR receptor-like serine/ no no 0.629 0.591 0.297 7e-68
C0LGQ5 1249 LRR receptor-like serine/ no no 0.731 0.645 0.277 6e-66
Q9FIZ3 1252 LRR receptor-like serine/ no no 0.640 0.563 0.291 4e-63
Q9ZWC8 1166 Serine/threonine-protein no no 0.600 0.567 0.293 6e-59
Q9LJF3 1164 Receptor-like protein kin no no 0.591 0.560 0.310 2e-58
Q9LYN8 1192 Leucine-rich repeat recep no no 0.653 0.604 0.301 7e-58
Q8GUQ5 1207 Brassinosteroid LRR recep N/A no 0.568 0.519 0.296 1e-55
Q8L899 1207 Systemin receptor SR160 O N/A no 0.568 0.519 0.295 3e-55
C0LGS2 1136 Probable LRR receptor-lik no no 0.576 0.558 0.283 7e-55
Q9ZPS9 1143 Serine/threonine-protein no no 0.516 0.497 0.303 7e-55
>sp|Q9FL28|FLS2_ARATH LRR receptor-like serine/threonine-protein kinase FLS2 OS=Arabidopsis thaliana GN=FLS2 PE=1 SV=1 Back     alignment and function desciption
 Score =  259 bits (663), Expect = 7e-68,   Method: Compositional matrix adjust.
 Identities = 229/769 (29%), Positives = 357/769 (46%), Gaps = 75/769 (9%)

Query: 278  GLRKLSYLHLLRVGIRD-GSKLLQSMGSFPSLNTLDLSYNNFTETVTTTTQGFPHFKSLK 336
             +  L+YL +L +       K+   +G    LN L L  N F+ ++ +          LK
Sbjct: 91   AIANLTYLQVLDLTSNSFTGKIPAEIGKLTELNQLILYLNYFSGSIPS------GIWELK 144

Query: 337  ELYMDDARIALNTSFLQIIGESMPSIQYLSLSNSSVSNNSRTLDQGLCPLVHLQELHMAD 396
             ++  D R   N      + E +     L L     +N +  + + L  LVHLQ    A 
Sbjct: 145  NIFYLDLR---NNLLSGDVPEEICKTSSLVLIGFDYNNLTGKIPECLGDLVHLQMFVAAG 201

Query: 397  NDLRGSLPWCLANMTSLRILDVSSNQLIGSISSSPLIHLTSIEDLILSDNHFQIPISLEP 456
            N L GS+P  +  + +L  LD+S NQL G I      +L +++ L+L++N  +  I  E 
Sbjct: 202  NHLTGSIPVSIGTLANLTDLDLSGNQLTGKIPRD-FGNLLNLQSLVLTENLLEGDIPAE- 259

Query: 457  LFNHSRLKIFDAENNEINAEIIESHSLTTPNFQLQSLLLSSGYRDGITFPKFLYNQHDLE 516
            + N S L   +  +N++  +I                            P  L N   L+
Sbjct: 260  IGNCSSLVQLELYDNQLTGKI----------------------------PAELGNLVQLQ 291

Query: 517  YVRLSHIKMNEEFPNWLLENNTKLRQLSLVNDSLVGPFRLPIHSHKQLRLLDVSKNNFQG 576
             +R+   K+    P+ L    T+L  L L  + LVGP    I   + L +L +  NNF G
Sbjct: 292  ALRIYKNKLTSSIPSSLFRL-TQLTHLGLSENHLVGPISEEIGFLESLEVLTLHSNNFTG 350

Query: 577  HIPLEIGDILSRLTVFNISMNALDGSIPSSFGNMNFLQFLDLSNNQLTGEIPEHLAMGCV 636
              P  I + L  LTV  +  N + G +P+  G +  L+ L   +N LTG IP  ++  C 
Sbjct: 351  EFPQSITN-LRNLTVLTVGFNNISGELPADLGLLTNLRNLSAHDNLLTGPIPSSIS-NCT 408

Query: 637  SLRSLALSNNNLEGHMFSRNFNLTNLIWLQLEGNHFVGEIPQSLSKCSSLQGLFLSNNSL 696
             L+ L LS+N + G +  R F   NL ++ +  NHF GEIP  +  CS+L+ L +++N+L
Sbjct: 409  GLKLLDLSHNQMTGEI-PRGFGRMNLTFISIGRNHFTGEIPDDIFNCSNLETLSVADNNL 467

Query: 697  SGKIPRWLGNLTVLRHIIMPKNHIEGPIPLEFCQLRILQILDISDNNISGSLP-SCYDFV 755
            +G +   +G L  LR + +  N + GPIP E   L+ L IL +  N  +G +P    +  
Sbjct: 468  TGTLKPLIGKLQKLRILQVSYNSLTGPIPREIGNLKDLNILYLHSNGFTGRIPREMSNLT 527

Query: 756  CIEQVHLSKNMLHGQLKEGTFFNCLTLMILDLSYNHLNGNIPDRVDGLSQLSYLILAHNN 815
             ++ + +  N L G + E   F+   L +LDLS N  +G IP     L  L+YL L  N 
Sbjct: 528  LLQGLRMYSNDLEGPIPE-EMFDMKLLSVLDLSNNKFSGQIPALFSKLESLTYLSLQGNK 586

Query: 816  LEGEVPIQLCRLNQLQLLDLSNNNLHGHIP----SCFDNTTLHERYNNGSSLQPFETSFV 871
              G +P  L  L+ L   D+S+N L G IP    +   N  L+  ++N           +
Sbjct: 587  FNGSIPASLKSLSLLNTFDISDNLLTGTIPGELLASLKNMQLYLNFSNN----------L 636

Query: 872  IMGGMDVDPKK-QILESFDFTTKSITYTYQGRVPSLLSG------LDLSCNRLIGHIPPQ 924
            + G +  +  K ++++  D +       + G +P  L        LD S N L GHIP +
Sbjct: 637  LTGTIPKELGKLEMVQEIDLSNN----LFSGSIPRSLQACKNVFTLDFSQNNLSGHIPDE 692

Query: 925  I-GNLTKIQTLNLSHNNLAGPIPSTFSNLRNIESLDLSYNKLSWKIPYQLVELNTLAVFS 983
            +   +  I +LNLS N+ +G IP +F N+ ++ SLDLS N L+ +IP  L  L+TL    
Sbjct: 693  VFQGMDMIISLNLSRNSFSGEIPQSFGNMTHLVSLDLSSNNLTGEIPESLANLSTLKHLK 752

Query: 984  VAYNNLSGKIPERAAQFATFNESSYEGNPFLCGPPLPICISPTTMPEAS 1032
            +A NNL G +PE    F   N S   GN  LCG   P  + P T+ + S
Sbjct: 753  LASNNLKGHVPESGV-FKNINASDLMGNTDLCGSKKP--LKPCTIKQKS 798




Constitutes the pattern-recognition receptor (PPR) that determines the specific perception of flagellin (flg22), a potent elicitor of the defense response to pathogen-associated molecular patterns (PAMPs). Flagellin-binding to the receptor is the first step to initiate the innate immune MAP kinase signaling cascade (MEKK1, MKK4/MKK5 and MPK3/MPK6), resulting in enhanced resistance against pathogens. Binding to the effector AvrPto1 from Pseudomonas syringae blocks the downstream plant immune response.
Arabidopsis thaliana (taxid: 3702)
EC: 2EC: .EC: 7EC: .EC: 1EC: 1EC: .EC: 1
>sp|C0LGQ5|GSO1_ARATH LRR receptor-like serine/threonine-protein kinase GSO1 OS=Arabidopsis thaliana GN=GSO1 PE=2 SV=1 Back     alignment and function description
>sp|Q9FIZ3|GSO2_ARATH LRR receptor-like serine/threonine-protein kinase GSO2 OS=Arabidopsis thaliana GN=GSO2 PE=2 SV=2 Back     alignment and function description
>sp|Q9ZWC8|BRL1_ARATH Serine/threonine-protein kinase BRI1-like 1 OS=Arabidopsis thaliana GN=BRL1 PE=1 SV=1 Back     alignment and function description
>sp|Q9LJF3|BRL3_ARATH Receptor-like protein kinase BRI1-like 3 OS=Arabidopsis thaliana GN=BRL3 PE=1 SV=1 Back     alignment and function description
>sp|Q9LYN8|EXS_ARATH Leucine-rich repeat receptor protein kinase EXS OS=Arabidopsis thaliana GN=EXS PE=1 SV=1 Back     alignment and function description
>sp|Q8GUQ5|BRI1_SOLLC Brassinosteroid LRR receptor kinase OS=Solanum lycopersicum GN=CURL3 PE=1 SV=1 Back     alignment and function description
>sp|Q8L899|BRI1_SOLPE Systemin receptor SR160 OS=Solanum peruvianum PE=1 SV=1 Back     alignment and function description
>sp|C0LGS2|Y4361_ARATH Probable LRR receptor-like serine/threonine-protein kinase At4g36180 OS=Arabidopsis thaliana GN=At4g36180 PE=1 SV=1 Back     alignment and function description
>sp|Q9ZPS9|BRL2_ARATH Serine/threonine-protein kinase BRI1-like 2 OS=Arabidopsis thaliana GN=BRL2 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query1102
255581263912 serine-threonine protein kinase, plant-t 0.687 0.831 0.495 0.0
2240980081097 predicted protein [Populus trichocarpa] 0.933 0.938 0.411 0.0
2240734361014 predicted protein [Populus trichocarpa] 0.870 0.945 0.400 0.0
359476165 1464 PREDICTED: LRR receptor-like serine/thre 0.808 0.608 0.441 1e-180
224142481781 predicted protein [Populus trichocarpa] 0.673 0.950 0.471 1e-178
224073422969 predicted protein [Populus trichocarpa] 0.822 0.934 0.399 1e-174
224124658 1228 predicted protein [Populus trichocarpa] 0.885 0.794 0.414 1e-174
3594827351097 PREDICTED: receptor-like protein 12-like 0.938 0.942 0.375 1e-174
3594827251144 PREDICTED: leucine-rich repeat receptor 0.979 0.943 0.380 1e-173
224124490981 predicted protein [Populus trichocarpa] 0.800 0.899 0.404 1e-171
>gi|255581263|ref|XP_002531443.1| serine-threonine protein kinase, plant-type, putative [Ricinus communis] gi|223528936|gb|EEF30930.1| serine-threonine protein kinase, plant-type, putative [Ricinus communis] Back     alignment and taxonomy information
 Score =  712 bits (1839), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 399/805 (49%), Positives = 527/805 (65%), Gaps = 47/805 (5%)

Query: 307  SLNTLDLSYNNFTET----------------------VTTTTQGFPHFKSLKELYMDDAR 344
            SL  LDLSYN+F E+                      V    Q  P+F++L+ELY+D  +
Sbjct: 129  SLEVLDLSYNSFNESILSSLSEFSSLKSLNLGFNPFEVPIQAQDLPNFENLEELYLD--K 186

Query: 345  IALNTSFLQIIGESMPSIQYLSLSNSSVSNNSRTLDQGLCPLVHLQELHMADNDLRGSLP 404
            I L  SFLQ +G  M S++ LSLS   ++     + QGLC L+HL+ L ++ N+  G LP
Sbjct: 187  IELENSFLQTVG-VMTSLKVLSLSGCGLTGALPNV-QGLCELIHLRVLDVSSNEFHGILP 244

Query: 405  WCLANMTSLRILDVSSNQLIGSISSSPLIHLTSIEDLILSDNHFQIPISLEPLFNHSRLK 464
            WCL+N+TSL++LD+SSNQ +G IS+SPL  L S+ DL +S+NHFQ+P SL P FNHS LK
Sbjct: 245  WCLSNLTSLQLLDLSSNQFVGDISNSPLKILKSLVDLDVSNNHFQVPFSLGPFFNHSNLK 304

Query: 465  IFDAENNEINAEIIESHSLTTPNFQLQSLLLSSGYRDGITFPKFLYNQHDLEYVRLSHIK 524
                +NN I  E  E HS   P FQL S++ S GY    TFP FLY+Q++L++V LSH+ 
Sbjct: 305  HIRGQNNAIYLEA-ELHS--APRFQLISIIFS-GYGICGTFPNFLYHQNNLQFVDLSHLS 360

Query: 525  MNEEFPNWLLENNTKLRQLSLVNDSLVGPFRLPIHSHKQLRLLDVSKNNFQGHIPLEIGD 584
            +  EFPNWLL NNT+L  L LVN+SL G  +LP+H H  L  LD+S N+   HIPLEIG 
Sbjct: 361  LKGEFPNWLLTNNTRLEILDLVNNSLSGHLQLPLHPHVNLLALDISNNHVHDHIPLEIGT 420

Query: 585  ILSRLTVFNISMNALDGSIPSSFGNMNFLQFLDLSNNQLTGEIPEHLAMGCVSLRSLALS 644
             L +L + N+S N  DGSIPSSFGNMN L+ LDLSNNQL+G IPEHLA GC SL +L LS
Sbjct: 421  FLPKLELLNMSSNGFDGSIPSSFGNMNSLRILDLSNNQLSGSIPEHLATGCFSLNTLILS 480

Query: 645  NNNLEGHMFSRNFNLTNLIWLQLEGNHFVGEIPQSLSKCSSLQGLFLSNNSLSGKIPRWL 704
            NN+L+G MFS+ FNLTNL WL+L+ NHF G IP+SLSK S+L  + LS+N LSG IP W+
Sbjct: 481  NNSLQGQMFSKQFNLTNLWWLELDKNHFSGRIPKSLSK-SALSIMDLSDNHLSGMIPGWI 539

Query: 705  GNLTVLRHIIMPKNHIEGPIPLEFCQLRILQILDISDNNISGSLPSCYDFVCIEQVHLSK 764
            GNL+ L+++I+  N ++GPIP+EFCQL  L++LD+++N++SG LPSC     I  VHLS+
Sbjct: 540  GNLSYLQNLILSNNRLKGPIPVEFCQLHYLEVLDLANNSVSGILPSCLSPSSIIHVHLSQ 599

Query: 765  NMLHGQLKEGTFFNCLTLMILDLSYNHLNGNIPDRVDGLSQLSYLILAHNNLEGEVPIQL 824
            NM+ G      F     L+ LDLS N + G IP  + G++ L  L L  N  +GE+P Q+
Sbjct: 600  NMIEGPWTNA-FSGSHFLVTLDLSSNRITGRIPTLIGGINALRILNLKSNRFDGEIPAQI 658

Query: 825  CRLNQLQLLDLSNNNLHGHIPSCFDNTTLHERYNNGSSLQPFETSFVIMGGMDVDPKKQI 884
            C L QL L+ L++NNL G IPSC        + +   SL P              P + +
Sbjct: 659  CGLYQLSLIVLADNNLSGSIPSCL-------QLDQSDSLAPDVPPVPNPLNPYYLPVRPM 711

Query: 885  LESFDFTTKSITYTYQGRVPSLLSGLDLSCNRLIGHIPPQIGNLTKIQTLNLSHNNLAGP 944
                 FTTK  +Y+YQG++ S +SG+D SCN+L G IPP++GN + I +LNLS+N   GP
Sbjct: 712  Y----FTTKRRSYSYQGKILSYISGIDFSCNKLTGEIPPEMGNHSAIYSLNLSYNRFTGP 767

Query: 945  IPSTFSNLRNIESLDLSYNKLSWKIPYQLVELNTLAVFSVAYNNLSGKIPERAAQFATFN 1004
            IPSTFSNL+ IESLDLSYN L+  IP QL+EL  L+ FSVA+NNL GK P+R  QFATF 
Sbjct: 768  IPSTFSNLKQIESLDLSYNNLNGDIPSQLLELKFLSYFSVAHNNLFGKTPKRTGQFATFE 827

Query: 1005 ESSYEGNPFLCGPPLPICIS---PTTMPEASPSNEGDNNLIDMDIFFITFTTSYVIVIFG 1061
             SSYEGNP LCG PLP   +    ++ P AS  +E ++N +DM+ F+ +F  SY  VI G
Sbjct: 828  VSSYEGNPNLCGLPLPKSCTEREASSAPRASAMDE-ESNFLDMNTFYGSFIVSYTFVIIG 886

Query: 1062 IVAVLYVNARWRRRWFYLVEMWTTS 1086
            +  VLY+N +WRR WF  V++  +S
Sbjct: 887  MFLVLYINPQWRRAWFDFVDICISS 911




Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|224098008|ref|XP_002334579.1| predicted protein [Populus trichocarpa] gi|222873205|gb|EEF10336.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224073436|ref|XP_002304095.1| predicted protein [Populus trichocarpa] gi|222841527|gb|EEE79074.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|359476165|ref|XP_002283141.2| PREDICTED: LRR receptor-like serine/threonine-protein kinase GSO1-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|224142481|ref|XP_002324585.1| predicted protein [Populus trichocarpa] gi|222866019|gb|EEF03150.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224073422|ref|XP_002304093.1| predicted protein [Populus trichocarpa] gi|222841525|gb|EEE79072.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224124658|ref|XP_002330078.1| predicted protein [Populus trichocarpa] gi|222871503|gb|EEF08634.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|359482735|ref|XP_003632821.1| PREDICTED: receptor-like protein 12-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|359482725|ref|XP_003632817.1| PREDICTED: leucine-rich repeat receptor protein kinase EXS-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|224124490|ref|XP_002330036.1| predicted protein [Populus trichocarpa] gi|222871461|gb|EEF08592.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query1102
TAIR|locus:20373131000 RLP13 "AT1G74170" [Arabidopsis 0.820 0.904 0.329 7.1e-116
TAIR|locus:20250121083 RLP1 "AT1G07390" [Arabidopsis 0.580 0.590 0.364 1.3e-113
TAIR|locus:2155909908 RLP56 "AT5G49290" [Arabidopsis 0.512 0.622 0.344 2.1e-109
TAIR|locus:2019662965 RLP15 "AT1G74190" [Arabidopsis 0.556 0.635 0.310 1.5e-102
TAIR|locus:2101943891 RLP45 "AT3G53240" [Arabidopsis 0.734 0.907 0.322 2.1e-100
TAIR|locus:2037308976 RLP14 "AT1G74180" [Arabidopsis 0.747 0.844 0.326 1.4e-96
TAIR|locus:2040075935 RLP21 "AT2G25470" [Arabidopsis 0.736 0.868 0.315 8.6e-88
TAIR|locus:2170483 1173 FLS2 "FLAGELLIN-SENSITIVE 2" [ 0.553 0.520 0.290 4.8e-56
TAIR|locus:2120362 1249 GSO1 "GASSHO1" [Arabidopsis th 0.556 0.490 0.283 3.5e-46
TAIR|locus:2156349 1252 GSO2 "GASSHO 2" [Arabidopsis t 0.682 0.600 0.266 5.4e-51
TAIR|locus:2037313 RLP13 "AT1G74170" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1142 (407.1 bits), Expect = 7.1e-116, P = 7.1e-116
 Identities = 317/961 (32%), Positives = 465/961 (48%)

Query:   170 DIKELD--SLRDLEKLNIGRNMIDKFVVSKGPKRLSRLNNLKVFDLSGNLFNNXXXXXXX 227
             D++ LD  S R  E       + D     +G K LSRL NL++ DLS + FNN       
Sbjct:    38 DVRSLDLSSSRSCEDCGFS-GLFDDV---EGYKSLSRLRNLEILDLSSHRFNNSIFPFLN 93

Query:   228 XXXXXXXXXXYDNRLEGSIDVKEFDSLSNLEELDMSYNEIDNFEVP-QACSGLRKLSYLH 286
                         N +     VKEF  L+NLE LD+  N   N  +P Q  + LR+   L 
Sbjct:    94 AATSLTTLFLTYNNMHSPFLVKEFKDLTNLEHLDLRGNRF-NGSIPTQDYNSLRRFRKLE 152

Query:   287 LLRVGIR-DGSKLLQSMGSFPSLNTLDLSYNNFXXXXXXXXQGFPHFKSLKEL----YMD 341
             +L +      S++   + S  SL +L L  NN           FP  K L++L     +D
Sbjct:   153 ILDLSDNLFNSRIFPFLNSATSLKSLSLWGNNMGGP-------FPA-KELRDLTNVELLD 204

Query:   342 DARIALNTSF-------LQIIGESMPSIQYXXXXXXXXXXXXRTLD-QGLCPLVHLQELH 393
              +R   N S        L+ +     S               +T    G CP  +++EL 
Sbjct:   205 LSRNRFNGSIPVRALFALRKLKALDLSDNEFSSSVELQGKFAKTKPLSGTCPWKNMEELK 264

Query:   394 MADNDLRGSLPWCLANMTSLRILDVXXXXXXXXXXXXPLIHLTSIEDLILSDNHFQIPIS 453
             +++N L G  P CL ++T LR+LD+             L +L S+E L L  N+F+   S
Sbjct:   265 LSNNKLAGQFPLCLTSLTGLRVLDLSSNQLTGNVPSA-LANLESLEYLSLFGNNFEGFFS 323

Query:   454 LEPLFNHSRLKIFDXXXXXXXXXXXXSHSLTTPNFQLQSLLLSSGYRDGITFPKFLYNQH 513
             L  L N S+LK+                S   P FQL  + L S   + +  P FL +Q 
Sbjct:   324 LGLLANLSKLKVLRLDSQSNSLEVEFETSWK-PKFQLVVIALRSCNLEKV--PHFLLHQK 380

Query:   514 DLEYVRLSHIKMNEEFPNWLLENNTKLRQLSLVNDSLVGPFRLPIHSHKQLRLLDVSKNN 573
             DL +V LS  +++  FP+WLLENNTKL  L L N+S    F+LP  +H  L  L+VS N 
Sbjct:   381 DLHHVDLSDNQIHGNFPSWLLENNTKLEVLLLQNNSFTS-FQLPKSAHNLL-FLNVSVNK 438

Query:   574 FQGHIPLE-IGDILSRLTVFNISMNALDGSIPSSFGNMNFLQFLDLSNNQLTGEIPEHLA 632
             F  H+ L+  G IL  L   N++ N   G++PSS  NM  ++FLDLS+N+  G++P    
Sbjct:   439 FN-HLFLQNFGWILPHLVCVNLAYNGFQGNLPSSLDNMKSIEFLDLSHNRFHGKLPRRFL 497

Query:   633 MGCVXXXXXXXXXXXXEGHMFSRNFNLTNLIWLQLEGNHFVGEIPQSLSKCSSLQGLFLS 692
              GC              G +F    N T L  + ++ N F G I +      SL  L +S
Sbjct:   498 KGCYNLTILKLSHNKLSGEVFPEAANFTRLWVMSMDNNLFTGNIGKGFRSLPSLNVLDIS 557

Query:   693 NNSLSGKIPRWLGNLTVLRHIIMPKNHIEGPIPLEFCQLRILQILDISDNNISGSLPSCY 752
             NN L+G IP W+G    L  + +  N +EG IP     +  LQ+LD+S N +SG +P   
Sbjct:   558 NNKLTGVIPSWIGERQGLFALQLSNNMLEGEIPTSLFNISYLQLLDLSSNRLSGDIPPHV 617

Query:   753 DFVCIEQVHL-SKNMLHGQLKEGTFFNCLTLMILDLSYNHLNGNIPDRVDGLSQLSYLIL 811
               +    V L   N L G + +    N   +++LDL  N L+GN+P+ ++    +S L+L
Sbjct:   618 SSIYHGAVLLLQNNNLSGVIPDTLLLN---VIVLDLRNNRLSGNLPEFIN-TQNISILLL 673

Query:   812 AHNNLEGEVPIXXXXXXXXXXXXXXXXXXHGHIPSCFDNTT--LHE-----RYNN----G 860
               NN  G++P                   +G IPSC  NT+  L +     RY+     G
Sbjct:   674 RGNNFTGQIPHQFCSLSNIQLLDLSNNKFNGSIPSCLSNTSFGLRKGDDSYRYDVPSRFG 733

Query:   861 SSLQP--FETSFVIMGGMDVDPKKQILESFDFTTKSITYTYQGRVPSLLSGLDLSCNRLI 918
             ++  P  FE S +++   ++  +       +F TK     Y G    LL G+DLS N L 
Sbjct:   734 TAKDPVYFE-SLLMIDEFNMVNETNSQTKIEFATKHRYDAYMGGNLKLLFGMDLSENELS 792

Query:   919 GHIPPQIGNLTKIQTLNLSHNNLAGPIPSTFSNLRNIESLDLSYNKLSWKIPYQLVELNT 978
             G IP ++G L +++ LNLSHNNL+G I  +FS L+N+ESLDLS+N+L   IP QL ++ +
Sbjct:   793 GEIPVELGGLVELEALNLSHNNLSGVILESFSGLKNVESLDLSFNRLQGPIPLQLTDMIS 852

Query:   979 LAVFSVAYNNLSGKIPERAAQFATFNESSYEGNPFLCGPPLPICISPTTMPEASPSNEGD 1038
             LAVF+V+YNNLSG +P+   QF TF   SY GNP LCG  + I  +           E D
Sbjct:   853 LAVFNVSYNNLSGIVPQ-GRQFNTFETQSYFGNPLLCGKSIDISCASNNFHPTDNGVEAD 911

Query:  1039 NNLIDMDIFFITFTTSYVIVIFGIVAVLYVNARWRRRWFYLVEMWTTSCYYFVIDNLIPT 1098
              + +DM+ F+ +F  +YV ++ GI+A L  ++ W R WFY+V+ +       +  N   T
Sbjct:   912 ESTVDMESFYWSFVAAYVTILLGILASLSFDSPWSRAWFYIVDAFVLKVRNMLWQNTAGT 971

Query:  1099 R 1099
             +
Sbjct:   972 K 972


GO:0007165 "signal transduction" evidence=IC
TAIR|locus:2025012 RLP1 "AT1G07390" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2155909 RLP56 "AT5G49290" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2019662 RLP15 "AT1G74190" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2101943 RLP45 "AT3G53240" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2037308 RLP14 "AT1G74180" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2040075 RLP21 "AT2G25470" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2170483 FLS2 "FLAGELLIN-SENSITIVE 2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2120362 GSO1 "GASSHO1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2156349 GSO2 "GASSHO 2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Fail to connect to STRING server


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query1102
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 4e-60
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 7e-50
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 2e-49
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 3e-47
PLN00113968 PLN00113, PLN00113, leucine-rich repeat receptor-l 7e-44
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 1e-34
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 8e-30
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 1e-16
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 2e-10
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 7e-10
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 7e-10
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 2e-09
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 2e-08
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 4e-08
cd00116319 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribo 8e-08
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 1e-07
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 5e-07
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 1e-06
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 2e-06
pfam0826342 pfam08263, LRRNT_2, Leucine rich repeat N-terminal 2e-06
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 5e-06
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 5e-06
cd00116319 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribo 6e-06
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 8e-06
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 1e-05
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 4e-05
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 5e-05
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 6e-05
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 6e-05
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 1e-04
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 1e-04
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 5e-04
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 5e-04
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 8e-04
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 0.001
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 0.002
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 0.003
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 0.003
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 0.004
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
 Score =  223 bits (569), Expect = 4e-60
 Identities = 188/609 (30%), Positives = 275/609 (45%), Gaps = 99/609 (16%)

Query: 413  LRILDVSSNQLIGSISSSPLIHLTSIEDLILSDNHFQIPISLEPLFNHSRLKIFDAENNE 472
            ++ +++S+NQL G I        +S+  L LS+N+F   I    + N   L+  D  NN 
Sbjct: 95   IQTINLSNNQLSGPIPDDIFTTSSSLRYLNLSNNNFTGSIPRGSIPN---LETLDLSNNM 151

Query: 473  INAEIIESHSLTTPNFQLQSLLLSSGYRDGITFPKFLYNQHDLEYVRLSHIKMNEEFPNW 532
            ++ EI                       D  +F         L+ + L    +  + PN 
Sbjct: 152  LSGEI---------------------PNDIGSF-------SSLKVLDLGGNVLVGKIPNS 183

Query: 533  LLENNTKLRQLSLVNDSLVGPFRLPIHSHKQLRLLDVSKNNFQGHIPLEIGDILSRLTVF 592
            L  N T L  L+L ++ LVG     +   K L+ + +  NN  G IP EIG  L+ L   
Sbjct: 184  L-TNLTSLEFLTLASNQLVGQIPRELGQMKSLKWIYLGYNNLSGEIPYEIGG-LTSLNHL 241

Query: 593  NISMNALDGSIPSSFGNMNFLQFLDLSNNQLTGEIPEHLAMGCVSLRSLALSNNNLEGHM 652
            ++  N L G IPSS GN+  LQ+L L  N+L+G IP  +      L SL LS+N+L G +
Sbjct: 242  DLVYNNLTGPIPSSLGNLKNLQYLFLYQNKLSGPIPPSI-FSLQKLISLDLSDNSLSGEI 300

Query: 653  FSRNFNLTNLIWLQLEGNHFVGEIPQSLSKCSSLQGLFLSNNSLSGKIPRWLG---NLTV 709
                  L NL  L L  N+F G+IP +L+    LQ L L +N  SG+IP+ LG   NLTV
Sbjct: 301  PELVIQLQNLEILHLFSNNFTGKIPVALTSLPRLQVLQLWSNKFSGEIPKNLGKHNNLTV 360

Query: 710  LRHIIMPKNHIEGPIPLEFCQLRILQILDISDNNISGSLP-SCYDFVCIEQVHLSKNMLH 768
            L    +  N++ G IP   C    L  L +  N++ G +P S      + +V L  N   
Sbjct: 361  LD---LSTNNLTGEIPEGLCSSGNLFKLILFSNSLEGEIPKSLGACRSLRRVRLQDNSFS 417

Query: 769  GQLKEGTFFNCLTLM-ILDLSYNHLNGNIPDRVDGLSQLSYLILAHNNLEGEVPIQLCRL 827
            G+L     F  L L+  LD+S N+L G I  R   +  L  L LA N   G +P      
Sbjct: 418  GELPSE--FTKLPLVYFLDISNNNLQGRINSRKWDMPSLQMLSLARNKFFGGLP-DSFGS 474

Query: 828  NQLQLLDLSNNNLHGHIPSCFDNTTLHERYNNGSSLQPFETSFVIMGGMDVDPKKQILES 887
             +L+ LDLS N   G +P                                          
Sbjct: 475  KRLENLDLSRNQFSGAVPRKL--------------------------------------- 495

Query: 888  FDFTTKSITYTYQGRVPSLLSGLDLSCNRLIGHIPPQIGNLTKIQTLNLSHNNLAGPIPS 947
                         G +  L+  L LS N+L G IP ++ +  K+ +L+LSHN L+G IP+
Sbjct: 496  -------------GSLSELMQ-LKLSENKLSGEIPDELSSCKKLVSLDLSHNQLSGQIPA 541

Query: 948  TFSNLRNIESLDLSYNKLSWKIPYQLVELNTLAVFSVAYNNLSGKIPERAAQFATFNESS 1007
            +FS +  +  LDLS N+LS +IP  L  + +L   ++++N+L G +P   A F   N S+
Sbjct: 542  SFSEMPVLSQLDLSQNQLSGEIPKNLGNVESLVQVNISHNHLHGSLPSTGA-FLAINASA 600

Query: 1008 YEGNPFLCG 1016
              GN  LCG
Sbjct: 601  VAGNIDLCG 609


Length = 968

>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|238064 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|219766 pfam08263, LRRNT_2, Leucine rich repeat N-terminal domain Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|238064 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 1102
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 100.0
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 100.0
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 100.0
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 100.0
KOG0472565 consensus Leucine-rich repeat protein [Function un 100.0
KOG0472565 consensus Leucine-rich repeat protein [Function un 100.0
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.97
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.96
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.96
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.96
KOG4237498 consensus Extracellular matrix protein slit, conta 99.93
KOG4237498 consensus Extracellular matrix protein slit, conta 99.9
PLN03210 1153 Resistant to P. syringae 6; Provisional 99.89
PLN03210 1153 Resistant to P. syringae 6; Provisional 99.89
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 99.86
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 99.85
PRK15370754 E3 ubiquitin-protein ligase SlrP; Provisional 99.77
PRK15370754 E3 ubiquitin-protein ligase SlrP; Provisional 99.77
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.68
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.64
KOG0617264 consensus Ras suppressor protein (contains leucine 99.63
KOG0617264 consensus Ras suppressor protein (contains leucine 99.61
PLN03150623 hypothetical protein; Provisional 99.55
PLN03150623 hypothetical protein; Provisional 99.37
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 99.18
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 99.15
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 99.12
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 99.1
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 99.09
KOG3207505 consensus Beta-tubulin folding cofactor E [Posttra 99.07
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 99.07
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 99.06
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 98.97
PF0826343 LRRNT_2: Leucine rich repeat N-terminal domain; In 98.95
KOG3207505 consensus Beta-tubulin folding cofactor E [Posttra 98.89
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 98.82
KOG1259490 consensus Nischarin, modulator of integrin alpha5 98.8
KOG1259490 consensus Nischarin, modulator of integrin alpha5 98.77
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.72
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 98.7
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.69
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 98.64
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 98.58
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 98.5
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 98.46
KOG4341483 consensus F-box protein containing LRR [General fu 98.42
KOG2982418 consensus Uncharacterized conserved protein [Funct 98.4
KOG18591096 consensus Leucine-rich repeat proteins [General fu 98.35
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 98.33
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 98.23
KOG18591096 consensus Leucine-rich repeat proteins [General fu 98.2
KOG4341483 consensus F-box protein containing LRR [General fu 98.19
KOG2982418 consensus Uncharacterized conserved protein [Funct 98.17
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 98.11
KOG3665699 consensus ZYG-1-like serine/threonine protein kina 97.98
KOG3665699 consensus ZYG-1-like serine/threonine protein kina 97.85
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 97.76
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 97.76
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 97.67
PRK15386426 type III secretion protein GogB; Provisional 97.5
PRK15386426 type III secretion protein GogB; Provisional 97.5
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 97.48
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 97.44
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 97.39
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 97.34
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 96.93
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 96.89
KOG1947482 consensus Leucine rich repeat proteins, some prote 96.74
KOG2123388 consensus Uncharacterized conserved protein [Funct 96.65
KOG1947482 consensus Leucine rich repeat proteins, some prote 96.52
KOG2123388 consensus Uncharacterized conserved protein [Funct 96.31
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 95.0
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 94.92
KOG4308478 consensus LRR-containing protein [Function unknown 94.7
KOG4308478 consensus LRR-containing protein [Function unknown 94.57
KOG3864221 consensus Uncharacterized conserved protein [Funct 89.95
PF1350417 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO 89.51
KOG0473326 consensus Leucine-rich repeat protein [Function un 89.32
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 88.48
smart0037026 LRR Leucine-rich repeats, outliers. 88.48
smart0037026 LRR Leucine-rich repeats, outliers. 88.09
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 88.09
KOG3864221 consensus Uncharacterized conserved protein [Funct 85.6
PF1351624 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RI 84.64
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
Probab=100.00  E-value=1.3e-68  Score=687.28  Aligned_cols=352  Identities=36%  Similarity=0.533  Sum_probs=255.7

Q ss_pred             CCcCEEEccCCcCCCCCCchhhhcCCCCcEEEccCCcccccCCcccCCCCCCcEEEccCcccccccchhHhhcCCCCcEE
Q 001313          562 KQLRLLDVSKNNFQGHIPLEIGDILSRLTVFNISMNALDGSIPSSFGNMNFLQFLDLSNNQLTGEIPEHLAMGCVSLRSL  641 (1102)
Q Consensus       562 ~~L~~L~ls~n~l~~~ip~~~~~~l~~L~~L~Ls~n~l~~~~~~~~~~l~~L~~L~Ls~n~l~~~ip~~~~~~l~~L~~L  641 (1102)
                      ++|++|++++|.+.+.+|..+.. +++|++|++++|.+.+.+|..+.++++|++|++++|.+++.+              
T Consensus       260 ~~L~~L~L~~n~l~~~~p~~l~~-l~~L~~L~Ls~n~l~~~~p~~~~~l~~L~~L~l~~n~~~~~~--------------  324 (968)
T PLN00113        260 KNLQYLFLYQNKLSGPIPPSIFS-LQKLISLDLSDNSLSGEIPELVIQLQNLEILHLFSNNFTGKI--------------  324 (968)
T ss_pred             CCCCEEECcCCeeeccCchhHhh-ccCcCEEECcCCeeccCCChhHcCCCCCcEEECCCCccCCcC--------------
Confidence            34445555555555555544443 445555555555554444444444444444444444444433              


Q ss_pred             EccccccCCcccccccCCCccCeeeccCccCcccCCCCcCCCCCCcEEEccCCcCCCCCCccccCCCCccEEECCCCccc
Q 001313          642 ALSNNNLEGHMFSRNFNLTNLIWLQLEGNHFVGEIPQSLSKCSSLQGLFLSNNSLSGKIPRWLGNLTVLRHIIMPKNHIE  721 (1102)
Q Consensus       642 ~L~~n~l~~~~~~~~~~l~~L~~L~L~~n~l~~~~~~~~~~l~~L~~L~l~~n~l~~~~p~~~~~l~~L~~L~l~~n~l~  721 (1102)
                                 |..+..+++|+.|++++|.+.+.+|..+..+++|+.|++++|++++.+|.++..+++|+.|++++|.+.
T Consensus       325 -----------~~~~~~l~~L~~L~L~~n~l~~~~p~~l~~~~~L~~L~Ls~n~l~~~~p~~~~~~~~L~~L~l~~n~l~  393 (968)
T PLN00113        325 -----------PVALTSLPRLQVLQLWSNKFSGEIPKNLGKHNNLTVLDLSTNNLTGEIPEGLCSSGNLFKLILFSNSLE  393 (968)
T ss_pred             -----------ChhHhcCCCCCEEECcCCCCcCcCChHHhCCCCCcEEECCCCeeEeeCChhHhCcCCCCEEECcCCEec
Confidence                       333444555555555555555555555555556666666666665555655555556666666666666


Q ss_pred             CCCcccccCCCcccEEEccCcccccCCCCCCCCccccEEEccCcccccccCcccccCccCccEEEccCccCcccCCcccc
Q 001313          722 GPIPLEFCQLRILQILDISDNNISGSLPSCYDFVCIEQVHLSKNMLHGQLKEGTFFNCLTLMILDLSYNHLNGNIPDRVD  801 (1102)
Q Consensus       722 ~~~~~~~~~l~~L~~L~ls~n~l~~~~p~~~~~~~L~~L~l~~n~l~~~i~~~~~~~~~~L~~L~Ls~n~l~~~~p~~~~  801 (1102)
                      +.+|..+..+++|+.|++++|++++                       .+|. .|.+++.|+.|++++|.+++.+|..+.
T Consensus       394 ~~~p~~~~~~~~L~~L~L~~n~l~~-----------------------~~p~-~~~~l~~L~~L~Ls~N~l~~~~~~~~~  449 (968)
T PLN00113        394 GEIPKSLGACRSLRRVRLQDNSFSG-----------------------ELPS-EFTKLPLVYFLDISNNNLQGRINSRKW  449 (968)
T ss_pred             ccCCHHHhCCCCCCEEECcCCEeee-----------------------ECCh-hHhcCCCCCEEECcCCcccCccChhhc
Confidence            5666556555666655555555543                       3444 566777777888888888877777777


Q ss_pred             CCCCCCEEEccCccccccCchhhcCCCCCCEEECcCccCCCCCCcccccccccccccCCCCCCCccchhhhcCCccCCcc
Q 001313          802 GLSQLSYLILAHNNLEGEVPIQLCRLNQLQLLDLSNNNLHGHIPSCFDNTTLHERYNNGSSLQPFETSFVIMGGMDVDPK  881 (1102)
Q Consensus       802 ~l~~L~~L~L~~N~l~~~~p~~~~~l~~L~~L~Ls~N~l~~~~p~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  881 (1102)
                      .+++|+.|++++|++.+.+|..+ ..++|+.||+++|++++.+|..+.++.                             
T Consensus       450 ~l~~L~~L~L~~n~~~~~~p~~~-~~~~L~~L~ls~n~l~~~~~~~~~~l~-----------------------------  499 (968)
T PLN00113        450 DMPSLQMLSLARNKFFGGLPDSF-GSKRLENLDLSRNQFSGAVPRKLGSLS-----------------------------  499 (968)
T ss_pred             cCCCCcEEECcCceeeeecCccc-ccccceEEECcCCccCCccChhhhhhh-----------------------------
Confidence            78888888888888887777765 457899999999999988888776554                             


Q ss_pred             ccccceeeeeccceeeeccCCcCCCCceEECCCCCCCCCCcccccCCCcCCEEECCCCCCCCCCcccccCCCcCCEEeCC
Q 001313          882 KQILESFDFTTKSITYTYQGRVPSLLSGLDLSCNRLIGHIPPQIGNLTKIQTLNLSHNNLAGPIPSTFSNLRNIESLDLS  961 (1102)
Q Consensus       882 ~~~~~~~~~~~~~~~~~~~~~~~~~L~~L~Ls~N~l~~~ip~~~~~l~~L~~L~Ls~N~l~~~~p~~~~~l~~L~~L~Ls  961 (1102)
                                              .|+.|+|++|++.+.+|+.++++++|++|+|++|.++|.+|..|+++++|+.|||+
T Consensus       500 ------------------------~L~~L~Ls~N~l~~~~p~~~~~l~~L~~L~Ls~N~l~~~~p~~~~~l~~L~~L~Ls  555 (968)
T PLN00113        500 ------------------------ELMQLKLSENKLSGEIPDELSSCKKLVSLDLSHNQLSGQIPASFSEMPVLSQLDLS  555 (968)
T ss_pred             ------------------------ccCEEECcCCcceeeCChHHcCccCCCEEECCCCcccccCChhHhCcccCCEEECC
Confidence                                    57889999999999999999999999999999999999999999999999999999


Q ss_pred             CCcCcccCchhhhcCCCCCEEEcccCcCcccCCccccccCCCCccccCCCCCCCCCC
Q 001313          962 YNKLSWKIPYQLVELNTLAVFSVAYNNLSGKIPERAAQFATFNESSYEGNPFLCGPP 1018 (1102)
Q Consensus       962 ~N~l~~~~p~~l~~l~~L~~l~ls~N~l~~~~p~~~~~~~~~~~~~~~gN~~lC~~~ 1018 (1102)
                      +|+++|.+|..+.++++|+++++++|+++|.+|. .+++.++...++.|||.+||.+
T Consensus       556 ~N~l~~~~p~~l~~l~~L~~l~ls~N~l~~~~p~-~~~~~~~~~~~~~~n~~lc~~~  611 (968)
T PLN00113        556 QNQLSGEIPKNLGNVESLVQVNISHNHLHGSLPS-TGAFLAINASAVAGNIDLCGGD  611 (968)
T ss_pred             CCcccccCChhHhcCcccCEEeccCCcceeeCCC-cchhcccChhhhcCCccccCCc
Confidence            9999999999999999999999999999999998 6889999999999999999865



>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>PF08263 LRRNT_2: Leucine rich repeat N-terminal domain; InterPro: IPR013210 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>KOG4308 consensus LRR-containing protein [Function unknown] Back     alignment and domain information
>KOG4308 consensus LRR-containing protein [Function unknown] Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D Back     alignment and domain information
>KOG0473 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF13516 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RIZ_A 3RGX_A 1DFJ_I 2BNH_A 3VQ1_A 3VQ2_A 2Z64_A 2OMX_A Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query1102
3riz_A772 Crystal Structure Of The Plant Steroid Receptor Bri 7e-47
3rgx_A768 Structural Insight Into Brassinosteroid Perception 7e-47
1ogq_A313 The Crystal Structure Of Pgip (Polygalacturonase In 5e-13
1ogq_A313 The Crystal Structure Of Pgip (Polygalacturonase In 3e-05
>pdb|3RIZ|A Chain A, Crystal Structure Of The Plant Steroid Receptor Bri1 Ectodomain Length = 772 Back     alignment and structure

Iteration: 1

Score = 186 bits (472), Expect = 7e-47, Method: Compositional matrix adjust. Identities = 170/559 (30%), Positives = 254/559 (45%), Gaps = 72/559 (12%) Query: 508 FLYNQHDLEYVRLSHIKMNEEFPNWLLENNTKLRQLSLVNDSLVGPFRLPIHSHKQLRLL 567 FL + L+++ +S K++ +F + + T+L+ L++ ++ VGP +P K L+ L Sbjct: 215 FLGDCSALQHLDISGNKLSGDF-SRAISTCTELKLLNISSNQFVGP--IPPLPLKSLQYL 271 Query: 568 DVSKNNFQGHIPLEIGDILSRLTVFNISMNALDGSIPSSFG------------------- 608 +++N F G IP + LT ++S N G++P FG Sbjct: 272 SLAENKFTGEIPDFLSGACDTLTGLDLSGNHFYGAVPPFFGSCSLLESLALSSNNFSGEL 331 Query: 609 ------NMNFLQFLDLSNNQLTGEIPEHLAMGCVXXXXXXXXXXXXEGHMF---SRNFNL 659 M L+ LDLS N+ +GE+PE L G + +N Sbjct: 332 PMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSASLLTLDLSSNNFSGPILPNLCQNPKN 391 Query: 660 TNLIWLQLEGNHFVGEIPQSLSKCSSLQGLFLSNNSLSGKIPRWLGNLTVLRHIIMPKNH 719 T L L L+ N F G+IP +LS CS L L LS N LSG IP LG+L+ LR + + N Sbjct: 392 T-LQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNYLSGTIPSSLGSLSKLRDLKLWLNM 450 Query: 720 IEGPIPLEFCQLRILQILDISDNNISGSLPSCY-DFVCIEQVHLSKNMLHGQLKE--GTF 776 +EG IP E ++ L+ L + N+++G +PS + + + LS N L G++ + G Sbjct: 451 LEGEIPQELMYVKTLETLILDFNDLTGEIPSGLSNCTNLNWISLSNNRLTGEIPKWIGRL 510 Query: 777 FNCLTLMILDLSYNHLNGNIPDRVDGLSQLSYLILAHNNLEGEVPIXXXXXXXXXXXXXX 836 N L IL LS N +GNIP + L +L L N G +P Sbjct: 511 EN---LAILKLSNNSFSGNIPAELGDCRSLIWLDLNTNLFNGTIPAAMFKQSGKIAANFI 567 Query: 837 XXXXHGHIPS------CFDNTTL-------HERYNNGSSLQPFETSFVIMGGMDVDPKKQ 883 + +I + C L E+ N S+ P + + GG Sbjct: 568 AGKRYVYIKNDGMKKECHGAGNLLEFQGIRSEQLNRLSTRNPCNITSRVYGGH------- 620 Query: 884 ILESFDFTTKSITYTYQGRVPSLLSGLDLSCNRLIGHIPPQIGNLTKIQTLNLSHNNLAG 943 S T+ G + LD+S N L G+IP +IG++ + LNL HN+++G Sbjct: 621 ---------TSPTFDNNGS----MMFLDMSYNMLSGYIPKEIGSMPYLFILNLGHNDISG 667 Query: 944 PIPSTFSNLRNIESLDLSYNKLSWKIPYQLVELNTLAVFSVAYNNLSGKIPERAAQFATF 1003 IP +LR + LDLS NKL +IP + L L ++ NNLSG IPE QF TF Sbjct: 668 SIPDEVGDLRGLNILDLSSNKLDGRIPQAMSALTMLTEIDLSNNNLSGPIPE-MGQFETF 726 Query: 1004 NESSYEGNPFLCGPPLPIC 1022 + + NP LCG PLP C Sbjct: 727 PPAKFLNNPGLCGYPLPRC 745
>pdb|3RGX|A Chain A, Structural Insight Into Brassinosteroid Perception By Bri1 Length = 768 Back     alignment and structure
>pdb|1OGQ|A Chain A, The Crystal Structure Of Pgip (Polygalacturonase Inhibiting Protein), A Leucine Rich Repeat Protein Involved In Plant Defense Length = 313 Back     alignment and structure
>pdb|1OGQ|A Chain A, The Crystal Structure Of Pgip (Polygalacturonase Inhibiting Protein), A Leucine Rich Repeat Protein Involved In Plant Defense Length = 313 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query1102
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 1e-159
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 3e-83
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 8e-07
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 4e-78
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 8e-73
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 2e-54
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 5e-45
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 2e-13
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 6e-10
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 2e-66
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 8e-58
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 6e-55
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 3e-54
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 4e-46
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 2e-44
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 4e-63
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 1e-61
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 7e-61
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 6e-56
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 8e-56
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 2e-54
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 5e-62
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 5e-56
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 1e-51
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 7e-50
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 2e-41
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 1e-31
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 9e-61
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 2e-56
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 5e-53
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 9e-36
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 5e-60
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 4e-52
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 6e-45
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 4e-44
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 6e-42
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 1e-40
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 7e-57
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 1e-54
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 9e-49
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 3e-47
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 6e-46
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 2e-34
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 1e-33
3j0a_A844 TOLL-like receptor 5; membrane protein, leucine-ri 7e-50
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 2e-46
3j0a_A844 TOLL-like receptor 5; membrane protein, leucine-ri 7e-44
3j0a_A844 TOLL-like receptor 5; membrane protein, leucine-ri 6e-35
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 3e-44
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 5e-42
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 6e-41
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 1e-36
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 1e-33
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 9e-30
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 3e-14
1o6v_A466 Internalin A; bacterial infection, extracellular r 1e-40
1o6v_A466 Internalin A; bacterial infection, extracellular r 1e-38
1o6v_A466 Internalin A; bacterial infection, extracellular r 2e-37
1o6v_A466 Internalin A; bacterial infection, extracellular r 4e-37
1o6v_A466 Internalin A; bacterial infection, extracellular r 1e-36
1o6v_A466 Internalin A; bacterial infection, extracellular r 9e-36
1o6v_A466 Internalin A; bacterial infection, extracellular r 1e-34
1o6v_A 466 Internalin A; bacterial infection, extracellular r 2e-06
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 1e-39
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 4e-39
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 8e-39
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 5e-36
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 1e-35
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 2e-35
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 2e-35
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 8e-35
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 2e-34
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 4e-32
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 6e-11
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 2e-09
4fmz_A347 Internalin; leucine rich repeat, structural genomi 6e-39
4fmz_A347 Internalin; leucine rich repeat, structural genomi 5e-38
4fmz_A347 Internalin; leucine rich repeat, structural genomi 2e-33
4fmz_A347 Internalin; leucine rich repeat, structural genomi 3e-33
4fmz_A347 Internalin; leucine rich repeat, structural genomi 5e-33
4fmz_A347 Internalin; leucine rich repeat, structural genomi 6e-32
4fmz_A347 Internalin; leucine rich repeat, structural genomi 1e-30
4fmz_A347 Internalin; leucine rich repeat, structural genomi 2e-30
4fmz_A347 Internalin; leucine rich repeat, structural genomi 5e-30
4fmz_A347 Internalin; leucine rich repeat, structural genomi 2e-26
4fmz_A347 Internalin; leucine rich repeat, structural genomi 2e-25
4fmz_A347 Internalin; leucine rich repeat, structural genomi 6e-21
4fmz_A347 Internalin; leucine rich repeat, structural genomi 9e-09
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 1e-37
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 2e-29
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 5e-28
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 1e-26
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 2e-26
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 3e-25
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 3e-22
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 2e-16
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 1e-06
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 2e-32
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 2e-31
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 2e-30
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 1e-29
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 2e-29
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 3e-24
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 9e-23
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 3e-32
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 8e-32
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 4e-30
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 3e-29
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 2e-28
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 3e-28
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 9e-26
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 4e-25
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 2e-22
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 3e-31
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 1e-28
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 3e-28
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 3e-24
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 5e-23
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 1e-19
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 7e-29
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 2e-28
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 2e-28
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 5e-26
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 5e-23
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 1e-22
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 2e-21
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 7e-20
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 5e-17
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 3e-28
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 4e-27
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 1e-25
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 9e-24
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 1e-21
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 2e-20
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 9e-15
3o53_A 317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 7e-07
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 3e-27
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 3e-26
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 4e-24
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 1e-21
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 1e-19
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 2e-26
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 4e-26
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 6e-24
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 1e-23
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 3e-23
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 4e-23
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 2e-19
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 2e-18
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 1e-12
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 3e-04
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 3e-26
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 1e-24
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 2e-22
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 4e-20
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 3e-15
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 9e-15
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 4e-26
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 1e-24
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 2e-23
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 2e-22
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 7e-19
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 5e-15
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 4e-13
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 1e-12
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 5e-26
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 8e-26
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 2e-24
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 5e-24
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 1e-23
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 8e-20
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 2e-12
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 5e-10
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 5e-25
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 4e-24
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 2e-23
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 3e-21
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 4e-19
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 1e-18
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 7e-18
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 6e-15
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 4e-14
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 1e-13
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 1e-07
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 9e-06
2z66_A 306 Variable lymphocyte receptor B, TOLL-like recepto; 6e-05
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 6e-25
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 2e-24
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 2e-22
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 4e-20
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 3e-19
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 2e-17
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 1e-15
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 8e-14
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 2e-10
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 5e-07
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 1e-04
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 2e-24
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 2e-23
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 3e-22
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 3e-17
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 7e-17
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 8e-16
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 7e-10
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 9e-24
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 8e-21
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 2e-19
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 8e-19
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 2e-16
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 4e-14
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 6e-14
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 7e-11
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 9e-24
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 1e-23
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 2e-23
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 8e-12
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 2e-11
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 3e-11
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 4e-11
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 4e-10
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 1e-09
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 3e-08
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 2e-06
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 1e-23
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 2e-20
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 3e-20
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 3e-19
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 7e-18
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 7e-15
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 3e-14
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 8e-14
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 1e-07
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 1e-23
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 4e-21
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 5e-19
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 1e-18
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 5e-18
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 9e-15
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 7e-13
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 2e-09
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 4e-09
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 5e-09
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 2e-23
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 2e-23
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 4e-21
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 2e-18
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 1e-15
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 5e-14
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 2e-13
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 8e-13
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 3e-11
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 2e-09
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 4e-23
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 5e-23
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 5e-23
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 3e-22
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 1e-20
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 2e-19
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 3e-18
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 3e-15
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 4e-13
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 4e-23
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 2e-22
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 2e-20
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 2e-16
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 6e-16
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 1e-15
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 1e-13
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 2e-12
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 2e-22
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 5e-21
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 3e-20
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 3e-19
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 2e-17
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 5e-17
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 2e-16
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 6e-16
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 5e-14
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 7e-11
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 9e-08
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 6e-07
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 4e-05
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 4e-21
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 6e-21
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 2e-20
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 3e-20
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 8e-18
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 3e-17
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 3e-16
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 5e-14
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 2e-11
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 9e-10
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 2e-09
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 4e-06
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 8e-21
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 4e-20
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 2e-18
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 2e-18
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 5e-17
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 3e-11
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 7e-05
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 1e-20
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 2e-18
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 7e-16
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 3e-15
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 4e-15
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 1e-14
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 2e-14
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 6e-14
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 1e-13
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 8e-12
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 1e-04
4ezg_A197 Putative uncharacterized protein; internalin-A, le 3e-20
4ezg_A197 Putative uncharacterized protein; internalin-A, le 1e-15
4ezg_A197 Putative uncharacterized protein; internalin-A, le 6e-15
4ezg_A197 Putative uncharacterized protein; internalin-A, le 1e-13
4ezg_A197 Putative uncharacterized protein; internalin-A, le 3e-10
4ezg_A197 Putative uncharacterized protein; internalin-A, le 5e-09
4ezg_A197 Putative uncharacterized protein; internalin-A, le 4e-08
4ezg_A197 Putative uncharacterized protein; internalin-A, le 2e-07
4ezg_A197 Putative uncharacterized protein; internalin-A, le 3e-07
4ezg_A197 Putative uncharacterized protein; internalin-A, le 6e-07
4ezg_A197 Putative uncharacterized protein; internalin-A, le 3e-05
4ezg_A197 Putative uncharacterized protein; internalin-A, le 1e-04
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 5e-20
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 2e-17
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 2e-15
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 7e-15
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 4e-14
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 2e-13
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 3e-10
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 5e-19
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 5e-16
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 3e-15
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 4e-12
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 1e-11
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 7e-06
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 8e-06
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 4e-05
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 4e-05
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 3e-16
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 3e-15
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 6e-15
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 2e-14
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 3e-14
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 5e-13
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 6e-09
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 8e-08
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 2e-06
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 2e-05
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 1e-15
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 5e-15
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 6e-15
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 2e-10
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 1e-08
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 6e-08
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 5e-07
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 2e-06
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 9e-06
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 2e-05
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 2e-15
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 3e-14
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 2e-12
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 2e-11
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 3e-11
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 7e-11
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 1e-09
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 2e-08
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 4e-08
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 4e-08
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 4e-15
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 3e-13
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 1e-12
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 4e-12
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 2e-07
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 6e-06
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 1e-05
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 4e-05
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 7e-14
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 7e-13
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 1e-12
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 3e-11
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 1e-10
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 2e-10
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 2e-09
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 5e-09
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 2e-08
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 2e-08
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 1e-07
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 2e-06
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 4e-06
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 1e-13
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 2e-12
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 1e-11
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 3e-11
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 3e-09
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 1e-06
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 1e-04
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 2e-13
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 4e-13
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 1e-11
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 2e-11
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 5e-10
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 6e-10
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 4e-09
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 2e-07
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 9e-05
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 4e-13
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 2e-11
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 7e-11
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 8e-10
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 4e-09
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 4e-13
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 5e-11
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 6e-11
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 1e-05
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 2e-05
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 1e-04
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 8e-04
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 8e-04
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 4e-13
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 3e-12
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 7e-12
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 2e-10
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 6e-10
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 2e-08
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 2e-12
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 4e-12
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 1e-10
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 8e-09
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 3e-12
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 2e-05
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 3e-05
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 1e-04
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 5e-11
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 5e-11
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 1e-10
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 9e-10
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 1e-09
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 1e-08
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 3e-08
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 1e-07
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 1e-06
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 1e-04
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 3e-04
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 4e-04
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 2e-10
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 5e-10
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 3e-09
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 7e-09
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 4e-08
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 4e-08
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 3e-06
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 4e-06
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 1e-04
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 1e-04
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 2e-04
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 4e-10
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 1e-07
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 2e-07
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 2e-07
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 2e-07
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 4e-07
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 1e-06
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 2e-06
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 1e-05
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 2e-05
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 2e-05
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 3e-05
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 5e-10
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 9e-10
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 3e-05
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 6e-10
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 1e-09
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 7e-09
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 4e-08
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 8e-06
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 2e-05
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 4e-05
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 6e-05
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 8e-05
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 1e-04
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 2e-04
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 1e-09
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 4e-09
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 1e-08
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 2e-08
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 7e-07
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 8e-07
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 2e-04
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 2e-04
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 7e-04
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 2e-09
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 5e-08
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 1e-07
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 1e-06
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 1e-06
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 5e-04
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 6e-04
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 8e-04
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-09
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-08
1vt4_I1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-08
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 1e-08
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 2e-08
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 4e-08
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 1e-06
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 3e-06
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 4e-06
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 1e-05
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 2e-05
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 5e-05
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 3e-04
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 4e-04
3e6j_A229 Variable lymphocyte receptor diversity region; var 2e-07
3e6j_A229 Variable lymphocyte receptor diversity region; var 3e-05
3e6j_A229 Variable lymphocyte receptor diversity region; var 7e-05
3e6j_A229 Variable lymphocyte receptor diversity region; var 1e-04
3e6j_A229 Variable lymphocyte receptor diversity region; var 9e-04
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 5e-07
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 6e-05
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 1e-04
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 6e-04
3m19_A251 Variable lymphocyte receptor A diversity region; a 1e-06
3m19_A251 Variable lymphocyte receptor A diversity region; a 2e-06
3m19_A251 Variable lymphocyte receptor A diversity region; a 5e-05
3m19_A251 Variable lymphocyte receptor A diversity region; a 8e-05
3m19_A251 Variable lymphocyte receptor A diversity region; a 8e-05
3m19_A251 Variable lymphocyte receptor A diversity region; a 1e-04
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 1e-06
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 2e-05
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 4e-05
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 1e-06
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 8e-05
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 8e-05
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 3e-04
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 5e-06
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 8e-05
1w8a_A192 SLIT protein; signaling protein, secreted protein, 2e-05
1w8a_A192 SLIT protein; signaling protein, secreted protein, 2e-05
1w8a_A192 SLIT protein; signaling protein, secreted protein, 3e-05
1w8a_A192 SLIT protein; signaling protein, secreted protein, 9e-05
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
 Score =  491 bits (1266), Expect = e-159
 Identities = 208/784 (26%), Positives = 336/784 (42%), Gaps = 95/784 (12%)

Query: 282  LSYLHLLRVGIR-DGSKLLQSMGSFPSLNTLDLSYNNFTETVTTTTQGFPHFKSLKELYM 340
            ++ + L    +    S +  S+ S   L +L LS ++   +V+    GF    SL  L +
Sbjct: 52   VTSIDLSSKPLNVGFSAVSSSLLSLTGLESLFLSNSHINGSVS----GFKCSASLTSLDL 107

Query: 341  DDARIALNTSFLQIIGESMPSIQYLSLSNSSVSNNSRTLDQGLCPLVHLQELHMADNDLR 400
                ++   + L  +G S   +++L++S++++    +    G   L  L+ L ++ N + 
Sbjct: 108  SRNSLSGPVTTLTSLG-SCSGLKFLNVSSNTLDFPGKV--SGGLKLNSLEVLDLSANSIS 164

Query: 401  GSLPWCLA---NMTSLRILDVSSNQLIGSISSSPLIHLTSIEDLILSDNHFQIPISLEPL 457
            G+             L+ L +S N++ G +    +    ++E L +S N+F   I    L
Sbjct: 165  GANVVGWVLSDGCGELKHLAISGNKISGDV---DVSRCVNLEFLDVSSNNFSTGIPF--L 219

Query: 458  FNHSRLKIFDAENNEINAEIIESHSLTTPNFQLQSLLLSSGYRDGITFPKFLYNQHDLEY 517
             + S L+  D   N+++ +                              + +    +L+ 
Sbjct: 220  GDCSALQHLDISGNKLSGDF----------------------------SRAISTCTELKL 251

Query: 518  VRLSHIKMNEEFPNWLLENNTKLRQLSLVNDSLVGPFRLPI-HSHKQLRLLDVSKNNFQG 576
            + +S  +     P   L     L+ LSL  +   G     +  +   L  LD+S N+F G
Sbjct: 252  LNISSNQFVGPIPPLPL---KSLQYLSLAENKFTGEIPDFLSGACDTLTGLDLSGNHFYG 308

Query: 577  HIPLEIGDILSRLTVFNISMNALDGSIP-SSFGNMNFLQFLDLSNNQLTGEIPEHLAMGC 635
             +P   G   S L    +S N   G +P  +   M  L+ LDLS N+ +GE+PE L    
Sbjct: 309  AVPPFFGS-CSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLS 367

Query: 636  VSLRSLALSNNNLEGHMFSR--NFNLTNLIWLQLEGNHFVGEIPQSLSKCSSLQGLFLSN 693
             SL +L LS+NN  G +           L  L L+ N F G+IP +LS CS L  L LS 
Sbjct: 368  ASLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSF 427

Query: 694  NSLSGKIPRWLGNLTVLRHIIMPKNHIEGPIPLEFCQLRILQILDISDNNISGSLPSCYD 753
            N LSG IP  LG+L+ LR + +  N +EG IP E   ++ L+ L +  N+++G +PS   
Sbjct: 428  NYLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDLTGEIPSG-- 485

Query: 754  FVCIEQVHLSKNMLHGQLKEGTFFNCLTLMILDLSYNHLNGNIPDRVDGLSQLSYLILAH 813
                                    NC  L  + LS N L G IP  +  L  L+ L L++
Sbjct: 486  ----------------------LSNCTNLNWISLSNNRLTGEIPKWIGRLENLAILKLSN 523

Query: 814  NNLEGEVPIQLCRLNQLQLLDLSNNNLHGHIPSCFDNTTLHERYNNGSSLQPFE------ 867
            N+  G +P +L     L  LDL+ N  +G IP+     +     N  +  +         
Sbjct: 524  NSFSGNIPAELGDCRSLIWLDLNTNLFNGTIPAAMFKQSGKIAANFIAGKRYVYIKNDGM 583

Query: 868  TSFVIMGGMDVDPKKQILESFDFTTKSITY-----TYQGRVP------SLLSGLDLSCNR 916
                   G  ++ +    E  +  +           Y G           +  LD+S N 
Sbjct: 584  KKECHGAGNLLEFQGIRSEQLNRLSTRNPCNITSRVYGGHTSPTFDNNGSMMFLDMSYNM 643

Query: 917  LIGHIPPQIGNLTKIQTLNLSHNNLAGPIPSTFSNLRNIESLDLSYNKLSWKIPYQLVEL 976
            L G+IP +IG++  +  LNL HN+++G IP    +LR +  LDLS NKL  +IP  +  L
Sbjct: 644  LSGYIPKEIGSMPYLFILNLGHNDISGSIPDEVGDLRGLNILDLSSNKLDGRIPQAMSAL 703

Query: 977  NTLAVFSVAYNNLSGKIPERAAQFATFNESSYEGNPFLCGPPLPICISPTTMPEASPSNE 1036
              L    ++ NNLSG IPE   QF TF  + +  NP LCG PLP C  P+     +    
Sbjct: 704  TMLTEIDLSNNNLSGPIPEM-GQFETFPPAKFLNNPGLCGYPLPRC-DPSNADGYAHHQR 761

Query: 1037 GDNN 1040
              ++
Sbjct: 762  SHHH 765


>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Length = 372 Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Length = 372 Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Length = 372 Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Length = 372 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336 Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336 Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208 Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query1102
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 100.0
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 100.0
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 100.0
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 100.0
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 100.0
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 100.0
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 100.0
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 100.0
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 100.0
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 100.0
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 100.0
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 100.0
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 100.0
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 100.0
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 100.0
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 100.0
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 100.0
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 100.0
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 100.0
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 100.0
4g8a_A635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 100.0
4g8a_A635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 100.0
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 100.0
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 100.0
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 100.0
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 100.0
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 100.0
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 100.0
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 100.0
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 100.0
1o6v_A466 Internalin A; bacterial infection, extracellular r 100.0
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 100.0
1o6v_A466 Internalin A; bacterial infection, extracellular r 100.0
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 100.0
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 100.0
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 100.0
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 100.0
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 100.0
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 100.0
4fmz_A347 Internalin; leucine rich repeat, structural genomi 99.98
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 99.98
4fmz_A347 Internalin; leucine rich repeat, structural genomi 99.97
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.97
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.97
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.97
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.97
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.97
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.96
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.95
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.95
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.95
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.95
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.94
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 99.94
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 99.94
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 99.94
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.94
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 99.94
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.94
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.94
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.94
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.94
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.93
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.93
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.93
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.93
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 99.93
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.93
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.93
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 99.92
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 99.92
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.91
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.9
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.9
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.89
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 99.89
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.89
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.89
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.89
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.89
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.87
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.85
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.85
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.85
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.85
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.85
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.85
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.84
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.84
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.84
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.83
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.83
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.82
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.82
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.82
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.81
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 99.8
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.79
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 99.79
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.79
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.79
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.77
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.76
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 99.76
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.76
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 99.75
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.75
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.73
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.73
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.72
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.72
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.71
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.7
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.7
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.7
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.68
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.68
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.67
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 99.65
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.65
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 99.64
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.64
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.63
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.61
4fdw_A401 Leucine rich hypothetical protein; putative cell s 99.6
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.6
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.58
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.58
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.58
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.57
4fdw_A401 Leucine rich hypothetical protein; putative cell s 99.57
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.57
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.56
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.55
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 99.55
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 99.51
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.47
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.45
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.44
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.42
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.41
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.4
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.36
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.35
4gt6_A394 Cell surface protein; leucine rich repeats, putati 99.33
4gt6_A394 Cell surface protein; leucine rich repeats, putati 99.29
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 99.22
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 99.2
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 99.19
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 99.17
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 99.04
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 98.98
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.53
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 98.51
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 98.51
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.46
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 98.31
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 98.18
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 97.9
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 97.8
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 97.48
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 97.06
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 96.84
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 96.71
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
Probab=100.00  E-value=3.8e-88  Score=844.98  Aligned_cols=730  Identities=30%  Similarity=0.436  Sum_probs=491.8

Q ss_pred             cccccHHHHHHHHhhhhhccCCCCCCCCCCCCCCCCCCcCcCceEecCCCCcEEEEEcCCCCCCcccccccccCCCCCCC
Q 001313           24 SEGCLNHERFALLQLKLFFIDPYNYLLDWVDDEGATDCCQWERVSCNNTMGRVVVLDLSQTHRGEYWYLNASLFTPFQQL  103 (1102)
Q Consensus        24 ~~~c~~~~~~all~~k~~~~~~~~~l~~w~~~~~~~~cc~w~gv~c~~~~~~v~~L~L~~~~~~~~~~~~~~~~~~~~~L  103 (1102)
                      ++.+.++||+|||+||+++.||. .+++|+. +  +|||+|+||+|+  +|||++|||++....|....-++.|.++++|
T Consensus         6 ~~~~~~~~~~all~~k~~~~~~~-~l~~W~~-~--~~~C~w~gv~C~--~~~v~~L~L~~~~l~g~~~~l~~~l~~L~~L   79 (768)
T 3rgz_A            6 PSQSLYREIHQLISFKDVLPDKN-LLPDWSS-N--KNPCTFDGVTCR--DDKVTSIDLSSKPLNVGFSAVSSSLLSLTGL   79 (768)
T ss_dssp             --CCHHHHHHHHHHHHTTCSCTT-SSTTCCT-T--SCGGGSTTEEEE--TTEEEEEECTTSCCCEEHHHHHHHTTTCTTC
T ss_pred             cccCCHHHHHHHHHHHhhCCCcc-cccCCCC-C--CCCcCCcceEEC--CCcEEEEECCCCCcCCccCccChhHhccCcc
Confidence            45558899999999999999998 9999974 3  799999999998  7999999999987766532223556778888


Q ss_pred             CEEeCCCCCCCCcccchhhhhhcCCCCCcEEeCCCCcCCcchhH--hhhcCCCcCEEEcCCCcccCCCChhhhccCCCCc
Q 001313          104 ESLDLRDNDIAGCVENEGLERLSRLSNLKMLNLVGNLFNNSILS--SLARLSSLTSLDLSANRLKGSIDIKELDSLRDLE  181 (1102)
Q Consensus       104 ~~L~Ls~~~~~~~~~~~~~~~l~~l~~L~~L~Ls~n~~~~~~~~--~l~~l~~L~~L~Ls~n~l~~~~~~~~l~~l~~L~  181 (1102)
                      +.++++.+.+...+     ..++++++||+|+|++|.+.+.+|.  .++++++|++||+++|.+.+.++...+.++++|+
T Consensus        80 ~~l~~~~~~~~~l~-----~~~~~l~~L~~L~Ls~n~l~~~~~~~~~l~~l~~L~~L~Ls~n~l~~~~~~~~~~~l~~L~  154 (768)
T 3rgz_A           80 ESLFLSNSHINGSV-----SGFKCSASLTSLDLSRNSLSGPVTTLTSLGSCSGLKFLNVSSNTLDFPGKVSGGLKLNSLE  154 (768)
T ss_dssp             CEEECTTSCEEECC-----CCCCCCTTCCEEECCSSEEEEEGGGGGGGGGCTTCCEEECCSSEEECCSSCCSCCCCTTCS
T ss_pred             cccCCcCCCcCCCc-----hhhccCCCCCEEECCCCcCCCcCCChHHHhCCCCCCEEECcCCccCCcCCHHHhccCCCCC
Confidence            88888877654322     2467788888888888888777777  7888888888888888777655443335666666


Q ss_pred             EEEcCCCcCCcccccCCccc---cCCCCCcCEEEcCCCcCChhhhHhhhccCCCcEEEccCCcCCCCCchhhccCCCCCc
Q 001313          182 KLNIGRNMIDKFVVSKGPKR---LSRLNNLKVFDLSGNLFNNSILSSLARLSSLRSLLLYDNRLEGSIDVKEFDSLSNLE  258 (1102)
Q Consensus       182 ~L~Ls~n~~~~~~~~~~~~~---l~~l~~L~~L~Ls~n~l~~~~~~~l~~l~~L~~L~L~~n~l~~~~~~~~l~~l~~L~  258 (1102)
                      +|++++|.+++..+    ..   +.++++|++|++++|.+++..+.  ..+++|++|++++|.+.+.++.  ++++++|+
T Consensus       155 ~L~Ls~n~l~~~~~----~~~~~~~~l~~L~~L~Ls~n~l~~~~~~--~~l~~L~~L~Ls~n~l~~~~~~--l~~l~~L~  226 (768)
T 3rgz_A          155 VLDLSANSISGANV----VGWVLSDGCGELKHLAISGNKISGDVDV--SRCVNLEFLDVSSNNFSTGIPF--LGDCSALQ  226 (768)
T ss_dssp             EEECCSSCCEEETH----HHHHHTTCCTTCCEEECCSSEEESCCBC--TTCTTCCEEECCSSCCCSCCCB--CTTCCSCC
T ss_pred             EEECCCCccCCcCC----hhhhhhccCCCCCEEECCCCcccccCCc--ccCCcCCEEECcCCcCCCCCcc--cccCCCCC
Confidence            66666666655433    22   45566666666666655543332  5555566666665555544442  55555555


Q ss_pred             EEecccCccCCcchhhhhccccccceeccccccccCchhhhhhcCCCCCCCEEeCCCCCcccccccccccccccccccee
Q 001313          259 ELDMSYNEIDNFEVPQACSGLRKLSYLHLLRVGIRDGSKLLQSMGSFPSLNTLDLSYNNFTETVTTTTQGFPHFKSLKEL  338 (1102)
Q Consensus       259 ~L~L~~n~l~~~~~~~~~~~l~~L~~L~l~~~~~~~~~~~~~~l~~l~~L~~L~Ls~n~~~~~~~~~~~~~~~l~~L~~L  338 (1102)
                      +|++++|.+++.                           .+..++.                                  
T Consensus       227 ~L~Ls~n~l~~~---------------------------~~~~l~~----------------------------------  245 (768)
T 3rgz_A          227 HLDISGNKLSGD---------------------------FSRAIST----------------------------------  245 (768)
T ss_dssp             EEECCSSCCCSC---------------------------HHHHTTT----------------------------------
T ss_pred             EEECcCCcCCCc---------------------------ccHHHhc----------------------------------
Confidence            555555554421                           1222333                                  


Q ss_pred             ecccchhhhchhhHHHhhccCCCCcEEecccCcCcCCcccccCCccCCCCccEEEcCCCcCCCCcchhccCC-CCCcEEE
Q 001313          339 YMDDARIALNTSFLQIIGESMPSIQYLSLSNSSVSNNSRTLDQGLCPLVHLQELHMADNDLRGSLPWCLANM-TSLRILD  417 (1102)
Q Consensus       339 ~l~~~~~~~~~~~~~~~~~~l~~L~~L~L~~~~~~~~~~~~~~~l~~l~~L~~L~L~~n~l~~~~p~~l~~l-~~L~~L~  417 (1102)
                                          +++|++|++++|.+.+..|.   .  .+++|++|++++|.+++.+|..+... ++|++|+
T Consensus       246 --------------------l~~L~~L~Ls~n~l~~~~~~---~--~l~~L~~L~L~~n~l~~~ip~~~~~~~~~L~~L~  300 (768)
T 3rgz_A          246 --------------------CTELKLLNISSNQFVGPIPP---L--PLKSLQYLSLAENKFTGEIPDFLSGACDTLTGLD  300 (768)
T ss_dssp             --------------------CSSCCEEECCSSCCEESCCC---C--CCTTCCEEECCSSEEEESCCCCSCTTCTTCSEEE
T ss_pred             --------------------CCCCCEEECCCCcccCccCc---c--ccCCCCEEECcCCccCCccCHHHHhhcCcCCEEE
Confidence                                34444444444444433332   1  34455555555555554444444443 5555555


Q ss_pred             cCCCccccccCCcccccCCccCeeecCCcccccccCccccccCCcceEEecCCCccchhhhccccCCCCcccceeeeecc
Q 001313          418 VSSNQLIGSISSSPLIHLTSIEDLILSDNHFQIPISLEPLFNHSRLKIFDAENNEINAEIIESHSLTTPNFQLQSLLLSS  497 (1102)
Q Consensus       418 Ls~n~l~~~i~~~~l~~l~~L~~L~L~~n~l~~~~~~~~l~~l~~L~~L~l~~n~l~~~~~~~~~~~~~~~~l~~l~l~~  497 (1102)
                      +++|.+.+.+ +..+.++++|++|++++|.+.+.++...                                         
T Consensus       301 Ls~n~l~~~~-p~~~~~l~~L~~L~L~~n~l~~~ip~~~-----------------------------------------  338 (768)
T 3rgz_A          301 LSGNHFYGAV-PPFFGSCSLLESLALSSNNFSGELPMDT-----------------------------------------  338 (768)
T ss_dssp             CCSSEEEECC-CGGGGGCTTCCEEECCSSEEEEECCHHH-----------------------------------------
T ss_pred             CcCCcCCCcc-chHHhcCCCccEEECCCCcccCcCCHHH-----------------------------------------
Confidence            5555554433 3444444444444444444433322221                                         


Q ss_pred             CCCCCCccCccccCCCcccEEEeccccCCCCCChhhhhcCCCCcEEEccCCCCcCCCcCCCCCCC-CcCEEEccCCcCCC
Q 001313          498 GYRDGITFPKFLYNQHDLEYVRLSHIKMNEEFPNWLLENNTKLRQLSLVNDSLVGPFRLPIHSHK-QLRLLDVSKNNFQG  576 (1102)
Q Consensus       498 ~~~~~~~~p~~l~~~~~L~~L~ls~~~~~~~~p~~~~~~~~~L~~L~L~~n~l~~~~~~~~~~~~-~L~~L~ls~n~l~~  576 (1102)
                                                          +..+++|++|++++|.+.+..+..+..++ +|++|++++|.+++
T Consensus       339 ------------------------------------l~~l~~L~~L~Ls~n~l~~~~p~~l~~l~~~L~~L~Ls~N~l~~  382 (768)
T 3rgz_A          339 ------------------------------------LLKMRGLKVLDLSFNEFSGELPESLTNLSASLLTLDLSSNNFSG  382 (768)
T ss_dssp             ------------------------------------HTTCTTCCEEECCSSEEEECCCTTHHHHTTTCSEEECCSSEEEE
T ss_pred             ------------------------------------HhcCCCCCEEeCcCCccCccccHHHHhhhcCCcEEEccCCCcCC
Confidence                                                22223333333333333322222233333 56777777777777


Q ss_pred             CCCchhhhc-CCCCcEEEccCCcccccCCcccCCCCCCcEEEccCcccccccchhHhhcCCCCcEEEccccccCCccccc
Q 001313          577 HIPLEIGDI-LSRLTVFNISMNALDGSIPSSFGNMNFLQFLDLSNNQLTGEIPEHLAMGCVSLRSLALSNNNLEGHMFSR  655 (1102)
Q Consensus       577 ~ip~~~~~~-l~~L~~L~Ls~n~l~~~~~~~~~~l~~L~~L~Ls~n~l~~~ip~~~~~~l~~L~~L~L~~n~l~~~~~~~  655 (1102)
                      .+|..++.. +++|++|++++|++++.+|..|.++++|++|++++|++++.+|..+ ..+++|++|++++|.+++.+|..
T Consensus       383 ~~~~~~~~~~~~~L~~L~L~~n~l~~~~p~~l~~l~~L~~L~Ls~N~l~~~~p~~l-~~l~~L~~L~L~~n~l~~~~p~~  461 (768)
T 3rgz_A          383 PILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNYLSGTIPSSL-GSLSKLRDLKLWLNMLEGEIPQE  461 (768)
T ss_dssp             ECCTTTTCSTTCCCCEEECCSSEEEEECCGGGGGCTTCCEEECCSSEEESCCCGGG-GGCTTCCEEECCSSCCCSCCCGG
T ss_pred             CcChhhhhcccCCccEEECCCCccccccCHHHhcCCCCCEEECcCCcccCcccHHH-hcCCCCCEEECCCCcccCcCCHH
Confidence            666665432 4667777777777777777777777777777777777776666655 46777777777777777777777


Q ss_pred             ccCCCccCeeeccCccCcccCCCCcCCCCCCcEEEccCCcCCCCCCccccCCCCccEEECCCCcccCCCcccccCCCccc
Q 001313          656 NFNLTNLIWLQLEGNHFVGEIPQSLSKCSSLQGLFLSNNSLSGKIPRWLGNLTVLRHIIMPKNHIEGPIPLEFCQLRILQ  735 (1102)
Q Consensus       656 ~~~l~~L~~L~L~~n~l~~~~~~~~~~l~~L~~L~l~~n~l~~~~p~~~~~l~~L~~L~l~~n~l~~~~~~~~~~l~~L~  735 (1102)
                      +..+++|++|++++|++++.+|..+..+++|++|++++|++++.+|.+++.+++|++|++++|++++.+|..+..+++|+
T Consensus       462 ~~~l~~L~~L~L~~N~l~~~~p~~l~~l~~L~~L~L~~N~l~~~~p~~~~~l~~L~~L~L~~N~l~~~~p~~l~~l~~L~  541 (768)
T 3rgz_A          462 LMYVKTLETLILDFNDLTGEIPSGLSNCTNLNWISLSNNRLTGEIPKWIGRLENLAILKLSNNSFSGNIPAELGDCRSLI  541 (768)
T ss_dssp             GGGCTTCCEEECCSSCCCSCCCGGGGGCTTCCEEECCSSCCCSCCCGGGGGCTTCCEEECCSSCCEEECCGGGGGCTTCC
T ss_pred             HcCCCCceEEEecCCcccCcCCHHHhcCCCCCEEEccCCccCCcCChHHhcCCCCCEEECCCCcccCcCCHHHcCCCCCC
Confidence            77777777777777777777777777777777777777777777777777777777777777777777777777777777


Q ss_pred             EEEccCcccccCCCCCCCCccccEEEccCcccccccCcccccCccCccE---------EEccCccCcccCCccccCCCCC
Q 001313          736 ILDISDNNISGSLPSCYDFVCIEQVHLSKNMLHGQLKEGTFFNCLTLMI---------LDLSYNHLNGNIPDRVDGLSQL  806 (1102)
Q Consensus       736 ~L~ls~n~l~~~~p~~~~~~~L~~L~l~~n~l~~~i~~~~~~~~~~L~~---------L~Ls~n~l~~~~p~~~~~l~~L  806 (1102)
                      .|++++|+++|.+|..+                        ..+..+..         ..+.++...        .....
T Consensus       542 ~L~Ls~N~l~g~ip~~~------------------------~~~~~~~~~~~~~~~~~~~~~~~~~~--------~~~~~  589 (768)
T 3rgz_A          542 WLDLNTNLFNGTIPAAM------------------------FKQSGKIAANFIAGKRYVYIKNDGMK--------KECHG  589 (768)
T ss_dssp             EEECCSSEEESBCCGGG------------------------GTTTTCBCCSTTCSCEEEEEECCSCC--------TTCCS
T ss_pred             EEECCCCccCCcCChHH------------------------hcccchhhhhcccccccccccccccc--------ccccc
Confidence            77777777666555432                        22222222         222222111        00011


Q ss_pred             CEEEccCccccccCchhhcCCCCCCEEECcCccCCCCCCcccccccccccccCCCCCCCccchhhhcCCccCCccccccc
Q 001313          807 SYLILAHNNLEGEVPIQLCRLNQLQLLDLSNNNLHGHIPSCFDNTTLHERYNNGSSLQPFETSFVIMGGMDVDPKKQILE  886 (1102)
Q Consensus       807 ~~L~L~~N~l~~~~p~~~~~l~~L~~L~Ls~N~l~~~~p~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  886 (1102)
                      ....   -.+.+..+..+..++.++.++++.|.++|.+|..+++++                                  
T Consensus       590 ~~~~---~~~~~~~~~~~~~l~~~~~~~l~~~~~~g~~~~~~~~l~----------------------------------  632 (768)
T 3rgz_A          590 AGNL---LEFQGIRSEQLNRLSTRNPCNITSRVYGGHTSPTFDNNG----------------------------------  632 (768)
T ss_dssp             SEEE---EECTTCCGGGGGGGGGTCCSCTTSCEEEEECCCSCSSSB----------------------------------
T ss_pred             cccc---cccccccchhhhccccccccccccceecccCchhhhccc----------------------------------
Confidence            1111   134567777888888888899999999999988876654                                  


Q ss_pred             eeeeeccceeeeccCCcCCCCceEECCCCCCCCCCcccccCCCcCCEEECCCCCCCCCCcccccCCCcCCEEeCCCCcCc
Q 001313          887 SFDFTTKSITYTYQGRVPSLLSGLDLSCNRLIGHIPPQIGNLTKIQTLNLSHNNLAGPIPSTFSNLRNIESLDLSYNKLS  966 (1102)
Q Consensus       887 ~~~~~~~~~~~~~~~~~~~~L~~L~Ls~N~l~~~ip~~~~~l~~L~~L~Ls~N~l~~~~p~~~~~l~~L~~L~Ls~N~l~  966 (1102)
                                         .|+.|||++|+++|.+|.+|+++++|+.|||++|+++|.+|..|+++++|++||||+|+++
T Consensus       633 -------------------~L~~LdLs~N~l~g~ip~~l~~l~~L~~L~Ls~N~l~g~ip~~l~~L~~L~~LdLs~N~l~  693 (768)
T 3rgz_A          633 -------------------SMMFLDMSYNMLSGYIPKEIGSMPYLFILNLGHNDISGSIPDEVGDLRGLNILDLSSNKLD  693 (768)
T ss_dssp             -------------------CCCEEECCSSCCBSCCCGGGGGCTTCCEEECCSSCCCSCCCGGGGGCTTCCEEECCSSCCE
T ss_pred             -------------------cccEEECcCCcccccCCHHHhccccCCEEeCcCCccCCCCChHHhCCCCCCEEECCCCccc
Confidence                               6899999999999999999999999999999999999999999999999999999999999


Q ss_pred             ccCchhhhcCCCCCEEEcccCcCcccCCccccccCCCCccccCCCCCCCCCCCCCCCCCCC
Q 001313          967 WKIPYQLVELNTLAVFSVAYNNLSGKIPERAAQFATFNESSYEGNPFLCGPPLPICISPTT 1027 (1102)
Q Consensus       967 ~~~p~~l~~l~~L~~l~ls~N~l~~~~p~~~~~~~~~~~~~~~gN~~lC~~~~~~~c~~~~ 1027 (1102)
                      |.+|..+.++++|++||+++|+++|.||. .++|.+|...+|.|||++||.|+. .|.+..
T Consensus       694 g~ip~~l~~l~~L~~L~ls~N~l~g~iP~-~~~~~~~~~~~~~gN~~Lcg~~l~-~C~~~~  752 (768)
T 3rgz_A          694 GRIPQAMSALTMLTEIDLSNNNLSGPIPE-MGQFETFPPAKFLNNPGLCGYPLP-RCDPSN  752 (768)
T ss_dssp             ECCCGGGGGCCCCSEEECCSSEEEEECCS-SSSGGGSCGGGGCSCTEEESTTSC-CCCSCC
T ss_pred             CcCChHHhCCCCCCEEECcCCcccccCCC-chhhccCCHHHhcCCchhcCCCCc-CCCCCc
Confidence            99999999999999999999999999999 789999999999999999999987 665443



>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 1102
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 6e-19
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 2e-18
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 7e-14
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 2e-13
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 2e-13
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 1e-10
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 1e-09
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 2e-09
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 1e-05
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 9e-19
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 1e-14
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 4e-11
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 9e-09
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 3e-07
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 1e-06
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 6e-04
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 9e-18
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 4e-13
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 1e-08
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 4e-08
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 4e-04
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 5e-04
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 2e-17
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 1e-16
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 6e-12
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 4e-10
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 4e-09
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 8e-05
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 1e-04
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 1e-04
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 0.003
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 2e-11
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 3e-11
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 5e-08
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 3e-06
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 1e-05
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 4e-05
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 9e-05
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 2e-04
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 8e-04
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 2e-09
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 3e-08
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 5e-08
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 1e-06
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 4e-04
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 0.002
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 2e-09
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 1e-07
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 2e-05
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 2e-05
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 3e-05
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 6e-05
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 8e-04
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 8e-04
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 9e-04
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 0.004
d1h6ta2210 c.10.2.1 (A:31-240) Internalin B {Listeria monocyt 1e-07
d1h6ta2210 c.10.2.1 (A:31-240) Internalin B {Listeria monocyt 4e-06
d1h6ta2210 c.10.2.1 (A:31-240) Internalin B {Listeria monocyt 4e-04
d1h6ta2210 c.10.2.1 (A:31-240) Internalin B {Listeria monocyt 8e-04
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 3e-07
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 4e-07
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 4e-05
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 5e-05
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 6e-05
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 6e-04
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 6e-07
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 2e-06
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 9e-05
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 2e-04
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 2e-04
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 7e-04
d1a9na_162 c.10.2.4 (A:) Splicesomal U2A' protein {Human (Hom 8e-07
d1a9na_162 c.10.2.4 (A:) Splicesomal U2A' protein {Human (Hom 6e-05
d2ca6a1344 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom 2e-06
d2ca6a1344 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom 6e-04
d2ca6a1344 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom 0.004
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 2e-06
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 5e-05
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 5e-05
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 1e-04
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 3e-04
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 5e-04
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 0.002
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 0.002
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 0.002
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 0.003
d2ifga3156 c.10.2.7 (A:36-191) High affinity nerve growth fac 4e-06
d2ifga3156 c.10.2.7 (A:36-191) High affinity nerve growth fac 4e-05
d2ifga3156 c.10.2.7 (A:36-191) High affinity nerve growth fac 2e-04
d1w8aa_192 c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanoga 7e-06
d1w8aa_192 c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanoga 8e-05
d1w8aa_192 c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanoga 7e-04
d2omxa2199 c.10.2.1 (A:37-235) Internalin B {Listeria monocyt 7e-05
d2omxa2199 c.10.2.1 (A:37-235) Internalin B {Listeria monocyt 0.003
d2omxa2199 c.10.2.1 (A:37-235) Internalin B {Listeria monocyt 0.003
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 4e-04
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 5e-04
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 6e-04
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 0.001
d1koha1162 c.10.2.3 (A:201-362) mRNA export factor tap {Human 4e-04
d1m9la_198 c.10.3.1 (A:) Outer arm dynein light chain 1 {Gree 0.002
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Internalin LRR domain
domain: Internalin A
species: Listeria monocytogenes [TaxId: 1639]
 Score = 88.1 bits (217), Expect = 6e-19
 Identities = 59/385 (15%), Positives = 113/385 (29%), Gaps = 41/385 (10%)

Query: 616 LDLSNNQLTGEIPEHLAMGCVSLRSLALSNNNLEGHMFSRNFNLTNLIWLQLEGNHFVGE 675
             L    +T  + +        + +L      ++         L NL  +    N     
Sbjct: 27  TVLGKTNVTDTVSQ---TDLDQVTTLQADRLGIKS--IDGVEYLNNLTQINFSNNQLTDI 81

Query: 676 IPQSLSKCSSLQGLFLSNNSLSGKIPRWLGNLTVLRHIIMPKNHIEGPIPLEFCQLRILQ 735
            P  L   + L  + ++NN ++   P           +   +     P+       R+  
Sbjct: 82  TP--LKNLTKLVDILMNNNQIADITPLANLTNLTGLTLFNNQITDIDPLKNLTNLNRLEL 139

Query: 736 ILDISDNNISGSLPSCYDFVCIEQVHLSKNMLHG-------------QLKEGTFFNCLTL 782
             +   +  + S  +    +           L                           L
Sbjct: 140 SSNTISDISALSGLTSLQQLSFGNQVTDLKPLANLTTLERLDISSNKVSDISVLAKLTNL 199

Query: 783 MILDLSYNHLNGNIPDRVDGLSQLSYLILAHNNLEGEVPIQLCRLNQLQLLDLSNNNLHG 842
             L  + N ++   P  +   + L  L L  N L+      L  L  L  LDL+NN +  
Sbjct: 200 ESLIATNNQISDITPLGIL--TNLDELSLNGNQLKD--IGTLASLTNLTDLDLANNQISN 255

Query: 843 HIPSCFDNTTLHERYNNGSSLQPFETSFVIMGGMDVDPKKQILESFDFTTKSITYTYQGR 902
             P               + L   +     +  +        L + +     +       
Sbjct: 256 LAPLS-----------GLTKLTELKLGANQISNISPLAGLTALTNLELNENQLEDISPIS 304

Query: 903 VPSLLSGLDLSCNRLIGHIPPQIGNLTKIQTLNLSHNNLAGPIPSTFSNLRNIESLDLSY 962
               L+ L L  N +    P  + +LTK+Q L  ++N ++    S+ +NL NI  L   +
Sbjct: 305 NLKNLTYLTLYFNNISDISP--VSSLTKLQRLFFANNKVSDV--SSLANLTNINWLSAGH 360

Query: 963 NKLSWKIPYQLVELNTLAVFSVAYN 987
           N++S   P  L  L  +    +   
Sbjct: 361 NQISDLTP--LANLTRITQLGLNDQ 383


>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 210 Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 210 Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 210 Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 210 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344 Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344 Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 192 Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 192 Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 192 Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 199 Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 199 Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 199 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Length = 198 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query1102
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 100.0
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.97
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.95
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.93
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.92
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.91
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.9
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.9
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.87
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.86
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.78
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.75
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.71
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 99.71
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.7
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.69
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.69
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 99.67
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.67
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.67
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.64
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.61
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.6
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.59
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.51
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.51
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.39
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 99.37
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.37
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 99.37
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.35
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.35
d2ifga3156 High affinity nerve growth factor receptor, N-term 99.2
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.16
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.06
d2ifga3156 High affinity nerve growth factor receptor, N-term 99.02
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 98.09
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 98.05
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 97.9
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 97.65
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 97.52
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 97.09
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Polygalacturonase inhibiting protein PGIP
domain: Polygalacturonase inhibiting protein PGIP
species: Kidney bean (Phaseolus vulgaris) [TaxId: 3885]
Probab=100.00  E-value=1.8e-35  Score=325.92  Aligned_cols=297  Identities=27%  Similarity=0.378  Sum_probs=199.2

Q ss_pred             cccHHHHHHHHhhhhhccCCCCCCCCCCCCCCCCCCcC--cCceEecCCC--CcEEEEEcCCCCCCcccccccccCCCCC
Q 001313           26 GCLNHERFALLQLKLFFIDPYNYLLDWVDDEGATDCCQ--WERVSCNNTM--GRVVVLDLSQTHRGEYWYLNASLFTPFQ  101 (1102)
Q Consensus        26 ~c~~~~~~all~~k~~~~~~~~~l~~w~~~~~~~~cc~--w~gv~c~~~~--~~v~~L~L~~~~~~~~~~~~~~~~~~~~  101 (1102)
                      .|+++||+||++||+++.||. .+++|.. +  +|||.  |+||+|+..+  +||++|||+++...|...+.        
T Consensus         2 ~c~~~e~~aLl~~k~~~~~~~-~l~sW~~-~--~d~C~~~w~gv~C~~~~~~~~v~~L~L~~~~l~g~~~lp--------   69 (313)
T d1ogqa_           2 LCNPQDKQALLQIKKDLGNPT-TLSSWLP-T--TDCCNRTWLGVLCDTDTQTYRVNNLDLSGLNLPKPYPIP--------   69 (313)
T ss_dssp             CSCHHHHHHHHHHHHHTTCCG-GGTTCCT-T--SCTTTTCSTTEEECCSSSCCCEEEEEEECCCCSSCEECC--------
T ss_pred             CCCHHHHHHHHHHHHHCCCCC-cCCCCCC-C--CCCCCCcCCCeEEeCCCCcEEEEEEECCCCCCCCCCCCC--------
Confidence            699999999999999998875 7999975 3  79995  9999999643  48999999887555432111        


Q ss_pred             CCCEEeCCCCCCCCcccchhhhhhcCCCCCcEEeCCC-CcCCcchhHhhhcCCCcCEEEcCCCcccCCCChhhhccCCCC
Q 001313          102 QLESLDLRDNDIAGCVENEGLERLSRLSNLKMLNLVG-NLFNNSILSSLARLSSLTSLDLSANRLKGSIDIKELDSLRDL  180 (1102)
Q Consensus       102 ~L~~L~Ls~~~~~~~~~~~~~~~l~~l~~L~~L~Ls~-n~~~~~~~~~l~~l~~L~~L~Ls~n~l~~~~~~~~l~~l~~L  180 (1102)
                                           +.++++++||+|+|++ |.+.|.+|++|+++++|++|+|++|++.+. .+..+..+.+|
T Consensus        70 ---------------------~~l~~L~~L~~L~Ls~~N~l~g~iP~~i~~L~~L~~L~Ls~N~l~~~-~~~~~~~~~~L  127 (313)
T d1ogqa_          70 ---------------------SSLANLPYLNFLYIGGINNLVGPIPPAIAKLTQLHYLYITHTNVSGA-IPDFLSQIKTL  127 (313)
T ss_dssp             ---------------------GGGGGCTTCSEEEEEEETTEESCCCGGGGGCTTCSEEEEEEECCEEE-CCGGGGGCTTC
T ss_pred             ---------------------hHHhcCccccccccccccccccccccccccccccchhhhcccccccc-ccccccchhhh
Confidence                                 2455666666666665 566666777777777777777777776653 33455566666


Q ss_pred             cEEEcCCCcCCcccccCCccccCCCCCcCEEEcCCCcCChhhhHhhhccCCC-cEEEccCCcCCCCCchhhccCCCCCcE
Q 001313          181 EKLNIGRNMIDKFVVSKGPKRLSRLNNLKVFDLSGNLFNNSILSSLARLSSL-RSLLLYDNRLEGSIDVKEFDSLSNLEE  259 (1102)
Q Consensus       181 ~~L~Ls~n~~~~~~~~~~~~~l~~l~~L~~L~Ls~n~l~~~~~~~l~~l~~L-~~L~L~~n~l~~~~~~~~l~~l~~L~~  259 (1102)
                      +++++++|.+.+..+    ..++++++|+++++++|.+.+.+|..+..+.++ +.++++.|++++..+. .+..+..+ +
T Consensus       128 ~~l~l~~N~~~~~~p----~~l~~l~~L~~l~l~~n~l~~~ip~~~~~l~~l~~~l~~~~n~l~~~~~~-~~~~l~~~-~  201 (313)
T d1ogqa_         128 VTLDFSYNALSGTLP----PSISSLPNLVGITFDGNRISGAIPDSYGSFSKLFTSMTISRNRLTGKIPP-TFANLNLA-F  201 (313)
T ss_dssp             CEEECCSSEEESCCC----GGGGGCTTCCEEECCSSCCEEECCGGGGCCCTTCCEEECCSSEEEEECCG-GGGGCCCS-E
T ss_pred             cccccccccccccCc----hhhccCcccceeeccccccccccccccccccccccccccccccccccccc-cccccccc-c
Confidence            666666665554433    455666666666666666665556555555554 5555666655543332 33333222 3


Q ss_pred             EecccCccCCcchhhhhccccccceeccccccccCchhhhhhcCCCCCCCEEeCCCCCccccccccccccccccccceee
Q 001313          260 LDMSYNEIDNFEVPQACSGLRKLSYLHLLRVGIRDGSKLLQSMGSFPSLNTLDLSYNNFTETVTTTTQGFPHFKSLKELY  339 (1102)
Q Consensus       260 L~L~~n~l~~~~~~~~~~~l~~L~~L~l~~~~~~~~~~~~~~l~~l~~L~~L~Ls~n~~~~~~~~~~~~~~~l~~L~~L~  339 (1102)
                      ++++.+...+                                                                      
T Consensus       202 l~l~~~~~~~----------------------------------------------------------------------  211 (313)
T d1ogqa_         202 VDLSRNMLEG----------------------------------------------------------------------  211 (313)
T ss_dssp             EECCSSEEEE----------------------------------------------------------------------
T ss_pred             cccccccccc----------------------------------------------------------------------
Confidence            4444333221                                                                      


Q ss_pred             cccchhhhchhhHHHhhccCCCCcEEecccCcCcCCcccccCCccCCCCccEEEcCCCcCCCCcchhccCCCCCcEEEcC
Q 001313          340 MDDARIALNTSFLQIIGESMPSIQYLSLSNSSVSNNSRTLDQGLCPLVHLQELHMADNDLRGSLPWCLANMTSLRILDVS  419 (1102)
Q Consensus       340 l~~~~~~~~~~~~~~~~~~l~~L~~L~L~~~~~~~~~~~~~~~l~~l~~L~~L~L~~n~l~~~~p~~l~~l~~L~~L~Ls  419 (1102)
                                .++..... +++++.++++++.+.+.++    .+..+++|+.|+|++|++++.+|..++++++|++|+++
T Consensus       212 ----------~~~~~~~~-~~~l~~l~~~~~~l~~~~~----~~~~~~~L~~L~Ls~N~l~g~iP~~l~~L~~L~~L~Ls  276 (313)
T d1ogqa_         212 ----------DASVLFGS-DKNTQKIHLAKNSLAFDLG----KVGLSKNLNGLDLRNNRIYGTLPQGLTQLKFLHSLNVS  276 (313)
T ss_dssp             ----------CCGGGCCT-TSCCSEEECCSSEECCBGG----GCCCCTTCCEEECCSSCCEECCCGGGGGCTTCCEEECC
T ss_pred             ----------cccccccc-ccccccccccccccccccc----ccccccccccccCccCeecccCChHHhCCCCCCEEECc
Confidence                      11111112 5667777777777666544    35667889999999999998899999999999999999


Q ss_pred             CCccccccCCcccccCCccCeeecCCcccc
Q 001313          420 SNQLIGSISSSPLIHLTSIEDLILSDNHFQ  449 (1102)
Q Consensus       420 ~n~l~~~i~~~~l~~l~~L~~L~L~~n~l~  449 (1102)
                      +|+++|.+|  .+.++++|+.+++++|+..
T Consensus       277 ~N~l~g~iP--~~~~L~~L~~l~l~~N~~l  304 (313)
T d1ogqa_         277 FNNLCGEIP--QGGNLQRFDVSAYANNKCL  304 (313)
T ss_dssp             SSEEEEECC--CSTTGGGSCGGGTCSSSEE
T ss_pred             CCcccccCC--CcccCCCCCHHHhCCCccc
Confidence            999998874  3577888888989888743



>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure