Citrus Sinensis ID: 001324

Local Sequence Feature Prediction

Prediction and (Method)	Result

Residue Number Marker

Protein Sequence

Secondary Structure (PSIPRED)

Secondary Structure Prediction (SSPRO)

Coil and Loop (DISEMBL)

Flexible Loop (DISEMBL)

Low Complexity Region (SEG)

Disordered region (IsUnstruct)

Disordered Region (DISOPRED)

Disordered Region (DISEMBL)

Disordered Region (DISPRO)

Transmembrane Helix (TMHMM)

Transmembrane Helix (HMMTOP)

Transmembrane Helix (MEMSAT)

TM Helix, Signal Peptide (MEMSAT_SVM)

TM Helix, Signal Peptide (Phobius)

Signal Peptide (SignalP HMM Mode)

Signal Peptide (SignalP NN Mode)

Coiled Coils (COILS)

Positional Conservation

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820-------830-------840-------850-------860-------870-------880-------890-------900-------910-------920-------930-------940-------950-------960-------970-------980-------990------1000------1010------1020------1030------1040------1050------1060------1070------1080------1090------1100

MASSSRARSSSPFSYRKPVTPYSSTSSTSSSFMNNRLMPRSCSTSASSYFNSGNGLGSRSMTPSRSCSDSMYNSPRAPPVIFPSEELMAEPLDAPQRSGDSISVTIRFRPLSEREFQRGDEIAWYADGDKIVRNEYNPATAYAFDRVFGPHANSQEVYDVAARPVVKAAMEGVNGTVFAYGVTSSGKTHTMHGDQNSPGIIPLAIKDVFSIIQDTPGREFLLRVSYLEIYNEVINDLLDPTGQNLRVREDAQGTYVEGIKEEVVLSPGHALSFIAAGEEHRHVGSNNFNLLSSRSHTIFTLMIESSDHGDEYDGVIFSQLNLIDLAGSESSKTETTGLRRKEGSYINKSLLTLGTVIGKLSEGKASHVPYRDSKLTRLLQSSLSGHGHVSLICTVTPASSSMEETHNTLKFASRAKRVEIYASRNKIIDEKSLIKKYQREISSLKEELDQLKRGILVGVSHEELMTLRQKLEEGQVKMQSRLEEEEEAKAALMSRIQRLTKLILVSTKNTIPGLSDVPNHQRSHSVGEDDGSLLLDGENQKDSTSSASGLASDLPSDFKHRRSSSKWNEEFSPTSSTVTESTQAGELISGSKHPIGGMTSDQMDLLVEQVKMLAGEIAFSSSNLKRLVDQSVNDPDGSKVQIQNLEREIQEKRRQMRILEQRIIENGEASMANASMVDMQQTVTRLMSQCNEKAFELEIKSADNRILQEQLQNKLIHECSENKKLQEKVNLLEQQLACQNGDKSAGSSGQGTSDEYVDELRKKVQSQETENEKLKLEHVQLSEENSGLHVQNQKLAEEASYAKELASAAAVELKNLAGEVTKLSLQNAKLEKELLAARESMHSRGAAMQTVNGVNRKYSDGMKAGRKGRLSGRSTEISGVVSDDFDSWNLDPDDLKLELQARKQREAALEAALAEKEFLEDEYRKKVEESKRREEALENDLANMWVLVAKLKKEVGSVPELNTVERHSNGEDRVCDPKANETDCNTVLKDRHFLEVSKPADENSVERQVLDVPKPADETPKEEPLVARLKARMQEMKEKEQKYQGNGDPNSHMCKVCFESPTAAILLPCRHFCLCKSCSLACSECPICRTKISDRLFAFT

cccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEEEEccccHHHHHccccEEEEEEccEEEEcccccccccccccccccccccHHHHHHHcHHHHHHHHccccEEEEEEccccccccccccccccccccHHHHHHHHHHHHHcccccEEEEEEHHHHHHcccccccccccccccEEEEcccccEEccccEEEcccHHHHHHHHHHHHHccccccccccccccccccEEEEEEEEEccccccccEEEEcEEEEEcccccccccccccHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccHHHHHHcccccccccEEEEEEcccccccHHHHHHHHHHHHHHccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHccccccccccccccccccHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHccHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHcccccccccccHHHHHHHHHHHHHHHHHccccHHHHHHHHHHccccccccccccHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccHHcccccccccccccccccccccccccccccccccccc

cccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEEEEEcccHHHHHccccEEEEEcccEEEEccccccEEEEccEEEcccccHHHHHHHHcHHHHHHHHcccEEEEEEEccccccHHHHHcEcccccccEHHHHHHHHHHHcccccEEEEEEEEEEEEEccEEEEccccccccEcEEEcccccEEcccccEEEccHHHHHHHHHHHHHHHHcccccHHHHHHHcEEEEEEEEEEEEccccccEEEEEEEEEEEcccccccccccccccccccHHccHHHHHHHHHHHHHHHcccccccHHHcHHHHHcHHHHHccEEEEEEEEEccEHHHHHHHHHHHHHHHHHHccEEEEccEEEccHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccHcHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHcHHHHcHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHcHHHHHHHHHHHHHHHHHHEEEEEHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHcccccccEccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccHHccccccccccccccEcccccHcHHccccccccEEEEEccccccccccccccHHHHHHHHHHHHHHHHHHHHcccccccccEEEEEEccccHEEEcccccEEccccccEEcccccccccccccEEEEcc

masssrarssspfsyrkpvtpysstsstsssfmnnrlmprscstsassyfnsgnglgsrsmtpsrscsdsmynsprappvifpseelmaepldapqrsgdsisvtirfrplserefqrgdeiawyadgdkivrneynpatayafdrvfgphansqevydVAARPVVKAAMEGVNGTVFAYGvtssgkthtmhgdqnspgiiplAIKDVFSIIQDTPGREFLLRVSYLEIYNEVINdlldptgqnlrvredaqgtyveGIKEevvlspghalsfiaageehrhvgsnnfnllssrSHTIFTLMIessdhgdeydgviFSQLNLidlagsessktettglrrkegsyINKSLLTLGTVIgklsegkashvpyrdskLTRLLQsslsghghvSLICtvtpasssmeeTHNTLKFASRAKRVEIYASRNKIIDEKSLIKKYQREISSLKEELDQLKRGILVGVSHEELMTLRQKLEEGQVKMQSRLEEEEEAKAALMSRIQRLTKLILVStkntipglsdvpnhqrshsvgeddgsllldgenqkdstssasglasdlpsdfkhrrssskwneefsptsstvtestqagelisgskhpiggmtsDQMDLLVEQVKMLAGEIafsssnlkrlvdqsvndpdgskvQIQNLEREIQEKRRQMRILEQRIIENGEASMANASMVDMQQTVTRLMSQCNEKAFELEIKSADNRILQEQLQNKLIHECSENKKLQEKVNLLEQQLACqngdksagssgqgtsDEYVDELRKKVQSQETENEKLKLEHVQLseensglhvqnQKLAEEASYAKELASAAAVELKNLAGEVTKLSLQNAKLEKELLAARESMHSRGAAMQTVNGVnrkysdgmkagrkgrlsgrsteisgvvsddfdswnldpddLKLELQARKQREAALEAALAEKEFLEDEYRKKVEESKRREEALENDLANMWVLVAKLKKevgsvpelntverhsngedrvcdpkanetdcntvlkdrhflevskpadensverqvldvpkpadetpkeePLVARLKARMQEMKEKEQkyqgngdpnshmckvcfesptaaillpcrhfclckscslacsecpicrtkISDRLFAFT

masssrarssspfsyrkpvtpysstsstsssfMNNRLMPRSCSTSASSYFNSGNGLGSRSMTPSRSCSDSMYNSPRAPPVIFPSEELMAEPldapqrsgdsisvtirfrplserefqrgdeiawyadgdkiVRNEYNPATAYAFDRVFGPHANSQEVYDVAARPVVKAAMEGVNGTVFAYGVTSSGKTHTMHGDQNSPGIIPLAIKDVFSIIQDTPGREFLLRVSYLEIYNEVINdlldptgqnLRVREDAQGTYVEGIKEEVVLSPGHALSFIAAGEEHRHVGSNNFNLLSSRSHTIFTLMIESSDHGDEYDGVIFSQLNLIdlagsessktettglrrkegsyinksLLTLGTVIGKLSEGKASHVPYRDSKLTRLLQSSLSGHGHVSLICTVTPASSSMEETHNtlkfasrakrveiyasrnkiidekslIKKYQREISSLKEELDQLKRGILVGVSHEELMTLRQKLEEGQVKMQSRLEEEEEAKAALMSRIQRLTKLILVSTKntipglsdvpnhqrshsVGEDDGSLLLDGENQKDStssasglasdlpsdfKHRRssskwneefsptsstvtestqageLISGSKHPIGGMTSDQMDLLVEQVKMLAGEIAFSSSNLKRLVDQsvndpdgskvqiqnLEREIQEKRRQMRILEQRIIengeasmanASMVDMQQTVTRLMSQCNEKAFELEIKSADNRILQEQLQNKLIHECSENKKLQEKVNLLEQQLACqngdksagssgqgTSDEYVDELRKKVQSQETENEKLKLEHVQLSEENSGLHVQNQKLAEEASYAKELASAAAVELKNLAGEVTKLSLQNAKLEKELLAARESMHsrgaamqtvngvnrkysdgmkagrkgrlsgrsteisgvvsddfdswnlDPDDLKLELQARKQREAALEAALaekefledeyrkKVEESKRREEALENDLANMWVLVAKLKKevgsvpelntverhsngedrvcdpkanETDCNTVLKDRHFLevskpadensverqvldvpkpadetpkeeplVARLKARMQEMKEKEqkyqgngdpnSHMCKVCFESPTAAILLPCRHFCLCKSCSLACSECPICRTKISDRLFAFT

MasssrarsssPFSYRKPVTPYsstsstsssFMNNRLMPRSCSTSASSYFNSGNGLGSRSMTPSRSCSDSMYNSPRAPPVIFPSEELMAEPLDAPQRSGDSISVTIRFRPLSEREFQRGDEIAWYADGDKIVRNEYNPATAYAFDRVFGPHANSQEVYDVAARPVVKAAMEGVNGTVFAYGVTSSGKTHTMHGDQNSPGIIPLAIKDVFSIIQDTPGREFLLRVSYLEIYNEVINDLLDPTGQNLRVREDAQGTYVEGIKEEVVLSPGHALSFIAAGEEHRHVGSNNFNLLSSRSHTIFTLMIESSDHGDEYDGVIFSQLNLIDLAGSESSKTETTGLRRKEGSYINKSLLTLGTVIGKLSEGKASHVPYRDSKLTRLLQSSLSGHGHVSLICTVTPASSSMEETHNTLKFASRAKRVEIYASRNKIIDEKSLIKKYQREISSLKEELDQLKRGILVGVSHEELMTLRQKLEEGQVKMQSRLeeeeeAKAALMSRIQRLTKLILVSTKNTIPGLSDVPNHQRSHSVGEDDGSLLLDGENQKDSTSSASGLASDLPSDFKHRRSSSKWNEEFSPTSSTVTESTQAGELISGSKHPIGGMTSDQMDLLVEQVKMLAGEIAFSSSNLKRLVDQSVNDPDGSKVQIQNLEREIQEKRRQMRILEQRIIENGEASMANASMVDMQQTVTRLMSQCNEKAFELEIKSADNRILQEQLQNKLIHECSENKKLQEKVNLLEQQLACQNGDKSAGSSGQGTSDEYVDELRKKVQSQETENEKLKLEHVQLSEENSGLHVQNQklaeeasyakelasaaavelkNLAGEVTKLSLQNAKLEKELLAARESMHSRGAAMQTVNGVNRKYSDGMKAGRKGRLSGRSTEISGVVSDDFDSWNLDPDDLKLELqarkqreaaleaalaekeFLEDeyrkkveeskrreeALENDLANMWVLVAKLKKEVGSVPELNTVERHSNGEDRVCDPKANETDCNTVLKDRHFLEVSKPADENSVERQVLDVPKPADETPKEEPLVARLKARMQEMKEKEQKYQGNGDPNSHMCKVCFESPTAAILLPCRHFCLCKSCSLACSECPICRTKISDRLFAFT

*******************************************************************************************************VTIRFRPLSEREFQRGDEIAWYADGDKIVRNEYNPATAYAFDRVFGPHANSQEVYDVAARPVVKAAMEGVNGTVFAYGVTSS************PGIIPLAIKDVFSIIQDTPGREFLLRVSYLEIYNEVINDLLDPTGQNLRVREDAQGTYVEGIKEEVVLSPGHALSFIAAGEEHRHVGSNNFNLLSSRSHTIFTLMIESSDHGDEYDGVIFSQLNLIDLA*****************SYINKSLLTLGTVIGKLSEG***HVPYR**KLTRLLQSSLSGHGHVSLICTVT**************FASRAKRVEIYASRNKIIDEKSLIKKYQREISSL**ELDQLKRGILVGVSHE********************************RIQRLTKLILVSTKN***********************************************************************************************LLVEQVKMLAGEIAF**************************************************************************AFELEI******IL*******LI*******************************************************************************************************************************************************************************************************************************DLANMWVLVAKLKKEVG******************************VL****************************************************************MCKVCFESPTAAILLPCRHFCLCKSCSLACSECPICRTKISDRLFA**

*******************************************************************************************************VTIRFRPLSEREFQRGDEIAWYADGDKI****YNPATAYAFDRVFGPHANSQEVYDVAARPVVKAAMEGVNGTVFAYGVTSSGKTHTMHGDQNSPGIIPLAIKDVFSIIQDTPGREFLLRVSYLEIYNEVINDLLDPTGQNLRVREDAQGTYVEGIKEEVVLSPGHALSFIAAGEEHRHVGSNNFNLLSSRSHTIFTLMI***************QLNLIDLAGSES***********EGSYINKSLLTLGTVIGKLSEGKASHVPYRDSKLTRLLQSSLSGHGHVSLICTVTPASSSMEETHNTLKFASRAKRVEIYASRNKIIDEKSLIKKYQREISSLK**********************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************VCFESPTAAILLPCRHFCLCKSCSLACSECPICRTKISDRLFAFT

*******************************FMNNRLMPRSCSTSASSYFNSGN*******************SPRAPPVIFPSEELMAEPLDAPQRSGDSISVTIRFRPLSEREFQRGDEIAWYADGDKIVRNEYNPATAYAFDRVFGPHANSQEVYDVAARPVVKAAMEGVNGTVFAYGVTSSGKTHTMHGDQNSPGIIPLAIKDVFSIIQDTPGREFLLRVSYLEIYNEVINDLLDPTGQNLRVREDAQGTYVEGIKEEVVLSPGHALSFIAAGEEHRHVGSNNFNLLSSRSHTIFTLMIESSDHGDEYDGVIFSQLNLIDLAGS*********LRRKEGSYINKSLLTLGTVIGKLSEGKASHVPYRDSKLTRLLQSSLSGHGHVSLICTVTPA********NTLKFASRAKRVEIYASRNKIIDEKSLIKKYQREISSLKEELDQLKRGILVGVSHEELMTLRQKLEEGQV**************ALMSRIQRLTKLILVSTKNTIPGLSDVPNHQRSHSVGEDDGSLLLDGE**********************************************GELISGSKHPIGGMTSDQMDLLVEQVKMLAGEIAFSSSNLKRLVDQSVNDPDGSKVQIQNLEREIQEKRRQMRILEQRIIENGEASMANASMVDMQQTVTRLMSQCNEKAFELEIKSADNRILQEQLQNKLIHECSENKKLQEKVNLLEQQLAC***********************************LKLEHVQLSEENSGLHVQNQKLAEEASYAKELASAAAVELKNLAGEVTKLSLQNAKLEKELLAARESMHSRGAAMQTVNGVNRKYSDGMKAGRKGRLSGRSTEISGVVSDDFDSWNLDPDDLKLELQARKQREAALEAALAEKEFLEDEYR***********ALENDLANMWVLVAKLKKEVGSVPELNTVERHSNGEDRVCDPKANETDCNTVLKDRHFLEVSKPADENSVERQVLDVPKPADETPKEEPLVARLKARMQ**************PNSHMCKVCFESPTAAILLPCRHFCLCKSCSLACSECPICRTKISDRLFAFT

***************************************************************************************************DSISVTIRFRPLSEREFQRGDEIAWYADGDKIVRNEYNPATAYAFDRVFGPHANSQEVYDVAARPVVKAAMEGVNGTVFAYGVTSSGKTHTMHGDQNSPGIIPLAIKDVFSIIQDTPGREFLLRVSYLEIYNEVINDLLDPTGQNLRVREDAQGTYVEGIKEEVVLSPGHALSFIAAGEEHRHVGSNNFNLLSSRSHTIFTLMIESSDHGDEYDGVIFSQLNLIDLAG************RKEGSYINKSLLTLGTVIGKLSEGKASHVPYRDSKLTRLLQSSLSGHGHVSLICTVTPASSSMEETHNTLKFASRAKRVEIYASRNKIIDEKSLIKKYQREISSLKEELDQLKRGILVGVSHEELMTLRQKLEEGQVKMQSRLEEEEEAKAALMSRIQRLTKLILVSTK****************************************************************************************GMTSDQMDLLVEQVKMLAGEIAFSSSNLKRLVDQSVNDPDGSKVQIQNLEREIQEKRRQMRILEQRIIENGEASMANASMVDMQQTVTRLMSQCNEKAFELEIKSADNRILQEQLQNKLIHECSENKKLQEKVNLLEQQLACQN************SDEYVDELRKKVQSQETENEKLKLEHVQLSEENSGLHVQNQKLAEEASYAKELASAAAVELKNLAGEVTKLSLQNAKLEKELLAAR********************************************DDFDSWNLDPDDLKLELQARKQREAALEAALAEKEFLEDEYRKKVEESKRREEALENDLANMWVLVAKLKKE***************************************LEVSKPADENSVERQVLDVPKPADETPKEEPLVARLKARMQEMKEKEQKYQGNGDPNSHMCKVCFESPTAAILLPCRHFCLCKSCSLACSECPICRTKISDRLFAFT

oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii

iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooo

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

MASSSRARSSSPFSYRKPVTPYSSTSSTSSSFMNNRLMPRSCSTSASSYFNSGNGLGSRSMTPSRSCSDSMYNSPRAPPVIFPSEELMAEPLDAPQRSGDSISVTIRFRPLSEREFQRGDEIAWYADGDKIVRNEYNPATAYAFDRVFGPHANSQEVYDVAARPVVKAAMEGVNGTVFAYGVTSSGKTHTMHGDQNSPGIIPLAIKDVFSIIQDTPGREFLLRVSYLEIYNEVINDLLDPTGQNLRVREDAQGTYVEGIKEEVVLSPGHALSFIAAGEEHRHVGSNNFNLLSSRSHTIFTLMIESSDHGDEYDGVIFSQLNLIDLAGSESSKTETTGLRRKEGSYINKSLLTLGTVIGKLSEGKASHVPYRDSKLTRLLQSSLSGHGHVSLICTVTPASSSMEETHNTLKFASRAKRVEIYASRNKxxxxxxxxxxxxxxxxxxxxxxxxxxxxILVGVSHEELMTLxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxILVSTKNTIPGLSDVPNHQRSHSVGEDDGSLLLDGENQKDSTSSASGLASDLPSDFKHRRSSSKWNEEFSPTSSTVTESTQAGELISGSKHPIGGMTSDQMDLLVEQVKMLAGEIAFSSSNLKRLVDQSVNDPDGSKVQxxxxxxxxxxxxxxxxxxxxxIIENGEASMANASMVDMQQTVTRLMSQCNEKAFELEIKSADNRILxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxKSAGSSGQGTSDEYxxxxxxxxxxxxxxxxxxxxxxxxxxxxNSGLHVQNQKLAEEASYAKELASAAAVExxxxxxxxxxxxxxxxxxxxxxxxxxxxMHSRGAAMQTVNGVNRKYSDGMKAGRKGRLSGRSTEISGVVSDDFDSWNLDPDDLKLELQAxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxLANMWVLVAKLKKEVGSVPELNTVERHSNGEDRVCDPKANETDCNTVLKDRHFLEVSKPADENSVERQVLDVPKPADETPKEEPLxxxxxxxxxxxxxxxxxxxxxGDPNSHMCKVCFESPTAAILLPCRHFCLCKSCSLACSECPICRTKISDRLFAFT

no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST

Original result of BLAST against SWISS-PROT Database

ID	Alignment graph	Length	Definition	RBH(Q2H)	RBH(H2Q)	Q cover	H cover	Identity	E-value
Query		1100	2.2.26 [Sep-21-2011]
Q6S001		685	Kinesin-related protein 1	yes	no	0.332	0.534	0.522	1e-102
Q54NP8		1922	Kinesin-related protein 4	no	no	0.313	0.179	0.478	2e-89
Q6RT24		2474	Centromere-associated pro	yes	no	0.314	0.139	0.455	5e-85
Q02224		2701	Centromere-associated pro	yes	no	0.358	0.145	0.410	1e-81
Q4R628		702	Kinesin-like protein KIF3	N/A	no	0.314	0.492	0.434	1e-67
Q5R4H3		702	Kinesin-like protein KIF3	yes	no	0.314	0.492	0.434	2e-67
Q9Y496		699	Kinesin-like protein KIF3	no	no	0.314	0.494	0.434	2e-67
P28741		701	Kinesin-like protein KIF3	no	no	0.314	0.493	0.431	3e-67
P46872		699	Kinesin-II 85 kDa subunit	no	no	0.321	0.506	0.416	7e-67
O60282		957	Kinesin heavy chain isofo	no	no	0.297	0.341	0.434	3e-66

>sp\|Q6S001\|KIF11_DICDI Kinesin-related protein 11 OS=Dictyostelium discoideum GN=kif11 PE=3 SV=1	Back alignment and function desciption

 Score =  374 bits (960), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 199/381 (52%), Positives = 272/381 (71%), Gaps = 15/381 (3%)

Query: 139 ATAYAFDRVFGPHANSQEVYDVAARPVVKAAMEGVNGTVFAYGVTSSGKTHTMHGD-QNS 197
           + +Y +D +F P  ++ EVYD  AR +VK+AMEG N ++ AYG+TSSGKT TM G  + +
Sbjct: 114 SNSYTYDHLFPPTCDNYEVYDTVARELVKSAMEGYNASIMAYGITSSGKTFTMTGSGKKN 173

Query: 198 PGIIPLAIKDVFSIIQDTPGREFLLRVSYLEIYNEVINDLLDPTGQN--LRVRED-AQGT 254
           PGIIPL+I+D+F+ IQ+   REFLLRVSYLEIYNE +NDLL    +N  L++ E    G 
Sbjct: 174 PGIIPLSIQDIFTYIQECKEREFLLRVSYLEIYNETVNDLLGVNQENFNLKIHEHPVTGV 233

Query: 255 YVEGIKEEVVLSPGHALSFIAAGEEHRHVGSNNFNLLSSRSHTIFTLMIESSDHGDEYDG 314
           YV G+KEE+VLS  H LS I+AGE HRHVGS ++NL SSRSHTIF ++IES +   E  G
Sbjct: 234 YVAGLKEEIVLSVEHVLSLISAGEAHRHVGSTSYNLQSSRSHTIFKMIIESKEVLPEGSG 293

Query: 315 -------VIFSQLNLIDLAGSE-SSKTETTGLRRKEGSYINKSLLTLGTVIGKLSEGKAS 366
                  V +S LNLIDLAGSE +S++  + +R KEGSYINKSLLTLGTVI KLSE    
Sbjct: 294 SGGLESPVRYSTLNLIDLAGSEKASESTISAIRNKEGSYINKSLLTLGTVISKLSEKDTG 353

Query: 367 HVPYRDSKLTRLLQSSLSGHGHVSLICTVTPASSSMEETHNTLKFASRAKRVEIYASRNK 426
           ++PYRDSKLTR+LQ+SLSG+  V++ICT+T AS++ EE+HNTLKFASRAK++   A  N+
Sbjct: 354 YIPYRDSKLTRVLQNSLSGNSRVAIICTITLASNNFEESHNTLKFASRAKKISNNAKVNE 413

Query: 427 IIDEKSLIKKYQREISSLKEELDQLKRGILVGVSHEELMTLRQKLEEGQVKMQSRLEEEE 486
           I+D+K+L+K+Y+ EI+ LK +L      +      +E +T ++K++    ++  +L + E
Sbjct: 414 ILDDKALLKQYRNEIAELKSKLSD---ALSTEKELQETLTEKEKMKITNQELLHKLVDAE 470

Query: 487 EAKAALMSRIQRLTKLILVST 507
           + ++ L S+I  L KLILVST
Sbjct: 471 KHRSLLESKINNLNKLILVST 491

Microtubule-associated force-producing protein that plays a role in organelle transport. Its motor activity is directed toward the microtubule's plus end.
Dictyostelium discoideum (taxid: 44689)

>sp\|Q54NP8\|KIF4_DICDI Kinesin-related protein 4 OS=Dictyostelium discoideum GN=kif4 PE=2 SV=1	Back alignment and function description

>sp\|Q6RT24\|CENPE_MOUSE Centromere-associated protein E OS=Mus musculus GN=Cenpe PE=1 SV=1	Back alignment and function description

>sp\|Q02224\|CENPE_HUMAN Centromere-associated protein E OS=Homo sapiens GN=CENPE PE=1 SV=2	Back alignment and function description

>sp\|Q4R628\|KIF3A_MACFA Kinesin-like protein KIF3A OS=Macaca fascicularis GN=KIF3A PE=2 SV=1	Back alignment and function description

>sp\|Q5R4H3\|KIF3A_PONAB Kinesin-like protein KIF3A OS=Pongo abelii GN=KIF3A PE=2 SV=1	Back alignment and function description

>sp\|Q9Y496\|KIF3A_HUMAN Kinesin-like protein KIF3A OS=Homo sapiens GN=KIF3A PE=1 SV=4	Back alignment and function description

>sp\|P28741\|KIF3A_MOUSE Kinesin-like protein KIF3A OS=Mus musculus GN=Kif3a PE=1 SV=2	Back alignment and function description

>sp\|P46872\|KRP85_STRPU Kinesin-II 85 kDa subunit OS=Strongylocentrotus purpuratus GN=KRP85 PE=1 SV=1	Back alignment and function description

>sp\|O60282\|KIF5C_HUMAN Kinesin heavy chain isoform 5C OS=Homo sapiens GN=KIF5C PE=1 SV=1	Back alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST

Original result of BLAST against Nonredundant Database

GI	Alignment Graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		1100
224080418		1067	predicted protein [Populus trichocarpa]	0.947	0.976	0.797	0.0
225427728		1079	PREDICTED: uncharacterized protein LOC10	0.953	0.972	0.792	0.0
147864402		1082	hypothetical protein VITISV_007231 [Viti	0.952	0.968	0.787	0.0
224103343		1000	predicted protein [Populus trichocarpa]	0.893	0.983	0.820	0.0
297744752		1046	unnamed protein product [Vitis vinifera]	0.922	0.970	0.779	0.0
357473457		1107	Kinesin heavy chain-like protein [Medica	0.965	0.959	0.729	0.0
255543819		1032	kinesin heavy chain, putative [Ricinus c	0.903	0.963	0.780	0.0
356538724		1086	PREDICTED: uncharacterized protein LOC10	0.963	0.976	0.743	0.0
449464854		1130	PREDICTED: chromosome-associated kinesin	0.967	0.941	0.734	0.0
297797890		1055	hypothetical protein ARALYDRAFT_327857 [	0.923	0.963	0.748	0.0

>gi\|224080418\|ref\|XP_002306132.1\| predicted protein [Populus trichocarpa] gi\|222849096\|gb\|EEE86643.1\| predicted protein [Populus trichocarpa]	Back alignment and taxonomy information

 Score = 1711 bits (4431), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 880/1103 (79%), Positives = 956/1103 (86%), Gaps = 61/1103 (5%)

Query: 12   PFSYRKPVTPYSSTSSTSSSFMNNRLMPRSCSTSASSYFNSGNGLGSRSMTPSRSCSDSM 71
            PFSYRKP +    +S++S++  NNRLMPRSCSTSASS+F      GSRS+TPSR  SDSM
Sbjct: 12   PFSYRKPSS--PYSSASSTTSYNNRLMPRSCSTSASSFF------GSRSVTPSRDRSDSM 63

Query: 72   Y----NSPRA-----PPVIFPSEELMAEPLDAPQRSGDSISVTIRFRPLSEREFQRGDEI 122
            +    N   A      PV F SEEL+AEP+D P+  GDSISVTIRFRPLSEREFQRGDEI
Sbjct: 64   HYGLSNGVGAYGGSLNPVGFGSEELIAEPIDQPRNGGDSISVTIRFRPLSEREFQRGDEI 123

Query: 123  AWYADGDKIVRNEYNPATAYAFDRVFGPHANSQEVYDVAARPVVKAAMEGVNGTVFAYGV 182
            AW ADGDKIVRNEYNPATAYAFD+VFGPH  SQEVY+VAA+PVVKAAMEGVNGTVFAYGV
Sbjct: 124  AWSADGDKIVRNEYNPATAYAFDKVFGPHTASQEVYEVAAKPVVKAAMEGVNGTVFAYGV 183

Query: 183  TSSGKTHTMHGDQNSPGIIPLAIKDVFSIIQDTPGREFLLRVSYLEIYNEVINDLLDPTG 242
            TSSGKTHTMHGDQNSPGIIPLAIKDVFS IQDTPGREFLLRVSYLEIYNEVINDLLDPTG
Sbjct: 184  TSSGKTHTMHGDQNSPGIIPLAIKDVFSSIQDTPGREFLLRVSYLEIYNEVINDLLDPTG 243

Query: 243  QNLRVREDAQGTYVEGIKEEVVLSPGHALSFIAAGEEHRHVGSNNFNLLSSRSHTIFTLM 302
            QNLRVREDAQGTYVEGIKEEVVLSPGHALSFIAAGEEHRHVGSNNFNL SSRSHTIFTLM
Sbjct: 244  QNLRVREDAQGTYVEGIKEEVVLSPGHALSFIAAGEEHRHVGSNNFNLFSSRSHTIFTLM 303

Query: 303  IESSDHGDEYDGVIFSQLNLIDLAGSESSKTETTGLRRKEGSYINKSLLTLGTVIGKLSE 362
            IESS HGDEYDGVIFSQLNLIDLAGSESSKTETTG+RRKEGSYINKSLLTLGTVIGKLSE
Sbjct: 304  IESSAHGDEYDGVIFSQLNLIDLAGSESSKTETTGIRRKEGSYINKSLLTLGTVIGKLSE 363

Query: 363  GKASHVPYRDSKLTRLLQSSLSGHGHVSLICTVTPASSSMEETHNTLKFASRAKRVEIYA 422
            G+ASHVPYRDSKLTRLLQSSLSGHGHVSLICTVTPASS+MEETHNTLKFASRAKRVEIYA
Sbjct: 364  GRASHVPYRDSKLTRLLQSSLSGHGHVSLICTVTPASSNMEETHNTLKFASRAKRVEIYA 423

Query: 423  SRNKIIDEKSLIKKYQREISSLKEELDQLKRGILVGVSHEELMTLRQKLEEGQVKMQSRL 482
            SRNKIIDEKSLIKKYQ+EISSLK+ELDQL+ G+L GVSHEE+++LRQKLEEGQVKMQSRL
Sbjct: 424  SRNKIIDEKSLIKKYQKEISSLKQELDQLRHGMLAGVSHEEILSLRQKLEEGQVKMQSRL 483

Query: 483  EEEEEAKAALMSRIQRLTKLILVSTKNTIPGLSDVPNHQRSHSVGEDD--GSLLLDGENQ 540
            EEEEEAKAALMSRIQRLTKLILVSTKNTIPGL+DVP HQ SHSVGEDD  G+LL + ENQ
Sbjct: 484  EEEEEAKAALMSRIQRLTKLILVSTKNTIPGLTDVPGHQPSHSVGEDDVKGALLAENENQ 543

Query: 541  KDSTSSASGLASDLPSDFKHRRSSSKWNEEFSPTSSTVTESTQAGELISGSKHPIGGMTS 600
            KDS SSAS +ASDL  +FKHRRSSS WNEE SP SST                  GGMT 
Sbjct: 544  KDSPSSASLIASDLTYEFKHRRSSSMWNEELSPASST------------------GGMTQ 585

Query: 601  DQMDLLVEQVKMLAGEIAFSSSNLKRLVDQSVNDPDGSKVQIQNLEREIQEKRRQMRILE 660
            DQMDLLVEQVKMLAGEIAFS+S LKRLV+ SVNDPD SK QIQNLEREI+EK+RQMR+LE
Sbjct: 586  DQMDLLVEQVKMLAGEIAFSTSTLKRLVEHSVNDPDNSKTQIQNLEREIREKKRQMRVLE 645

Query: 661  QRIIENGEASMANASMVDMQQTVTRLMSQCNEKAFELEIKSADNRILQEQLQNKLIHECS 720
            QRIIE+GEAS+ANAS+VDMQQTV RLM+QCNEKAFELEIKSADNRILQEQLQNK    CS
Sbjct: 646  QRIIESGEASIANASLVDMQQTVMRLMTQCNEKAFELEIKSADNRILQEQLQNK----CS 701

Query: 721  ENKKLQEKVNLLEQQLACQNGDKSAGSSGQGTSDEYVDELRKKVQS-QETENEKLKLEHV 779
            ENK+LQ+KV LLE +LA  +GDK++ +S    S+EYVDEL+KKVQS QE ENEKLK+  V
Sbjct: 702  ENKELQDKVTLLEHRLASLSGDKASVNSEHNMSEEYVDELKKKVQSQQEIENEKLKIGQV 761

Query: 780  QLSEENSGLHVQNQKLAEEASYAKELASAAAVELKNLAGEVTKLSLQNAKLEKELLAARE 839
            Q+SEENSGL VQNQKL+EEASYAKELASAAAVELKNLAGEVTKLSLQNAKLEKELLAARE
Sbjct: 762  QISEENSGLRVQNQKLSEEASYAKELASAAAVELKNLAGEVTKLSLQNAKLEKELLAARE 821

Query: 840  SMHSRGAAMQTVNGVNRKYSDGMKAGRKGRLSGRSTEISGVVSDDFDSWNLDPDDLKLEL 899
            S+HSRGA MQ+VNGVNRK++DG++ GRKGR SGR  + SG+ SDDF+SWNLDPDDLK EL
Sbjct: 822  SVHSRGAGMQSVNGVNRKFNDGIRHGRKGRFSGRGNDFSGMHSDDFESWNLDPDDLKREL 881

Query: 900  QARKQREAALEAALAEKEFLEDEYRKKVEESKRREEALENDLANMWVLVAKLKKEVGSVP 959
            QARKQREAALEAALAEKEF+EDEYRKK EE+K+RE ALENDLANMWVLVAKLK+E  ++ 
Sbjct: 882  QARKQREAALEAALAEKEFIEDEYRKKCEEAKKREGALENDLANMWVLVAKLKREDSAIF 941

Query: 960  ELNTVERHSNGEDRVCDPKAN--ETDCNTVLKDRHFLEVSKPADENSVERQVLDVPKPAD 1017
             +N  ERHS+G D   DPK N  E D N++LK+R  L+ S+                  D
Sbjct: 942  GMNADERHSDGIDHTSDPKTNGVEVDRNSILKEREDLDASQ-----------------VD 984

Query: 1018 ETPKEEPLVARLKARMQEMKEKEQKYQGNGDPNSHMCKVCFESPTAAILLPCRHFCLCKS 1077
            ETPKEEPLV RLKAR+QEMKEKE K  GNGD NSH+CKVCFESPTAAILLPCRHFCLCKS
Sbjct: 985  ETPKEEPLVVRLKARIQEMKEKELKQLGNGDANSHVCKVCFESPTAAILLPCRHFCLCKS 1044

Query: 1078 CSLACSECPICRTKISDRLFAFT 1100
            CSLACSECPICRTKI+DRLFAFT
Sbjct: 1045 CSLACSECPICRTKIADRLFAFT 1067

Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi\|225427728\|ref\|XP_002265593.1\| PREDICTED: uncharacterized protein LOC100253714 [Vitis vinifera]	Back alignment and taxonomy information

>gi\|147864402\|emb\|CAN80502.1\| hypothetical protein VITISV_007231 [Vitis vinifera]	Back alignment and taxonomy information

>gi\|224103343\|ref\|XP_002313019.1\| predicted protein [Populus trichocarpa] gi\|222849427\|gb\|EEE86974.1\| predicted protein [Populus trichocarpa]	Back alignment and taxonomy information

>gi\|297744752\|emb\|CBI38014.3\| unnamed protein product [Vitis vinifera]	Back alignment and taxonomy information

>gi\|357473457\|ref\|XP_003607013.1\| Kinesin heavy chain-like protein [Medicago truncatula] gi\|355508068\|gb\|AES89210.1\| Kinesin heavy chain-like protein [Medicago truncatula]	Back alignment and taxonomy information

>gi\|255543819\|ref\|XP_002512972.1\| kinesin heavy chain, putative [Ricinus communis] gi\|223547983\|gb\|EEF49475.1\| kinesin heavy chain, putative [Ricinus communis]	Back alignment and taxonomy information

>gi\|356538724\|ref\|XP_003537851.1\| PREDICTED: uncharacterized protein LOC100780424 [Glycine max]	Back alignment and taxonomy information

>gi\|449464854\|ref\|XP_004150144.1\| PREDICTED: chromosome-associated kinesin KIF4-like [Cucumis sativus]	Back alignment and taxonomy information

>gi\|297797890\|ref\|XP_002866829.1\| hypothetical protein ARALYDRAFT_327857 [Arabidopsis lyrata subsp. lyrata] gi\|297312665\|gb\|EFH43088.1\| hypothetical protein ARALYDRAFT_327857 [Arabidopsis lyrata subsp. lyrata]	Back alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST

Original result of BLAST against Gene Ontology (AMIGO)

ID	Alignment graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		1100
TAIR\|locus:2120187		1055	AT4G39050 [Arabidopsis thalian	0.68	0.709	0.712	0.0
TAIR\|locus:2050044		1058	AT2G21380 [Arabidopsis thalian	0.69	0.717	0.607	2.2e-224
TAIR\|locus:2036987		890	AT1G21730 [Arabidopsis thalian	0.440	0.544	0.663	2.3e-196
TAIR\|locus:2144103		986	AT5G06670 [Arabidopsis thalian	0.542	0.605	0.527	3.6e-153
DICTYBASE\|DDB_G0291039		685	kif11 "kinesin-7" [Dictyosteli	0.461	0.741	0.430	9.1e-105
UNIPROTKB\|E1BQJ6		2616	E1BQJ6 "Uncharacterized protei	0.338	0.142	0.450	1.9e-86
UNIPROTKB\|O42263		2954	cenpe "Kinesin-related protein	0.605	0.225	0.321	4.8e-85
RGD\|1307115		1968	Cenpe "centromere protein E" [	0.315	0.176	0.462	3.5e-84
MGI\|MGI:1098230		2474	Cenpe "centromere protein E" [	0.314	0.139	0.453	4.9e-84
ZFIN\|ZDB-GENE-060929-860		2690	cenpe "centromere protein E" [	0.609	0.249	0.323	6.1e-81

TAIR\|locus:2120187 AT4G39050 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

 Score = 2611 (924.2 bits), Expect = 0., Sum P(3) = 0.
 Identities = 560/786 (71%), Positives = 634/786 (80%)

Query:    21 PYXXXXXXXXXFMNNRLMPRSCSTSASSYFNSGNGLGSRSMTPSRSCSDS-MYNSPR--- 76
             P           ++NRL+PRS STSASS   S  G+ SRSMTPSR+ SDS +  S     
Sbjct:    13 PPSPASSTSSSHLSNRLIPRSNSTSASSLITSAAGIASRSMTPSRTFSDSGLIGSGSFGI 72

Query:    77 APPVIFPSEELMAEPLDAPQRSG-DSISVTIRFRPLSEREFQRGDEIAWYADGDKIVRNE 135
               PV +PSEEL+ +P+D    S  DSISVT+RFRPLS+RE+QRGDE+AWY DGD +VR+E
Sbjct:    73 GSPVPYPSEELLGDPMDDTISSERDSISVTVRFRPLSDREYQRGDEVAWYPDGDTLVRHE 132

Query:   136 YNPATAYAFDRVFGPHANSQEVYDVAARPVVKAAMEGVNGTVFAYGVTSSGKTHTMHGDQ 195
             YNP TAYAFD+VFGP A + +VYDVAARPVVKAAMEGVNGTVFAYGVTSSGKTHTMHGDQ
Sbjct:   133 YNPLTAYAFDKVFGPQATTIDVYDVAARPVVKAAMEGVNGTVFAYGVTSSGKTHTMHGDQ 192

Query:   196 NSPGIIPLAIKDVFSIIQDTPGREFLLRVSYLEIYNEVINDLLDPTGQNLRVREDAQGTY 255
              SPGIIPLAIKDVFSIIQDTPGREFLLRVSYLEIYNEVINDLLDPTGQNLRVRED+QGTY
Sbjct:   193 ESPGIIPLAIKDVFSIIQDTPGREFLLRVSYLEIYNEVINDLLDPTGQNLRVREDSQGTY 252

Query:   256 VEGIKEEVVLSPGHALSFIAAGEEHRHVGSNNFNLLSSRSHTIFTLMIESSDHGDEYDGV 315
             VEGIKEEVVLSPGHALSFIAAGEEHRHVGSNNFNLLSSRSHTIFTLM+ESS  GDEYDGV
Sbjct:   253 VEGIKEEVVLSPGHALSFIAAGEEHRHVGSNNFNLLSSRSHTIFTLMVESSATGDEYDGV 312

Query:   316 IFSQLNLIDLAGSESSKTETTGLRRKEGSYINKSLLTLGTVIGKLSEGKASHVPYRDSKL 375
             IFSQLNLIDLAGSESSKTETTGLRRKEGSYINKSLLTLGTVIGKLSEGKA+H+PYRDSKL
Sbjct:   313 IFSQLNLIDLAGSESSKTETTGLRRKEGSYINKSLLTLGTVIGKLSEGKATHIPYRDSKL 372

Query:   376 TRLLQSSLSGHGHVSLICTVTPASSSMEETHNTLKFASRAKRVEIYASRNKIIDEKSLIK 435
             TRLLQSSLSGHGHVSLICT+TPASSS EETHNTLKFASRAK +EIYASRN+IIDEKSLIK
Sbjct:   373 TRLLQSSLSGHGHVSLICTITPASSSSEETHNTLKFASRAKSIEIYASRNQIIDEKSLIK 432

Query:   436 KYQREISSLKEELDQLKRGILVGVSHEELMTLRQKLEEGQVKMQSRLXXXXXAKAALMSR 495
             KYQREIS+LK ELDQL+RG+LVGVSHEELM+L+Q+LEEGQVKMQSRL     AKAALMSR
Sbjct:   433 KYQREISTLKLELDQLRRGMLVGVSHEELMSLKQQLEEGQVKMQSRLEEEEEAKAALMSR 492

Query:   496 IQRLTKLILVSTKNTIPGLS-DVPNHQRSHSVGEDD--GSLLLDGENQKDSTSSASGLAS 552
             IQ+LTKLILVSTKN+IPG S D+P HQRS S G+DD   SLLL+ +N   S SS   L S
Sbjct:   493 IQKLTKLILVSTKNSIPGYSGDIPTHQRSLSAGKDDKFDSLLLESDNL-GSPSSTLALLS 551

Query:   553 DLPSDFKHRRSSSKWNEEFSPTSSTVTESTQAGELISGSKHPIGGMTSDQMDLLVEQVKM 612
             +    F HRRSSSK N+E SP +    E TQ            G MT D++DLLVEQVKM
Sbjct:   552 EGSLGFNHRRSSSKLNDENSPGA----EFTQ------------GVMTPDEIDLLVEQVKM 595

Query:   613 LAGEIAFSSSNLKRLVDQSVNDPDGSKVQIQNLEREIQEKRRQMRILEQRIIENGEASMA 672
             LAGEIAFS+S LKRLVDQSVNDP+ S+ QIQNLEREI EK+RQMR LEQ IIE+GEAS+A
Sbjct:   596 LAGEIAFSTSTLKRLVDQSVNDPENSQTQIQNLEREIHEKQRQMRGLEQLIIESGEASIA 655

Query:   673 NASMVDMQQTVTRLMSQCNEKAFELEIKSADNRILQEQLQNKLIHECSENKK---LQEKV 729
             NAS+V+MQQ V  LM+QCNEK+FELEIKSADN ILQEQLQ K       ++K   L++++
Sbjct:   656 NASLVEMQQKVMSLMTQCNEKSFELEIKSADNCILQEQLQEKCTENKELHEKVNLLEQRL 715

Query:   730 NLLEQQLA---CQN----GDKSAGSSGQGTSDEYV-DELR-KKVQSQETENEKLKLEHVQ 780
             N +  + +   C N    G+ +     +  S E   +EL+ + VQ  E EN  L++++ +
Sbjct:   716 NAVSSEKSSPSCSNKAVSGEYADELKKKIQSQEIENEELKLEHVQIVE-ENSGLRVQNQK 774

Query:   781 LSEENS 786
             L+EE S
Sbjct:   775 LAEEAS 780

GO:0003777 "microtubule motor activity" evidence=IEA;ISS

GO:0005524 "ATP binding" evidence=IEA

GO:0007018 "microtubule-based movement" evidence=IEA

GO:0008270 "zinc ion binding" evidence=IEA

GO:0009507 "chloroplast" evidence=ISM

GO:0031347 "regulation of defense response" evidence=IMP

TAIR\|locus:2050044 AT2G21380 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2036987 AT1G21730 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2144103 AT5G06670 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

DICTYBASE\|DDB_G0291039 kif11 "kinesin-7" [Dictyostelium discoideum (taxid:44689)]	Back alignment and assigned GO terms

UNIPROTKB\|E1BQJ6 E1BQJ6 "Uncharacterized protein" [Gallus gallus (taxid:9031)]	Back alignment and assigned GO terms

UNIPROTKB\|O42263 cenpe "Kinesin-related protein" [Xenopus laevis (taxid:8355)]	Back alignment and assigned GO terms

RGD\|1307115 Cenpe "centromere protein E" [Rattus norvegicus (taxid:10116)]	Back alignment and assigned GO terms

MGI\|MGI:1098230 Cenpe "centromere protein E" [Mus musculus (taxid:10090)]	Back alignment and assigned GO terms

ZFIN\|ZDB-GENE-060929-860 cenpe "centromere protein E" [Danio rerio (taxid:7955)]	Back alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST

Original result of RPS-BLAST against CDD database part I

ID	Alignment Graph	Length	Definition	E-value
Query		1100
cd01374		321	cd01374, KISc_CENP_E, Kinesin motor domain, CENP-E	1e-179
pfam00225		326	pfam00225, Kinesin, Kinesin motor domain	1e-130
smart00129		335	smart00129, KISc, Kinesin motor, catalytic domain	1e-119
cd00106		328	cd00106, KISc, Kinesin motor domain	1e-118
cd01369		325	cd01369, KISc_KHC_KIF5, Kinesin motor domain, kine	1e-102
cd01371		333	cd01371, KISc_KIF3, Kinesin motor domain, kinesins	7e-95
cd01372		341	cd01372, KISc_KIF4, Kinesin motor domain, KIF4-lik	7e-94
cd01370		338	cd01370, KISc_KIP3_like, Kinesin motor domain, KIP	2e-92
cd01364		352	cd01364, KISc_BimC_Eg5, Kinesin motor domain, BimC	5e-88
cd01365		356	cd01365, KISc_KIF1A_KIF1B, Kinesin motor domain, K	3e-86
cd01366		329	cd01366, KISc_C_terminal, Kinesin motor domain, KI	2e-85
cd01373		337	cd01373, KISc_KLP2_like, Kinesin motor domain, KLP	2e-81
COG5059		568	COG5059, KIP1, Kinesin-like protein [Cytoskeleton]	9e-75
cd01368		345	cd01368, KISc_KIF23_like, Kinesin motor domain, KI	7e-74
cd01367		322	cd01367, KISc_KIF2_like, Kinesin motor domain, KIF	3e-71
cd01376		319	cd01376, KISc_KID_like, Kinesin motor domain, KIF2	3e-70
cd01375		334	cd01375, KISc_KIF9_like, Kinesin motor domain, KIF	2e-68
PLN03188		1320	PLN03188, PLN03188, kinesin-12 family protein; Pro	5e-56
cd01363		186	cd01363, Motor_domain, Myosin and Kinesin motor do	7e-23
pfam13920		49	pfam13920, zf-C3HC4_3, Zinc finger, C3HC4 type (RI	2e-17
cd01363		186	cd01363, Motor_domain, Myosin and Kinesin motor do	9e-10
TIGR02168		1179	TIGR02168, SMC_prok_B, chromosome segregation prot	4e-09
COG1196		1163	COG1196, Smc, Chromosome segregation ATPases [Cell	4e-09
pfam13923		45	pfam13923, zf-C3HC4_2, Zinc finger, C3HC4 type (RI	1e-08
cd00162		45	cd00162, RING, RING-finger (Really Interesting New	3e-07
COG1196		1163	COG1196, Smc, Chromosome segregation ATPases [Cell	4e-07
COG1196		1163	COG1196, Smc, Chromosome segregation ATPases [Cell	9e-07
pfam13639		46	pfam13639, zf-RING_2, Ring finger domain	4e-06
TIGR02168		1179	TIGR02168, SMC_prok_B, chromosome segregation prot	2e-05
smart00184		40	smart00184, RING, Ring finger	3e-05
TIGR02169		1164	TIGR02169, SMC_prok_A, chromosome segregation prot	3e-05
TIGR02169		1164	TIGR02169, SMC_prok_A, chromosome segregation prot	2e-04
TIGR02169		1164	TIGR02169, SMC_prok_A, chromosome segregation prot	2e-04
COG2433		652	COG2433, COG2433, Uncharacterized conserved protei	4e-04
COG0419		908	COG0419, SbcC, ATPase involved in DNA repair [DNA	0.001
pfam03961		450	pfam03961, DUF342, Protein of unknown function (DU	0.002
TIGR02169		1164	TIGR02169, SMC_prok_A, chromosome segregation prot	0.003
TIGR02169		1164	TIGR02169, SMC_prok_A, chromosome segregation prot	0.003
COG0419		908	COG0419, SbcC, ATPase involved in DNA repair [DNA	0.004
COG4372		499	COG4372, COG4372, Uncharacterized protein conserve	0.004

>gnl\|CDD\|238670 cd01374, KISc_CENP_E, Kinesin motor domain, CENP-E/KIP2-like subgroup, involved in chromosome movement and/or spindle elongation during mitosis	Back alignment and domain information

 Score =  525 bits (1354), Expect = e-179
 Identities = 198/322 (61%), Positives = 238/322 (73%), Gaps = 5/322 (1%)

Query: 101 SISVTIRFRPLSEREFQRGDEIAWYADGDK-IVRNEYNPATAYAFDRVFGPHANSQEVYD 159
            I V++R RPL+ RE    +++AW  D D  I   E  P  ++ FDRVFG  + ++EVY+
Sbjct: 1   KIKVSVRVRPLNPRE-SDNEQVAWSIDNDNTISLEESTPGQSFTFDRVFGGESTNREVYE 59

Query: 160 VAARPVVKAAMEGVNGTVFAYGVTSSGKTHTMHGDQNSPGIIPLAIKDVFSIIQDTPGRE 219
             A+PVV++A+EG NGT+FAYG TSSGKT TM GD+  PGIIPLA++D+F  IQDTP RE
Sbjct: 60  RIAKPVVRSALEGYNGTIFAYGQTSSGKTFTMSGDEQEPGIIPLAVRDIFQRIQDTPDRE 119

Query: 220 FLLRVSYLEIYNEVINDLLDPTGQNLRVREDAQ-GTYVEGIKEEVVLSPGHALSFIAAGE 278
           FLLRVSYLEIYNE I DLL P+ Q LR+RED   G  V G+ EE+V SP H L  IA GE
Sbjct: 120 FLLRVSYLEIYNEKIKDLLSPSPQELRIREDPNKGVVVAGLTEEIVTSPEHLLQLIARGE 179

Query: 279 EHRHVGSNNFNLLSSRSHTIFTLMIESSDHGDEYDG-VIFSQLNLIDLAGSESSKTETTG 337
           ++RHVG  +FN  SSRSHTIF L IES + GD   G V  S LNLIDLAGSE +     G
Sbjct: 180 KNRHVGETDFNERSSRSHTIFQLTIESRERGDSESGTVRVSTLNLIDLAGSERASQTGAG 239

Query: 338 LRRKEGSYINKSLLTLGTVIGKLSEGKAS-HVPYRDSKLTRLLQSSLSGHGHVSLICTVT 396
            RRKEGS+INKSLLTLGTVI KLSEGK S H+PYRDSKLTR+LQ SLSG+   ++ICT++
Sbjct: 240 ERRKEGSFINKSLLTLGTVISKLSEGKNSGHIPYRDSKLTRILQPSLSGNARTAIICTIS 299

Query: 397 PASSSMEETHNTLKFASRAKRV 418
           PASS +EET NTLKFASRAK+V
Sbjct: 300 PASSHVEETLNTLKFASRAKKV 321

This catalytic (head) domain has ATPase activity and belongs to the larger group of P-loop NTPases. Kinesins are microtubule-dependent molecular motors that play important roles in intracellular transport and in cell division. In most kinesins, the motor domain is found at the N-terminus (N-type). N-type kinesins are (+) end-directed motors, i.e. they transport cargo towards the (+) end of the microtubule. Kinesin motor domains hydrolyze ATP at a rate of about 80 per second, and move along the microtubule at a speed of about 6400 Angstroms per second. To achieve that, kinesin head groups work in pairs. Upon replacing ADP with ATP, a kinesin motor domain increases its affinity for microtubule binding and locks in place. Also, the neck linker binds to the motor domain, which repositions the other head domain through the coiled-coil domain close to a second tubulin dimer, about 80 Angstroms along the microtubule. Meanwhile, ATP hydrolysis takes place, and when the second head domain binds to the microtubule, the first domain again replaces ADP with ATP, triggering a conformational change that pulls the first domain forward. Length = 321

>gnl\|CDD\|215803 pfam00225, Kinesin, Kinesin motor domain	Back alignment and domain information

>gnl\|CDD\|214526 smart00129, KISc, Kinesin motor, catalytic domain	Back alignment and domain information

>gnl\|CDD\|238054 cd00106, KISc, Kinesin motor domain	Back alignment and domain information

>gnl\|CDD\|238665 cd01369, KISc_KHC_KIF5, Kinesin motor domain, kinesin heavy chain (KHC) or KIF5-like subgroup	Back alignment and domain information

>gnl\|CDD\|238667 cd01371, KISc_KIF3, Kinesin motor domain, kinesins II or KIF3_like proteins	Back alignment and domain information

>gnl\|CDD\|238668 cd01372, KISc_KIF4, Kinesin motor domain, KIF4-like subfamily	Back alignment and domain information

>gnl\|CDD\|238666 cd01370, KISc_KIP3_like, Kinesin motor domain, KIP3-like subgroup	Back alignment and domain information

>gnl\|CDD\|238660 cd01364, KISc_BimC_Eg5, Kinesin motor domain, BimC/Eg5 spindle pole proteins, participate in spindle assembly and chromosome segregation during cell division	Back alignment and domain information

>gnl\|CDD\|238661 cd01365, KISc_KIF1A_KIF1B, Kinesin motor domain, KIF1_like proteins	Back alignment and domain information

>gnl\|CDD\|238662 cd01366, KISc_C_terminal, Kinesin motor domain, KIFC2/KIFC3/ncd-like carboxy-terminal kinesins	Back alignment and domain information

>gnl\|CDD\|238669 cd01373, KISc_KLP2_like, Kinesin motor domain, KLP2-like subgroup	Back alignment and domain information

>gnl\|CDD\|227392 COG5059, KIP1, Kinesin-like protein [Cytoskeleton]	Back alignment and domain information

>gnl\|CDD\|238664 cd01368, KISc_KIF23_like, Kinesin motor domain, KIF23-like subgroup	Back alignment and domain information

>gnl\|CDD\|238663 cd01367, KISc_KIF2_like, Kinesin motor domain, KIF2-like group	Back alignment and domain information

>gnl\|CDD\|238672 cd01376, KISc_KID_like, Kinesin motor domain, KIF22/Kid-like subgroup	Back alignment and domain information

>gnl\|CDD\|238671 cd01375, KISc_KIF9_like, Kinesin motor domain, KIF9-like subgroup; might play a role in cell shape remodeling	Back alignment and domain information

>gnl\|CDD\|215621 PLN03188, PLN03188, kinesin-12 family protein; Provisional	Back alignment and domain information

>gnl\|CDD\|238659 cd01363, Motor_domain, Myosin and Kinesin motor domain	Back alignment and domain information

>gnl\|CDD\|222454 pfam13920, zf-C3HC4_3, Zinc finger, C3HC4 type (RING finger)	Back alignment and domain information

>gnl\|CDD\|238659 cd01363, Motor_domain, Myosin and Kinesin motor domain	Back alignment and domain information

>gnl\|CDD\|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type	Back alignment and domain information

>gnl\|CDD\|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning]	Back alignment and domain information

>gnl\|CDD\|206094 pfam13923, zf-C3HC4_2, Zinc finger, C3HC4 type (RING finger)	Back alignment and domain information

>gnl|CDD|238093 cd00162, RING, RING-finger (Really Interesting New Gene) domain, a specialized type of Zn-finger of 40 to 60 residues that binds two atoms of zinc; defined by the 'cross-brace' motif C-X2-C-X(9-39)-C-X(1-3)- H-X(2-3)-(N/C/H)-X2-C-X(4-48)C-X2-C; probably involved in mediating protein-protein interactions; identified in a proteins with a wide range of functions such as viral replication, signal transduction, and development; has two variants, the C3HC4-type and a C3H2C3-type (RING-H2 finger), which have different cysteine/histidine pattern; a subset of RINGs are associated with B-Boxes (C-X2-H-X7-C-X7-C-X2-C-H-X2-H)

Back alignment and domain information

>gnl\|CDD\|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning]	Back alignment and domain information

>gnl\|CDD\|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning]	Back alignment and domain information

>gnl\|CDD\|222279 pfam13639, zf-RING_2, Ring finger domain	Back alignment and domain information

>gnl\|CDD\|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type	Back alignment and domain information

>gnl\|CDD\|214546 smart00184, RING, Ring finger	Back alignment and domain information

>gnl\|CDD\|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type	Back alignment and domain information

>gnl\|CDD\|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type	Back alignment and domain information

>gnl\|CDD\|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type	Back alignment and domain information

>gnl\|CDD\|225288 COG2433, COG2433, Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>gnl\|CDD\|223496 COG0419, SbcC, ATPase involved in DNA repair [DNA replication, recombination, and repair]	Back alignment and domain information

>gnl\|CDD\|217817 pfam03961, DUF342, Protein of unknown function (DUF342)	Back alignment and domain information

>gnl\|CDD\|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type	Back alignment and domain information

>gnl\|CDD\|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type	Back alignment and domain information

>gnl\|CDD\|223496 COG0419, SbcC, ATPase involved in DNA repair [DNA replication, recombination, and repair]	Back alignment and domain information

>gnl\|CDD\|226809 COG4372, COG4372, Uncharacterized protein conserved in bacteria with the myosin-like domain [Function unknown]	Back alignment and domain information

Conserved Domains Detected by HHsearch

Original result of HHsearch against CDD database

ID	Alignment Graph	Length	Definition	Probability
Query		1100
KOG0243		1041	consensus Kinesin-like protein [Cytoskeleton]	100.0
KOG0245		1221	consensus Kinesin-like protein [Cytoskeleton]	100.0
PLN03188		1320	kinesin-12 family protein; Provisional	100.0
KOG4280		574	consensus Kinesin-like protein [Cytoskeleton]	100.0
KOG0242		675	consensus Kinesin-like protein [Cytoskeleton]	100.0
KOG0240		607	consensus Kinesin (SMY1 subfamily) [Cytoskeleton]	100.0
KOG0241		1714	consensus Kinesin-like protein [Cytoskeleton]	100.0
cd01373		337	KISc_KLP2_like Kinesin motor domain, KLP2-like sub	100.0
cd01370		338	KISc_KIP3_like Kinesin motor domain, KIP3-like sub	100.0
cd01368		345	KISc_KIF23_like Kinesin motor domain, KIF23-like s	100.0
cd01365		356	KISc_KIF1A_KIF1B Kinesin motor domain, KIF1_like p	100.0
cd01371		333	KISc_KIF3 Kinesin motor domain, kinesins II or KIF	100.0
cd01374		321	KISc_CENP_E Kinesin motor domain, CENP-E/KIP2-like	100.0
cd01367		322	KISc_KIF2_like Kinesin motor domain, KIF2-like gro	100.0
cd01364		352	KISc_BimC_Eg5 Kinesin motor domain, BimC/Eg5 spind	100.0
cd01369		325	KISc_KHC_KIF5 Kinesin motor domain, kinesin heavy	100.0
cd01376		319	KISc_KID_like Kinesin motor domain, KIF22/Kid-like	100.0
cd01375		334	KISc_KIF9_like Kinesin motor domain, KIF9-like sub	100.0
cd01372		341	KISc_KIF4 Kinesin motor domain, KIF4-like subfamil	100.0
cd01366		329	KISc_C_terminal Kinesin motor domain, KIFC2/KIFC3/	100.0
smart00129		335	KISc Kinesin motor, catalytic domain. ATPase. Micr	100.0
KOG0239		670	consensus Kinesin (KAR3 subfamily) [Cytoskeleton]	100.0
cd00106		328	KISc Kinesin motor domain. This catalytic (head) d	100.0
KOG0246		676	consensus Kinesin-like protein [Cytoskeleton]	100.0
PF00225		335	Kinesin: Kinesin motor domain; InterPro: IPR001752	100.0
KOG0244		913	consensus Kinesin-like protein [Cytoskeleton]	100.0
KOG0247		809	consensus Kinesin-like protein [Cytoskeleton]	100.0
COG5059		568	KIP1 Kinesin-like protein [Cytoskeleton]	100.0
cd01363		186	Motor_domain Myosin and Kinesin motor domain. Thes	100.0
KOG0161		1930	consensus Myosin class II heavy chain [Cytoskeleto	99.96
PF01576		859	Myosin_tail_1: Myosin tail; InterPro: IPR002928 Mu	99.93
KOG0978		698	consensus E3 ubiquitin ligase involved in syntaxin	99.61
KOG4265		349	consensus Predicted E3 ubiquitin ligase [Posttrans	99.22
KOG4172		62	consensus Predicted E3 ubiquitin ligase [Posttrans	99.05
KOG0612		1317	consensus Rho-associated, coiled-coil containing p	99.01
KOG0977		546	consensus Nuclear envelope protein lamin, intermed	98.99
KOG4275		350	consensus Predicted E3 ubiquitin ligase [Posttrans	98.88
KOG0161		1930	consensus Myosin class II heavy chain [Cytoskeleto	98.84
PF13920		50	zf-C3HC4_3: Zinc finger, C3HC4 type (RING finger);	98.82
KOG1571		355	consensus Predicted E3 ubiquitin ligase [Posttrans	98.73
TIGR02168		1179	SMC_prok_B chromosome segregation protein SMC, com	98.71
PF00038		312	Filament: Intermediate filament protein; InterPro:	98.7
PRK02224		880	chromosome segregation protein; Provisional	98.69
KOG0971		1243	consensus Microtubule-associated protein dynactin	98.69
PF07888		546	CALCOCO1: Calcium binding and coiled-coil domain (	98.68
TIGR02169		1164	SMC_prok_A chromosome segregation protein SMC, pri	98.55
COG1196		1163	Smc Chromosome segregation ATPases [Cell division	98.55
TIGR02169		1164	SMC_prok_A chromosome segregation protein SMC, pri	98.54
TIGR02168		1179	SMC_prok_B chromosome segregation protein SMC, com	98.53
PF10174		775	Cast: RIM-binding protein of the cytomatrix active	98.49
PRK02224		880	chromosome segregation protein; Provisional	98.48
KOG0976		1265	consensus Rho/Rac1-interacting serine/threonine ki	98.45
KOG1100		207	consensus Predicted E3 ubiquitin ligase [Posttrans	98.42
PF07888		546	CALCOCO1: Calcium binding and coiled-coil domain (	98.41
KOG4674		1822	consensus Uncharacterized conserved coiled-coil pr	98.35
KOG0933		1174	consensus Structural maintenance of chromosome pro	98.34
PF12128		1201	DUF3584: Protein of unknown function (DUF3584); In	98.28
PF10174		775	Cast: RIM-binding protein of the cytomatrix active	98.28
COG1196		1163	Smc Chromosome segregation ATPases [Cell division	98.27
KOG4643		1195	consensus Uncharacterized coiled-coil protein [Fun	98.25
KOG0823		230	consensus Predicted E3 ubiquitin ligase [Posttrans	98.25
TIGR00606		1311	rad50 rad50. This family is based on the phylogeno	98.23
KOG0976		1265	consensus Rho/Rac1-interacting serine/threonine ki	98.21
PF01576		859	Myosin_tail_1: Myosin tail; InterPro: IPR002928 Mu	98.21
TIGR00606		1311	rad50 rad50. This family is based on the phylogeno	98.2
KOG0971		1243	consensus Microtubule-associated protein dynactin	98.18
KOG0994		1758	consensus Extracellular matrix glycoprotein Lamini	98.17
PF15070		617	GOLGA2L5: Putative golgin subfamily A member 2-lik	98.17
KOG0996		1293	consensus Structural maintenance of chromosome pro	98.15
KOG0964		1200	consensus Structural maintenance of chromosome pro	98.12
PF12128		1201	DUF3584: Protein of unknown function (DUF3584); In	98.12
PF00261		237	Tropomyosin: Tropomyosin; InterPro: IPR000533 Trop	98.03
PLN03208		193	E3 ubiquitin-protein ligase RMA2; Provisional	98.02
PF00038		312	Filament: Intermediate filament protein; InterPro:	98.0
KOG4673		961	consensus Transcription factor TMF, TATA element m	98.0
KOG4643		1195	consensus Uncharacterized coiled-coil protein [Fun	97.99
KOG4673		961	consensus Transcription factor TMF, TATA element m	97.96
KOG0612		1317	consensus Rho-associated, coiled-coil containing p	97.95
KOG0933		1174	consensus Structural maintenance of chromosome pro	97.9
KOG0317		293	consensus Predicted E3 ubiquitin ligase, integral	97.89
KOG0250		1074	consensus DNA repair protein RAD18 (SMC family pro	97.88
KOG4674		1822	consensus Uncharacterized conserved coiled-coil pr	97.87
PRK11637		428	AmiB activator; Provisional	97.86
KOG0995		581	consensus Centromere-associated protein HEC1 [Cell	97.84
PRK03918		880	chromosome segregation protein; Provisional	97.84
PF05701		522	WEMBL: Weak chloroplast movement under blue light;	97.83
PRK11281		1113	hypothetical protein; Provisional	97.78
COG1340		294	Uncharacterized archaeal coiled-coil protein [Func	97.78
KOG0996		1293	consensus Structural maintenance of chromosome pro	97.77
PRK04778		569	septation ring formation regulator EzrA; Provision	97.76
PRK03918		880	chromosome segregation protein; Provisional	97.76
PF14662		193	CCDC155: Coiled-coil region of CCDC155	97.75
KOG0250		1074	consensus DNA repair protein RAD18 (SMC family pro	97.75
KOG0977		546	consensus Nuclear envelope protein lamin, intermed	97.74
PHA02562		562	46 endonuclease subunit; Provisional	97.71
PF15070		617	GOLGA2L5: Putative golgin subfamily A member 2-lik	97.71
PHA02562		562	46 endonuclease subunit; Provisional	97.7
PF09726		697	Macoilin: Transmembrane protein; InterPro: IPR0191	97.67
PF09730		717	BicD: Microtubule-associated protein Bicaudal-D; I	97.67
PRK04863		1486	mukB cell division protein MukB; Provisional	97.66
PRK04778		569	septation ring formation regulator EzrA; Provision	97.66
PRK10929		1109	putative mechanosensitive channel protein; Provisi	97.65
PRK04863		1486	mukB cell division protein MukB; Provisional	97.65
PHA02929		238	N1R/p28-like protein; Provisional	97.64
COG5059		568	KIP1 Kinesin-like protein [Cytoskeleton]	97.63
KOG0320		187	consensus Predicted E3 ubiquitin ligase [Posttrans	97.63
PF13923		39	zf-C3HC4_2: Zinc finger, C3HC4 type (RING finger);	97.62
PF14662		193	CCDC155: Coiled-coil region of CCDC155	97.62
KOG2164		513	consensus Predicted E3 ubiquitin ligase [Posttrans	97.61
PRK11637		428	AmiB activator; Provisional	97.6
PF00261		237	Tropomyosin: Tropomyosin; InterPro: IPR000533 Trop	97.6
PF14634		44	zf-RING_5: zinc-RING finger domain	97.6
COG4372		499	Uncharacterized protein conserved in bacteria with	97.56
PF05483		786	SCP-1: Synaptonemal complex protein 1 (SCP-1); Int	97.55
PF05701		522	WEMBL: Weak chloroplast movement under blue light;	97.55
KOG0963		629	consensus Transcription factor/CCAAT displacement	97.54
COG4942		420	Membrane-bound metallopeptidase [Cell division and	97.52
PF09726		697	Macoilin: Transmembrane protein; InterPro: IPR0191	97.49
KOG0018		1141	consensus Structural maintenance of chromosome pro	97.49
PF04849		306	HAP1_N: HAP1 N-terminal conserved region; InterPro	97.48
KOG0994		1758	consensus Extracellular matrix glycoprotein Lamini	97.42
KOG1029		1118	consensus Endocytic adaptor protein intersectin [S	97.41
PF05483		786	SCP-1: Synaptonemal complex protein 1 (SCP-1); Int	97.38
COG1579		239	Zn-ribbon protein, possibly nucleic acid-binding [	97.37
PF09730		717	BicD: Microtubule-associated protein Bicaudal-D; I	97.36
KOG0964		1200	consensus Structural maintenance of chromosome pro	97.36
PF09789		319	DUF2353: Uncharacterized coiled-coil protein (DUF2	97.33
PHA02926		242	zinc finger-like protein; Provisional	97.3
PF13639		44	zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C	97.3
KOG0999		772	consensus Microtubule-associated protein Bicaudal-	97.28
KOG0963		629	consensus Transcription factor/CCAAT displacement	97.27
PF05622		713	HOOK: HOOK protein; InterPro: IPR008636 This famil	97.24
COG4942		420	Membrane-bound metallopeptidase [Cell division and	97.23
TIGR00599		397	rad18 DNA repair protein rad18. This family is bas	97.22
PF06160		560	EzrA: Septation ring formation regulator, EzrA ; I	97.22
PRK01156		895	chromosome segregation protein; Provisional	97.16
KOG0018		1141	consensus Structural maintenance of chromosome pro	97.15
KOG0999		772	consensus Microtubule-associated protein Bicaudal-	97.14
KOG0287		442	consensus Postreplication repair protein RAD18 [Re	97.13
PRK01156		895	chromosome segregation protein; Provisional	97.12
PF06160		560	EzrA: Septation ring formation regulator, EzrA ; I	97.11
COG5574		271	PEX10 RING-finger-containing E3 ubiquitin ligase [	97.09
COG5432		391	RAD18 RING-finger-containing E3 ubiquitin ligase [	97.07
KOG4593		716	consensus Mitotic checkpoint protein MAD1 [Cell cy	97.06
PF14447		55	Prok-RING_4: Prokaryotic RING finger family 4	97.04
PF05557		722	MAD: Mitotic checkpoint protein; InterPro: IPR0086	97.01
KOG1029		1118	consensus Endocytic adaptor protein intersectin [S	97.0
smart00184		39	RING Ring finger. E3 ubiquitin-protein ligase acti	96.99
PF15227		42	zf-C3HC4_4: zinc finger of C3HC4-type, RING; PDB:	96.98
cd00162		45	RING RING-finger (Really Interesting New Gene) dom	96.96
KOG0980		980	consensus Actin-binding protein SLA2/Huntingtin-in	96.95
KOG0978		698	consensus E3 ubiquitin ligase involved in syntaxin	96.95
KOG1785		563	consensus Tyrosine kinase negative regulator CBL [	96.88
PF05557		722	MAD: Mitotic checkpoint protein; InterPro: IPR0086	96.87
PF00097		41	zf-C3HC4: Zinc finger, C3HC4 type (RING finger); I	96.85
PF05667		594	DUF812: Protein of unknown function (DUF812); Inte	96.84
COG4372		499	Uncharacterized protein conserved in bacteria with	96.76
PF05622		713	HOOK: HOOK protein; InterPro: IPR008636 This famil	96.76
KOG0946		970	consensus ER-Golgi vesicle-tethering protein p115	96.75
KOG4692		489	consensus Predicted E3 ubiquitin ligase [Posttrans	96.7
smart00504		63	Ubox Modified RING finger domain. Modified RING fi	96.7
KOG0962		1294	consensus DNA repair protein RAD50, ABC-type ATPas	96.69
PF15397		258	DUF4618: Domain of unknown function (DUF4618)	96.68
KOG0946		970	consensus ER-Golgi vesicle-tethering protein p115	96.55
PF08826		61	DMPK_coil: DMPK coiled coil domain like; InterPro:	96.54
COG1579		239	Zn-ribbon protein, possibly nucleic acid-binding [	96.5
COG1340		294	Uncharacterized archaeal coiled-coil protein [Func	96.49
KOG1003		205	consensus Actin filament-coating protein tropomyos	96.48
COG0419		908	SbcC ATPase involved in DNA repair [DNA replicatio	96.47
PF06818		202	Fez1: Fez1; InterPro: IPR009638 This family repres	96.47
COG5540		374	RING-finger-containing ubiquitin ligase [Posttrans	96.46
KOG0980		980	consensus Actin-binding protein SLA2/Huntingtin-in	96.44
COG5185		622	HEC1 Protein involved in chromosome segregation, i	96.42
PF13445		43	zf-RING_UBOX: RING-type zinc-finger; PDB: 2CT2_A.	96.37
PRK11281		1113	hypothetical protein; Provisional	96.36
PF15619		194	Lebercilin: Ciliary protein causing Leber congenit	96.35
PF05667		594	DUF812: Protein of unknown function (DUF812); Inte	96.35
PRK10929		1109	putative mechanosensitive channel protein; Provisi	96.31
KOG0249		916	consensus LAR-interacting protein and related prot	96.29
PF15619		194	Lebercilin: Ciliary protein causing Leber congenit	96.29
PRK09039		343	hypothetical protein; Validated	96.29
COG5236		493	Uncharacterized conserved protein, contains RING Z	96.27
PF06785		401	UPF0242: Uncharacterised protein family (UPF0242);	96.14
KOG0995		581	consensus Centromere-associated protein HEC1 [Cell	96.12
PF09755		310	DUF2046: Uncharacterized conserved protein H4 (DUF	96.11
COG5152		259	Uncharacterized conserved protein, contains RING a	96.08
PF14835		65	zf-RING_6: zf-RING of BARD1-type protein; PDB: 1JM	96.04
PF04849		306	HAP1_N: HAP1 N-terminal conserved region; InterPro	96.02
KOG4593		716	consensus Mitotic checkpoint protein MAD1 [Cell cy	96.0
PRK09039		343	hypothetical protein; Validated	95.96
PF07926		132	TPR_MLP1_2: TPR/MLP1/MLP2-like protein; InterPro:	95.9
PF14915		305	CCDC144C: CCDC144C protein coiled-coil region	95.88
PF15254		861	CCDC14: Coiled-coil domain-containing protein 14	95.84
PLN02939		977	transferase, transferring glycosyl groups	95.81
PF12718		143	Tropomyosin_1: Tropomyosin like; InterPro: IPR0005	95.8
KOG1813		313	consensus Predicted E3 ubiquitin ligase [Posttrans	95.76
COG5185		622	HEC1 Protein involved in chromosome segregation, i	95.71
KOG1853		333	consensus LIS1-interacting protein NUDE [Cytoskele	95.67
KOG1850		391	consensus Myosin-like coiled-coil protein [Cytoske	95.65
KOG2177		386	consensus Predicted E3 ubiquitin ligase [Posttrans	95.64
PF12718		143	Tropomyosin_1: Tropomyosin like; InterPro: IPR0005	95.56
TIGR03185		650	DNA_S_dndD DNA sulfur modification protein DndD. T	95.49
COG5243		491	HRD1 HRD ubiquitin ligase complex, ER membrane com	95.39
KOG1853		333	consensus LIS1-interacting protein NUDE [Cytoskele	95.29
TIGR02680		1353	conserved hypothetical protein TIGR02680. Members	95.27
PF12678		73	zf-rbx1: RING-H2 zinc finger; InterPro: IPR024766	95.27
PF08614		194	ATG16: Autophagy protein 16 (ATG16); InterPro: IPR	95.27
TIGR02680		1353	conserved hypothetical protein TIGR02680. Members	95.16
PF09787		511	Golgin_A5: Golgin subfamily A member 5; InterPro:	95.15
KOG0249		916	consensus LAR-interacting protein and related prot	95.13
PF05010		207	TACC: Transforming acidic coiled-coil-containing p	94.99
KOG0979		1072	consensus Structural maintenance of chromosome pro	94.96
PF15254		861	CCDC14: Coiled-coil domain-containing protein 14	94.83
PF07111		739	HCR: Alpha helical coiled-coil rod protein (HCR);	94.81
PF09728		309	Taxilin: Myosin-like coiled-coil protein; InterPro	94.79
KOG4628		348	consensus Predicted E3 ubiquitin ligase [Posttrans	94.78
KOG1937		521	consensus Uncharacterized conserved protein [Funct	94.75
PF04564		73	U-box: U-box domain; InterPro: IPR003613 Quality c	94.67
KOG4809		654	consensus Rab6 GTPase-interacting protein involved	94.65
PF13514		1111	AAA_27: AAA domain	94.65
PF09738		302	DUF2051: Double stranded RNA binding protein (DUF2	94.64
PF14988		206	DUF4515: Domain of unknown function (DUF4515)	94.64
KOG4159		398	consensus Predicted E3 ubiquitin ligase [Posttrans	94.57
KOG4809		654	consensus Rab6 GTPase-interacting protein involved	94.43
PF08317		325	Spc7: Spc7 kinetochore protein; InterPro: IPR01325	94.4
smart00787		312	Spc7 Spc7 kinetochore protein. This domain is foun	94.39
PF10473		140	CENP-F_leu_zip: Leucine-rich repeats of kinetochor	94.32
COG0556		663	UvrB Helicase subunit of the DNA excision repair c	94.19
KOG2113		394	consensus Predicted RNA binding protein, contains	94.1
PF04012		221	PspA_IM30: PspA/IM30 family; InterPro: IPR007157 T	93.99
TIGR03007		498	pepcterm_ChnLen polysaccharide chain length determ	93.98
COG3883		265	Uncharacterized protein conserved in bacteria [Fun	93.95
KOG2879		298	consensus Predicted E3 ubiquitin ligase [Posttrans	93.94
COG3883		265	Uncharacterized protein conserved in bacteria [Fun	93.92
PF10481		307	CENP-F_N: Cenp-F N-terminal domain; InterPro: IPR0	93.91
TIGR03007		498	pepcterm_ChnLen polysaccharide chain length determ	93.83
KOG0802		543	consensus E3 ubiquitin ligase [Posttranslational m	93.7
PF15066		527	CAGE1: Cancer-associated gene protein 1 family	93.69
PF00308		219	Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013	93.64
PF05911		769	DUF869: Plant protein of unknown function (DUF869)	93.57
KOG4360		596	consensus Uncharacterized coiled coil protein [Fun	93.57
KOG0962		1294	consensus DNA repair protein RAD50, ABC-type ATPas	93.53
smart00787		312	Spc7 Spc7 kinetochore protein. This domain is foun	93.49
PF10481		307	CENP-F_N: Cenp-F N-terminal domain; InterPro: IPR0	93.47
PF07926		132	TPR_MLP1_2: TPR/MLP1/MLP2-like protein; InterPro:	93.47
PF06008		264	Laminin_I: Laminin Domain I; InterPro: IPR009254 L	93.19
PF10473		140	CENP-F_leu_zip: Leucine-rich repeats of kinetochor	93.17
PF08317		325	Spc7: Spc7 kinetochore protein; InterPro: IPR01325	93.12
PF13514		1111	AAA_27: AAA domain	93.05
TIGR01843		423	type_I_hlyD type I secretion membrane fusion prote	92.97
COG4477		570	EzrA Negative regulator of septation ring formatio	92.93
TIGR01005		754	eps_transp_fam exopolysaccharide transport protein	92.85
KOG0311		381	consensus Predicted E3 ubiquitin ligase [Posttrans	92.84
PF10267		395	Tmemb_cc2: Predicted transmembrane and coiled-coil	92.8
PF06785		401	UPF0242: Uncharacterised protein family (UPF0242);	92.77
PF04641		260	Rtf2: Rtf2 RING-finger	92.74
KOG4807		593	consensus F-actin binding protein, regulates actin	92.68
PF09789		319	DUF2353: Uncharacterized coiled-coil protein (DUF2	92.67
PF15450		531	DUF4631: Domain of unknown function (DUF4631)	92.65
PRK06893		229	DNA replication initiation factor; Validated	92.57
KOG4360		596	consensus Uncharacterized coiled coil protein [Fun	92.5
PF13851		201	GAS: Growth-arrest specific micro-tubule binding	92.5
KOG0825		1134	consensus PHD Zn-finger protein [General function	92.49
PRK14086		617	dnaA chromosomal replication initiation protein; P	92.45
KOG1003		205	consensus Actin filament-coating protein tropomyos	92.38
PRK06620		214	hypothetical protein; Validated	92.31
PF13870		177	DUF4201: Domain of unknown function (DUF4201)	92.26
PRK10884		206	SH3 domain-containing protein; Provisional	92.1
PF05010		207	TACC: Transforming acidic coiled-coil-containing p	91.95
PF14915		305	CCDC144C: CCDC144C protein coiled-coil region	91.94
COG2804		500	PulE Type II secretory pathway, ATPase PulE/Tfp pi	91.93
KOG1039		344	consensus Predicted E3 ubiquitin ligase [Posttrans	91.89
TIGR01843		423	type_I_hlyD type I secretion membrane fusion prote	91.82
KOG1001		674	consensus Helicase-like transcription factor HLTF/	91.79
PF10498		359	IFT57: Intra-flagellar transport protein 57 ; Inte	91.76
PRK10884		206	SH3 domain-containing protein; Provisional	91.7
KOG0828		636	consensus Predicted E3 ubiquitin ligase [Posttrans	91.58
PF07111		739	HCR: Alpha helical coiled-coil rod protein (HCR);	91.43
PF12325		120	TMF_TATA_bd: TATA element modulatory factor 1 TATA	91.31
PF08614		194	ATG16: Autophagy protein 16 (ATG16); InterPro: IPR	91.28
KOG4302		660	consensus Microtubule-associated protein essential	91.1
PF13870		177	DUF4201: Domain of unknown function (DUF4201)	91.07
PF14988		206	DUF4515: Domain of unknown function (DUF4515)	91.04
PF06005		72	DUF904: Protein of unknown function (DUF904); Inte	91.0
COG2805		353	PilT Tfp pilus assembly protein, pilus retraction	90.93
KOG0993		542	consensus Rab5 GTPase effector Rabaptin-5 [Intrace	90.92
KOG2991		330	consensus Splicing regulator [RNA processing and m	90.92
PF15035		182	Rootletin: Ciliary rootlet component, centrosome c	90.75
COG4913		1104	Uncharacterized protein conserved in bacteria [Fun	90.71
KOG3002		299	consensus Zn finger protein [General function pred	90.69
KOG1814		445	consensus Predicted E3 ubiquitin ligase [Posttrans	90.6
KOG2129		552	consensus Uncharacterized conserved protein H4 [Fu	90.37
PF05911		769	DUF869: Plant protein of unknown function (DUF869)	90.33
PF12861		85	zf-Apc11: Anaphase-promoting complex subunit 11 RI	90.32
KOG0982		502	consensus Centrosomal protein Nuf [Cell cycle cont	90.2
PF13851		201	GAS: Growth-arrest specific micro-tubule binding	90.18
KOG2991		330	consensus Splicing regulator [RNA processing and m	90.18
PF10168		717	Nup88: Nuclear pore component; InterPro: IPR019321	90.16
TIGR01005		754	eps_transp_fam exopolysaccharide transport protein	90.14
KOG4787		852	consensus Uncharacterized conserved protein [Funct	90.11
PF10168		717	Nup88: Nuclear pore component; InterPro: IPR019321	90.05
PF09787		511	Golgin_A5: Golgin subfamily A member 5; InterPro:	89.95
PF09755		310	DUF2046: Uncharacterized conserved protein H4 (DUF	89.81
KOG1103		561	consensus Predicted coiled-coil protein [Function	89.79
KOG1899		861	consensus LAR transmembrane tyrosine phosphatase-i	89.61
PF04111		314	APG6: Autophagy protein Apg6; InterPro: IPR007243	89.59
PF04156		191	IncA: IncA protein; InterPro: IPR007285 Chlamydia	89.55
PRK06835		329	DNA replication protein DnaC; Validated	89.25
PF06818		202	Fez1: Fez1; InterPro: IPR009638 This family repres	89.24
PRK12377		248	putative replication protein; Provisional	89.01
PRK10361		475	DNA recombination protein RmuC; Provisional	88.98
PRK00149		450	dnaA chromosomal replication initiation protein; R	88.95
TIGR03017		444	EpsF chain length determinant protein EpsF. Sequen	88.88
PRK06526		254	transposase; Provisional	88.69
PRK08084		235	DNA replication initiation factor; Provisional	88.66
PRK08116		268	hypothetical protein; Validated	88.65
PLN03229		762	acetyl-coenzyme A carboxylase carboxyl transferase	88.55
PRK05642		234	DNA replication initiation factor; Validated	88.53
PRK10869		553	recombination and repair protein; Provisional	88.53
PF04111		314	APG6: Autophagy protein Apg6; InterPro: IPR007243	88.5
KOG0579		1187	consensus Ste20-like serine/threonine protein kina	88.41
PF11932		251	DUF3450: Protein of unknown function (DUF3450); In	88.41
PF00769		246	ERM: Ezrin/radixin/moesin family; InterPro: IPR011	88.36
PF12795		240	MscS_porin: Mechanosensitive ion channel porin dom	88.29
PF15397		258	DUF4618: Domain of unknown function (DUF4618)	88.28
KOG4807		593	consensus F-actin binding protein, regulates actin	88.23
COG0593		408	DnaA ATPase involved in DNA replication initiation	88.09
PRK10698		222	phage shock protein PspA; Provisional	88.07
KOG3039		303	consensus Uncharacterized conserved protein [Funct	88.01
PRK14088		440	dnaA chromosomal replication initiation protein; P	87.86
PRK14087		450	dnaA chromosomal replication initiation protein; P	87.85
PRK09087		226	hypothetical protein; Validated	87.81
PF15450		531	DUF4631: Domain of unknown function (DUF4631)	87.72
KOG0243		1041	consensus Kinesin-like protein [Cytoskeleton]	87.58
PF14197		69	Cep57_CLD_2: Centrosome localisation domain of PPC	87.34
PF07058		351	Myosin_HC-like: Myosin II heavy chain-like; InterP	87.15
KOG1002		791	consensus Nucleotide excision repair protein RAD16	87.0
PF15066		527	CAGE1: Cancer-associated gene protein 1 family	86.92
TIGR00634		563	recN DNA repair protein RecN. All proteins in this	86.91
TIGR00362		405	DnaA chromosomal replication initiator protein Dna	86.75
PF09728		309	Taxilin: Myosin-like coiled-coil protein; InterPro	86.7
KOG0240		607	consensus Kinesin (SMY1 subfamily) [Cytoskeleton]	86.62
PF10186		302	Atg14: UV radiation resistance protein and autopha	86.46
PF06005		72	DUF904: Protein of unknown function (DUF904); Inte	86.3
PRK07952		244	DNA replication protein DnaC; Validated	86.15
TIGR00618		1042	sbcc exonuclease SbcC. This family is based on the	86.04
COG1474		366	CDC6 Cdc6-related protein, AAA superfamily ATPase	86.01
PF11932		251	DUF3450: Protein of unknown function (DUF3450); In	85.98
PF00769		246	ERM: Ezrin/radixin/moesin family; InterPro: IPR011	85.79
PF15294		278	Leu_zip: Leucine zipper	85.73
PRK08903		227	DnaA regulatory inactivator Hda; Validated	85.62
KOG4677		554	consensus Golgi integral membrane protein [Intrace	85.52
PRK10246		1047	exonuclease subunit SbcC; Provisional	85.4
TIGR02977		219	phageshock_pspA phage shock protein A. Members of	85.39
TIGR03420		226	DnaA_homol_Hda DnaA regulatory inactivator Hda. Me	85.37
COG4026		290	Uncharacterized protein containing TOPRIM domain,	85.35
COG1842		225	PspA Phage shock protein A (IM30), suppresses sigm	85.31
COG2433		652	Uncharacterized conserved protein [Function unknow	85.24
KOG0804		493	consensus Cytoplasmic Zn-finger protein BRAP2 (BRC	85.07
TIGR02449		65	conserved hypothetical protein TIGR02449. Members	84.97
TIGR03017		444	EpsF chain length determinant protein EpsF. Sequen	84.73
PF12325		120	TMF_TATA_bd: TATA element modulatory factor 1 TATA	84.69
KOG2685		421	consensus Cystoskeletal protein Tektin [Cytoskelet	84.61
KOG0239		670	consensus Kinesin (KAR3 subfamily) [Cytoskeleton]	84.44
PF08826		61	DMPK_coil: DMPK coiled coil domain like; InterPro:	84.43
TIGR02928		365	orc1/cdc6 family replication initiation protein. M	84.38
PRK08181		269	transposase; Validated	84.35
PF04912		388	Dynamitin: Dynamitin ; InterPro: IPR006996 Dynamit	84.27
KOG0804		493	consensus Cytoplasmic Zn-finger protein BRAP2 (BRC	83.96
KOG2113		394	consensus Predicted RNA binding protein, contains	83.8
PF15290		305	Syntaphilin: Golgi-localised syntaxin-1-binding cl	83.64
TIGR01000		457	bacteriocin_acc bacteriocin secretion accessory pr	83.53
PF14992		280	TMCO5: TMCO5 family	83.48
COG0497		557	RecN ATPase involved in DNA repair [DNA replicatio	83.38
PRK08939		306	primosomal protein DnaI; Reviewed	83.38
COG4913		1104	Uncharacterized protein conserved in bacteria [Fun	83.37
KOG2077		832	consensus JNK/SAPK-associated protein-1 [Signal tr	83.24
PF03148		384	Tektin: Tektin family; InterPro: IPR000435 Tektin	83.21
PRK00411		394	cdc6 cell division control protein 6; Reviewed	83.19
PF05276		239	SH3BP5: SH3 domain-binding protein 5 (SH3BP5); Int	82.98
PLN03188		1320	kinesin-12 family protein; Provisional	82.92
PRK08727		233	hypothetical protein; Validated	82.85
COG0497		557	RecN ATPase involved in DNA repair [DNA replicatio	82.79
PLN03229		762	acetyl-coenzyme A carboxylase carboxyl transferase	82.76
TIGR03185		650	DNA_S_dndD DNA sulfur modification protein DndD. T	82.72
KOG1103		561	consensus Predicted coiled-coil protein [Function	82.7
PLN00020		413	ribulose bisphosphate carboxylase/oxygenase activa	82.57
KOG1962		216	consensus B-cell receptor-associated protein and r	81.89
PF12795		240	MscS_porin: Mechanosensitive ion channel porin dom	81.86
PF04851		184	ResIII: Type III restriction enzyme, res subunit;	81.84
COG2433		652	Uncharacterized conserved protein [Function unknow	81.75
COG5175		480	MOT2 Transcriptional repressor [Transcription]	81.43
PRK15422		79	septal ring assembly protein ZapB; Provisional	81.21
COG3074		79	Uncharacterized protein conserved in bacteria [Fun	81.16
PF13166		712	AAA_13: AAA domain	80.97
PF06008		264	Laminin_I: Laminin Domain I; InterPro: IPR009254 L	80.95
PF05384		159	DegS: Sensor protein DegS; InterPro: IPR008595 Thi	80.94
PF06120		301	Phage_HK97_TLTM: Tail length tape measure protein;	80.73
PF09304		107	Cortex-I_coil: Cortexillin I, coiled coil; InterPr	80.67
KOG4445		368	consensus Uncharacterized conserved protein, conta	80.05
KOG0982		502	consensus Centrosomal protein Nuf [Cell cycle cont	80.04

>KOG0243 consensus Kinesin-like protein [Cytoskeleton]	Back alignment and domain information

Probab=100.00  E-value=5.6e-89  Score=820.28  Aligned_cols=400  Identities=36%  Similarity=0.593  Sum_probs=347.4

Q ss_pred             CCCCCCEEEEEEeCCCChhhhhcCCeEEEeeCC-CE-EEecCC--C--CCcceecceecCCCCChhHHHhhhhHHHHHHH
Q 001324           96 QRSGDSISVTIRFRPLSEREFQRGDEIAWYADG-DK-IVRNEY--N--PATAYAFDRVFGPHANSQEVYDVAARPVVKAA  169 (1100)
Q Consensus        96 ~~~~~~i~V~vRvRP~~~~E~~~~~~~~~~~~~-~~-~~~~~~--~--~~~~f~FD~Vf~~~~~q~~vy~~~~~~lv~~~  169 (1100)
                      ...+.||+|+|||||++.+|......+++.++| .+ |.+...  .  -.+.|+||+||||.+.|.+||+.++.|+|..|
T Consensus        45 ~e~~~NIqVivRcRp~n~~E~~~~s~~VVs~~~~~kEV~v~~~~~sk~~~k~ftFDkVFGpes~Q~d~Y~~~v~p~i~eV  124 (1041)
T KOG0243|consen   45 KEKEVNIQVIVRCRPRNDRERKSKSSVVVSCDGIRKEVAVRQTIASKQIDKTFTFDKVFGPESQQEDLYDQAVSPIIKEV  124 (1041)
T ss_pred             CCCCCceEEEEEeCCCCchhhhcCCCeEEecCCCcceEEEecccccccccceeecceeeCcchhHHHHHHHHHHHHHHHH
Confidence            345679999999999999999888888888877 33 332222  2  35789999999999999999999999999999


Q ss_pred             hcCCceeEEeeccCCCCCccccCC--------CCCCCCchhHHHHHHHHHhhcCCCceEEEEEeeeeeecceeeecCCCC
Q 001324          170 MEGVNGTVFAYGVTSSGKTHTMHG--------DQNSPGIIPLAIKDVFSIIQDTPGREFLLRVSYLEIYNEVINDLLDPT  241 (1100)
Q Consensus       170 l~G~n~ti~aYGqtgSGKT~Tm~G--------~~~~~Giipr~~~~lF~~i~~~~~~~~~v~vS~~EIyne~i~DLL~~~  241 (1100)
                      +.|||||||||||||+||||||.|        .+..+|||||++.+||+.+.... .+|.|+|||||+|||.|+|||+|.
T Consensus       125 l~GyNCTIFAYGQTGTGKTyTMeG~~~~~~g~l~~~aGIIPRal~~IFd~Le~~~-~EYsvKVSfLELYNEEl~DLLa~~  203 (1041)
T KOG0243|consen  125 LEGYNCTIFAYGQTGTGKTYTMEGGERKKNGELPSEAGIIPRALRQIFDTLEAQG-AEYSVKVSFLELYNEELTDLLASE  203 (1041)
T ss_pred             hccCCceEEEecCCCCCceeeeecCcccccCCCCccCCcchHHHHHHHHHHHhcC-CeEEEEEEehhhhhHHHHHhcCCc
Confidence            999999999999999999999999        56789999999999999998664 899999999999999999999875


Q ss_pred             C---CcceEEeCC------CCcEeeCceEEEeCChHHHHHHHHHHHhhcccCCCcccCCCCCceEEEEEEEEEeecCC-C
Q 001324          242 G---QNLRVREDA------QGTYVEGIKEEVVLSPGHALSFIAAGEEHRHVGSNNFNLLSSRSHTIFTLMIESSDHGD-E  311 (1100)
Q Consensus       242 ~---~~l~i~e~~------~g~~v~gl~~~~v~s~~e~~~~l~~g~~~R~~~~t~~n~~SSRSH~if~i~v~~~~~~~-~  311 (1100)
                      .   ..+.+.+++      .|++|.||.+++|.++.|++.+|.+|...|++++|.||.+|||||+||+|+|....... +
T Consensus       204 ~~~~~~~~~k~~~~~~~~kggV~vkGlEEi~V~~A~ei~klLekGs~kRrtAaTl~N~~SSRSHsIFsItvhike~t~~g  283 (1041)
T KOG0243|consen  204 DTSDKKLRIKDDSTIVDGKGGVIVKGLEEIIVTNADEIYKLLEKGSKKRRTAATLMNDQSSRSHSIFSITVHIKENTPEG  283 (1041)
T ss_pred             cccccccccccCCcccCCcCcEEEecceeeeecchhHHHHHHHhhhhHhHHHHHHhhhhccccceEEEEEEEEecCCCcc
Confidence            4   345555554      57899999999999999999999999999999999999999999999999998765433 3


Q ss_pred             CCceEEeeeEEEecCCCCC-cccccchhhhhhhhHHhhhHHHHHHHHHHhhcCCCCCcCCCCCccchhhcccCCCCccce
Q 001324          312 YDGVIFSQLNLIDLAGSES-SKTETTGLRRKEGSYINKSLLTLGTVIGKLSEGKASHVPYRDSKLTRLLQSSLSGHGHVS  390 (1100)
Q Consensus       312 ~~~~~~s~L~lVDLAGsE~-~~~~~~g~r~~E~~~IN~SL~~L~~vI~~L~~~~~~~iPyRdSkLT~lL~dsLgGns~t~  390 (1100)
                      ...++.|||+||||||||. +.+|+.+.|.+|++.||+||+|||+||+||.++. .|||||+|||||||||||||.+||+
T Consensus       284 eelvK~GKLNLVDLAGSENI~RSGA~~~RArEAG~INqSLLTLGRVInALVe~s-~HIPYRESKLTRLLQDSLGGkTKT~  362 (1041)
T KOG0243|consen  284 EELVKIGKLNLVDLAGSENISRSGARNGRAREAGEINQSLLTLGRVINALVEHS-GHIPYRESKLTRLLQDSLGGKTKTC  362 (1041)
T ss_pred             hhhHhhcccceeeccccccccccccccchhHHhhhhhHHHHHHHHHHHHHHccC-CCCCchHHHHHHHHHHHhCCCceeE
Confidence            3567889999999999997 7899999999999999999999999999999965 5999999999999999999999999


Q ss_pred             eEEeeCCCCCCHHHHHHHHHHHHHhcccccccccccccChHHHHHHHHHHHHHHHHHHHHHhccccCCCCHHHHHHHHHH
Q 001324          391 LICTVTPASSSMEETHNTLKFASRAKRVEIYASRNKIIDEKSLIKKYQREISSLKEELDQLKRGILVGVSHEELMTLRQK  470 (1100)
Q Consensus       391 ~I~~isp~~~~~~eTl~TL~fa~rak~i~~~~~~n~~~~~~~~~~~lq~eI~~Lk~eL~qlk~~~~~~~~~ee~~~l~qk  470 (1100)
                      |||||||+..+++||++||.||.|||+|+|+|.+|..+..+.+++.|-.||.+|+.+|...|.+..+..+++.+.+.   
T Consensus       363 iIATiSPa~~~lEETlSTLEYA~RAKnIkNKPevNQkl~K~~llKd~~~EIerLK~dl~AaReKnGvyisee~y~~~---  439 (1041)
T KOG0243|consen  363 IIATISPAKHNLEETLSTLEYAHRAKNIKNKPEVNQKLMKKTLLKDLYEEIERLKRDLAAAREKNGVYISEERYTQE---  439 (1041)
T ss_pred             EEEEeCCCcccHHHHHHHHHHHHHhhhccCCCccchHHHHHHHHHHHHHHHHHHHHHHHHhHhhCceEechHHHHHH---
Confidence            99999999999999999999999999999999999999999999999999999999999988766655666554321   


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q 001324          471 LEEGQVKMQSRLEEEEEAKAALMSRIQRLTK  501 (1100)
Q Consensus       471 LEe~q~klq~~lee~ee~~~al~~ri~~L~k  501 (1100)
                       +.....+..++++.++..+++..++..++-
T Consensus       440 -e~e~~~~~~~ieele~el~~~~~~l~~~~e  469 (1041)
T KOG0243|consen  440 -EKEKKEMAEQIEELEEELENLEKQLKDLTE  469 (1041)
T ss_pred             -HHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence             112234455566666666666666655543

>KOG0245 consensus Kinesin-like protein [Cytoskeleton]	Back alignment and domain information

>PLN03188 kinesin-12 family protein; Provisional	Back alignment and domain information

>KOG4280 consensus Kinesin-like protein [Cytoskeleton]	Back alignment and domain information

>KOG0242 consensus Kinesin-like protein [Cytoskeleton]	Back alignment and domain information

>KOG0240 consensus Kinesin (SMY1 subfamily) [Cytoskeleton]	Back alignment and domain information

>KOG0241 consensus Kinesin-like protein [Cytoskeleton]	Back alignment and domain information

>cd01373 KISc_KLP2_like Kinesin motor domain, KLP2-like subgroup	Back alignment and domain information

>cd01370 KISc_KIP3_like Kinesin motor domain, KIP3-like subgroup	Back alignment and domain information

>cd01368 KISc_KIF23_like Kinesin motor domain, KIF23-like subgroup	Back alignment and domain information

>cd01365 KISc_KIF1A_KIF1B Kinesin motor domain, KIF1_like proteins	Back alignment and domain information

>cd01371 KISc_KIF3 Kinesin motor domain, kinesins II or KIF3_like proteins	Back alignment and domain information

>cd01374 KISc_CENP_E Kinesin motor domain, CENP-E/KIP2-like subgroup, involved in chromosome movement and/or spindle elongation during mitosis	Back alignment and domain information

>cd01367 KISc_KIF2_like Kinesin motor domain, KIF2-like group	Back alignment and domain information

>cd01364 KISc_BimC_Eg5 Kinesin motor domain, BimC/Eg5 spindle pole proteins, participate in spindle assembly and chromosome segregation during cell division	Back alignment and domain information

>cd01369 KISc_KHC_KIF5 Kinesin motor domain, kinesin heavy chain (KHC) or KIF5-like subgroup	Back alignment and domain information

>cd01376 KISc_KID_like Kinesin motor domain, KIF22/Kid-like subgroup	Back alignment and domain information

>cd01375 KISc_KIF9_like Kinesin motor domain, KIF9-like subgroup; might play a role in cell shape remodeling	Back alignment and domain information

>cd01372 KISc_KIF4 Kinesin motor domain, KIF4-like subfamily	Back alignment and domain information

>cd01366 KISc_C_terminal Kinesin motor domain, KIFC2/KIFC3/ncd-like carboxy-terminal kinesins	Back alignment and domain information

>smart00129 KISc Kinesin motor, catalytic domain	Back alignment and domain information

>KOG0239 consensus Kinesin (KAR3 subfamily) [Cytoskeleton]	Back alignment and domain information

>cd00106 KISc Kinesin motor domain	Back alignment and domain information

>KOG0246 consensus Kinesin-like protein [Cytoskeleton]	Back alignment and domain information

>PF00225 Kinesin: Kinesin motor domain; InterPro: IPR001752 Kinesin [, , ] is a microtubule-associated force-producing protein that may play a role in organelle transport	Back alignment and domain information

>KOG0244 consensus Kinesin-like protein [Cytoskeleton]	Back alignment and domain information

>KOG0247 consensus Kinesin-like protein [Cytoskeleton]	Back alignment and domain information

>COG5059 KIP1 Kinesin-like protein [Cytoskeleton]	Back alignment and domain information

>cd01363 Motor_domain Myosin and Kinesin motor domain	Back alignment and domain information

>KOG0161 consensus Myosin class II heavy chain [Cytoskeleton]	Back alignment and domain information

>PF01576 Myosin_tail_1: Myosin tail; InterPro: IPR002928 Muscle contraction is caused by sliding between the thick and thin filaments of the myofibril	Back alignment and domain information

>KOG0978 consensus E3 ubiquitin ligase involved in syntaxin degradation [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG4265 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG4172 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG0612 consensus Rho-associated, coiled-coil containing protein kinase [Signal transduction mechanisms]	Back alignment and domain information

>KOG0977 consensus Nuclear envelope protein lamin, intermediate filament superfamily [Cell cycle control, cell division, chromosome partitioning; Nuclear structure]	Back alignment and domain information

>KOG4275 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG0161 consensus Myosin class II heavy chain [Cytoskeleton]	Back alignment and domain information

>PF13920 zf-C3HC4_3: Zinc finger, C3HC4 type (RING finger); PDB: 2YHN_B 2YHO_G 3T6P_A 2CSY_A 2VJE_B 2VJF_B 2HDP_B 2EA5_A 2ECG_A 3EB5_A	Back alignment and domain information

>KOG1571 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>TIGR02168 SMC_prok_B chromosome segregation protein SMC, common bacterial type	Back alignment and domain information

>PF00038 Filament: Intermediate filament protein; InterPro: IPR016044 Intermediate filaments (IF) [, , ] are proteins which are primordial components of the cytoskeleton and the nuclear envelope	Back alignment and domain information

>PRK02224 chromosome segregation protein; Provisional	Back alignment and domain information

>KOG0971 consensus Microtubule-associated protein dynactin DCTN1/Glued [Cell cycle control, cell division, chromosome partitioning; Cytoskeleton]	Back alignment and domain information

>PF07888 CALCOCO1: Calcium binding and coiled-coil domain (CALCOCO1) like; InterPro: IPR012852 Proteins found in this family are similar to the coiled-coil transcriptional coactivator protein expressed by Mus musculus (CoCoA, Q8CGU1 from SWISSPROT)	Back alignment and domain information

>TIGR02169 SMC_prok_A chromosome segregation protein SMC, primarily archaeal type	Back alignment and domain information

>COG1196 Smc Chromosome segregation ATPases [Cell division and chromosome partitioning]	Back alignment and domain information

>TIGR02169 SMC_prok_A chromosome segregation protein SMC, primarily archaeal type	Back alignment and domain information

>TIGR02168 SMC_prok_B chromosome segregation protein SMC, common bacterial type	Back alignment and domain information

>PF10174 Cast: RIM-binding protein of the cytomatrix active zone; InterPro: IPR019323 This entry represents a family of proteins that form part of the CAZ (cytomatrix at the active zone) complex which is involved in determining the site of synaptic vesicle fusion []	Back alignment and domain information

>PRK02224 chromosome segregation protein; Provisional	Back alignment and domain information

>KOG0976 consensus Rho/Rac1-interacting serine/threonine kinase Citron [Signal transduction mechanisms]	Back alignment and domain information

>KOG1100 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PF07888 CALCOCO1: Calcium binding and coiled-coil domain (CALCOCO1) like; InterPro: IPR012852 Proteins found in this family are similar to the coiled-coil transcriptional coactivator protein expressed by Mus musculus (CoCoA, Q8CGU1 from SWISSPROT)	Back alignment and domain information

>KOG4674 consensus Uncharacterized conserved coiled-coil protein [Function unknown]	Back alignment and domain information

>KOG0933 consensus Structural maintenance of chromosome protein 2 (chromosome condensation complex Condensin, subunit E) [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning]	Back alignment and domain information

>PF12128 DUF3584: Protein of unknown function (DUF3584); InterPro: IPR021979 This family consist of uncharacterised bacterial proteins	Back alignment and domain information

>PF10174 Cast: RIM-binding protein of the cytomatrix active zone; InterPro: IPR019323 This entry represents a family of proteins that form part of the CAZ (cytomatrix at the active zone) complex which is involved in determining the site of synaptic vesicle fusion []	Back alignment and domain information

>COG1196 Smc Chromosome segregation ATPases [Cell division and chromosome partitioning]	Back alignment and domain information

>KOG4643 consensus Uncharacterized coiled-coil protein [Function unknown]	Back alignment and domain information

>KOG0823 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>TIGR00606 rad50 rad50	Back alignment and domain information

>KOG0976 consensus Rho/Rac1-interacting serine/threonine kinase Citron [Signal transduction mechanisms]	Back alignment and domain information

>PF01576 Myosin_tail_1: Myosin tail; InterPro: IPR002928 Muscle contraction is caused by sliding between the thick and thin filaments of the myofibril	Back alignment and domain information

>TIGR00606 rad50 rad50	Back alignment and domain information

>KOG0971 consensus Microtubule-associated protein dynactin DCTN1/Glued [Cell cycle control, cell division, chromosome partitioning; Cytoskeleton]	Back alignment and domain information

>KOG0994 consensus Extracellular matrix glycoprotein Laminin subunit beta [Extracellular structures]	Back alignment and domain information

>PF15070 GOLGA2L5: Putative golgin subfamily A member 2-like protein 5	Back alignment and domain information

>KOG0996 consensus Structural maintenance of chromosome protein 4 (chromosome condensation complex Condensin, subunit C) [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning]	Back alignment and domain information

>KOG0964 consensus Structural maintenance of chromosome protein 3 (sister chromatid cohesion complex Cohesin, subunit SMC3) [Cell cycle control, cell division, chromosome partitioning]	Back alignment and domain information

>PF12128 DUF3584: Protein of unknown function (DUF3584); InterPro: IPR021979 This family consist of uncharacterised bacterial proteins	Back alignment and domain information

>PF00261 Tropomyosin: Tropomyosin; InterPro: IPR000533 Tropomyosins [], are a family of closely related proteins present in muscle and non-muscle cells	Back alignment and domain information

>PLN03208 E3 ubiquitin-protein ligase RMA2; Provisional	Back alignment and domain information

>PF00038 Filament: Intermediate filament protein; InterPro: IPR016044 Intermediate filaments (IF) [, , ] are proteins which are primordial components of the cytoskeleton and the nuclear envelope	Back alignment and domain information

>KOG4673 consensus Transcription factor TMF, TATA element modulatory factor [Transcription]	Back alignment and domain information

>KOG4643 consensus Uncharacterized coiled-coil protein [Function unknown]	Back alignment and domain information

>KOG4673 consensus Transcription factor TMF, TATA element modulatory factor [Transcription]	Back alignment and domain information

>KOG0612 consensus Rho-associated, coiled-coil containing protein kinase [Signal transduction mechanisms]	Back alignment and domain information

>KOG0933 consensus Structural maintenance of chromosome protein 2 (chromosome condensation complex Condensin, subunit E) [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning]	Back alignment and domain information

>KOG0317 consensus Predicted E3 ubiquitin ligase, integral peroxisomal membrane protein [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG0250 consensus DNA repair protein RAD18 (SMC family protein) [Replication, recombination and repair]	Back alignment and domain information

>KOG4674 consensus Uncharacterized conserved coiled-coil protein [Function unknown]	Back alignment and domain information

>PRK11637 AmiB activator; Provisional	Back alignment and domain information

>KOG0995 consensus Centromere-associated protein HEC1 [Cell cycle control, cell division, chromosome partitioning]	Back alignment and domain information

>PRK03918 chromosome segregation protein; Provisional	Back alignment and domain information

>PF05701 WEMBL: Weak chloroplast movement under blue light; InterPro: IPR008545 This family consists of several plant proteins of unknown function	Back alignment and domain information

>PRK11281 hypothetical protein; Provisional	Back alignment and domain information

>COG1340 Uncharacterized archaeal coiled-coil protein [Function unknown]	Back alignment and domain information

>KOG0996 consensus Structural maintenance of chromosome protein 4 (chromosome condensation complex Condensin, subunit C) [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning]	Back alignment and domain information

>PRK04778 septation ring formation regulator EzrA; Provisional	Back alignment and domain information

>PRK03918 chromosome segregation protein; Provisional	Back alignment and domain information

>PF14662 CCDC155: Coiled-coil region of CCDC155	Back alignment and domain information

>KOG0250 consensus DNA repair protein RAD18 (SMC family protein) [Replication, recombination and repair]	Back alignment and domain information

>KOG0977 consensus Nuclear envelope protein lamin, intermediate filament superfamily [Cell cycle control, cell division, chromosome partitioning; Nuclear structure]	Back alignment and domain information

>PHA02562 46 endonuclease subunit; Provisional	Back alignment and domain information

>PF15070 GOLGA2L5: Putative golgin subfamily A member 2-like protein 5	Back alignment and domain information

>PHA02562 46 endonuclease subunit; Provisional	Back alignment and domain information

>PF09726 Macoilin: Transmembrane protein; InterPro: IPR019130 This entry represents the multi-pass transmembrane protein Macoilin, which is highly conserved in eukaryotes	Back alignment and domain information

>PF09730 BicD: Microtubule-associated protein Bicaudal-D; InterPro: IPR018477 BicD proteins consist of three coiled-coiled domains and are involved in dynein-mediated minus end-directed transport from the Golgi apparatus to the endoplasmic reticulum (ER) []	Back alignment and domain information

>PRK04863 mukB cell division protein MukB; Provisional	Back alignment and domain information

>PRK04778 septation ring formation regulator EzrA; Provisional	Back alignment and domain information

>PRK10929 putative mechanosensitive channel protein; Provisional	Back alignment and domain information

>PRK04863 mukB cell division protein MukB; Provisional	Back alignment and domain information

>PHA02929 N1R/p28-like protein; Provisional	Back alignment and domain information

>COG5059 KIP1 Kinesin-like protein [Cytoskeleton]	Back alignment and domain information

>KOG0320 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PF13923 zf-C3HC4_2: Zinc finger, C3HC4 type (RING finger); PDB: 3HCU_A 2ECI_A 2JMD_A 3HCS_B 3HCT_A 3ZTG_A 2YUR_A 3L11_A	Back alignment and domain information

>PF14662 CCDC155: Coiled-coil region of CCDC155	Back alignment and domain information

>KOG2164 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PRK11637 AmiB activator; Provisional	Back alignment and domain information

>PF00261 Tropomyosin: Tropomyosin; InterPro: IPR000533 Tropomyosins [], are a family of closely related proteins present in muscle and non-muscle cells	Back alignment and domain information

>PF14634 zf-RING_5: zinc-RING finger domain	Back alignment and domain information

>COG4372 Uncharacterized protein conserved in bacteria with the myosin-like domain [Function unknown]	Back alignment and domain information

>PF05483 SCP-1: Synaptonemal complex protein 1 (SCP-1); InterPro: IPR008827 Synaptonemal complex protein 1 (SCP-1) is the major component of the transverse filaments of the synaptonemal complex	Back alignment and domain information

>PF05701 WEMBL: Weak chloroplast movement under blue light; InterPro: IPR008545 This family consists of several plant proteins of unknown function	Back alignment and domain information

>KOG0963 consensus Transcription factor/CCAAT displacement protein CDP1 [Transcription]	Back alignment and domain information

>COG4942 Membrane-bound metallopeptidase [Cell division and chromosome partitioning]	Back alignment and domain information

>PF09726 Macoilin: Transmembrane protein; InterPro: IPR019130 This entry represents the multi-pass transmembrane protein Macoilin, which is highly conserved in eukaryotes	Back alignment and domain information

>KOG0018 consensus Structural maintenance of chromosome protein 1 (sister chromatid cohesion complex Cohesin, subunit SMC1) [Cell cycle control, cell division, chromosome partitioning]	Back alignment and domain information

>PF04849 HAP1_N: HAP1 N-terminal conserved region; InterPro: IPR006933 This family is defined by an N-terminal conserved region found in several huntingtin-associated protein 1 (HAP1) homologues	Back alignment and domain information

>KOG0994 consensus Extracellular matrix glycoprotein Laminin subunit beta [Extracellular structures]	Back alignment and domain information

>KOG1029 consensus Endocytic adaptor protein intersectin [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>PF05483 SCP-1: Synaptonemal complex protein 1 (SCP-1); InterPro: IPR008827 Synaptonemal complex protein 1 (SCP-1) is the major component of the transverse filaments of the synaptonemal complex	Back alignment and domain information

>COG1579 Zn-ribbon protein, possibly nucleic acid-binding [General function prediction only]	Back alignment and domain information

>PF09730 BicD: Microtubule-associated protein Bicaudal-D; InterPro: IPR018477 BicD proteins consist of three coiled-coiled domains and are involved in dynein-mediated minus end-directed transport from the Golgi apparatus to the endoplasmic reticulum (ER) []	Back alignment and domain information

>KOG0964 consensus Structural maintenance of chromosome protein 3 (sister chromatid cohesion complex Cohesin, subunit SMC3) [Cell cycle control, cell division, chromosome partitioning]	Back alignment and domain information

>PF09789 DUF2353: Uncharacterized coiled-coil protein (DUF2353); InterPro: IPR019179 Members of this family have been annotated as being coiled-coil domain-containing protein 149, however they currently have no known function	Back alignment and domain information

>PHA02926 zinc finger-like protein; Provisional	Back alignment and domain information

>PF13639 zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C 1IYM_A 2EP4_A 2ECT_A 2JRJ_A 2ECN_A 2ECM_A 3NG2_A 2EA6_A	Back alignment and domain information

>KOG0999 consensus Microtubule-associated protein Bicaudal-D [Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>KOG0963 consensus Transcription factor/CCAAT displacement protein CDP1 [Transcription]	Back alignment and domain information

>PF05622 HOOK: HOOK protein; InterPro: IPR008636 This family consists of several HOOK1, 2 and 3 proteins from different eukaryotic organisms	Back alignment and domain information

>COG4942 Membrane-bound metallopeptidase [Cell division and chromosome partitioning]	Back alignment and domain information

>TIGR00599 rad18 DNA repair protein rad18	Back alignment and domain information

>PF06160 EzrA: Septation ring formation regulator, EzrA ; InterPro: IPR010379 During the bacterial cell cycle, the tubulin-like cell-division protein FtsZ polymerises into a ring structure that establishes the location of the nascent division site	Back alignment and domain information

>PRK01156 chromosome segregation protein; Provisional	Back alignment and domain information

>KOG0018 consensus Structural maintenance of chromosome protein 1 (sister chromatid cohesion complex Cohesin, subunit SMC1) [Cell cycle control, cell division, chromosome partitioning]	Back alignment and domain information

>KOG0999 consensus Microtubule-associated protein Bicaudal-D [Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>KOG0287 consensus Postreplication repair protein RAD18 [Replication, recombination and repair]	Back alignment and domain information

>PRK01156 chromosome segregation protein; Provisional	Back alignment and domain information

>PF06160 EzrA: Septation ring formation regulator, EzrA ; InterPro: IPR010379 During the bacterial cell cycle, the tubulin-like cell-division protein FtsZ polymerises into a ring structure that establishes the location of the nascent division site	Back alignment and domain information

>COG5574 PEX10 RING-finger-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>COG5432 RAD18 RING-finger-containing E3 ubiquitin ligase [Signal transduction mechanisms]	Back alignment and domain information

>KOG4593 consensus Mitotic checkpoint protein MAD1 [Cell cycle control, cell division, chromosome partitioning]	Back alignment and domain information

>PF14447 Prok-RING_4: Prokaryotic RING finger family 4	Back alignment and domain information

>PF05557 MAD: Mitotic checkpoint protein; InterPro: IPR008672 This family consists of several eukaryotic mitotic checkpoint (Mitotic arrest deficient or MAD) proteins	Back alignment and domain information

>KOG1029 consensus Endocytic adaptor protein intersectin [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>smart00184 RING Ring finger	Back alignment and domain information

>PF15227 zf-C3HC4_4: zinc finger of C3HC4-type, RING; PDB: 2EGP_A 2ECV_A 2ECJ_A 2YSL_A 2YSJ_A	Back alignment and domain information

>cd00162 RING RING-finger (Really Interesting New Gene) domain, a specialized type of Zn-finger of 40 to 60 residues that binds two atoms of zinc; defined by the 'cross-brace' motif C-X2-C-X(9-39)-C-X(1-3)- H-X(2-3)-(N/C/H)-X2-C-X(4-48)C-X2-C; probably involved in mediating protein-protein interactions; identified in a proteins with a wide range of functions such as viral replication, signal transduction, and development; has two variants, the C3HC4-type and a C3H2C3-type (RING-H2 finger), which have different cysteine/histidine pattern; a subset of RINGs are associated with B-Boxes (C-X2-H-X7-C-X7-C-X2-C-H-X2-H)

Back alignment and domain information

>KOG0980 consensus Actin-binding protein SLA2/Huntingtin-interacting protein Hip1 [Cytoskeleton]	Back alignment and domain information

>KOG0978 consensus E3 ubiquitin ligase involved in syntaxin degradation [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG1785 consensus Tyrosine kinase negative regulator CBL [Defense mechanisms]	Back alignment and domain information

>PF05557 MAD: Mitotic checkpoint protein; InterPro: IPR008672 This family consists of several eukaryotic mitotic checkpoint (Mitotic arrest deficient or MAD) proteins	Back alignment and domain information

>PF00097 zf-C3HC4: Zinc finger, C3HC4 type (RING finger); InterPro: IPR018957 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule	Back alignment and domain information

>PF05667 DUF812: Protein of unknown function (DUF812); InterPro: IPR008530 This family consists of several eukaryotic proteins of unknown function	Back alignment and domain information

>COG4372 Uncharacterized protein conserved in bacteria with the myosin-like domain [Function unknown]	Back alignment and domain information

>PF05622 HOOK: HOOK protein; InterPro: IPR008636 This family consists of several HOOK1, 2 and 3 proteins from different eukaryotic organisms	Back alignment and domain information

>KOG0946 consensus ER-Golgi vesicle-tethering protein p115 [Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>KOG4692 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>smart00504 Ubox Modified RING finger domain	Back alignment and domain information

>KOG0962 consensus DNA repair protein RAD50, ABC-type ATPase/SMC superfamily [Replication, recombination and repair]	Back alignment and domain information

>PF15397 DUF4618: Domain of unknown function (DUF4618)	Back alignment and domain information

>KOG0946 consensus ER-Golgi vesicle-tethering protein p115 [Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>PF08826 DMPK_coil: DMPK coiled coil domain like; InterPro: IPR014930 This domain is found in the myotonic dystrophy protein kinase (DMPK) and adopts a coiled coil structure	Back alignment and domain information

>COG1579 Zn-ribbon protein, possibly nucleic acid-binding [General function prediction only]	Back alignment and domain information

>COG1340 Uncharacterized archaeal coiled-coil protein [Function unknown]	Back alignment and domain information

>KOG1003 consensus Actin filament-coating protein tropomyosin [Cytoskeleton]	Back alignment and domain information

>COG0419 SbcC ATPase involved in DNA repair [DNA replication, recombination, and repair]	Back alignment and domain information

>PF06818 Fez1: Fez1; InterPro: IPR009638 This family represents the eukaryotic Fez1 protein	Back alignment and domain information

>COG5540 RING-finger-containing ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG0980 consensus Actin-binding protein SLA2/Huntingtin-interacting protein Hip1 [Cytoskeleton]	Back alignment and domain information

>COG5185 HEC1 Protein involved in chromosome segregation, interacts with SMC proteins [Cell division and chromosome partitioning]	Back alignment and domain information

>PF13445 zf-RING_UBOX: RING-type zinc-finger; PDB: 2CT2_A	Back alignment and domain information

>PRK11281 hypothetical protein; Provisional	Back alignment and domain information

>PF15619 Lebercilin: Ciliary protein causing Leber congenital amaurosis disease	Back alignment and domain information

>PF05667 DUF812: Protein of unknown function (DUF812); InterPro: IPR008530 This family consists of several eukaryotic proteins of unknown function	Back alignment and domain information

>PRK10929 putative mechanosensitive channel protein; Provisional	Back alignment and domain information

>KOG0249 consensus LAR-interacting protein and related proteins [General function prediction only]	Back alignment and domain information

>PF15619 Lebercilin: Ciliary protein causing Leber congenital amaurosis disease	Back alignment and domain information

>PRK09039 hypothetical protein; Validated	Back alignment and domain information

>COG5236 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only]	Back alignment and domain information

>PF06785 UPF0242: Uncharacterised protein family (UPF0242); InterPro: IPR009623 This is a group of proteins of unknown function	Back alignment and domain information

>KOG0995 consensus Centromere-associated protein HEC1 [Cell cycle control, cell division, chromosome partitioning]	Back alignment and domain information

>PF09755 DUF2046: Uncharacterized conserved protein H4 (DUF2046); InterPro: IPR019152 This is the conserved N-terminal 350 residues of a family of proteins of unknown function possibly containing a coiled-coil domain	Back alignment and domain information

>COG5152 Uncharacterized conserved protein, contains RING and CCCH-type Zn-fingers [General function prediction only]	Back alignment and domain information

>PF14835 zf-RING_6: zf-RING of BARD1-type protein; PDB: 1JM7_B	Back alignment and domain information

>PF04849 HAP1_N: HAP1 N-terminal conserved region; InterPro: IPR006933 This family is defined by an N-terminal conserved region found in several huntingtin-associated protein 1 (HAP1) homologues	Back alignment and domain information

>KOG4593 consensus Mitotic checkpoint protein MAD1 [Cell cycle control, cell division, chromosome partitioning]	Back alignment and domain information

>PRK09039 hypothetical protein; Validated	Back alignment and domain information

>PF07926 TPR_MLP1_2: TPR/MLP1/MLP2-like protein; InterPro: IPR012929 This domain is found in a number of proteins, including TPR protein (P12270 from SWISSPROT) and yeast myosin-like proteins 1 (MLP1, Q02455 from SWISSPROT) and 2 (MLP2, P40457 from SWISSPROT)	Back alignment and domain information

>PF14915 CCDC144C: CCDC144C protein coiled-coil region	Back alignment and domain information

>PF15254 CCDC14: Coiled-coil domain-containing protein 14	Back alignment and domain information

>PLN02939 transferase, transferring glycosyl groups	Back alignment and domain information

>PF12718 Tropomyosin_1: Tropomyosin like; InterPro: IPR000533 Tropomyosins [], are a family of closely related proteins present in muscle and non-muscle cells	Back alignment and domain information

>KOG1813 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>COG5185 HEC1 Protein involved in chromosome segregation, interacts with SMC proteins [Cell division and chromosome partitioning]	Back alignment and domain information

>KOG1853 consensus LIS1-interacting protein NUDE [Cytoskeleton]	Back alignment and domain information

>KOG1850 consensus Myosin-like coiled-coil protein [Cytoskeleton]	Back alignment and domain information

>KOG2177 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PF12718 Tropomyosin_1: Tropomyosin like; InterPro: IPR000533 Tropomyosins [], are a family of closely related proteins present in muscle and non-muscle cells	Back alignment and domain information

>TIGR03185 DNA_S_dndD DNA sulfur modification protein DndD	Back alignment and domain information

>COG5243 HRD1 HRD ubiquitin ligase complex, ER membrane component [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG1853 consensus LIS1-interacting protein NUDE [Cytoskeleton]	Back alignment and domain information

>TIGR02680 conserved hypothetical protein TIGR02680	Back alignment and domain information

>PF12678 zf-rbx1: RING-H2 zinc finger; InterPro: IPR024766 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule	Back alignment and domain information

>PF08614 ATG16: Autophagy protein 16 (ATG16); InterPro: IPR013923 Macroautophagy is a bulk degradation process induced by starvation in eukaryotic cells	Back alignment and domain information

>TIGR02680 conserved hypothetical protein TIGR02680	Back alignment and domain information

>PF09787 Golgin_A5: Golgin subfamily A member 5; InterPro: IPR019177 This entry represents a family of proteins involved in maintaining Golgi structure	Back alignment and domain information

>KOG0249 consensus LAR-interacting protein and related proteins [General function prediction only]	Back alignment and domain information

>PF05010 TACC: Transforming acidic coiled-coil-containing protein (TACC); InterPro: IPR007707 This family contains the proteins TACC 1, 2 and 3, found concentrated in the centrosomes of eukaryotes which may play a conserved role in organising centrosomal microtubules	Back alignment and domain information

>KOG0979 consensus Structural maintenance of chromosome protein SMC5/Spr18, SMC superfamily [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning; Replication, recombination and repair]	Back alignment and domain information

>PF15254 CCDC14: Coiled-coil domain-containing protein 14	Back alignment and domain information

>PF07111 HCR: Alpha helical coiled-coil rod protein (HCR); InterPro: IPR009800 This family consists of several mammalian alpha helical coiled-coil rod HCR proteins	Back alignment and domain information

>PF09728 Taxilin: Myosin-like coiled-coil protein; InterPro: IPR019132 Taxilin contains an extraordinarily long coiled-coil domain in its C-terminal half and is ubiquitously expressed	Back alignment and domain information

>KOG4628 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG1937 consensus Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>PF04564 U-box: U-box domain; InterPro: IPR003613 Quality control of intracellular proteins is essential for cellular homeostasis	Back alignment and domain information

>KOG4809 consensus Rab6 GTPase-interacting protein involved in endosome-to-TGN transport [Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>PF13514 AAA_27: AAA domain	Back alignment and domain information

>PF09738 DUF2051: Double stranded RNA binding protein (DUF2051); InterPro: IPR019139 This entry represents transcriptional repressors which preferentially bind to the GC-rich consensus sequence (5'-AGCCCCCGGCG-3') and may regulate expression of TNF, EGFR and PDGFA	Back alignment and domain information

>PF14988 DUF4515: Domain of unknown function (DUF4515)	Back alignment and domain information

>KOG4159 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG4809 consensus Rab6 GTPase-interacting protein involved in endosome-to-TGN transport [Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>PF08317 Spc7: Spc7 kinetochore protein; InterPro: IPR013253 This entry consists of cell division proteins which are required for kinetochore-spindle association []	Back alignment and domain information

>smart00787 Spc7 Spc7 kinetochore protein	Back alignment and domain information

>PF10473 CENP-F_leu_zip: Leucine-rich repeats of kinetochore protein Cenp-F/LEK1; InterPro: IPR019513 Cenp-F, a centromeric kinetochore, microtubule-binding protein consisting of two 1,600-amino acid-long coils, is essential for the full functioning of the mitotic checkpoint pathway [, ]	Back alignment and domain information

>COG0556 UvrB Helicase subunit of the DNA excision repair complex [DNA replication, recombination, and repair]	Back alignment and domain information

>KOG2113 consensus Predicted RNA binding protein, contains KH domain [General function prediction only]	Back alignment and domain information

>PF04012 PspA_IM30: PspA/IM30 family; InterPro: IPR007157 This family includes PspA a protein that suppresses sigma54-dependent transcription	Back alignment and domain information

>TIGR03007 pepcterm_ChnLen polysaccharide chain length determinant protein, PEP-CTERM locus subfamily	Back alignment and domain information

>COG3883 Uncharacterized protein conserved in bacteria [Function unknown]	Back alignment and domain information

>KOG2879 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>COG3883 Uncharacterized protein conserved in bacteria [Function unknown]	Back alignment and domain information

>PF10481 CENP-F_N: Cenp-F N-terminal domain; InterPro: IPR018463 Mitosin or centromere-associated protein-F (Cenp-F) is found bound across the centromere as one of the proteins of the outer layer of the kinetochore []	Back alignment and domain information

>TIGR03007 pepcterm_ChnLen polysaccharide chain length determinant protein, PEP-CTERM locus subfamily	Back alignment and domain information

>KOG0802 consensus E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PF15066 CAGE1: Cancer-associated gene protein 1 family	Back alignment and domain information

>PF00308 Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013317 This entry represents the central domain of bacterial DnaA proteins [, , ] that play an important role in initiating and regulating chromosomal replication	Back alignment and domain information

>PF05911 DUF869: Plant protein of unknown function (DUF869); InterPro: IPR008587 This family consists of a number of sequences found in plants	Back alignment and domain information

>KOG4360 consensus Uncharacterized coiled coil protein [Function unknown]	Back alignment and domain information

>KOG0962 consensus DNA repair protein RAD50, ABC-type ATPase/SMC superfamily [Replication, recombination and repair]	Back alignment and domain information

>smart00787 Spc7 Spc7 kinetochore protein	Back alignment and domain information

>PF10481 CENP-F_N: Cenp-F N-terminal domain; InterPro: IPR018463 Mitosin or centromere-associated protein-F (Cenp-F) is found bound across the centromere as one of the proteins of the outer layer of the kinetochore []	Back alignment and domain information

>PF07926 TPR_MLP1_2: TPR/MLP1/MLP2-like protein; InterPro: IPR012929 This domain is found in a number of proteins, including TPR protein (P12270 from SWISSPROT) and yeast myosin-like proteins 1 (MLP1, Q02455 from SWISSPROT) and 2 (MLP2, P40457 from SWISSPROT)	Back alignment and domain information

>PF06008 Laminin_I: Laminin Domain I; InterPro: IPR009254 Laminins are glycoproteins that are major constituents of the basement membrane of cells	Back alignment and domain information

>PF10473 CENP-F_leu_zip: Leucine-rich repeats of kinetochore protein Cenp-F/LEK1; InterPro: IPR019513 Cenp-F, a centromeric kinetochore, microtubule-binding protein consisting of two 1,600-amino acid-long coils, is essential for the full functioning of the mitotic checkpoint pathway [, ]	Back alignment and domain information

>PF08317 Spc7: Spc7 kinetochore protein; InterPro: IPR013253 This entry consists of cell division proteins which are required for kinetochore-spindle association []	Back alignment and domain information

>PF13514 AAA_27: AAA domain	Back alignment and domain information

>TIGR01843 type_I_hlyD type I secretion membrane fusion protein, HlyD family	Back alignment and domain information

>COG4477 EzrA Negative regulator of septation ring formation [Cell division and chromosome partitioning]	Back alignment and domain information

>TIGR01005 eps_transp_fam exopolysaccharide transport protein family	Back alignment and domain information

>KOG0311 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PF10267 Tmemb_cc2: Predicted transmembrane and coiled-coil 2 protein; InterPro: IPR019394 This family of transmembrane coiled-coil containing proteins is conserved from worms to humans	Back alignment and domain information

>PF06785 UPF0242: Uncharacterised protein family (UPF0242); InterPro: IPR009623 This is a group of proteins of unknown function	Back alignment and domain information

>PF04641 Rtf2: Rtf2 RING-finger	Back alignment and domain information

>KOG4807 consensus F-actin binding protein, regulates actin cytoskeletal organization [Cytoskeleton]	Back alignment and domain information

>PF09789 DUF2353: Uncharacterized coiled-coil protein (DUF2353); InterPro: IPR019179 Members of this family have been annotated as being coiled-coil domain-containing protein 149, however they currently have no known function	Back alignment and domain information

>PF15450 DUF4631: Domain of unknown function (DUF4631)	Back alignment and domain information

>PRK06893 DNA replication initiation factor; Validated	Back alignment and domain information

>KOG4360 consensus Uncharacterized coiled coil protein [Function unknown]	Back alignment and domain information

>PF13851 GAS: Growth-arrest specific micro-tubule binding	Back alignment and domain information

>KOG0825 consensus PHD Zn-finger protein [General function prediction only]	Back alignment and domain information

>PRK14086 dnaA chromosomal replication initiation protein; Provisional	Back alignment and domain information

>KOG1003 consensus Actin filament-coating protein tropomyosin [Cytoskeleton]	Back alignment and domain information

>PRK06620 hypothetical protein; Validated	Back alignment and domain information

>PF13870 DUF4201: Domain of unknown function (DUF4201)	Back alignment and domain information

>PRK10884 SH3 domain-containing protein; Provisional	Back alignment and domain information

>PF05010 TACC: Transforming acidic coiled-coil-containing protein (TACC); InterPro: IPR007707 This family contains the proteins TACC 1, 2 and 3, found concentrated in the centrosomes of eukaryotes which may play a conserved role in organising centrosomal microtubules	Back alignment and domain information

>PF14915 CCDC144C: CCDC144C protein coiled-coil region	Back alignment and domain information

>COG2804 PulE Type II secretory pathway, ATPase PulE/Tfp pilus assembly pathway, ATPase PilB [Cell motility and secretion / Intracellular trafficking and secretion]	Back alignment and domain information

>KOG1039 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>TIGR01843 type_I_hlyD type I secretion membrane fusion protein, HlyD family	Back alignment and domain information

>KOG1001 consensus Helicase-like transcription factor HLTF/DNA helicase RAD5, DEAD-box superfamily [Transcription; Replication, recombination and repair]	Back alignment and domain information

>PF10498 IFT57: Intra-flagellar transport protein 57 ; InterPro: IPR019530 Eukaryotic cilia and flagella are specialised organelles found at the periphery of cells of diverse organisms	Back alignment and domain information

>PRK10884 SH3 domain-containing protein; Provisional	Back alignment and domain information

>KOG0828 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PF07111 HCR: Alpha helical coiled-coil rod protein (HCR); InterPro: IPR009800 This family consists of several mammalian alpha helical coiled-coil rod HCR proteins	Back alignment and domain information

>PF12325 TMF_TATA_bd: TATA element modulatory factor 1 TATA binding; InterPro: IPR022091 This is the C-terminal conserved coiled coil region of a family of TATA element modulatory factor 1 proteins conserved in eukaryotes []	Back alignment and domain information

>PF08614 ATG16: Autophagy protein 16 (ATG16); InterPro: IPR013923 Macroautophagy is a bulk degradation process induced by starvation in eukaryotic cells	Back alignment and domain information

>KOG4302 consensus Microtubule-associated protein essential for anaphase spindle elongation [Cell cycle control, cell division, chromosome partitioning; Cytoskeleton]	Back alignment and domain information

>PF13870 DUF4201: Domain of unknown function (DUF4201)	Back alignment and domain information

>PF14988 DUF4515: Domain of unknown function (DUF4515)	Back alignment and domain information

>PF06005 DUF904: Protein of unknown function (DUF904); InterPro: IPR009252 Cell division protein ZapB is a non-essential, abundant cell division factor that is required for proper Z-ring formation	Back alignment and domain information

>COG2805 PilT Tfp pilus assembly protein, pilus retraction ATPase PilT [Cell motility and secretion / Intracellular trafficking and secretion]	Back alignment and domain information

>KOG0993 consensus Rab5 GTPase effector Rabaptin-5 [Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>KOG2991 consensus Splicing regulator [RNA processing and modification]	Back alignment and domain information

>PF15035 Rootletin: Ciliary rootlet component, centrosome cohesion	Back alignment and domain information

>COG4913 Uncharacterized protein conserved in bacteria [Function unknown]	Back alignment and domain information

>KOG3002 consensus Zn finger protein [General function prediction only]	Back alignment and domain information

>KOG1814 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG2129 consensus Uncharacterized conserved protein H4 [Function unknown]	Back alignment and domain information

>PF05911 DUF869: Plant protein of unknown function (DUF869); InterPro: IPR008587 This family consists of a number of sequences found in plants	Back alignment and domain information

>PF12861 zf-Apc11: Anaphase-promoting complex subunit 11 RING-H2 finger	Back alignment and domain information

>KOG0982 consensus Centrosomal protein Nuf [Cell cycle control, cell division, chromosome partitioning; Cytoskeleton]	Back alignment and domain information

>PF13851 GAS: Growth-arrest specific micro-tubule binding	Back alignment and domain information

>KOG2991 consensus Splicing regulator [RNA processing and modification]	Back alignment and domain information

>PF10168 Nup88: Nuclear pore component; InterPro: IPR019321 Nup88 can be divided into two structural domains; the N-terminal two-thirds of the protein have no obvious structural motifs	Back alignment and domain information

>TIGR01005 eps_transp_fam exopolysaccharide transport protein family	Back alignment and domain information

>KOG4787 consensus Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>PF10168 Nup88: Nuclear pore component; InterPro: IPR019321 Nup88 can be divided into two structural domains; the N-terminal two-thirds of the protein have no obvious structural motifs	Back alignment and domain information

>PF09787 Golgin_A5: Golgin subfamily A member 5; InterPro: IPR019177 This entry represents a family of proteins involved in maintaining Golgi structure	Back alignment and domain information

>PF09755 DUF2046: Uncharacterized conserved protein H4 (DUF2046); InterPro: IPR019152 This is the conserved N-terminal 350 residues of a family of proteins of unknown function possibly containing a coiled-coil domain	Back alignment and domain information

>KOG1103 consensus Predicted coiled-coil protein [Function unknown]	Back alignment and domain information

>KOG1899 consensus LAR transmembrane tyrosine phosphatase-interacting protein liprin [General function prediction only]	Back alignment and domain information

>PF04111 APG6: Autophagy protein Apg6; InterPro: IPR007243 Macroautophagy is a bulk degradation process induced by starvation in eukaryotic cells	Back alignment and domain information

>PF04156 IncA: IncA protein; InterPro: IPR007285 Chlamydia trachomatis is an obligate intracellular bacterium that develops within a parasitophorous vacuole termed an inclusion	Back alignment and domain information

>PRK06835 DNA replication protein DnaC; Validated	Back alignment and domain information

>PF06818 Fez1: Fez1; InterPro: IPR009638 This family represents the eukaryotic Fez1 protein	Back alignment and domain information

>PRK12377 putative replication protein; Provisional	Back alignment and domain information

>PRK10361 DNA recombination protein RmuC; Provisional	Back alignment and domain information

>PRK00149 dnaA chromosomal replication initiation protein; Reviewed	Back alignment and domain information

>TIGR03017 EpsF chain length determinant protein EpsF	Back alignment and domain information

>PRK06526 transposase; Provisional	Back alignment and domain information

>PRK08084 DNA replication initiation factor; Provisional	Back alignment and domain information

>PRK08116 hypothetical protein; Validated	Back alignment and domain information

>PLN03229 acetyl-coenzyme A carboxylase carboxyl transferase subunit alpha; Provisional	Back alignment and domain information

>PRK05642 DNA replication initiation factor; Validated	Back alignment and domain information

>PRK10869 recombination and repair protein; Provisional	Back alignment and domain information

>PF04111 APG6: Autophagy protein Apg6; InterPro: IPR007243 Macroautophagy is a bulk degradation process induced by starvation in eukaryotic cells	Back alignment and domain information

>KOG0579 consensus Ste20-like serine/threonine protein kinase [Signal transduction mechanisms]	Back alignment and domain information

>PF11932 DUF3450: Protein of unknown function (DUF3450); InterPro: IPR016866 There is currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function	Back alignment and domain information

>PF00769 ERM: Ezrin/radixin/moesin family; InterPro: IPR011259 The ERM family consists of three closely-related proteins, ezrin, radixin and moesin []	Back alignment and domain information

>PF12795 MscS_porin: Mechanosensitive ion channel porin domain	Back alignment and domain information

>PF15397 DUF4618: Domain of unknown function (DUF4618)	Back alignment and domain information

>KOG4807 consensus F-actin binding protein, regulates actin cytoskeletal organization [Cytoskeleton]	Back alignment and domain information

>COG0593 DnaA ATPase involved in DNA replication initiation [DNA replication, recombination, and repair]	Back alignment and domain information

>PRK10698 phage shock protein PspA; Provisional	Back alignment and domain information

>KOG3039 consensus Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>PRK14088 dnaA chromosomal replication initiation protein; Provisional	Back alignment and domain information

>PRK14087 dnaA chromosomal replication initiation protein; Provisional	Back alignment and domain information

>PRK09087 hypothetical protein; Validated	Back alignment and domain information

>PF15450 DUF4631: Domain of unknown function (DUF4631)	Back alignment and domain information

>KOG0243 consensus Kinesin-like protein [Cytoskeleton]	Back alignment and domain information

>PF14197 Cep57_CLD_2: Centrosome localisation domain of PPC89	Back alignment and domain information

>PF07058 Myosin_HC-like: Myosin II heavy chain-like; InterPro: IPR009768 This family represents a conserved region within a number of myosin II heavy chain-like proteins that seem to be specific to Arabidopsis thaliana	Back alignment and domain information

>KOG1002 consensus Nucleotide excision repair protein RAD16 [Replication, recombination and repair]	Back alignment and domain information

>PF15066 CAGE1: Cancer-associated gene protein 1 family	Back alignment and domain information

>TIGR00634 recN DNA repair protein RecN	Back alignment and domain information

>TIGR00362 DnaA chromosomal replication initiator protein DnaA	Back alignment and domain information

>PF09728 Taxilin: Myosin-like coiled-coil protein; InterPro: IPR019132 Taxilin contains an extraordinarily long coiled-coil domain in its C-terminal half and is ubiquitously expressed	Back alignment and domain information

>KOG0240 consensus Kinesin (SMY1 subfamily) [Cytoskeleton]	Back alignment and domain information

>PF10186 Atg14: UV radiation resistance protein and autophagy-related subunit 14; InterPro: IPR018791 Class III phosphatidylinositol 3-kinase (PI3-kinase) regulates multiple membrane trafficking	Back alignment and domain information

>PF06005 DUF904: Protein of unknown function (DUF904); InterPro: IPR009252 Cell division protein ZapB is a non-essential, abundant cell division factor that is required for proper Z-ring formation	Back alignment and domain information

>PRK07952 DNA replication protein DnaC; Validated	Back alignment and domain information

>TIGR00618 sbcc exonuclease SbcC	Back alignment and domain information

>COG1474 CDC6 Cdc6-related protein, AAA superfamily ATPase [DNA replication, recombination, and repair / Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PF11932 DUF3450: Protein of unknown function (DUF3450); InterPro: IPR016866 There is currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function	Back alignment and domain information

>PF00769 ERM: Ezrin/radixin/moesin family; InterPro: IPR011259 The ERM family consists of three closely-related proteins, ezrin, radixin and moesin []	Back alignment and domain information

>PF15294 Leu_zip: Leucine zipper	Back alignment and domain information

>PRK08903 DnaA regulatory inactivator Hda; Validated	Back alignment and domain information

>KOG4677 consensus Golgi integral membrane protein [Intracellular trafficking, secretion, and vesicular transport; General function prediction only]	Back alignment and domain information

>PRK10246 exonuclease subunit SbcC; Provisional	Back alignment and domain information

>TIGR02977 phageshock_pspA phage shock protein A	Back alignment and domain information

>TIGR03420 DnaA_homol_Hda DnaA regulatory inactivator Hda	Back alignment and domain information

>COG4026 Uncharacterized protein containing TOPRIM domain, potential nuclease [General function prediction only]	Back alignment and domain information

>COG1842 PspA Phage shock protein A (IM30), suppresses sigma54-dependent transcription [Transcription / Signal transduction mechanisms]	Back alignment and domain information

>COG2433 Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>KOG0804 consensus Cytoplasmic Zn-finger protein BRAP2 (BRCA1 associated protein) [General function prediction only]	Back alignment and domain information

>TIGR02449 conserved hypothetical protein TIGR02449	Back alignment and domain information

>TIGR03017 EpsF chain length determinant protein EpsF	Back alignment and domain information

>PF12325 TMF_TATA_bd: TATA element modulatory factor 1 TATA binding; InterPro: IPR022091 This is the C-terminal conserved coiled coil region of a family of TATA element modulatory factor 1 proteins conserved in eukaryotes []	Back alignment and domain information

>KOG2685 consensus Cystoskeletal protein Tektin [Cytoskeleton]	Back alignment and domain information

>KOG0239 consensus Kinesin (KAR3 subfamily) [Cytoskeleton]	Back alignment and domain information

>PF08826 DMPK_coil: DMPK coiled coil domain like; InterPro: IPR014930 This domain is found in the myotonic dystrophy protein kinase (DMPK) and adopts a coiled coil structure	Back alignment and domain information

>TIGR02928 orc1/cdc6 family replication initiation protein	Back alignment and domain information

>PRK08181 transposase; Validated	Back alignment and domain information

>PF04912 Dynamitin: Dynamitin ; InterPro: IPR006996 Dynamitin is a subunit of the microtubule-dependent motor complex, it is also implicated in cell adhesion by binding to macrophage-enriched myristoylated alanine-rice C kinase substrate (MacMARCKS) []	Back alignment and domain information

>KOG0804 consensus Cytoplasmic Zn-finger protein BRAP2 (BRCA1 associated protein) [General function prediction only]	Back alignment and domain information

>KOG2113 consensus Predicted RNA binding protein, contains KH domain [General function prediction only]	Back alignment and domain information

>PF15290 Syntaphilin: Golgi-localised syntaxin-1-binding clamp	Back alignment and domain information

>TIGR01000 bacteriocin_acc bacteriocin secretion accessory protein	Back alignment and domain information

>PF14992 TMCO5: TMCO5 family	Back alignment and domain information

>COG0497 RecN ATPase involved in DNA repair [DNA replication, recombination, and repair]	Back alignment and domain information

>PRK08939 primosomal protein DnaI; Reviewed	Back alignment and domain information

>COG4913 Uncharacterized protein conserved in bacteria [Function unknown]	Back alignment and domain information

>KOG2077 consensus JNK/SAPK-associated protein-1 [Signal transduction mechanisms]	Back alignment and domain information

>PF03148 Tektin: Tektin family; InterPro: IPR000435 Tektin heteropolymers form unique protofilaments of flagellar microtubules []	Back alignment and domain information

>PRK00411 cdc6 cell division control protein 6; Reviewed	Back alignment and domain information

>PF05276 SH3BP5: SH3 domain-binding protein 5 (SH3BP5); InterPro: IPR007940 The SH3 domain-binding protein inhibits the auto and transphophorylation of BTK and acts as a negative regulator of BTK-related signalling in B cells	Back alignment and domain information

>PLN03188 kinesin-12 family protein; Provisional	Back alignment and domain information

>PRK08727 hypothetical protein; Validated	Back alignment and domain information

>COG0497 RecN ATPase involved in DNA repair [DNA replication, recombination, and repair]	Back alignment and domain information

>PLN03229 acetyl-coenzyme A carboxylase carboxyl transferase subunit alpha; Provisional	Back alignment and domain information

>TIGR03185 DNA_S_dndD DNA sulfur modification protein DndD	Back alignment and domain information

>KOG1103 consensus Predicted coiled-coil protein [Function unknown]	Back alignment and domain information

>PLN00020 ribulose bisphosphate carboxylase/oxygenase activase -RuBisCO activase (RCA); Provisional	Back alignment and domain information

>KOG1962 consensus B-cell receptor-associated protein and related proteins [Defense mechanisms]	Back alignment and domain information

>PF12795 MscS_porin: Mechanosensitive ion channel porin domain	Back alignment and domain information

>PF04851 ResIII: Type III restriction enzyme, res subunit; InterPro: IPR006935 This entry represents a domain found in the N terminus of several proteins, including helicases, the R subunit (HsdR) of type I restriction endonucleases (3	Back alignment and domain information

>COG2433 Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>COG5175 MOT2 Transcriptional repressor [Transcription]	Back alignment and domain information

>PRK15422 septal ring assembly protein ZapB; Provisional	Back alignment and domain information

>COG3074 Uncharacterized protein conserved in bacteria [Function unknown]	Back alignment and domain information

>PF13166 AAA_13: AAA domain	Back alignment and domain information

>PF06008 Laminin_I: Laminin Domain I; InterPro: IPR009254 Laminins are glycoproteins that are major constituents of the basement membrane of cells	Back alignment and domain information

>PF05384 DegS: Sensor protein DegS; InterPro: IPR008595 This is a group of Bacillus DegS proteins	Back alignment and domain information

>PF06120 Phage_HK97_TLTM: Tail length tape measure protein; InterPro: IPR009302 This entry consists of the tail length tape measure protein from Bacteriophage HK97 and related sequences from Escherichia coli (strain K12)	Back alignment and domain information

>PF09304 Cortex-I_coil: Cortexillin I, coiled coil; InterPro: IPR015383 This domain is predominantly found in the actin-bundling protein cortexillin I from Dictyostelium discoideum (Slime mold)	Back alignment and domain information

>KOG4445 consensus Uncharacterized conserved protein, contains RWD domain [Function unknown]	Back alignment and domain information

>KOG0982 consensus Centrosomal protein Nuf [Cell cycle control, cell division, chromosome partitioning; Cytoskeleton]	Back alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST

Original result of BLAST against Protein Data Bank

ID	Alignment Graph	Length	Definition	E-value
Query		1100
1t5c_A		349	Crystal Structure Of The Motor Domain Of Human Kine		4e-73
1mkj_A		349	Human Kinesin Motor Domain With Docked Neck Linker		7e-64
4atx_C		340	Rigor Kinesin Motor Domain With An Ordered Neck-Lin		1e-63
1bg2_A		325	Human Ubiquitous Kinesin Motor Domain Length = 325		1e-63
2y5w_A		365	Crystal Structure Of Drosophila Melanogaster Kinesi		1e-61
3b6u_A		372	Crystal Structure Of The Motor Domain Of Human Kine		4e-59
1goj_A		355	Structure Of A Fast Kinesin: Implications For Atpas		9e-59
2vvg_A		350	Crystal Structure Of The G.Intestinalis Kinesin 2 G		2e-56
3b6v_A		395	Crystal Structure Of The Motor Domain Of Human Kine		2e-55
2wbe_C		373	Kinesin-5-Tubulin Complex With Amppnp Length = 373		6e-54
3gbj_A		354	Crystal Structure Of The Motor Domain Of Kinesin Ki		5e-52
4a14_A		344	Human Kif7, A Kinesin Involved In Hedgehog Signalli		2e-51
2xt3_A		344	Human Kif7, A Kinesin Involved In Hedgehog Signalli		5e-50
4aqv_C		373	Model Of Human Kinesin-5 Motor Domain (3hqd) And Ma		9e-50
1ia0_K		394	Kif1a Head-Microtubule Complex Structure In Atp-For		3e-49
4a28_A		368	Eg5-2 Length = 368		4e-49
4a1z_A		368	Eg5-1 Length = 368		5e-49
1ii6_A		368	Crystal Structure Of The Mitotic Kinesin Eg5 In Com		5e-49
1q0b_A		367	Crystal Structure Of The Motor Protein Ksp In Compl		5e-49
3hqd_A		369	Human Kinesin Eg5 Motor Domain In Complex With Ampp		5e-49
4ap0_A		370	The Mitotic Kinesin Eg5 In Complex With Mg-Adp And		5e-49
1x88_A		359	Human Eg5 Motor Domain Bound To Mg-Adp And Monastro		6e-49
3zcw_A		348	Eg5 - New Allosteric Binding Site Length = 348		1e-48
1i5s_A		367	Crystal Structure Of The Kif1a Motor Domain Complex		2e-48
1i6i_A		366	Crystal Structure Of The Kif1a Motor Domain Complex		3e-48
1vfv_A		366	Crystal Structure Of The Kif1a Motor Domain Complex		4e-48
2owm_A		443	Motor Domain Of Neurospora Crassa Kinesin-3 (Nckin3		4e-48
3bfn_A		388	Crystal Structure Of The Motor Domain Of Human Kine		1e-47
3lre_A		355	Crystal Structure Analysis Of Human Kinesin-8 Motor		3e-47
3nwn_A		359	Crystal Structure Of The Human Kif9 Motor Domain In		2e-46
3h4s_A		386	Structure Of The Complex Of A Mitotic Kinesin With		7e-46
1sdm_A		369	Crystal Structure Of Kinesin-Like Calmodulin Bindin		3e-45
3u06_A		412	Crystal Structure Of The Kinesin-14 Ncdg347d Length		5e-43
1v8j_A		410	The Crystal Structure Of The Minimal Functional Dom		2e-42
2ncd_A		420	Ncd (Non-Claret Disjunctional) Dimer From D. Melano		2e-42
2h58_A		330	Crystal Structure Of The Kifc3 Motor Domain In Comp		2e-42
1cz7_A		406	The Crystal Structure Of A Minus-End Directed Micro		3e-42
2heh_A		387	Crystal Structure Of The Kif2c Motor Domain (Casp T		4e-42
3edl_D		331	Kinesin13-Microtubule Ring Complex Length = 331		6e-42
2kin_A		238	Kinesin (Monomeric) From Rattus Norvegicus Length =		2e-41
1n6m_A		409	Rotation Of The StalkNECK AND ONE HEAD IN A NEW CRY		2e-41
3l1c_A		383	Kinesin-14 Protein Ncd, T436s Mutant Length = 383		3e-41
2gry_A		420	Crystal Structure Of The Human Kif2 Motor Domain In		6e-41
4h1g_A		715	Structure Of Candida Albicans Kar3 Motor Domain Fus		2e-38
4gkr_A		371	Structure Of The C-Terminal Motor Domain Of Kar3 Fr		3e-36
3t0q_A		349	Motor Domain Structure Of The Kar3-Like Kinesin Fro		2e-35
2rep_A		376	Crystal Structure Of The Motor Domain Of Human Kine		1e-34
4etp_A		403	C-Terminal Motor And Motor Homology Domain Of Kar3v		4e-32
1f9t_A		358	Crystal Structures Of Kinesin Mutants Reveal A Sign		6e-32
3kar_A		346	The Motor Domain Of Kinesin-Like Protein Kar3, A Sa		7e-32
1f9u_A		347	Crystal Structures Of Mutants Reveal A Signalling P		3e-31
1f9w_A		347	Crystal Structures Of Mutants Reveal A Signalling P		4e-31
3pxn_A		344	Crystal Structure Of The Drosophila Kinesin Family		4e-31
1f9v_A		347	Crystal Structures Of Mutants Reveal A Signalling P		5e-31
3dc4_A		344	Crystal Structure Of The Drosophila Kinesin Family		1e-30
1ry6_A		360	Crystal Structure Of Internal Kinesin Motor Domain		2e-29
2kin_B		100	Kinesin (Monomeric) From Rattus Norvegicus Length =		7e-14
3kin_B		117	Kinesin (Dimeric) From Rattus Norvegicus Length = 1		3e-13
3eb5_A		74	Structure Of The Ciap2 Ring Domain Length = 74		9e-06
2ecg_A		75	Solution Structure Of The Ring Domain Of The Baculo		2e-05
4ic2_A		74	Crystal Structure Of The Xiap Ring Domain Length =		3e-05
4ic3_A		74	Crystal Structure Of The F495l Mutant Xiap Ring Dom		3e-05
3t6p_A		345	Iap Antagonist-Induced Conformational Change In Cia		7e-05
4auq_B		62	Structure Of Birc7-Ubch5b-Ub Complex. Length = 62		4e-04
2yhn_A		79	The Idol-Ube2d Complex Mediates Sterol-Dependent De		6e-04

>pdb|1T5C|A Chain A, Crystal Structure Of The Motor Domain Of Human Kinetochore Protein Cenp-E Length = 349