Citrus Sinensis ID: 001325

Local Sequence Feature Prediction

Prediction and (Method)	Result

Residue Number Marker

Protein Sequence

Secondary Structure (PSIPRED)

Secondary Structure Prediction (SSPRO)

Coil and Loop (DISEMBL)

Flexible Loop (DISEMBL)

Low Complexity Region (SEG)

Disordered region (IsUnstruct)

Disordered Region (DISOPRED)

Disordered Region (DISEMBL)

Disordered Region (DISPRO)

Transmembrane Helix (TMHMM)

Transmembrane Helix (HMMTOP)

Transmembrane Helix (MEMSAT)

TM Helix, Signal Peptide (MEMSAT_SVM)

TM Helix, Signal Peptide (Phobius)

Signal Peptide (SignalP HMM Mode)

Signal Peptide (SignalP NN Mode)

Coiled Coils (COILS)

Positional Conservation

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820-------830-------840-------850-------860-------870-------880-------890-------900-------910-------920-------930-------940-------950-------960-------970-------980-------990------1000------1010------1020------1030------1040------1050------1060------1070------1080------1090------1100

MDTAEQPLKKRKLYDLPPESPKPVEGPQSDVVPPQTPPPLSQDEIQSRRRNKDEIRSVYECYRRLKACIAQKDARRLPELEQAYLSLITASRGCTSVQRIVADLVPRYALYCPTALEAATEVVIYMHNSSVALINRGEDADGVAFQTASACIFGLGDICRTASSEVPTSSVIRGICSAVFHNVLDFFISSFDGKDIIHTVDKEITKMLDSDEVFLGLKKKFSDEDESSLIKLSKFRLLSLLQIFFSSPKNLLAACFELFNPSVLEGIHKGQYFFSQITSRFDDDNMTHSFIIKDDGPKFPETSTKGKEASSEQLVSDDNHVGTSVLKSCLLGLALGKNPSLRRWMFSRYKKLCNLSSSNALPELSSALKRIFESFSEVAKEEGSEVDSDEDDSDPSKYANQQYLVARSANQHETSRELSGNESNSRVNEESCDVSFADKFSGQYPRPHGSVGPRETDFHSNAGSSHDSGCTRSMEYDTGDPGDFSCGRSSMPRDLPNPQMLSPAARTPLHFRNNSFEGRNHFPGRSSSEGASNALLSPNHHLPVPYASTTSQIVWYFDEDPAAMDIFSASKQLWLGSFGPEASEAHIRFQIDRFGPLEHFFFFPIKGFALVEYINIIDAIRAREYIRNHFSWRVKFMDVGLGTKGVINGVAVGSCFHVYVGNIPNQWAKDEILHESYKVVYKGPYMVTDLSCEGALLMEFRTPEEATTAMAHLRQHRKSRSNYLPPNTGPANAAMSQIDGARSVPAAPIHVDIRSNRLGNISAGGFGSPHTAPFHSSQPGFHHATSFTVRPEISSMELSSPRVISENHGAAVQDGHSFQSNWSVSGRTEMPEAGFRKIDGHDSSIMVNPSQGGNMPCLPMATQGPIPPPQPIQPTQYLHPVYLPPNSSWDAGGSNHQLPSNPISPNVVPNTFHVNAVAAPFIPPSVTPLAQIQGAPMQNYDQMFSHPVAPPHLSSLPPQPAELPPLPPSPPPLPQSQPPLVPPPPNSPPPPPPSPVVEPMQVERSGQLLQYQWQGALCKSGVHYCTIYAQREESDICKYTHDISEPAEWPAKLDMTKRTDFRHVKSTFTSTPPNKREVCRLVPSSPGDHKGVSFLIHLLF

cccccccccccccccccccccccccccccccccccccccccHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHccccHHHHHHHHHccccccccccHHHHHHHHHHEEEEccccEEEccccccccHHHHHHHHHHccccHHcccccccccccccccccHHHHHHHHHHHHHHccccccEEEEccHHHHcccccHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHcccccccccHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccEEHHHcccccccccHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEcccccHHHHHHHcccEEEEEEccccHHHHHHHHHHHHcccccEEEEcccccEEEEEEHHHHHHHHHHHHHccccEEEEEEEEcccccccccccEEEEEEEEEEEccccccHHHHHHHHHHHHHHcccccEEEEcccccEEEEEEccHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEEEccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHcc

cccccccHHHcccccccccccccccccccccccccccccccHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHcHcHHHHHHHHHHHHHHHHccHHHEccccccccHHHHHHHHHHHHHHHHHHHHccccccccHHccHHHHHHHHHHHHHHHHcccccEEEEccHHHccccccHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccHHHHHEEcccccHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccEcccccccccccccccccccccccccccccHcccccccEEEccccccccccccccccccccccccccccEEEccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEEccccccEEEEEcccHEEEccccccHHHHHHHHHHHHcccHHHEEEccccccEEEEHHHHHHHHHHHHHccccccHEEEEHHHcccccccEccEEEcccEEEEEEEcccHHHHHHHHHHHHHHccccccEEEEcccccEEEEEcccHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEEEEEEcccccccccccccccccccHccEEEEcccccEEcccccccccccEEEEEEcccccccccHHHHHHHHc

mdtaeqplkkrklydlppespkpvegpqsdvvppqtppplsqdeiqsRRRNKDEIRSVYECYRRLKACIAQKDARRLPELEQAYLSLITASRGCTSVQRIVADlvpryalycpTALEAATEVVIYMHNSSVALinrgedadgvAFQTASACIFGLGdicrtassevptssviRGICSAVFHNVLDFfissfdgkdiIHTVDKEITKMldsdevflglkkkfsdedesslIKLSKFRLLSLLQIFFSSPKNLLAACFELfnpsvlegihkgqYFFSQitsrfdddnmthsfiikddgpkfpetstkgkeasseqlvsddnhvgtSVLKSCLLglalgknpslrRWMFSRYKKLCnlsssnalpELSSALKRIFESFSEVAKeegsevdsdeddsdpskyanQQYLVARSAnqhetsrelsgnesnsrvneescdvsfadkfsgqyprphgsvgpretdfhsnagsshdsgctrsmeydtgdpgdfscgrssmprdlpnpqmlspaartplhfrnnsfegrnhfpgrsssegasnallspnhhlpvpyasttSQIVwyfdedpaamDIFSASKQLwlgsfgpeaseAHIRFQidrfgplehffffpikgFALVEYINIIDAIRAREYIRNHFSWRVKFMDVGLGTKGVINGVAVGSCFHVYvgnipnqwakdeilHESYKVVYKGPYMVTDLSCEGallmefrtpeEATTAMAHLRQHRksrsnylppntgpanaamsqidgarsvpaapihvdirsnrlgnisaggfgsphtapfhssqpgfhhatsftvrpeissmelssprvisenhgaavqdghsfqsnwsvsgrtempeagfrkidghdssimvnpsqggnmpclpmatqgpipppqpiqptqylhpvylppnsswdaggsnhqlpsnpispnvvpntfhvnavaapfippsvtplaqiqgapmqnydqmfshpvapphlsslppqpaelpplppsppplpqsqpplvppppnsppppppspvvepmqversgQLLQYQWQGALCKSGVHYCTIYAQREEsdickythdisepaewpakldmtkrtdfrhvkstftstppnkrevcrlvpsspgdhkgvsFLIHLLF

mdtaeqplkkrklydlppespkpvegpqsdvvppqtppplsqdeiqsrrrnkdeIRSVYECYRRLKAciaqkdarrlpELEQAYLSLitasrgctsVQRIVADLVPRYALYCPTALEAATEVVIYMHNSSVALINRGEDADGVAFQTASACIFGLGDICRTASSEVPTSSVIRGICSAVFHNVLDFFISSFDGKDIIHTVDKEITKMLDSDEVFLGLKkkfsdedesSLIKLSKFRLLSLLQIFFSSPKNLLAACFELFNPSVLEGIHKGQYFFSQITSRFDDDNMTHSFiikddgpkfPETSTkgkeasseqlvsddnhVGTSVLKSCLLGLALGKNPSLRRWMFSRYKKLCNLSSSNALPELSSALKRIFESFSEVAKeegsevdsdeddsdpsKYANQQYLVARSanqhetsrelsgnesnsrvnEESCDVSFADKFSGQYPRPHGSVGPRETDFHSNAGSSHDSGCTRSMEYDTGDPGDFSCGRSSMPRDLPNPQMLSPAARTPLHFRNNSFEGRNHFPGRSSSEGASNALLSPNHHLPVPYASTTSQIVWYFDEDPAAMDIFSASKQLWLGSFGPEASEAHIRFQIDRFGPLEHFFFFPIKGFALVEYINIIDAIRAREYIRNHFSWRVKFMDVGLGTKGVINGVAVGSCFHVYVGNIPNQWAKDEILHESYKVVYKGPYMVTDLSCEGALLMEFRTPEEATTAMAHLRQHRKSRSNYLPPNTGPANAAMSQIDGARSVPAAPIHVDIRSNRLGNISAGGFGSPHTAPFHSSQPGFHHATSFTVRPEISSMELSSPRVISENHGAAVQDGHSFQSNWSVSGRTEMPEAGFRKIDGHDSSIMVNPSQGGNMPCLPMATQGPIPPPQPIQPTQYLHPVYLPPNSSWDAGGSNHQLPSNPISPNVVPNTFHVNAVAAPFIPPSVTPLAQIQGAPMQNYDQMFSHPVAPPHLSSLPPQPAELPPLPPSPPPLPQSQPPLVPPPPNSPPPPPPSPVVEPMQVERSGQLLQYQWQGALCKSGVHYCTIYAQREESDICKYTHdisepaewpakldmtkrtDFRHvkstftstppnkrevcrlvpsspgdhkgvsFLIHLLF

MDTAEQPLKKRKLYDLPPESPKPVEGPQSDVVPPQTPPPLSQDEIQSRRRNKDEIRSVYECYRRLKACIAQKDARRLPELEQAYLSLITASRGCTSVQRIVADLVPRYALYCPTALEAATEVVIYMHNSSVALINRGEDADGVAFQTASACIFGLGDICRTASSEVPTSSVIRGICSAVFHNVLDFFISSFDGKDIIHTVDKEITKMLDSDEVFLGLKKKFSDEDESSLIKLSKFRLLSLLQIFFSSPKNLLAACFELFNPSVLEGIHKGQYFFSQITSRFDDDNMTHSFIIKDDGPKFPETSTKGKEASSEQLVSDDNHVGTSVLKSCLLGLALGKNPSLRRWMFSRYKKLCNLSSSNALPELSSALKRIFESFSEVAKeegsevdsdeddsdpsKYANQQYLVARSANQHETSRELSGNESNSRVNEESCDVSFADKFSGQYPRPHGSVGPRETDFHSNAGSSHDSGCTRSMEYDTGDPGDFSCGRSSMPRDLPNPQMLSPAARTPLHFRNNSFEGRNHFPGRSSSEGASNALLSPNHHLPVPYASTTSQIVWYFDEDPAAMDIFSASKQLWLGSFGPEASEAHIRFQIDRFGPLEHFFFFPIKGFALVEYINIIDAIRAREYIRNHFSWRVKFMDVGLGTKGVINGVAVGSCFHVYVGNIPNQWAKDEILHESYKVVYKGPYMVTDLSCEGALLMEFRTPEEATTAMAHLRQHRKSRSNYLPPNTGPANAAMSQIDGARSVPAAPIHVDIRSNRLGNISAGGFGSPHTAPFHSSQPGFHHATSFTVRPEISSMELSSPRVISENHGAAVQDGHSFQSNWSVSGRTEMPEAGFRKIDGHDSSIMVNPSQGGNMPCLPMATQGpipppqpiqpTQYLHPVYLPPNSSWDAGGSNHQLpsnpispnvvpnTFHVNAVAAPFIPPSVTPLAQIQGAPMQNYDQMFSHPVAPPHlsslppqpaelpplppsppplpqsqpplvppppnsppppppspvvepMQVERSGQLLQYQWQGALCKSGVHYCTIYAQREESDICKYTHDISEPAEWPAKLDMTKRTDFRHVKSTFTSTPPNKREVCRLVPSSPGDHKGVSFLIHLLF

******************************************************IRSVYECYRRLKACIAQKDARRLPELEQAYLSLITASRGCTSV***********ALYCPTALEAATEVVIYMHNSSVALINRGEDADGVAFQTASACIFGLGDICRTASSEVPTSSVIRGICSAVFHNVLDFFISSFDGKDIIHTVDKEITKMLDSDEVFLGLKKKFS****SSLIKLSKFRLLSLLQIFFSSPKNLLAACFELFNPSVLEGIHKGQYFFSQITSRFDDDNMTHSFII****************************VGTSVLKSCLLGLALGKNPSLRRWMFSRYKKLCNLS*****************************************************************************************************************************************************************************************LPVPYASTTSQIVWYFDEDPAAMDIFSASKQLWLGSFGPEASEAHIRFQIDRFGPLEHFFFFPIKGFALVEYINIIDAIRAREYIRNHFSWRVKFMDVGLGTKGVINGVAVGSCFHVYVGNIPNQWAKDEILHESYKVVYKGPYMVTDLSCEGALLMEFR********************************************************************************************************************************************************************************LHPVY************************VVPNTFHVNAVAAPFIPPSVTPLAQ***************************************************************************QLLQYQWQGALCKSGVHYCTIYAQREESDICKYTHDISEPAEWPA****************************************VSFLIHL**

********************************************************SVYECYRRLKACIAQKDARRLPELEQAYLSLITASRGCTSVQRIVADLVPRYALYCPTALEAATEVVIYMHNSSVALINRGEDADGVAFQTASACIFGLGDICRTASSEVPTSSVIRGICSAVFHNVLDFFISSFDGKDIIHTVDKEIT**LDS**V***************LIKLSKFRLLSLLQIFFSSPKNLLAACFELFNPSVLEGIHKGQYFFSQITSRFDDDNMTH*************************************LKSCLLGLALGKNPSLRRWMFSRYKKLCNLSSSNALPELSSALKRIFESF************************NQQYLVA*********************NEESCDVSFADKFS**********************************************************MLSPA***********************************************QIVWYFDEDPAAMDIFSASKQLWLGSFGPEASEAHIRFQIDRFGPLEHFFFFPIKGFALVEYINIIDAIRAREYIRNHFSWRVKFMDVGLGTKGVINGVAVGSCFHVYVGNIPNQWAKDEILHESYKVVYKGPYMVTDLSCEGALLMEFRTPEEATTAMA*****************************************************************************************************************************************************************************************************************************************************************************************************************LCKSGVHYCTIYAQREESD*************WPAKLDMTKRTDFRHVKSTFTSTPPNKREVCRLVPSSPGDHKGVSFLIHLLF

MDTAEQPLKKRKLYDLPPE*********************************DEIRSVYECYRRLKACIAQKDARRLPELEQAYLSLITASRGCTSVQRIVADLVPRYALYCPTALEAATEVVIYMHNSSVALINRGEDADGVAFQTASACIFGLGDICRTASSEVPTSSVIRGICSAVFHNVLDFFISSFDGKDIIHTVDKEITKMLDSDEVFLGLKKKFSDEDESSLIKLSKFRLLSLLQIFFSSPKNLLAACFELFNPSVLEGIHKGQYFFSQITSRFDDDNMTHSFIIKDDGPKF*****************DDNHVGTSVLKSCLLGLALGKNPSLRRWMFSRYKKLCNLSSSNALPELSSALKRIFESFS********************KYANQQYLVARS***********************CDVSFADKFSGQYPRPHGSVGPRETDF***********CTRSMEYDTGDPGDFSCGRSSMPRDLPNPQMLSPAARTPLHFRNNSFEGRNHFPGRSSSEGASNALLSPNHHLPVPYASTTSQIVWYFDEDPAAMDIFSASKQLWLGSFGPEASEAHIRFQIDRFGPLEHFFFFPIKGFALVEYINIIDAIRAREYIRNHFSWRVKFMDVGLGTKGVINGVAVGSCFHVYVGNIPNQWAKDEILHESYKVVYKGPYMVTDLSCEGALLMEFRTPEEATTAMAHLRQHRKSRSNYLPPNTGPANAAMSQIDGARSVPAAPIHVDIRSNRLGNISAGGFGSPHTAPFHSSQPGFHHATSFTVRPEISSMELSSPRVISENHGAAVQDGHSFQSNWSVSGRTEMPEAGFRKIDGHDSSIMVNPSQGGNMPCLPMATQGPIPPPQPIQPTQYLHPVYLPPNSSWDAGGSNHQLPSNPISPNVVPNTFHVNAVAAPFIPPSVTPLAQIQGAPMQNYDQMFSHPVAPPHLSSLPPQPAELPPLPPSPP************************VVEPMQVERSGQLLQYQWQGALCKSGVHYCTIYAQREESDICKYTHDISEPAEWPAKLDMTKRTDFRHVKSTFTSTPPNKREVCRLVPSSPGDHKGVSFLIHLLF

******************************************D*IQ**RRNKDEIRSVYECYRRLKACIAQKDARRLPELEQAYLSLITASRGCTSVQRIVADLVPRYALYCPTALEAATEVVIYMHNSSVALINRGEDADGVAFQTASACIFGLGDICRTASSEVPTSSVIRGICSAVFHNVLDFFISSFDGKDIIHTVDKEITKMLDSDEVFLGLKKKFSDEDESSLIKLSKFRLLSLLQIFFSSPKNLLAACFELFNPSVLEGIHKGQYFFSQITSRFDDDN****************************************LKSCLLGLALGKNPSLRRWMFSRYKKLCNLSSSNALPELSSALKRIFESFSEVAKE**************SKYANQ*YLVARSANQHETSRELSGNESNSRVNEESCDVSFADKFSGQYPRP*********************************************************************************************H*PVPYASTTSQIVWYFDEDPAAMDIFSASKQLWLGSFGPEASEAHIRFQIDRFGPLEHFFFFPIKGFALVEYINIIDAIRAREYIRNHFSWRVKFMDVGLGTKGVINGVAVGSCFHVYVGNIPNQWAKDEILHESYKVVYKGPYMVTDLSCEGALLMEFRTPEEATTAMAHLRQHRKSRSN****************************V*******************************************************NHGAAVQDGHSFQSNWSV*GRTEMPEAGFRKIDGHDSSIMVNPSQGGNMPCLPMATQGPIPPPQPIQPTQYLHPVYLPPNSSWDAGGSNHQLPSNPISPNVVPNTFHVNAVAAPFIPPSVTPLAQIQGAP***YDQMFSHPVAPPHLSSLPPQPAELPPLPPSPPPLPQSQPPLVPPPPNSPPPPPPSPVVEPMQVERSGQLLQYQWQGALCKSGVHYCTIYAQREESDICKYTHDISEPAEWPAKLDMTKRTDFRHVKSTFTSTPPNKREVCRLVPSSPGDHKGVSFLIHLLF

oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST

Original result of BLAST against SWISS-PROT Database

No hits with e-value below 0.001 by BLAST

Close Homologs in the Non-Redundant Database Detected by BLAST

Original result of BLAST against Nonredundant Database

GI	Alignment Graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		1100
302142208		1077	unnamed protein product [Vitis vinifera]	0.861	0.880	0.510	0.0
224129874		1944	predicted protein [Populus trichocarpa]	0.884	0.500	0.522	0.0
359492549		1263	PREDICTED: uncharacterized protein LOC10	0.678	0.590	0.562	0.0
6693023		1840	T22C5.20 [Arabidopsis thaliana]	0.827	0.494	0.392	0.0
356562239		1310	PREDICTED: uncharacterized protein LOC10	0.658	0.552	0.513	0.0
449515095		1308	PREDICTED: uncharacterized LOC101209442	0.695	0.584	0.489	0.0
449447293		1308	PREDICTED: uncharacterized protein LOC10	0.695	0.584	0.489	0.0
356554000		1311	PREDICTED: uncharacterized protein LOC10	0.703	0.590	0.496	0.0
145336181		1075	nucleic acid binding protein [Arabidopsi	0.755	0.773	0.408	0.0
297845734		1838	predicted protein [Arabidopsis lyrata su	0.727	0.435	0.402	0.0

>gi\|302142208\|emb\|CBI19411.3\| unnamed protein product [Vitis vinifera]	Back alignment and taxonomy information

 Score = 1022 bits (2643), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 595/1166 (51%), Positives = 717/1166 (61%), Gaps = 218/1166 (18%)

Query: 3    TAEQPLKKRKLYD-LPPESPKPVEGPQSDVVPPQTPPPLSQDEIQSRRRNKDEIRSVYEC 61
            +AEQPLKKRKL+D +    P+P   PQ+        PPLSQ+EI  RRRN++EIR+VYEC
Sbjct: 2    SAEQPLKKRKLHDHVSEPPPEPQPPPQTAAQQRSATPPLSQEEIMRRRRNREEIRNVYEC 61

Query: 62   YRRLKACIAQKDARRLPELEQAYLSLITASRGCTSVQRIVADLVPRYALYCPTALEAATE 121
            Y+R+K+CIA +DAR +PELEQAYLSLITASRGCTS QRIVAD VPRYA YCPTALEAA +
Sbjct: 62   YKRIKSCIAHEDARLMPELEQAYLSLITASRGCTSAQRIVADFVPRYASYCPTALEAAAK 121

Query: 122  VVIYMHNSSVALINRGEDADGVAFQTASACIFGLGDICRTASSEVPTSSVIRGICSAVFH 181
            VVI MH  S+  INRGED++GVAF+TA ACIFGLGDIC  A+SE PTSSVIRGICSAVF 
Sbjct: 122  VVINMHKWSLTTINRGEDSNGVAFETAKACIFGLGDICSAAASEAPTSSVIRGICSAVFL 181

Query: 182  NVLDFFISSFDGKDIIHTVDKEITKMLDSDEVFLGLKKKFSDEDESSLIKLSKFRLLSLL 241
            NVL FF+SSF+GKDI   VDKE  K+ DS E+F  LK+KFSDED S L+KL KF  LS L
Sbjct: 182  NVLTFFLSSFEGKDIFQIVDKETLKIHDSPELFPRLKQKFSDEDGSPLLKLPKFSALSFL 241

Query: 242  QIFFSSPKNLLAACFELFNPSVLEGIHKGQYFF-SQITSRFDDDNMTHSFIIKDDGPK-- 298
            +IFFS  K LLAACFELFN +  EGI+K  YFF SQ+TSR D D+ TH+     DGPK  
Sbjct: 242  KIFFSCSKKLLAACFELFNSTTTEGINKEGYFFLSQVTSRLDADDATHTSNTTIDGPKSC 301

Query: 299  --FPETSTKGKEASSEQLVSDDNHV---GTSVLKSCLLGLALGKNPSLRRWMFSRYKKLC 353
                ETST+G + S E  V D NHV    + +  SCLL L L K+PSLR WMF +YKKLC
Sbjct: 302  PGSVETSTEGNKVSDEGFVRDGNHVLGKASPMSNSCLLRLVLDKDPSLRSWMFVKYKKLC 361

Query: 354  NLSSSNALPELSSALKRIFESFSEVAKEEGSEVDSDEDDSDPSKYANQQYLVARSANQHE 413
              +SS  + E +SAL+RIFESF+E+A+ E S+VDSDED SDPSKY N+            
Sbjct: 362  KSASSQVVSEFTSALERIFESFTELAQVEDSQVDSDEDTSDPSKYINRH----------- 410

Query: 414  TSRELSGNESNSRVNEESCDVSFADKFSGQYPRPHGSVGPRETDFHSNAGSSHDSGCTRS 473
                                                SVGP E D  S+  S+HD G +RS
Sbjct: 411  ------------------------------------SVGPMEADIRSSTSSNHDKGGSRS 434

Query: 474  MEYDTGDPGDFSCGRSSMPRDLPNPQMLSPAARTPLHFRNNSFEGRNHFPGRSSSEGASN 533
            M+++TG+ GD S GRSSMPRDL N  + SP  R    FR + FEGR+H            
Sbjct: 435  MDFETGEHGDLSHGRSSMPRDLLNNHLHSPVTRKSFEFRTDPFEGRSHL----------- 483

Query: 534  ALLSPNHHLPVPYASTTSQIVWYFDEDPAAMDIFSASKQLWLGSFGPEASEAHIRFQIDR 593
             + +  + + + Y++T+SQ +WYFD DPAAMD+FSASKQLWLGS  P+ASEA +RFQ++R
Sbjct: 484  -VQAEKNQMTISYSATSSQTIWYFDGDPAAMDVFSASKQLWLGSISPDASEALVRFQVER 542

Query: 594  FGPLEHFFFFPIKGFALVEYINIIDAIRAREYIRNHFSWRVKFMDVGLGTKGVINGVAVG 653
            FGP+EHFFFFPIKGFALVEY NI+DAIRAREY++ H  W +KF+D+GLGT+G INGVAVG
Sbjct: 543  FGPIEHFFFFPIKGFALVEYRNIMDAIRAREYMQGHSPWHIKFLDIGLGTRGAINGVAVG 602

Query: 654  SCFHVYVGNIPNQWAKDEILHESYKVVYKGPYMVTDLSCEGALLMEFRTPEEATTAMAHL 713
            S +HVYVGN+ +QWAKDEILHES KV+YKGP+MVTDL+   ALLMEF TPEEA + MAHL
Sbjct: 603  SSYHVYVGNVSSQWAKDEILHESMKVIYKGPHMVTDLTGGEALLMEFETPEEAASVMAHL 662

Query: 714  RQHRKSRSNYLPPNTGPANAAMSQIDGARSVPAAPIHVDIRSN-RLGNISA--------- 763
            RQ+R+   N L P     N A + +DGARS+ + PI +    N  +GN+ +         
Sbjct: 663  RQYRRENGNRLMPLNSVTNVARTHLDGARSM-SGPIPLMTMCNLAIGNVGSVVRLARANM 721

Query: 764  ------------------------GGFGSPHTAPFHSSQPGFHHATSFTVRPEISSMELS 799
                                    G  G      F  SQPG  HA  FT + E S++EL 
Sbjct: 722  QMGCCWFIECSNVDAAVTVLKNLRGCPGMFFQIEF--SQPGKPHA--FTKKSESSTLELV 777

Query: 800  SPRVISENHGAAVQDGHSFQSNWSVSGRTEMPEAGFRKIDGHDSSIMVN-PSQG------ 852
            SPRV  ENHG A+Q GH FQSNW+VSG TEMPE G RK DG+DSS++V  PS G      
Sbjct: 778  SPRVKLENHGTALQSGHGFQSNWAVSGSTEMPEVGVRKTDGYDSSMVVGLPSGGHAGSGA 837

Query: 853  ------------------GNMPCLPMATQGP-IPPPQPIQPTQYLHPVYLPPNSSWDAGG 893
                              GN+PC+P+ATQGP I PPQ                       
Sbjct: 838  AEQMWMYKKPEIELHSGQGNIPCMPIATQGPNIAPPQ----------------------- 874

Query: 894  SNHQLPSNPISPNVVPNTFHVNAVAAPFIPPSVTPLAQIQGAPMQNYDQMFSHPVAPPHL 953
                                     APF+P SVTPLAQ+QG  MQ++DQMFS PV+ P L
Sbjct: 875  -------------------------APFLPASVTPLAQMQGNSMQHFDQMFSLPVSLPPL 909

Query: 954  SSLPPQPAELPPLPPSPPPLPQSQPPLVPPPPNSPPPPPPSPVVEPMQVERSGQLLQYQW 1013
               PP                    P+               V+  +Q +  G L     
Sbjct: 910  VPPPPSSP-------------PPPTPI---------------VLSNLQYQWQGTL----- 936

Query: 1014 QGALCKSGVHYCTIYAQREESDICKYTHDISEPAEWPAKLDMTKRTDFRHVKSTFTSTPP 1073
                 KSGV+YCTI A R +SDICKY  ++SEP EWPAKLDMTKRTDFRHVKSTFT TPP
Sbjct: 937  ----SKSGVNYCTIIAHRVDSDICKYLSNMSEPTEWPAKLDMTKRTDFRHVKSTFTGTPP 992

Query: 1074 NKREVCRLVPSSPGDHKGVSFLIHLL 1099
            +KREVC+L P S  DHKG    I  L
Sbjct: 993  HKREVCQLRPFSASDHKGFQDFIAYL 1018

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi\|224129874\|ref\|XP_002320692.1\| predicted protein [Populus trichocarpa] gi\|222861465\|gb\|EEE99007.1\| predicted protein [Populus trichocarpa]	Back alignment and taxonomy information

>gi\|359492549\|ref\|XP_002283309.2\| PREDICTED: uncharacterized protein LOC100259158 [Vitis vinifera]	Back alignment and taxonomy information

>gi\|6693023\|gb\|AAF24949.1\|AC012375_12 T22C5.20 [Arabidopsis thaliana]	Back alignment and taxonomy information

>gi\|356562239\|ref\|XP_003549379.1\| PREDICTED: uncharacterized protein LOC100780367 [Glycine max]	Back alignment and taxonomy information

>gi\|449515095\|ref\|XP_004164585.1\| PREDICTED: uncharacterized LOC101209442 [Cucumis sativus]	Back alignment and taxonomy information

>gi\|449447293\|ref\|XP_004141403.1\| PREDICTED: uncharacterized protein LOC101209442 [Cucumis sativus]	Back alignment and taxonomy information

>gi\|356554000\|ref\|XP_003545338.1\| PREDICTED: uncharacterized protein LOC100798033 [Glycine max]	Back alignment and taxonomy information

>gi\|145336181\|ref\|NP_174096.3\| nucleic acid binding protein [Arabidopsis thaliana] gi\|20259447\|gb\|AAM13844.1\| unknown protein [Arabidopsis thaliana] gi\|332192751\|gb\|AEE30872.1\| nucleic acid binding protein [Arabidopsis thaliana]	Back alignment and taxonomy information

>gi\|297845734\|ref\|XP_002890748.1\| predicted protein [Arabidopsis lyrata subsp. lyrata] gi\|297336590\|gb\|EFH67007.1\| predicted protein [Arabidopsis lyrata subsp. lyrata]	Back alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST

Original result of BLAST against Gene Ontology (AMIGO)

ID	Alignment graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		1100
TAIR\|locus:2199236		1075	AT1G27750 [Arabidopsis thalian	0.340	0.348	0.483	6.1e-211

TAIR\|locus:2199236 AT1G27750 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

 Score = 854 (305.7 bits), Expect = 6.1e-211, Sum P(4) = 6.1e-211
 Identities = 189/391 (48%), Positives = 255/391 (65%)

Query:     1 MDTAEQPLKKRKLYDLPPES--PKP--VEGPQ-SDVV---P-PQTPPPLSQDEIQSRRRN 51
             M  AEQP+KKR+LY+  PES  P P  +E    S VV   P P TP P SQ+EIQ+R RN
Sbjct:     1 MACAEQPIKKRRLYESIPESHPPPPPQLESQSPSTVVSSFPAPVTPSPPSQEEIQTRSRN 60

Query:    52 KDEIRSVYECYRRLKACIAQKDAR-RLPELEQAYLSLITASRGCTSVQRIVADLVPRYAL 110
             ++EIR V++CY+RLK+C+AQ+D   R   LEQAY SLI+ASRGCTSV+R+VADLVPRYAL
Sbjct:    61 REEIRRVHDCYKRLKSCVAQRDGGGRSANLEQAYRSLISASRGCTSVKRLVADLVPRYAL 120

Query:   111 YCPTALEAATEVVIYMHNSSVALINRGEDADGVAFQTASACIFGLGDICRTASSEVPTSS 170
             YCPTA+  A + VI MHN S+  + RG+DADGVAFQTA ACIFGL D+C  A S+  +S 
Sbjct:   121 YCPTAIGDAVQAVIDMHNFSLEALKRGQDADGVAFQTAKACIFGLVDLCSAALSKKTSSP 180

Query:   171 VIRGICSAVFHNVLDFFISSFDGKDIIHTVDKEITKMLDSDEVFLGLKKKFSDEDESSLI 230
               R ICSAVF NVL FF+ SF+GK+I   VDK   K+ D DE+F  L +K SD +   LI
Sbjct:   181 GARDICSAVFRNVLTFFVLSFEGKNIFQIVDKSDLKLQDPDEIFSQLMQKLSDGNSLPLI 240

Query:   231 KLSKFRLLSLLQIFFSSPKNLLAACFELFNPSVLEGIHKGQYFFSQITSRFDDDNMTHSF 290
             KLS+FR+L+LL++FF+ PK  +A CF  FN S  E +  G+Y  + +T + +D  +  + 
Sbjct:   241 KLSQFRVLALLKVFFNFPKKSIATCFGFFNSSSTEDVATGRYLITHMTEKIND--IDAAS 298

Query:   291 IIKDDGPKFPETSTKGKEASSEQLVSDDN-HVGTSVLKSCLLGLALGKNPSLRRWMFSRY 349
             I  +      +T +   EA+ +     +     ++ L SCLL + + K+ S+ RW F +Y
Sbjct:   299 IEPEVDENSGQTGSNNIEATGKNAEGLNGVQEASNSLTSCLLEMVIRKSSSIGRWAFFQY 358

Query:   350 KKLCNLSSSNALPELSSALKRIFESFSEVAK 380
             KK+C+LSS     ++SSA+  +   F  V K
Sbjct:   359 KKICSLSS---FVDISSAVTSLEGIFGFVGK 386

GO:0003676 "nucleic acid binding" evidence=IEA

GO:0005634 "nucleus" evidence=ISM

GO:0008150 "biological_process" evidence=ND

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST

Original result of RPS-BLAST against CDD database part I

ID	Alignment Graph	Length	Definition	E-value
Query		1100
cd12310		72	cd12310, RRM3_Spen, RNA recognition motif 3 in the	4e-13
pfam09770		804	pfam09770, PAT1, Topoisomerase II-associated prote	2e-10
PHA03247		3151	PHA03247, PHA03247, large tegument protein UL36; P	3e-09
pfam09770		804	pfam09770, PAT1, Topoisomerase II-associated prote	8e-09
PRK03427		333	PRK03427, PRK03427, cell division protein ZipA; Pr	3e-06
pfam03154		979	pfam03154, Atrophin-1, Atrophin-1 family	5e-06
PHA03247		3151	PHA03247, PHA03247, large tegument protein UL36; P	9e-06
PHA03247		3151	PHA03247, PHA03247, large tegument protein UL36; P	1e-05
pfam07174		297	pfam07174, FAP, Fibronectin-attachment protein (FA	1e-05
PRK10263		1355	PRK10263, PRK10263, DNA translocase FtsK; Provisio	1e-05
PHA03247		3151	PHA03247, PHA03247, large tegument protein UL36; P	2e-05
pfam03276		582	pfam03276, Gag_spuma, Spumavirus gag protein	2e-05
pfam09770		804	pfam09770, PAT1, Topoisomerase II-associated prote	3e-05
pfam07223		357	pfam07223, DUF1421, Protein of unknown function (D	3e-05
PRK14950		585	PRK14950, PRK14950, DNA polymerase III subunits ga	3e-05
cd12523		78	cd12523, RRM2_MRN1, RNA recognition motif 2 of RNA	3e-05
pfam04652		315	pfam04652, DUF605, Vta1 like	4e-05
PRK14950		585	PRK14950, PRK14950, DNA polymerase III subunits ga	5e-05
pfam07174		297	pfam07174, FAP, Fibronectin-attachment protein (FA	6e-05
pfam03154		979	pfam03154, Atrophin-1, Atrophin-1 family	7e-05
smart00818		165	smart00818, Amelogenin, Amelogenins, cell adhesion	8e-05
PHA03247		3151	PHA03247, PHA03247, large tegument protein UL36; P	1e-04
PRK07764		824	PRK07764, PRK07764, DNA polymerase III subunits ga	1e-04
cd12522		79	cd12522, RRM4_MRN1, RNA recognition motif 4 of RNA	1e-04
pfam07174		297	pfam07174, FAP, Fibronectin-attachment protein (FA	2e-04
PRK14948		620	PRK14948, PRK14948, DNA polymerase III subunits ga	2e-04
COG3147		226	COG3147, DedD, Uncharacterized protein conserved i	2e-04
PRK14965		576	PRK14965, PRK14965, DNA polymerase III subunits ga	2e-04
PRK11633		226	PRK11633, PRK11633, cell division protein DedD; Pr	2e-04
PRK14951		618	PRK14951, PRK14951, DNA polymerase III subunits ga	2e-04
pfam04652		315	pfam04652, DUF605, Vta1 like	3e-04
PHA03247		3151	PHA03247, PHA03247, large tegument protein UL36; P	4e-04
PRK03427		333	PRK03427, PRK03427, cell division protein ZipA; Pr	4e-04
PRK10263		1355	PRK10263, PRK10263, DNA translocase FtsK; Provisio	4e-04
pfam07223		357	pfam07223, DUF1421, Protein of unknown function (D	4e-04
PRK10263		1355	PRK10263, PRK10263, DNA translocase FtsK; Provisio	5e-04
pfam04652		315	pfam04652, DUF605, Vta1 like	5e-04
PRK07994		647	PRK07994, PRK07994, DNA polymerase III subunits ga	6e-04
COG5178		2365	COG5178, PRP8, U5 snRNP spliceosome subunit [RNA p	8e-04
PHA03247		3151	PHA03247, PHA03247, large tegument protein UL36; P	0.001
PHA03247		3151	PHA03247, PHA03247, large tegument protein UL36; P	0.001
pfam14179		110	pfam14179, YppG, YppG-like protein	0.001
PRK10819		246	PRK10819, PRK10819, transport protein TonB; Provis	0.001
PHA03247		3151	PHA03247, PHA03247, large tegument protein UL36; P	0.002
pfam07223		357	pfam07223, DUF1421, Protein of unknown function (D	0.002
PRK07764		824	PRK07764, PRK07764, DNA polymerase III subunits ga	0.002
TIGR02031		589	TIGR02031, BchD-ChlD, magnesium chelatase ATPase s	0.002
pfam12004		489	pfam12004, DUF3498, Domain of unknown function (DU	0.002
pfam13388		422	pfam13388, DUF4106, Protein of unknown function (D	0.002
PHA03247		3151	PHA03247, PHA03247, large tegument protein UL36; P	0.003
pfam07174		297	pfam07174, FAP, Fibronectin-attachment protein (FA	0.003
cd12340		67	cd12340, RBD_RRM1_NPL3, RNA recognition motif 1 in	0.003
cd00590		72	cd00590, RRM_SF, RNA recognition motif (RRM) super	0.004
PRK12270		1228	PRK12270, kgd, alpha-ketoglutarate decarboxylase;	0.004

>gnl\|CDD\|240756 cd12310, RRM3_Spen, RNA recognition motif 3 in the Spen (split end) protein family	Back alignment and domain information

 Score = 64.9 bits (159), Expect = 4e-13
 Identities = 21/69 (30%), Positives = 34/69 (49%), Gaps = 1/69 (1%)

Query: 573 LWLGSFGPEASEAHIRFQIDRFGPLEHFFFFPIKGFALVEYINIIDAIRAREYIRNHFSW 632
           LW+G  GP  S A +  + DRFG +    + P + +A +EY +I  A  A+E +R     
Sbjct: 1   LWVGGLGPWTSLAELEREFDRFGAIRRIDYDPGRNYAYIEYESIEAAQAAKEALRGFPLG 60

Query: 633 RV-KFMDVG 640
              + + V 
Sbjct: 61  GPGRRLRVD 69

This subfamily corresponds to the RRM3 domain in the Spen (split end) protein family which includes RNA binding motif protein 15 (RBM15), putative RNA binding motif protein 15B (RBM15B) and similar proteins found in Metazoa. RBM15, also termed one-twenty two protein 1 (OTT1), conserved in eukaryotes, is a novel mRNA export factor and is a novel component of the NXF1 pathway. It binds to NXF1 and serves as receptor for the RNA export element RTE. It also possess mRNA export activity and can facilitate the access of DEAD-box protein DBP5 to mRNA at the nuclear pore complex (NPC). RNA-binding protein 15B (RBM15B), also termed one twenty-two 3 (OTT3), is a paralog of RBM15 and therefore has post-transcriptional regulatory activity. It is a nuclear protein sharing with RBM15 the association with the splicing factor compartment and the nuclear envelope as well as the binding to mRNA export factors NXF1 and Aly/REF. Members in this family belong to the Spen (split end) protein family, which shares a domain architecture comprising of three N-terminal RNA recognition motifs (RRMs), also known as RBD (RNA binding domain) or RNP (ribonucleoprotein domain), and a C-terminal SPOC (Spen paralog and ortholog C-terminal) domain. . Length = 72

>gnl\|CDD\|220392 pfam09770, PAT1, Topoisomerase II-associated protein PAT1	Back alignment and domain information

>gnl\|CDD\|223021 PHA03247, PHA03247, large tegument protein UL36; Provisional	Back alignment and domain information

>gnl\|CDD\|220392 pfam09770, PAT1, Topoisomerase II-associated protein PAT1	Back alignment and domain information

>gnl\|CDD\|235124 PRK03427, PRK03427, cell division protein ZipA; Provisional	Back alignment and domain information

>gnl\|CDD\|217393 pfam03154, Atrophin-1, Atrophin-1 family	Back alignment and domain information

>gnl\|CDD\|223021 PHA03247, PHA03247, large tegument protein UL36; Provisional	Back alignment and domain information

>gnl\|CDD\|223021 PHA03247, PHA03247, large tegument protein UL36; Provisional	Back alignment and domain information

>gnl\|CDD\|219321 pfam07174, FAP, Fibronectin-attachment protein (FAP)	Back alignment and domain information

>gnl\|CDD\|236669 PRK10263, PRK10263, DNA translocase FtsK; Provisional	Back alignment and domain information

>gnl\|CDD\|223021 PHA03247, PHA03247, large tegument protein UL36; Provisional	Back alignment and domain information

>gnl\|CDD\|217469 pfam03276, Gag_spuma, Spumavirus gag protein	Back alignment and domain information

>gnl\|CDD\|220392 pfam09770, PAT1, Topoisomerase II-associated protein PAT1	Back alignment and domain information

>gnl\|CDD\|219339 pfam07223, DUF1421, Protein of unknown function (DUF1421)	Back alignment and domain information

>gnl\|CDD\|237864 PRK14950, PRK14950, DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>gnl\|CDD\|240967 cd12523, RRM2_MRN1, RNA recognition motif 2 of RNA-binding protein MRN1 and similar proteins	Back alignment and domain information

>gnl\|CDD\|218191 pfam04652, DUF605, Vta1 like	Back alignment and domain information

>gnl\|CDD\|237864 PRK14950, PRK14950, DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>gnl\|CDD\|219321 pfam07174, FAP, Fibronectin-attachment protein (FAP)	Back alignment and domain information

>gnl\|CDD\|217393 pfam03154, Atrophin-1, Atrophin-1 family	Back alignment and domain information

>gnl\|CDD\|197891 smart00818, Amelogenin, Amelogenins, cell adhesion proteins, play a role in the biomineralisation of teeth	Back alignment and domain information

>gnl\|CDD\|223021 PHA03247, PHA03247, large tegument protein UL36; Provisional	Back alignment and domain information

>gnl\|CDD\|236090 PRK07764, PRK07764, DNA polymerase III subunits gamma and tau; Validated	Back alignment and domain information

>gnl\|CDD\|240966 cd12522, RRM4_MRN1, RNA recognition motif 4 of RNA-binding protein MRN1 and similar proteins	Back alignment and domain information

>gnl\|CDD\|219321 pfam07174, FAP, Fibronectin-attachment protein (FAP)	Back alignment and domain information

>gnl\|CDD\|237862 PRK14948, PRK14948, DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>gnl\|CDD\|225689 COG3147, DedD, Uncharacterized protein conserved in bacteria [Function unknown]	Back alignment and domain information

>gnl\|CDD\|237871 PRK14965, PRK14965, DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>gnl\|CDD\|236940 PRK11633, PRK11633, cell division protein DedD; Provisional	Back alignment and domain information

>gnl\|CDD\|237865 PRK14951, PRK14951, DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>gnl\|CDD\|218191 pfam04652, DUF605, Vta1 like	Back alignment and domain information

>gnl\|CDD\|223021 PHA03247, PHA03247, large tegument protein UL36; Provisional	Back alignment and domain information

>gnl\|CDD\|235124 PRK03427, PRK03427, cell division protein ZipA; Provisional	Back alignment and domain information

>gnl\|CDD\|236669 PRK10263, PRK10263, DNA translocase FtsK; Provisional	Back alignment and domain information

>gnl\|CDD\|219339 pfam07223, DUF1421, Protein of unknown function (DUF1421)	Back alignment and domain information

>gnl\|CDD\|236669 PRK10263, PRK10263, DNA translocase FtsK; Provisional	Back alignment and domain information

>gnl\|CDD\|218191 pfam04652, DUF605, Vta1 like	Back alignment and domain information

>gnl\|CDD\|236138 PRK07994, PRK07994, DNA polymerase III subunits gamma and tau; Validated	Back alignment and domain information

>gnl\|CDD\|227505 COG5178, PRP8, U5 snRNP spliceosome subunit [RNA processing and modification]	Back alignment and domain information

>gnl\|CDD\|223021 PHA03247, PHA03247, large tegument protein UL36; Provisional	Back alignment and domain information

>gnl\|CDD\|223021 PHA03247, PHA03247, large tegument protein UL36; Provisional	Back alignment and domain information

>gnl\|CDD\|222579 pfam14179, YppG, YppG-like protein	Back alignment and domain information

>gnl\|CDD\|236768 PRK10819, PRK10819, transport protein TonB; Provisional	Back alignment and domain information

>gnl\|CDD\|223021 PHA03247, PHA03247, large tegument protein UL36; Provisional	Back alignment and domain information

>gnl\|CDD\|219339 pfam07223, DUF1421, Protein of unknown function (DUF1421)	Back alignment and domain information

>gnl\|CDD\|236090 PRK07764, PRK07764, DNA polymerase III subunits gamma and tau; Validated	Back alignment and domain information

>gnl\|CDD\|233692 TIGR02031, BchD-ChlD, magnesium chelatase ATPase subunit D	Back alignment and domain information

>gnl\|CDD\|221371 pfam12004, DUF3498, Domain of unknown function (DUF3498)	Back alignment and domain information

>gnl\|CDD\|222095 pfam13388, DUF4106, Protein of unknown function (DUF4106)	Back alignment and domain information

>gnl\|CDD\|223021 PHA03247, PHA03247, large tegument protein UL36; Provisional	Back alignment and domain information

>gnl\|CDD\|219321 pfam07174, FAP, Fibronectin-attachment protein (FAP)	Back alignment and domain information

>gnl\|CDD\|240786 cd12340, RBD_RRM1_NPL3, RNA recognition motif 1 in yeast nucleolar protein 3 (Npl3p) and similar proteins	Back alignment and domain information

>gnl\|CDD\|240668 cd00590, RRM_SF, RNA recognition motif (RRM) superfamily	Back alignment and domain information

>gnl\|CDD\|237030 PRK12270, kgd, alpha-ketoglutarate decarboxylase; Reviewed	Back alignment and domain information

Conserved Domains Detected by HHsearch

Original result of HHsearch against CDD database

ID	Alignment Graph	Length	Definition	Probability
Query		1100
TIGR01661		352	ELAV_HUD_SF ELAV/HuD family splicing factor. These	99.74
TIGR01659		346	sex-lethal sex-lethal family splicing factor. This	99.72
TIGR01628		562	PABP-1234 polyadenylate binding protein, human typ	99.7
KOG0107		195	consensus Alternative splicing factor SRp20/9G8 (R	99.69
TIGR01628		562	PABP-1234 polyadenylate binding protein, human typ	99.68
TIGR01649		481	hnRNP-L_PTB hnRNP-L/PTB/hephaestus splicing factor	99.66
TIGR01645		612	half-pint poly-U binding splicing factor, half-pin	99.64
TIGR01649		481	hnRNP-L_PTB hnRNP-L/PTB/hephaestus splicing factor	99.62
TIGR01661		352	ELAV_HUD_SF ELAV/HuD family splicing factor. These	99.62
TIGR01622		457	SF-CC1 splicing factor, CC1-like family. A homolog	99.61
TIGR01642		509	U2AF_lg U2 snRNP auxilliary factor, large subunit,	99.59
TIGR01648		578	hnRNP-R-Q heterogeneous nuclear ribonucleoprotein	99.58
TIGR01642		509	U2AF_lg U2 snRNP auxilliary factor, large subunit,	99.55
TIGR01622		457	SF-CC1 splicing factor, CC1-like family. A homolog	99.55
KOG0117		506	consensus Heterogeneous nuclear ribonucleoprotein	99.55
KOG1924		1102	consensus RhoA GTPase effector DIA/Diaphanous [Sig	99.48
TIGR01648		578	hnRNP-R-Q heterogeneous nuclear ribonucleoprotein	99.46
KOG0148		321	consensus Apoptosis-promoting RNA-binding protein	99.43
KOG0105		241	consensus Alternative splicing factor ASF/SF2 (RRM	99.38
KOG0144		510	consensus RNA-binding protein CUGBP1/BRUNO (RRM su	99.31
PF00076		70	RRM_1: RNA recognition motif. (a.k.a. RRM, RBD, or	99.22
PLN03134		144	glycine-rich RNA-binding protein 4; Provisional	99.21
KOG0145		360	consensus RNA-binding protein ELAV/HU (RRM superfa	99.17
KOG0117		506	consensus Heterogeneous nuclear ribonucleoprotein	99.16
PF14259		70	RRM_6: RNA recognition motif (a.k.a. RRM, RBD, or	98.99
KOG0124		544	consensus Polypyrimidine tract-binding protein PUF	98.99
KOG0132		894	consensus RNA polymerase II C-terminal domain-bind	98.99
KOG0131		203	consensus Splicing factor 3b, subunit 4 [RNA proce	98.97
KOG0106		216	consensus Alternative splicing factor SRp55/B52/SR	98.95
smart00362		72	RRM_2 RNA recognition motif.	98.92
PLN03120		260	nucleic acid binding protein; Provisional	98.89
KOG0123		369	consensus Polyadenylate-binding protein (RRM super	98.88
COG0724		306	RNA-binding proteins (RRM domain) [General functio	98.87
TIGR01659		346	sex-lethal sex-lethal family splicing factor. This	98.84
KOG0113		335	consensus U1 small nuclear ribonucleoprotein (RRM	98.78
KOG0109		346	consensus RNA-binding protein LARK, contains RRM a	98.77
KOG0122		270	consensus Translation initiation factor 3, subunit	98.76
KOG1924		1102	consensus RhoA GTPase effector DIA/Diaphanous [Sig	98.76
TIGR01645		612	half-pint poly-U binding splicing factor, half-pin	98.75
KOG3671		569	consensus Actin regulatory protein (Wiskott-Aldric	98.73
smart00360		71	RRM RNA recognition motif.	98.71
cd00590		74	RRM RRM (RNA recognition motif), also known as RBD	98.71
KOG0110		725	consensus RNA-binding protein (RRM superfamily) [G	98.71
PLN03213		759	repressor of silencing 3; Provisional	98.7
PF13893		56	RRM_5: RNA recognition motif. (a.k.a. RRM, RBD, or	98.69
KOG0121		153	consensus Nuclear cap-binding protein complex, sub	98.68
KOG0111		298	consensus Cyclophilin-type peptidyl-prolyl cis-tra	98.66
KOG4206		221	consensus Spliceosomal protein snRNP-U1A/U2B [RNA	98.65
KOG0114		124	consensus Predicted RNA-binding protein (RRM super	98.63
KOG0144		510	consensus RNA-binding protein CUGBP1/BRUNO (RRM su	98.62
KOG0148		321	consensus Apoptosis-promoting RNA-binding protein	98.62
PLN03121		243	nucleic acid binding protein; Provisional	98.61
KOG4207		256	consensus Predicted splicing factor, SR protein su	98.57
KOG1457		284	consensus RNA binding protein (contains RRM repeat	98.53
KOG0123		369	consensus Polyadenylate-binding protein (RRM super	98.48
KOG0151		877	consensus Predicted splicing regulator, contains R	98.44
KOG0125		376	consensus Ataxin 2-binding protein (RRM superfamil	98.42
KOG0145		360	consensus RNA-binding protein ELAV/HU (RRM superfa	98.37
KOG0112		975	consensus Large RNA-binding protein (RRM superfami	98.31
KOG4660		549	consensus Protein Mei2, essential for commitment t	98.2
KOG0127		678	consensus Nucleolar protein fibrillarin NOP77 (RRM	98.19
KOG0146		371	consensus RNA-binding protein ETR-3 (RRM superfami	98.18
smart00361		70	RRM_1 RNA recognition motif.	98.17
KOG0153		377	consensus Predicted RNA-binding protein (RRM super	98.14
KOG0147		549	consensus Transcriptional coactivator CAPER (RRM s	98.13
KOG4205		311	consensus RNA-binding protein musashi/mRNA cleavag	98.06
KOG0149		247	consensus Predicted RNA-binding protein SEB4 (RRM	98.02
KOG0109		346	consensus RNA-binding protein LARK, contains RRM a	98.01
KOG0108		435	consensus mRNA cleavage and polyadenylation factor	98.0
KOG0130		170	consensus RNA-binding protein RBM8/Tsunagi (RRM su	97.8
KOG1190		492	consensus Polypyrimidine tract-binding protein [RN	97.79
PHA03247		3151	large tegument protein UL36; Provisional	97.75
KOG0110		725	consensus RNA-binding protein (RRM superfamily) [G	97.71
KOG0120		500	consensus Splicing factor U2AF, large subunit (RRM	97.7
KOG0147		549	consensus Transcriptional coactivator CAPER (RRM s	97.69
KOG0126		219	consensus Predicted RNA-binding protein (RRM super	97.61
KOG1190		492	consensus Polypyrimidine tract-binding protein [RN	97.48
KOG0132		894	consensus RNA polymerase II C-terminal domain-bind	97.48
KOG0127		678	consensus Nucleolar protein fibrillarin NOP77 (RRM	97.45
KOG4208		214	consensus Nucleolar RNA-binding protein NIFK [Gene	97.45
KOG1457		284	consensus RNA binding protein (contains RRM repeat	97.41
KOG1456		494	consensus Heterogeneous nuclear ribonucleoprotein	97.36
PF00076		70	RRM_1: RNA recognition motif. (a.k.a. RRM, RBD, or	97.3
PHA03247		3151	large tegument protein UL36; Provisional	97.3
KOG0415		479	consensus Predicted peptidyl prolyl cis-trans isom	97.28
KOG0131		203	consensus Splicing factor 3b, subunit 4 [RNA proce	97.23
KOG0116		419	consensus RasGAP SH3 binding protein rasputin, con	97.07
KOG4209		231	consensus Splicing factor RNPS1, SR protein superf	96.95
PF14259		70	RRM_6: RNA recognition motif (a.k.a. RRM, RBD, or	96.95
PLN03134		144	glycine-rich RNA-binding protein 4; Provisional	96.92
KOG0226		290	consensus RNA-binding proteins [General function p	96.88
KOG3671		569	consensus Actin regulatory protein (Wiskott-Aldric	96.8
KOG4212		608	consensus RNA-binding protein hnRNP-M [RNA process	96.8
KOG0112		975	consensus Large RNA-binding protein (RRM superfami	96.77
KOG0107		195	consensus Alternative splicing factor SRp20/9G8 (R	96.72
KOG1923		830	consensus Rac1 GTPase effector FRL [Signal transdu	96.55
KOG0129		520	consensus Predicted RNA-binding protein (RRM super	96.53
KOG1548		382	consensus Transcription elongation factor TAT-SF1	96.53
KOG0146		371	consensus RNA-binding protein ETR-3 (RRM superfami	96.48
KOG0533		243	consensus RRM motif-containing protein [RNA proces	96.46
KOG0120		500	consensus Splicing factor U2AF, large subunit (RRM	96.42
KOG2193		584	consensus IGF-II mRNA-binding protein IMP, contain	96.4
KOG4454		267	consensus RNA binding protein (RRM superfamily) [G	96.36
KOG0124		544	consensus Polypyrimidine tract-binding protein PUF	96.23
smart00362		72	RRM_2 RNA recognition motif.	96.2
PF04059		97	RRM_2: RNA recognition motif 2; InterPro: IPR00720	96.1
KOG4206		221	consensus Spliceosomal protein snRNP-U1A/U2B [RNA	96.06
KOG4211		510	consensus Splicing factor hnRNP-F and related RNA-	95.97
KOG1456		494	consensus Heterogeneous nuclear ribonucleoprotein	95.89
KOG0121		153	consensus Nuclear cap-binding protein complex, sub	95.8
cd00590		74	RRM RRM (RNA recognition motif), also known as RBD	95.67
KOG1830		518	consensus Wiskott Aldrich syndrome proteins [Cytos	95.47
smart00360		71	RRM RNA recognition motif.	95.42
KOG4205		311	consensus RNA-binding protein musashi/mRNA cleavag	95.41
KOG1923		830	consensus Rac1 GTPase effector FRL [Signal transdu	95.11
PLN03120		260	nucleic acid binding protein; Provisional	95.01
KOG4672		487	consensus Uncharacterized conserved low complexity	94.88
COG0724		306	RNA-binding proteins (RRM domain) [General functio	94.86
KOG4849		498	consensus mRNA cleavage factor I subunit/CPSF subu	94.8
KOG0128		881	consensus RNA-binding protein SART3 (RRM superfami	94.69
KOG4661		940	consensus Hsp27-ERE-TATA-binding protein/Scaffold	94.22
KOG4212		608	consensus RNA-binding protein hnRNP-M [RNA process	94.08
KOG0106		216	consensus Alternative splicing factor SRp55/B52/SR	93.95
PF14605		53	Nup35_RRM_2: Nup53/35/40-type RNA recognition moti	93.93
KOG1855		484	consensus Predicted RNA-binding protein [General f	93.82
PF08777		105	RRM_3: RNA binding motif; InterPro: IPR014886 This	93.74
PF05918		556	API5: Apoptosis inhibitory protein 5 (API5); Inter	93.6
KOG2416		718	consensus Acinus (induces apoptotic chromatin cond	93.51
KOG0114		124	consensus Predicted RNA-binding protein (RRM super	93.51
KOG2314		698	consensus Translation initiation factor 3, subunit	93.19
KOG1548		382	consensus Transcription elongation factor TAT-SF1	93.04
KOG0108		435	consensus mRNA cleavage and polyadenylation factor	93.02
PF15023		166	DUF4523: Protein of unknown function (DUF4523)	92.92
KOG4574		1007	consensus RNA-binding protein (contains RRM and Pu	92.59
KOG4672		487	consensus Uncharacterized conserved low complexity	92.16
KOG1830		518	consensus Wiskott Aldrich syndrome proteins [Cytos	92.07
KOG1365		508	consensus RNA-binding protein Fusilli, contains RR	91.93
PF13893		56	RRM_5: RNA recognition motif. (a.k.a. RRM, RBD, or	91.29
PLN03121		243	nucleic acid binding protein; Provisional	90.99
PF07744		119	SPOC: SPOC domain; InterPro: IPR012921 Spen (split	90.95
KOG0105		241	consensus Alternative splicing factor ASF/SF2 (RRM	89.65
KOG1925		817	consensus Rac1 GTPase effector FHOS [Signal transd	89.05
smart00361		70	RRM_1 RNA recognition motif.	89.05
KOG1996		378	consensus mRNA splicing factor [RNA processing and	88.68
KOG3152		278	consensus TBP-binding protein, activator of basal	88.38
PF15449		1287	Retinal: Retinal protein	88.34
KOG0130		170	consensus RNA-binding protein RBM8/Tsunagi (RRM su	87.21
PF04847		184	Calcipressin: Calcipressin; InterPro: IPR006931 Ca	86.68
KOG4210		285	consensus Nuclear localization sequence binding pr	86.3
KOG1922		833	consensus Rho GTPase effector BNI1 and related for	86.19
KOG4210		285	consensus Nuclear localization sequence binding pr	85.89
PLN03213		759	repressor of silencing 3; Provisional	84.91
KOG2202		260	consensus U2 snRNP splicing factor, small subunit,	83.51
KOG4660		549	consensus Protein Mei2, essential for commitment t	83.42
PRK15313		955	autotransport protein MisL; Provisional	81.9
KOG0391		1958	consensus SNF2 family DNA-dependent ATPase [Genera	80.5
KOG1984		1007	consensus Vesicle coat complex COPII, subunit SFB3	80.42

>TIGR01661 ELAV_HUD_SF ELAV/HuD family splicing factor	Back alignment and domain information

Probab=99.74  E-value=1.2e-17  Score=179.75  Aligned_cols=141  Identities=16%  Similarity=0.187  Sum_probs=119.4

Q ss_pred             ccceEEeccCCCcccHHHHHHHhhccCCcceEEEec------cCceEEEEecCHHHHHHHHHhhcCCcee----EEEEee
Q 001325          569 ASKQLWLGSFGPEASEAHIRFQIDRFGPLEHFFFFP------IKGFALVEYINIIDAIRAREYIRNHFSW----RVKFMD  638 (1100)
Q Consensus       569 ~Sr~LWVGnLg~~vte~dL~~~F~~fGpLe~V~~~~------~rgfAFVeF~~i~DAv~A~~~LqG~~~~----RI~F~r  638 (1100)
                      +..+||||||+.+++|+||+++|++||+|.+|++.+      .||||||+|.+.+||.+|++.|+|..+.    +|+|++
T Consensus         2 ~~~~l~V~nLp~~~~e~~l~~~F~~~G~i~~v~i~~d~~~g~s~g~afV~f~~~~~A~~Ai~~l~g~~l~g~~i~v~~a~   81 (352)
T TIGR01661         2 SKTNLIVNYLPQTMTQEEIRSLFTSIGEIESCKLVRDKVTGQSLGYGFVNYVRPEDAEKAVNSLNGLRLQNKTIKVSYAR   81 (352)
T ss_pred             CCcEEEEeCCCCCCCHHHHHHHHHccCCEEEEEEEEcCCCCccceEEEEEECcHHHHHHHHhhcccEEECCeeEEEEeec
Confidence            467999999999999999999999999999999854      5699999999999999999999999876    788876


Q ss_pred             ccCCCCcccccccccccceEEEccCCCcchhHHHHHhhhcccccCCceee-c---CCCCcccccccCCHHHHHHHHHHhh
Q 001325          639 VGLGTKGVINGVAVGSCFHVYVGNIPNQWAKDEILHESYKVVYKGPYMVT-D---LSCEGALLMEFRTPEEATTAMAHLR  714 (1100)
Q Consensus       639 ~~~gsrg~~~Gva~~~Sr~LwVG~Iss~~~kEELfsE~dkag~kgPv~f~-D---lsee~aLLmEF~s~eEA~~Ak~~l~  714 (1100)
                      +...         ....+.||||+++..++.++|...|..++....+.+. +   ...++..+|+|++.+||..|++.|+
T Consensus        82 ~~~~---------~~~~~~l~v~~l~~~~~~~~l~~~f~~~G~i~~~~~~~~~~~~~~~g~~fv~f~~~~~A~~ai~~l~  152 (352)
T TIGR01661        82 PSSD---------SIKGANLYVSGLPKTMTQHELESIFSPFGQIITSRILSDNVTGLSKGVGFIRFDKRDEADRAIKTLN  152 (352)
T ss_pred             cccc---------ccccceEEECCccccCCHHHHHHHHhccCCEEEEEEEecCCCCCcCcEEEEEECCHHHHHHHHHHhC
Confidence            6211         1245789999999999999999999987765555442 2   3457789999999999999999999


Q ss_pred             hhcc
Q 001325          715 QHRK  718 (1100)
Q Consensus       715 ~~r~  718 (1100)
                      +...
T Consensus       153 g~~~  156 (352)
T TIGR01661       153 GTTP  156 (352)
T ss_pred             CCcc
Confidence            8763

These proteins contain 3 RNA-recognition motifs (rrm: pfam00076).

>TIGR01659 sex-lethal sex-lethal family splicing factor	Back alignment and domain information

>TIGR01628 PABP-1234 polyadenylate binding protein, human types 1, 2, 3, 4 family	Back alignment and domain information

>KOG0107 consensus Alternative splicing factor SRp20/9G8 (RRM superfamily) [RNA processing and modification]	Back alignment and domain information

>TIGR01628 PABP-1234 polyadenylate binding protein, human types 1, 2, 3, 4 family	Back alignment and domain information

>TIGR01649 hnRNP-L_PTB hnRNP-L/PTB/hephaestus splicing factor family	Back alignment and domain information

>TIGR01645 half-pint poly-U binding splicing factor, half-pint family	Back alignment and domain information

>TIGR01649 hnRNP-L_PTB hnRNP-L/PTB/hephaestus splicing factor family	Back alignment and domain information

>TIGR01661 ELAV_HUD_SF ELAV/HuD family splicing factor	Back alignment and domain information

>TIGR01622 SF-CC1 splicing factor, CC1-like family	Back alignment and domain information

>TIGR01642 U2AF_lg U2 snRNP auxilliary factor, large subunit, splicing factor	Back alignment and domain information

>TIGR01648 hnRNP-R-Q heterogeneous nuclear ribonucleoprotein R, Q family	Back alignment and domain information

>TIGR01642 U2AF_lg U2 snRNP auxilliary factor, large subunit, splicing factor	Back alignment and domain information

>TIGR01622 SF-CC1 splicing factor, CC1-like family	Back alignment and domain information

>KOG0117 consensus Heterogeneous nuclear ribonucleoprotein R (RRM superfamily) [RNA processing and modification]	Back alignment and domain information

>KOG1924 consensus RhoA GTPase effector DIA/Diaphanous [Signal transduction mechanisms; Cytoskeleton]	Back alignment and domain information

>TIGR01648 hnRNP-R-Q heterogeneous nuclear ribonucleoprotein R, Q family	Back alignment and domain information

>KOG0148 consensus Apoptosis-promoting RNA-binding protein TIA-1/TIAR (RRM superfamily) [RNA processing and modification; Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>KOG0105 consensus Alternative splicing factor ASF/SF2 (RRM superfamily) [RNA processing and modification]	Back alignment and domain information

>KOG0144 consensus RNA-binding protein CUGBP1/BRUNO (RRM superfamily) [RNA processing and modification]	Back alignment and domain information

>PF00076 RRM_1: RNA recognition motif	Back alignment and domain information

>PLN03134 glycine-rich RNA-binding protein 4; Provisional	Back alignment and domain information

>KOG0145 consensus RNA-binding protein ELAV/HU (RRM superfamily) [RNA processing and modification]	Back alignment and domain information

>KOG0117 consensus Heterogeneous nuclear ribonucleoprotein R (RRM superfamily) [RNA processing and modification]	Back alignment and domain information

>PF14259 RRM_6: RNA recognition motif (a	Back alignment and domain information

>KOG0124 consensus Polypyrimidine tract-binding protein PUF60 (RRM superfamily) [RNA processing and modification]	Back alignment and domain information

>KOG0132 consensus RNA polymerase II C-terminal domain-binding protein RA4, contains RPR and RRM domains [RNA processing and modification; Transcription]	Back alignment and domain information

>KOG0131 consensus Splicing factor 3b, subunit 4 [RNA processing and modification]	Back alignment and domain information

>KOG0106 consensus Alternative splicing factor SRp55/B52/SRp75 (RRM superfamily) [RNA processing and modification]	Back alignment and domain information

>smart00362 RRM_2 RNA recognition motif	Back alignment and domain information

>PLN03120 nucleic acid binding protein; Provisional	Back alignment and domain information

>KOG0123 consensus Polyadenylate-binding protein (RRM superfamily) [RNA processing and modification; Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>COG0724 RNA-binding proteins (RRM domain) [General function prediction only]	Back alignment and domain information

>TIGR01659 sex-lethal sex-lethal family splicing factor	Back alignment and domain information

>KOG0113 consensus U1 small nuclear ribonucleoprotein (RRM superfamily) [RNA processing and modification]	Back alignment and domain information

>KOG0109 consensus RNA-binding protein LARK, contains RRM and retroviral-type Zn-finger domains [RNA processing and modification; General function prediction only]	Back alignment and domain information

>KOG0122 consensus Translation initiation factor 3, subunit g (eIF-3g) [Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>KOG1924 consensus RhoA GTPase effector DIA/Diaphanous [Signal transduction mechanisms; Cytoskeleton]	Back alignment and domain information

>TIGR01645 half-pint poly-U binding splicing factor, half-pint family	Back alignment and domain information

>KOG3671 consensus Actin regulatory protein (Wiskott-Aldrich syndrome protein) [Signal transduction mechanisms; Cytoskeleton]	Back alignment and domain information

>smart00360 RRM RNA recognition motif	Back alignment and domain information

>cd00590 RRM RRM (RNA recognition motif), also known as RBD (RNA binding domain) or RNP (ribonucleoprotein domain), is a highly abundant domain in eukaryotes found in proteins involved in post-transcriptional gene expression processes including mRNA and rRNA processing, RNA export, and RNA stability	Back alignment and domain information

>KOG0110 consensus RNA-binding protein (RRM superfamily) [General function prediction only]	Back alignment and domain information

>PLN03213 repressor of silencing 3; Provisional	Back alignment and domain information

>PF13893 RRM_5: RNA recognition motif	Back alignment and domain information

>KOG0121 consensus Nuclear cap-binding protein complex, subunit CBP20 (RRM superfamily) [RNA processing and modification]	Back alignment and domain information

>KOG0111 consensus Cyclophilin-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG4206 consensus Spliceosomal protein snRNP-U1A/U2B [RNA processing and modification]	Back alignment and domain information

>KOG0114 consensus Predicted RNA-binding protein (RRM superfamily) [General function prediction only]	Back alignment and domain information

>KOG0144 consensus RNA-binding protein CUGBP1/BRUNO (RRM superfamily) [RNA processing and modification]	Back alignment and domain information

>KOG0148 consensus Apoptosis-promoting RNA-binding protein TIA-1/TIAR (RRM superfamily) [RNA processing and modification; Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>PLN03121 nucleic acid binding protein; Provisional	Back alignment and domain information

>KOG4207 consensus Predicted splicing factor, SR protein superfamily [RNA processing and modification]	Back alignment and domain information

>KOG1457 consensus RNA binding protein (contains RRM repeats) [General function prediction only]	Back alignment and domain information

>KOG0123 consensus Polyadenylate-binding protein (RRM superfamily) [RNA processing and modification; Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>KOG0151 consensus Predicted splicing regulator, contains RRM, SWAP and RPR domains [General function prediction only]	Back alignment and domain information

>KOG0125 consensus Ataxin 2-binding protein (RRM superfamily) [General function prediction only]	Back alignment and domain information

>KOG0145 consensus RNA-binding protein ELAV/HU (RRM superfamily) [RNA processing and modification]	Back alignment and domain information

>KOG0112 consensus Large RNA-binding protein (RRM superfamily) [General function prediction only]	Back alignment and domain information

>KOG4660 consensus Protein Mei2, essential for commitment to meiosis, and related proteins [Cell cycle control, cell division, chromosome partitioning]	Back alignment and domain information

>KOG0127 consensus Nucleolar protein fibrillarin NOP77 (RRM superfamily) [RNA processing and modification]	Back alignment and domain information

>KOG0146 consensus RNA-binding protein ETR-3 (RRM superfamily) [RNA processing and modification]	Back alignment and domain information

>smart00361 RRM_1 RNA recognition motif	Back alignment and domain information

>KOG0153 consensus Predicted RNA-binding protein (RRM superfamily) [General function prediction only]	Back alignment and domain information

>KOG0147 consensus Transcriptional coactivator CAPER (RRM superfamily) [Transcription]	Back alignment and domain information

>KOG4205 consensus RNA-binding protein musashi/mRNA cleavage and polyadenylation factor I complex, subunit HRP1 [RNA processing and modification]	Back alignment and domain information

>KOG0149 consensus Predicted RNA-binding protein SEB4 (RRM superfamily) [General function prediction only]	Back alignment and domain information

>KOG0109 consensus RNA-binding protein LARK, contains RRM and retroviral-type Zn-finger domains [RNA processing and modification; General function prediction only]	Back alignment and domain information

>KOG0108 consensus mRNA cleavage and polyadenylation factor I complex, subunit RNA15 [RNA processing and modification]	Back alignment and domain information

>KOG0130 consensus RNA-binding protein RBM8/Tsunagi (RRM superfamily) [General function prediction only]	Back alignment and domain information

>KOG1190 consensus Polypyrimidine tract-binding protein [RNA processing and modification]	Back alignment and domain information

>PHA03247 large tegument protein UL36; Provisional	Back alignment and domain information

>KOG0110 consensus RNA-binding protein (RRM superfamily) [General function prediction only]	Back alignment and domain information

>KOG0120 consensus Splicing factor U2AF, large subunit (RRM superfamily) [RNA processing and modification]	Back alignment and domain information

>KOG0147 consensus Transcriptional coactivator CAPER (RRM superfamily) [Transcription]	Back alignment and domain information

>KOG0126 consensus Predicted RNA-binding protein (RRM superfamily) [General function prediction only]	Back alignment and domain information

>KOG1190 consensus Polypyrimidine tract-binding protein [RNA processing and modification]	Back alignment and domain information

>KOG0132 consensus RNA polymerase II C-terminal domain-binding protein RA4, contains RPR and RRM domains [RNA processing and modification; Transcription]	Back alignment and domain information

>KOG0127 consensus Nucleolar protein fibrillarin NOP77 (RRM superfamily) [RNA processing and modification]	Back alignment and domain information

>KOG4208 consensus Nucleolar RNA-binding protein NIFK [General function prediction only]	Back alignment and domain information

>KOG1457 consensus RNA binding protein (contains RRM repeats) [General function prediction only]	Back alignment and domain information

>KOG1456 consensus Heterogeneous nuclear ribonucleoprotein L (contains RRM repeats) [RNA processing and modification]	Back alignment and domain information

>PF00076 RRM_1: RNA recognition motif	Back alignment and domain information

>PHA03247 large tegument protein UL36; Provisional	Back alignment and domain information

>KOG0415 consensus Predicted peptidyl prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG0131 consensus Splicing factor 3b, subunit 4 [RNA processing and modification]	Back alignment and domain information

>KOG0116 consensus RasGAP SH3 binding protein rasputin, contains NTF2 and RRM domains [Signal transduction mechanisms]	Back alignment and domain information

>KOG4209 consensus Splicing factor RNPS1, SR protein superfamily [RNA processing and modification]	Back alignment and domain information

>PF14259 RRM_6: RNA recognition motif (a	Back alignment and domain information

>PLN03134 glycine-rich RNA-binding protein 4; Provisional	Back alignment and domain information

>KOG0226 consensus RNA-binding proteins [General function prediction only]	Back alignment and domain information

>KOG3671 consensus Actin regulatory protein (Wiskott-Aldrich syndrome protein) [Signal transduction mechanisms; Cytoskeleton]	Back alignment and domain information

>KOG4212 consensus RNA-binding protein hnRNP-M [RNA processing and modification]	Back alignment and domain information

>KOG0112 consensus Large RNA-binding protein (RRM superfamily) [General function prediction only]	Back alignment and domain information

>KOG0107 consensus Alternative splicing factor SRp20/9G8 (RRM superfamily) [RNA processing and modification]	Back alignment and domain information

>KOG1923 consensus Rac1 GTPase effector FRL [Signal transduction mechanisms; Cytoskeleton]	Back alignment and domain information

>KOG0129 consensus Predicted RNA-binding protein (RRM superfamily) [Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>KOG1548 consensus Transcription elongation factor TAT-SF1 [Transcription]	Back alignment and domain information

>KOG0146 consensus RNA-binding protein ETR-3 (RRM superfamily) [RNA processing and modification]	Back alignment and domain information

>KOG0533 consensus RRM motif-containing protein [RNA processing and modification]	Back alignment and domain information

>KOG0120 consensus Splicing factor U2AF, large subunit (RRM superfamily) [RNA processing and modification]	Back alignment and domain information

>KOG2193 consensus IGF-II mRNA-binding protein IMP, contains RRM and KH domains [RNA processing and modification; General function prediction only]	Back alignment and domain information

>KOG4454 consensus RNA binding protein (RRM superfamily) [General function prediction only]	Back alignment and domain information

>KOG0124 consensus Polypyrimidine tract-binding protein PUF60 (RRM superfamily) [RNA processing and modification]	Back alignment and domain information

>smart00362 RRM_2 RNA recognition motif	Back alignment and domain information

>PF04059 RRM_2: RNA recognition motif 2; InterPro: IPR007201 This RNA recognition motif 2 is found in Meiosis protein mei2	Back alignment and domain information

>KOG4206 consensus Spliceosomal protein snRNP-U1A/U2B [RNA processing and modification]	Back alignment and domain information

>KOG4211 consensus Splicing factor hnRNP-F and related RNA-binding proteins [RNA processing and modification]	Back alignment and domain information

>KOG1456 consensus Heterogeneous nuclear ribonucleoprotein L (contains RRM repeats) [RNA processing and modification]	Back alignment and domain information

>KOG0121 consensus Nuclear cap-binding protein complex, subunit CBP20 (RRM superfamily) [RNA processing and modification]	Back alignment and domain information

>cd00590 RRM RRM (RNA recognition motif), also known as RBD (RNA binding domain) or RNP (ribonucleoprotein domain), is a highly abundant domain in eukaryotes found in proteins involved in post-transcriptional gene expression processes including mRNA and rRNA processing, RNA export, and RNA stability	Back alignment and domain information

>KOG1830 consensus Wiskott Aldrich syndrome proteins [Cytoskeleton]	Back alignment and domain information

>smart00360 RRM RNA recognition motif	Back alignment and domain information

>KOG4205 consensus RNA-binding protein musashi/mRNA cleavage and polyadenylation factor I complex, subunit HRP1 [RNA processing and modification]	Back alignment and domain information

>KOG1923 consensus Rac1 GTPase effector FRL [Signal transduction mechanisms; Cytoskeleton]	Back alignment and domain information

>PLN03120 nucleic acid binding protein; Provisional	Back alignment and domain information

>KOG4672 consensus Uncharacterized conserved low complexity protein [Function unknown]	Back alignment and domain information

>COG0724 RNA-binding proteins (RRM domain) [General function prediction only]	Back alignment and domain information

>KOG4849 consensus mRNA cleavage factor I subunit/CPSF subunit [RNA processing and modification]	Back alignment and domain information

>KOG0128 consensus RNA-binding protein SART3 (RRM superfamily) [RNA processing and modification]	Back alignment and domain information

>KOG4661 consensus Hsp27-ERE-TATA-binding protein/Scaffold attachment factor (SAF-B) [Transcription]	Back alignment and domain information

>KOG4212 consensus RNA-binding protein hnRNP-M [RNA processing and modification]	Back alignment and domain information

>KOG0106 consensus Alternative splicing factor SRp55/B52/SRp75 (RRM superfamily) [RNA processing and modification]	Back alignment and domain information

>PF14605 Nup35_RRM_2: Nup53/35/40-type RNA recognition motif	Back alignment and domain information

>KOG1855 consensus Predicted RNA-binding protein [General function prediction only]	Back alignment and domain information

>PF08777 RRM_3: RNA binding motif; InterPro: IPR014886 This domain is found in protein La which functions as an RNA chaperone during RNA polymerase III transcription, and can also stimulate translation initiation	Back alignment and domain information

>PF05918 API5: Apoptosis inhibitory protein 5 (API5); InterPro: IPR008383 This family consists of apoptosis inhibitory protein 5 (API5) sequences from several organisms	Back alignment and domain information

>KOG2416 consensus Acinus (induces apoptotic chromatin condensation) [Chromatin structure and dynamics]	Back alignment and domain information

>KOG0114 consensus Predicted RNA-binding protein (RRM superfamily) [General function prediction only]	Back alignment and domain information

>KOG2314 consensus Translation initiation factor 3, subunit b (eIF-3b) [Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>KOG1548 consensus Transcription elongation factor TAT-SF1 [Transcription]	Back alignment and domain information

>KOG0108 consensus mRNA cleavage and polyadenylation factor I complex, subunit RNA15 [RNA processing and modification]	Back alignment and domain information

>PF15023 DUF4523: Protein of unknown function (DUF4523)	Back alignment and domain information

>KOG4574 consensus RNA-binding protein (contains RRM and Pumilio-like repeats) [General function prediction only]	Back alignment and domain information

>KOG4672 consensus Uncharacterized conserved low complexity protein [Function unknown]	Back alignment and domain information

>KOG1830 consensus Wiskott Aldrich syndrome proteins [Cytoskeleton]	Back alignment and domain information

>KOG1365 consensus RNA-binding protein Fusilli, contains RRM domain [RNA processing and modification; General function prediction only]	Back alignment and domain information

>PF13893 RRM_5: RNA recognition motif	Back alignment and domain information

>PLN03121 nucleic acid binding protein; Provisional	Back alignment and domain information

>PF07744 SPOC: SPOC domain; InterPro: IPR012921 Spen (split end) proteins regulate the expression of key transcriptional effectors in diverse signalling pathways	Back alignment and domain information

>KOG0105 consensus Alternative splicing factor ASF/SF2 (RRM superfamily) [RNA processing and modification]	Back alignment and domain information

>KOG1925 consensus Rac1 GTPase effector FHOS [Signal transduction mechanisms; Cytoskeleton]	Back alignment and domain information

>smart00361 RRM_1 RNA recognition motif	Back alignment and domain information

>KOG1996 consensus mRNA splicing factor [RNA processing and modification]	Back alignment and domain information

>KOG3152 consensus TBP-binding protein, activator of basal transcription (contains rrm motif) [Transcription]	Back alignment and domain information

>PF15449 Retinal: Retinal protein	Back alignment and domain information

>KOG0130 consensus RNA-binding protein RBM8/Tsunagi (RRM superfamily) [General function prediction only]	Back alignment and domain information

>PF04847 Calcipressin: Calcipressin; InterPro: IPR006931 Calcipressin 1 negatively regulates calcineurin (IPR015757 from INTERPRO) by direct binding and is essential for the survival of T helper type 1 cells	Back alignment and domain information

>KOG4210 consensus Nuclear localization sequence binding protein [Transcription]	Back alignment and domain information

>KOG1922 consensus Rho GTPase effector BNI1 and related formins [Signal transduction mechanisms; Cytoskeleton]	Back alignment and domain information

>KOG4210 consensus Nuclear localization sequence binding protein [Transcription]	Back alignment and domain information

>PLN03213 repressor of silencing 3; Provisional	Back alignment and domain information

>KOG2202 consensus U2 snRNP splicing factor, small subunit, and related proteins [RNA processing and modification]	Back alignment and domain information

>KOG4660 consensus Protein Mei2, essential for commitment to meiosis, and related proteins [Cell cycle control, cell division, chromosome partitioning]	Back alignment and domain information

>PRK15313 autotransport protein MisL; Provisional	Back alignment and domain information

>KOG0391 consensus SNF2 family DNA-dependent ATPase [General function prediction only]	Back alignment and domain information

>KOG1984 consensus Vesicle coat complex COPII, subunit SFB3 [Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST

Original result of RPS-BLAST against PDB70 database

ID	Alignment Graph	Length	Definition	E-value
Query		1100
1vt4_I		1221	APAF-1 related killer DARK; drosophila apoptosome,	3e-13
1vt4_I		1221	APAF-1 related killer DARK; drosophila apoptosome,	7e-08
1m2v_B		926	SEC24, protein transport protein SEC24, SEC24P, SE	1e-08
1m2v_B		926	SEC24, protein transport protein SEC24, SEC24P, SE	3e-08
1m2v_B		926	SEC24, protein transport protein SEC24, SEC24P, SE	3e-06
1m2v_B		926	SEC24, protein transport protein SEC24, SEC24P, SE	1e-05
1m2v_B		926	SEC24, protein transport protein SEC24, SEC24P, SE	3e-04
1m2v_B		926	SEC24, protein transport protein SEC24, SEC24P, SE	4e-04
1why_A		97	Hypothetical protein riken cDNA 1810017N16; RNA re	1e-07
3r27_A		100	HnRNP L, heterogeneous nuclear ribonucleoprotein L	3e-06
2ytc_A		85	PRE-mRNA-splicing factor RBM22; RRM domain, RBD, s	4e-06
2grx_C		229	Protein TONB; beta barrel, outer membrane, heteroc	5e-06
2grx_C		229	Protein TONB; beta barrel, outer membrane, heteroc	2e-05
2grx_C		229	Protein TONB; beta barrel, outer membrane, heteroc	7e-04
3pgw_B		231	SM B; protein-RNA complex, U1 snRNA, SM fold, SM c	5e-06
3pgw_B		231	SM B; protein-RNA complex, U1 snRNA, SM fold, SM c	2e-05
1wex_A		104	Hypothetical protein (riken cDNA 2810036L13); stru	7e-06
2cq2_A		114	Hypothetical protein LOC91801; RRM domain, structu	3e-05
3v1v_A		433	2-MIB synthase, 2-methylisoborneol synthase; class	5e-05
3v1v_A		433	2-MIB synthase, 2-methylisoborneol synthase; class	2e-04
3v1v_A		433	2-MIB synthase, 2-methylisoborneol synthase; class	3e-04
1twf_A		1733	B220, DNA-directed RNA polymerase II largest subun	1e-04
1twf_A		1733	B220, DNA-directed RNA polymerase II largest subun	3e-04
2ghp_A		292	U4/U6 snRNA-associated splicing factor PRP24; RNA	2e-04
2cq1_A		101	PTB-like protein L; RRM domain, structural genomic	2e-04
2la4_A		101	Nuclear and cytoplasmic polyadenylated RNA-bindin	4e-04
2cpd_A		99	Apobec-1 stimulating protein; RNA recognition moti	4e-04
1sjq_A		105	Polypyrimidine tract-binding protein 1; babbab mot	5e-04
2ad9_A		119	Polypyrimidine tract-binding protein 1; RBD, RRM,	8e-04

>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221	Back alignment and structure

 Score = 73.7 bits (180), Expect = 3e-13
 Identities = 91/651 (13%), Positives = 174/651 (26%), Gaps = 178/651 (27%)

Query: 181 HNVLDFFISSFD--GKDIIHTVDKEITKMLDSDEVFLGLKKKFSDEDESSLIKLS--KFR 236
           H+ +DF         KDI+   +       D  +V    K   S E+   +I        
Sbjct: 4   HHHMDFETGEHQYQYKDILSVFEDAFVDNFDCKDVQDMPKSILSKEEIDHIIMSKDAVSG 63

Query: 237 LLSLLQIFFSSPKNLLAACFELFNPSVLEGIHKGQYFF--SQITSRFDDDNM-THSFI-- 291
            L L     S  + +     + F    +E + +  Y F  S I +     +M T  +I  
Sbjct: 64  TLRLFWTLLSKQEEM----VQKF----VEEVLRINYKFLMSPIKTEQRQPSMMTRMYIEQ 115

Query: 292 ---IKDDGPKF-------PETSTKGKEASSEQLVSDDNHVGTSVL------KSCLLGLAL 335
              + +D   F        +   K ++A    L+         +       K+ +     
Sbjct: 116 RDRLYNDNQVFAKYNVSRLQPYLKLRQA----LLELRPAKNVLIDGVLGSGKTWVALDVC 171

Query: 336 GKNPSLRR------WMFSRYKKLCNLSSSNALPELSSALKRIFESFSEVAKEEGSEVDSD 389
                  +      W+      L N +S   + E+   L+++                + 
Sbjct: 172 LSYKVQCKMDFKIFWL-----NLKNCNSPETVLEM---LQKLLYQIDPNWTSRSDHSSNI 223

Query: 390 EDDSDPSKYANQQYLVARSANQHETS----RELSGNESNSRVNEE---SC-------DVS 435
           +      +   ++ L ++    +E        +     N++       SC          
Sbjct: 224 KLRIHSIQAELRRLLKSK---PYENCLLVLLNV----QNAKAWNAFNLSCKILLTTRFKQ 276

Query: 436 FADKFSGQYPRPHGSVGPRETDFHSNAGSSHDSGCTRSMEYDTGDPGDFSCGRSSMPRDL 495
             D  S      H S+                                        P+DL
Sbjct: 277 VTDFLSAAT-TTHISLDHHSMTLTP----------DEVKSL-------LLKYLDCRPQDL 318

Query: 496 P------NPQMLSPAARTPLHFRNNSFEGRNHFPGRSSSEGASNAL--LSPN-------- 539
           P      NP+ LS  A + +     +++   H      +    ++L  L P         
Sbjct: 319 PREVLTTNPRRLSIIAES-IRDGLATWDNWKHVNCDKLTTIIESSLNVLEPAEYRKMFDR 377

Query: 540 -----HHLPVPYASTTSQIVWYFDEDPAAMDIFS-------ASKQLWLGSFG-------- 579
                    +P  +    ++W+       M + +         KQ    +          
Sbjct: 378 LSVFPPSAHIP--TILLSLIWFDVIKSDVMVVVNKLHKYSLVEKQPKESTISIPSIYLEL 435

Query: 580 ----PEASEAHIRFQIDRFGPLEHFFFFPIKGFALVEYINIIDAIRAREYIRNHFS---- 631
                     H    +D +   + F    +    L +Y           +I +H      
Sbjct: 436 KVKLENEYALHRSI-VDHYNIPKTFDSDDLIPPYLDQYF--------YSHIGHHLKNIEH 486

Query: 632 ------WRVKFMDVG-LGTKGVINGVAVGSC---------FHVYVGNIPNQWAKDEILHE 675
                 +R+ F+D   L  K   +  A  +             Y   I +   K E L  
Sbjct: 487 PERMTLFRMVFLDFRFLEQKIRHDSTAWNASGSILNTLQQLKFYKPYICDNDPKYERLVN 546

Query: 676 SYK--------VVYKGPYMVTDLSCEGALLMEFRTPEEATTAMAHLRQHRK 718
           +           +    Y  TDL     L +     +EA    AH +Q ++
Sbjct: 547 AILDFLPKIEENLICSKY--TDL-----LRIALMAEDEAIFEEAH-KQVQR 589

PyMOL of 1vt4

>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221	Back alignment and structure

>1m2v_B SEC24, protein transport protein SEC24, SEC24P, SEC24 protein, abnormal nuclear; zinc-finger, beta barrel, VWA domain, gelsolin domain,; 2.75A {Saccharomyces cerevisiae} SCOP: a.71.2.1 b.2.8.1 c.62.1.2 d.109.2.1 g.41.10.1 Length = 926	Back alignment and structure

>1m2v_B SEC24, protein transport protein SEC24, SEC24P, SEC24 protein, abnormal nuclear; zinc-finger, beta barrel, VWA domain, gelsolin domain,; 2.75A {Saccharomyces cerevisiae} SCOP: a.71.2.1 b.2.8.1 c.62.1.2 d.109.2.1 g.41.10.1 Length = 926	Back alignment and structure

>1m2v_B SEC24, protein transport protein SEC24, SEC24P, SEC24 protein, abnormal nuclear; zinc-finger, beta barrel, VWA domain, gelsolin domain,; 2.75A {Saccharomyces cerevisiae} SCOP: a.71.2.1 b.2.8.1 c.62.1.2 d.109.2.1 g.41.10.1 Length = 926	Back alignment and structure

>1m2v_B SEC24, protein transport protein SEC24, SEC24P, SEC24 protein, abnormal nuclear; zinc-finger, beta barrel, VWA domain, gelsolin domain,; 2.75A {Saccharomyces cerevisiae} SCOP: a.71.2.1 b.2.8.1 c.62.1.2 d.109.2.1 g.41.10.1 Length = 926	Back alignment and structure

>1m2v_B SEC24, protein transport protein SEC24, SEC24P, SEC24 protein, abnormal nuclear; zinc-finger, beta barrel, VWA domain, gelsolin domain,; 2.75A {Saccharomyces cerevisiae} SCOP: a.71.2.1 b.2.8.1 c.62.1.2 d.109.2.1 g.41.10.1 Length = 926	Back alignment and structure

>1m2v_B SEC24, protein transport protein SEC24, SEC24P, SEC24 protein, abnormal nuclear; zinc-finger, beta barrel, VWA domain, gelsolin domain,; 2.75A {Saccharomyces cerevisiae} SCOP: a.71.2.1 b.2.8.1 c.62.1.2 d.109.2.1 g.41.10.1 Length = 926	Back alignment and structure

>1why_A Hypothetical protein riken cDNA 1810017N16; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Length = 97	Back alignment and structure

>3r27_A HnRNP L, heterogeneous nuclear ribonucleoprotein L; RBD fold, protein binding, nucleus; 2.04A {Homo sapiens} Length = 100	Back alignment and structure

>2ytc_A PRE-mRNA-splicing factor RBM22; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 85	Back alignment and structure

>2grx_C Protein TONB; beta barrel, outer membrane, heterocomplex, inter-protein beta sheet, protein-protein, metal transport; HET: GCN KDO GMH FTT DAO MYR FCI; 3.30A {Escherichia coli} SCOP: d.212.1.2 PDB: 1xx3_A Length = 229	Back alignment and structure

>2grx_C Protein TONB; beta barrel, outer membrane, heterocomplex, inter-protein beta sheet, protein-protein, metal transport; HET: GCN KDO GMH FTT DAO MYR FCI; 3.30A {Escherichia coli} SCOP: d.212.1.2 PDB: 1xx3_A Length = 229	Back alignment and structure

>2grx_C Protein TONB; beta barrel, outer membrane, heterocomplex, inter-protein beta sheet, protein-protein, metal transport; HET: GCN KDO GMH FTT DAO MYR FCI; 3.30A {Escherichia coli} SCOP: d.212.1.2 PDB: 1xx3_A Length = 229	Back alignment and structure

>3pgw_B SM B; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 3cw1_A Length = 231	Back alignment and structure

>3pgw_B SM B; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 3cw1_A Length = 231	Back alignment and structure

>1wex_A Hypothetical protein (riken cDNA 2810036L13); structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.58.7.1 Length = 104	Back alignment and structure

>2cq2_A Hypothetical protein LOC91801; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 114	Back alignment and structure

>3v1v_A 2-MIB synthase, 2-methylisoborneol synthase; class I terpenoid cyclase fold, DDXXXXD motif, NDXXSXXXE MOT methylisoborneol biosynthesis; HET: GST; 1.80A {Streptomyces coelicolor} PDB: 3v1x_A* Length = 433	Back alignment and structure

>3v1v_A 2-MIB synthase, 2-methylisoborneol synthase; class I terpenoid cyclase fold, DDXXXXD motif, NDXXSXXXE MOT methylisoborneol biosynthesis; HET: GST; 1.80A {Streptomyces coelicolor} PDB: 3v1x_A* Length = 433	Back alignment and structure

>3v1v_A 2-MIB synthase, 2-methylisoborneol synthase; class I terpenoid cyclase fold, DDXXXXD motif, NDXXSXXXE MOT methylisoborneol biosynthesis; HET: GST; 1.80A {Streptomyces coelicolor} PDB: 3v1x_A* Length = 433	Back alignment and structure

>1twf_A B220, DNA-directed RNA polymerase II largest subunit; transcription, mRNA, multiprotein complex; HET: UTP; 2.30A {Saccharomyces cerevisiae} SCOP: e.29.1.2 PDB: 1i3q_A 1i6h_A 1k83_A* 1nik_A 1nt9_A 1pqv_A 1r5u_A 1r9s_A* 1r9t_A* 1sfo_A* 1twa_A* 1twc_A* 1i50_A* 1twg_A* 1twh_A* 1wcm_A 1y1v_A 1y1w_A 1y1y_A 1y77_A* ... Length = 1733	Back alignment and structure

>1twf_A B220, DNA-directed RNA polymerase II largest subunit; transcription, mRNA, multiprotein complex; HET: UTP; 2.30A {Saccharomyces cerevisiae} SCOP: e.29.1.2 PDB: 1i3q_A 1i6h_A 1k83_A* 1nik_A 1nt9_A 1pqv_A 1r5u_A 1r9s_A* 1r9t_A* 1sfo_A* 1twa_A* 1twc_A* 1i50_A* 1twg_A* 1twh_A* 1wcm_A 1y1v_A 1y1w_A 1y1y_A 1y77_A* ... Length = 1733	Back alignment and structure

>2ghp_A U4/U6 snRNA-associated splicing factor PRP24; RNA chaperone, RNA binding domain, RNA recognition motif, SP factor, snRNP, spliceosome; 2.70A {Saccharomyces cerevisiae} SCOP: d.58.7.1 d.58.7.1 d.58.7.1 PDB: 2go9_A 2kh9_A Length = 292	Back alignment and structure

>2cq1_A PTB-like protein L; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 101	Back alignment and structure

>2la4_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNA recognition, stress granules, nucleus, RNA-binding, transcription; NMR {Saccharomyces cerevisiae} Length = 101	Back alignment and structure

>2cpd_A Apobec-1 stimulating protein; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 99	Back alignment and structure

>1sjq_A Polypyrimidine tract-binding protein 1; babbab motif, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 105	Back alignment and structure

>2ad9_A Polypyrimidine tract-binding protein 1; RBD, RRM, protein-RNA complex, RNA binding protein/RNA complex; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 119	Back alignment and structure

Structure Templates Detected by HHsearch

Original result of HHsearch against PDB70 database

ID	Alignment Graph	Length	Definition	Probability
Query		1100
1fxl_A		167	Paraneoplastic encephalomyelitis antigen HUD; prot	99.83
3nmr_A		175	Cugbp ELAV-like family member 1; RRM, PRE-mRNA spl	99.82
3md3_A		166	Nuclear and cytoplasmic polyadenylated RNA-bindin	99.82
1b7f_A		168	Protein (SXL-lethal protein), RNA (5'-R(PGPUP*UP	99.82
4f02_A		213	Polyadenylate-binding protein 1; mRNA, eukaryotic	99.8
3tyt_A		205	Heterogeneous nuclear ribonucleoprotein L; ferredo	99.8
2g4b_A		172	Splicing factor U2AF 65 kDa subunit; protein-RNA c	99.79
2qfj_A		216	FBP-interacting repressor; protein-DNA complex; HE	99.78
1qm9_A		198	Polypyrimidine tract-binding protein; ribonucleopr	99.78
2adc_A		229	Polypyrimidine tract-binding protein 1; RBD, RRM,	99.78
2yh0_A		198	Splicing factor U2AF 65 kDa subunit; PRE-mRNA spli	99.78
3pgw_A		282	U1-A; protein-RNA complex, U1 snRNA, SM fold, SM c	99.77
3sde_A		261	Paraspeckle component 1; RRM, anti parallel right	99.77
3smz_A		284	Protein raver-1, ribonucleoprotein PTB-binding 1;	99.77
1l3k_A		196	Heterogeneous nuclear ribonucleoprotein A1; nuclea	99.77
2cjk_A		167	Nuclear polyadenylated RNA-binding protein 4; HRP1	99.76
1fje_B		175	Nucleolin RBD12, protein C23; RNP, RRM, RNA bindin	99.76
2ghp_A		292	U4/U6 snRNA-associated splicing factor PRP24; RNA	99.72
3smz_A		284	Protein raver-1, ribonucleoprotein PTB-binding 1;	99.71
2ghp_A		292	U4/U6 snRNA-associated splicing factor PRP24; RNA	99.69
4f25_A		115	Polyadenylate-binding protein 1; RRM fold, transla	99.64
2cpj_A		99	Non-POU domain-containing octamer-binding protein;	99.56
2hvz_A		101	Splicing factor, arginine/serine-rich 7; RRM, RNA	99.55
3r27_A		100	HnRNP L, heterogeneous nuclear ribonucleoprotein L	99.54
1wex_A		104	Hypothetical protein (riken cDNA 2810036L13); stru	99.54
2cq1_A		101	PTB-like protein L; RRM domain, structural genomic	99.51
2cq2_A		114	Hypothetical protein LOC91801; RRM domain, structu	99.5
1x4d_A		102	Matrin 3; structural genomics, RRM domain, NPPSFA,	99.5
4fxv_A		99	ELAV-like protein 1; RNA recognition motif, putati	99.5
2ytc_A		85	PRE-mRNA-splicing factor RBM22; RRM domain, RBD, s	99.49
1why_A		97	Hypothetical protein riken cDNA 1810017N16; RNA re	99.48
1sjq_A		105	Polypyrimidine tract-binding protein 1; babbab mot	99.47
2ad9_A		119	Polypyrimidine tract-binding protein 1; RBD, RRM,	99.47
1x5s_A		102	Cold-inducible RNA-binding protein; structure geno	99.47
2cqi_A		103	Nucleolysin TIAR; RNA recognition motif, RRM, RNA	99.47
1x4f_A		112	Matrin 3; structural genomics, RRM domain, NPPSFA,	99.47
2la4_A		101	Nuclear and cytoplasmic polyadenylated RNA-bindin	99.46
2x1f_A		96	MRNA 3'-END-processing protein RNA15; transcriptio	99.46
3md1_A		83	Nuclear and cytoplasmic polyadenylated RNA-bindin	99.46
2dnz_A		95	Probable RNA-binding protein 23; RNA recognition m	99.46
3mdf_A		85	Peptidyl-prolyl CIS-trans isomerase E; RRM domain,	99.46
3bs9_A		87	Nucleolysin TIA-1 isoform P40; RNA recognition mot	99.45
2wbr_A		89	GW182, gawky, LD47780P; DNA-binding protein, RRM,	99.45
1x4g_A		109	Nucleolysin TIAR; structural genomics, RRM domain,	99.45
2ywk_A		95	Putative RNA-binding protein 11; RRM-domain, struc	99.45
2cqb_A		102	Peptidyl-prolyl CIS-trans isomerase E; RNA recogni	99.45
2dnq_A		90	RNA-binding protein 4B; RRM domain,RBD, structural	99.45
2cqc_A		95	Arginine/serine-rich splicing factor 10; RNA recog	99.45
1x5t_A		96	Splicing factor 3B subunit 4; structure genomics,	99.44
3s8s_A		110	Histone-lysine N-methyltransferase SETD1A; chromat	99.44
2kvi_A		96	Nuclear polyadenylated RNA-binding protein 3; RNA-	99.44
2cph_A		107	RNA binding motif protein 19; RNA recognition moti	99.44
2cpf_A		98	RNA binding motif protein 19; RNA recognition moti	99.44
1whx_A		111	Hypothetical protein riken cDNA 1200009A02; RNA re	99.43
2dgt_A		92	RNA-binding protein 30; RRM domain, structural gen	99.43
2cq3_A		103	RNA-binding protein 9; RRM domain, structural geno	99.43
2xnq_A		97	Nuclear polyadenylated RNA-binding protein 3; tran	99.43
2dnh_A		105	Bruno-like 5, RNA binding protein; RRM domain, RBD	99.42
1x4a_A		109	Splicing factor, arginine/serine-rich 1 (splicing	99.42
2dnp_A		90	RNA-binding protein 14; RRM domain, RBD, structura	99.42
3lqv_A		115	PRE-mRNA branch site protein P14; cysless mutant,	99.42
4a8x_A		88	RNA-binding protein with serine-rich domain 1; tra	99.42
1u6f_A		139	Tcubp1, RNA-binding protein UBP1; trypanosome, mRN	99.42
2dgx_A		96	KIAA0430 protein; RRM domain, structural genomics,	99.42
2d9p_A		103	Polyadenylate-binding protein 3; RRM domain, struc	99.42
2e5h_A		94	Zinc finger CCHC-type and RNA-binding motif- conta	99.42
2dgp_A		106	Bruno-like 4, RNA binding protein; RRM domain, str	99.42
2div_A		99	TRNA selenocysteine associated protein; structural	99.41
2fy1_A		116	RNA-binding motif protein, Y chromosome, family 1	99.41
2dgv_A		92	HnRNP M, heterogeneous nuclear ribonucleoprotein M	99.41
2cqh_A		93	IGF-II mRNA-binding protein 2 isoform A; RNA recog	99.41
1fjc_A		96	Nucleolin RBD2, protein C23; RNP, RRM, RNA binding	99.41
1p27_B		106	RNA-binding protein 8A; nuclear protein, mRNA spli	99.41
2la6_A		99	RNA-binding protein FUS; structural genomics, nort	99.41
1whw_A		99	Hypothetical protein riken cDNA 1200009A02; RNA re	99.41
2err_A		109	Ataxin-2-binding protein 1; protein-RNA complex, R	99.4
2cpe_A		113	RNA-binding protein EWS; RNA recognition motif, RR	99.4
2dgo_A		115	Cytotoxic granule-associated RNA binding protein 1	99.4
2e5i_A		124	Heterogeneous nuclear ribonucleoprotein L-like; RR	99.4
1nu4_A		97	U1A RNA binding domain; RNA recognition motif, U1	99.4
1x4e_A		85	RNA binding motif, single-stranded interacting pro	99.4
2do0_A		114	HnRNP M, heterogeneous nuclear ribonucleoprotein M	99.4
2jvo_A		108	Nucleolar protein 3; nucleus, phosphorylation, rib	99.4
2do4_A		100	Squamous cell carcinoma antigen recognized by T- c	99.39
3ex7_B		126	RNA-binding protein 8A; protein-RNA complex, mRNA	99.39
1wf1_A		110	RNA-binding protein RALY; structural genomics, RRM	99.39
2dgs_A		99	DAZ-associated protein 1; RRM domain, structural g	99.39
2lxi_A		91	RNA-binding protein 10; NMR {Homo sapiens}	99.39
2e5j_A		97	Methenyltetrahydrofolate synthetase domain contain	99.39
2dis_A		109	Unnamed protein product; structural genomics, RRM	99.39
1x5o_A		114	RNA binding motif, single-stranded interacting pro	99.38
2cq0_A		103	Eukaryotic translation initiation factor 3 subunit	99.38
2dgu_A		103	Heterogeneous nuclear ribonucleoprotein Q; RRM dom	99.38
1p1t_A		104	Cleavage stimulation factor, 64 kDa subunit; RNA r	99.38
1oo0_B		110	CG8781-PA, drosophila Y14; RNA recognition motif,	99.38
3tht_A		345	Alkylated DNA repair protein ALKB homolog 8; struc	99.38
2cpz_A		115	CUG triplet repeat RNA-binding protein 1; RRM doma	99.38
2dnm_A		103	SRP46 splicing factor; RRM domain, RBD, structural	99.38
2hzc_A		87	Splicing factor U2AF 65 kDa subunit; RNA splicing,	99.38
2cpd_A		99	Apobec-1 stimulating protein; RNA recognition moti	99.37
1x4h_A		111	RNA-binding protein 28; structural genomics, RRM d	99.37
2khc_A		118	Testis-specific RNP-type RNA binding protein; RRM,	99.37
2ek1_A		95	RNA-binding protein 12; RNA recognition motif, dim	99.37
1x5p_A		97	Negative elongation factor E; structure genomics,	99.37
3ulh_A		107	THO complex subunit 4; nuclear protein, RNA bindin	99.36
1x5u_A		105	Splicing factor 3B subunit 4 (spliceosome associat	99.36
2a3j_A		127	U1 small nuclear ribonucleoprotein A; computationa	99.36
2krb_A		81	Eukaryotic translation initiation factor 3 subunit	99.36
2kt5_A		124	RNA and export factor-binding protein 2; chaperone	99.36
2jrs_A		108	RNA-binding protein 39; RNA binding motif of RBM39	99.35
2i2y_A		150	Fusion protein consists of immunoglobin G- binding	99.35
3zzy_A		130	Polypyrimidine tract-binding protein 1; protein bi	99.35
2dhg_A		104	TRNA selenocysteine associated protein (SECP43); R	99.35
2ku7_A		140	MLL1 PHD3-CYP33 RRM chimeric protein; transcriptio	99.35
2cpi_A		111	CCR4-NOT transcription complex subunit 4; RNA reco	99.35
1x4c_A		108	Splicing factor, arginine/serine-rich 1; structura	99.35
3ucg_A		89	Polyadenylate-binding protein 2; ferredoxin-like,	99.34
1sjr_A		164	Polypyrimidine tract-binding protein 1; extended b	99.34
2lkz_A		95	RNA-binding protein 5; RRM; NMR {Homo sapiens}	99.34
2cqd_A		116	RNA-binding region containing protein 1; RNA recog	99.34
2kxn_B		129	Transformer-2 protein homolog beta; SR protein, RR	99.33
1wi8_A		104	EIF-4B, eukaryotic translation initiation factor 4	99.32
1wg1_A		88	KIAA1579 protein, homolog EXC-7; RBD, structural g	99.32
1h2v_Z		156	20 kDa nuclear CAP binding protein; CAP-binding-co	99.32
2cpx_A		115	Hypothetical protein FLJ11016; RRM domain, structu	99.31
2cqp_A		98	RNA-binding protein 12; RNA recognition motif, RRM	99.31
3p5t_L		90	Cleavage and polyadenylation specificity factor S;	99.31
2jvr_A		111	Nucleolar protein 3; RNA recognition motif, nucleu	99.31
3ns6_A		100	Eukaryotic translation initiation factor 3 subuni;	99.3
2ki2_A		90	SS-DNA binding protein 12RNP2; HP0827, RRM, SS-DNA	99.3
2jwn_A		124	Embryonic polyadenylate-binding protein 2-B; epabp	99.29
2cq4_A		114	RNA binding motif protein 23; RRM domain, structur	99.29
2bz2_A		121	Negative elongation factor E; NELF E, RNA recognit	99.29
1s79_A		103	Lupus LA protein; RRM, alpha/beta, RNA binding pro	99.28
2kn4_A		158	Immunoglobulin G-binding protein G, splicing FACT	99.28
2dng_A		103	Eukaryotic translation initiation factor 4H; RRM d	99.28
1fj7_A		101	Nucleolin RBD1, protein C23; RNP, RRM, RNA binding	99.28
2nlw_A		105	Eukaryotic translation initiation factor 3 subunit	99.28
3egn_A		143	RNA-binding protein 40; RNA recognition motif (RRM	99.28
2m2b_A		131	RNA-binding protein 10; T-cell, JCSG, MPP, PSI-bio	99.27
3s7r_A		87	Heterogeneous nuclear ribonucleoprotein A/B; ferre	99.27
2fc9_A		101	NCL protein; structure genomics, RRM_1 domain, str	99.27
2rs2_A		109	Musashi-1, RNA-binding protein musashi homolog 1;	99.27
2j76_E		100	EIF-4B, EIF4B, eukaryotic translation initiation f	99.27
3nmr_A		175	Cugbp ELAV-like family member 1; RRM, PRE-mRNA spl	99.27
3n9u_C		156	Cleavage and polyadenylation specificity factor S;	99.26
2mss_A		75	Protein (musashi1); RNA-binding domain, RNA bindin	99.26
2lea_A		135	Serine/arginine-rich splicing factor 2; SR protein	99.26
1uaw_A		77	Mouse-musashi-1; RNP-type structure, RNA binding p	99.26
2dh8_A		105	DAZ-associated protein 1; RRM domain, structural g	99.26
3d2w_A		89	TAR DNA-binding protein 43; DP-43 proteinopathy, T	99.26
1x4b_A		116	Heterogeneous nuclear ribonucleoproteins A2/B1; st	99.25
1rk8_A		165	CG8781-PA, CG8781-PA protein; mRNA processing, RRM	99.25
3u1l_A		240	PRE-mRNA-splicing factor CWC2; CSMP, zinc finger;	99.25
3beg_B		115	Splicing factor, arginine/serine-rich 1; kinase, S	99.24
2e5g_A		94	U6 snRNA-specific terminal uridylyltransferase 1;	99.24
2cqg_A		103	TDP-43, TAR DNA-binding protein-43; RNA recognitio	99.24
1wf0_A		88	TDP-43, TAR DNA-binding protein-43; structural gen	99.24
2cpy_A		114	RNA-binding protein 12; RRM domain, structural gen	99.23
3md3_A		166	Nuclear and cytoplasmic polyadenylated RNA-bindin	99.23
2e44_A		96	Insulin-like growth factor 2 mRNA binding protein	99.22
1qm9_A		198	Polypyrimidine tract-binding protein; ribonucleopr	99.22
2fc8_A		102	NCL protein; structure genomics, RRM_1 domain, str	99.22
2dnl_A		114	Cytoplasmic polyadenylation element binding protei	99.22
2dgw_A		91	Probable RNA-binding protein 19; RRM domain, struc	99.21
1iqt_A		75	AUF1, heterogeneous nuclear ribonucleoprotein D0;	99.21
1wez_A		102	HnRNP H', FTP-3, heterogeneous nuclear ribonucleop	99.2
2lcw_A		116	RNA-binding protein FUS; RRM, nucleic acid binding	98.82
2qfj_A		216	FBP-interacting repressor; protein-DNA complex; HE	99.19
3pgw_A		282	U1-A; protein-RNA complex, U1 snRNA, SM fold, SM c	99.19
1fxl_A		167	Paraneoplastic encephalomyelitis antigen HUD; prot	99.19
2adc_A		229	Polypyrimidine tract-binding protein 1; RBD, RRM,	99.18
1wel_A		124	RNA-binding protein 12; structural genomics, NPPSF	99.18
2xs2_A		102	Deleted in azoospermia-like; RNA binding protein-R	99.17
2f3j_A		177	RNA and export factor binding protein 2; RRM domai	99.17
2g4b_A		172	Splicing factor U2AF 65 kDa subunit; protein-RNA c	99.17
2yh0_A		198	Splicing factor U2AF 65 kDa subunit; PRE-mRNA spli	99.15
1b7f_A		168	Protein (SXL-lethal protein), RNA (5'-R(PGPUP*UP	99.15
3q2s_C		229	Cleavage and polyadenylation specificity factor S;	99.14
4f02_A		213	Polyadenylate-binding protein 1; mRNA, eukaryotic	99.14
2db1_A		118	Heterogeneous nuclear ribonucleoprotein F; RRM dom	99.13
1wg5_A		104	Heterogeneous nuclear ribonucleoprotein H; structu	99.11
2lmi_A		107	GRSF-1, G-rich sequence factor 1; G-rich RNA seque	99.1
2cjk_A		167	Nuclear polyadenylated RNA-binding protein 4; HRP1	99.09
3tyt_A		205	Heterogeneous nuclear ribonucleoprotein L; ferredo	99.09
2pe8_A		105	Splicing factor 45; RRM, protein binding; 2.00A {H	99.08
2hgl_A		136	HNRPF protein, heterogeneous nuclear ribonucleopro	99.08
3pgw_S		437	U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM	99.08
1l3k_A		196	Heterogeneous nuclear ribonucleoprotein A1; nuclea	99.06
1fje_B		175	Nucleolin RBD12, protein C23; RNP, RRM, RNA bindin	99.05
2dit_A		112	HIV TAT specific factor 1 variant; structural geno	99.05
2diu_A		96	KIAA0430 protein; structural genomics, RRM domain,	99.04
3sde_A		261	Paraspeckle component 1; RRM, anti parallel right	99.02
2hgn_A		139	Heterogeneous nuclear ribonucleoprotein F; RNA rec	99.0
2dnn_A		109	RNA-binding protein 12; RRM domain, RBD, structura	98.99
2dha_A		123	FLJ20171 protein; RRM domain, structural genomics,	98.96
2voo_A		193	Lupus LA protein; RNA-binding protein, RNA recogni	98.88
2hgm_A		126	HNRPF protein, heterogeneous nuclear ribonucleopro	98.85
3v4m_A		105	Splicing factor U2AF 65 kDa subunit; canonical RNA	98.85
2kn4_A		158	Immunoglobulin G-binding protein G, splicing FACT	98.85
2d9o_A		100	DNAJ (HSP40) homolog, subfamily C, member 17; RRM	98.82
3ue2_A		118	Poly(U)-binding-splicing factor PUF60; RNA recogni	98.8
1jmt_A		104	Splicing factor U2AF 35 kDa subunit; RRM, RNA spli	98.77
2j8a_A		136	Histone-lysine N-methyltransferase, H3 lysine-4 sp	98.72
3s6e_A		114	RNA-binding protein 39; ferredoxin-like, structura	98.72
2i2y_A		150	Fusion protein consists of immunoglobin G- binding	98.69
1owx_A		121	Lupus LA protein, SS-B, LA; RRM, transcription; NM	98.46
2lea_A		135	Serine/arginine-rich splicing factor 2; SR protein	98.17
3dxb_A		222	Thioredoxin N-terminally fused to PUF60(UHM); spli	98.06
1rk8_A		165	CG8781-PA, CG8781-PA protein; mRNA processing, RRM	98.01
3pgw_S		437	U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM	97.97
2e5h_A		94	Zinc finger CCHC-type and RNA-binding motif- conta	97.9
1why_A		97	Hypothetical protein riken cDNA 1810017N16; RNA re	97.87
3mdf_A		85	Peptidyl-prolyl CIS-trans isomerase E; RRM domain,	97.84
1x4a_A		109	Splicing factor, arginine/serine-rich 1 (splicing	97.78
2cpj_A		99	Non-POU domain-containing octamer-binding protein;	97.77
2dnq_A		90	RNA-binding protein 4B; RRM domain,RBD, structural	97.75
2cqb_A		102	Peptidyl-prolyl CIS-trans isomerase E; RNA recogni	97.74
1x5t_A		96	Splicing factor 3B subunit 4; structure genomics,	97.74
2x1f_A		96	MRNA 3'-END-processing protein RNA15; transcriptio	97.72
1x4e_A		85	RNA binding motif, single-stranded interacting pro	97.7
2e5j_A		97	Methenyltetrahydrofolate synthetase domain contain	97.7
2dnr_A		91	Synaptojanin-1; RRM domain, RBD, structural genomi	97.69
1whw_A		99	Hypothetical protein riken cDNA 1200009A02; RNA re	97.69
2la4_A		101	Nuclear and cytoplasmic polyadenylated RNA-bindin	97.69
2hgl_A		136	HNRPF protein, heterogeneous nuclear ribonucleopro	97.68
1wex_A		104	Hypothetical protein (riken cDNA 2810036L13); stru	97.68
2dgu_A		103	Heterogeneous nuclear ribonucleoprotein Q; RRM dom	97.67
2div_A		99	TRNA selenocysteine associated protein; structural	97.67
2do0_A		114	HnRNP M, heterogeneous nuclear ribonucleoprotein M	97.67
2cqc_A		95	Arginine/serine-rich splicing factor 10; RNA recog	97.67
2jvo_A		108	Nucleolar protein 3; nucleus, phosphorylation, rib	97.66
2cq3_A		103	RNA-binding protein 9; RRM domain, structural geno	97.66
2cpx_A		115	Hypothetical protein FLJ11016; RRM domain, structu	97.65
2dnz_A		95	Probable RNA-binding protein 23; RNA recognition m	97.65
3r27_A		100	HnRNP L, heterogeneous nuclear ribonucleoprotein L	97.65
3lqv_A		115	PRE-mRNA branch site protein P14; cysless mutant,	97.64
2kvi_A		96	Nuclear polyadenylated RNA-binding protein 3; RNA-	97.64
2fc9_A		101	NCL protein; structure genomics, RRM_1 domain, str	97.63
2cqh_A		93	IGF-II mRNA-binding protein 2 isoform A; RNA recog	97.63
3bs9_A		87	Nucleolysin TIA-1 isoform P40; RNA recognition mot	97.63
2cqi_A		103	Nucleolysin TIAR; RNA recognition motif, RRM, RNA	97.62
2cpe_A		113	RNA-binding protein EWS; RNA recognition motif, RR	97.62
1x4d_A		102	Matrin 3; structural genomics, RRM domain, NPPSFA,	97.6
2dgv_A		92	HnRNP M, heterogeneous nuclear ribonucleoprotein M	97.6
2cq0_A		103	Eukaryotic translation initiation factor 3 subunit	97.59
2dgt_A		92	RNA-binding protein 30; RRM domain, structural gen	97.59
2ku7_A		140	MLL1 PHD3-CYP33 RRM chimeric protein; transcriptio	97.59
4a8x_A		88	RNA-binding protein with serine-rich domain 1; tra	97.58
1x5s_A		102	Cold-inducible RNA-binding protein; structure geno	97.57
2xnq_A		97	Nuclear polyadenylated RNA-binding protein 3; tran	97.57
2dgp_A		106	Bruno-like 4, RNA binding protein; RRM domain, str	97.57
2d9p_A		103	Polyadenylate-binding protein 3; RRM domain, struc	97.57
2dgo_A		115	Cytotoxic granule-associated RNA binding protein 1	97.56
2cph_A		107	RNA binding motif protein 19; RNA recognition moti	97.55
2cpf_A		98	RNA binding motif protein 19; RNA recognition moti	97.55
2ywk_A		95	Putative RNA-binding protein 11; RRM-domain, struc	97.55
3ex7_B		126	RNA-binding protein 8A; protein-RNA complex, mRNA	97.55
2dnp_A		90	RNA-binding protein 14; RRM domain, RBD, structura	97.55
1x5u_A		105	Splicing factor 3B subunit 4 (spliceosome associat	97.55
1p1t_A		104	Cleavage stimulation factor, 64 kDa subunit; RNA r	97.54
2dnm_A		103	SRP46 splicing factor; RRM domain, RBD, structural	97.54
2ek1_A		95	RNA-binding protein 12; RNA recognition motif, dim	97.54
2do4_A		100	Squamous cell carcinoma antigen recognized by T- c	97.54
2dgs_A		99	DAZ-associated protein 1; RRM domain, structural g	97.54
1x4c_A		108	Splicing factor, arginine/serine-rich 1; structura	97.53
2cpz_A		115	CUG triplet repeat RNA-binding protein 1; RRM doma	97.53
3md1_A		83	Nuclear and cytoplasmic polyadenylated RNA-bindin	97.53
1p27_B		106	RNA-binding protein 8A; nuclear protein, mRNA spli	97.53
2krb_A		81	Eukaryotic translation initiation factor 3 subunit	97.52
1wf1_A		110	RNA-binding protein RALY; structural genomics, RRM	97.52
2la6_A		99	RNA-binding protein FUS; structural genomics, nort	97.52
1oo0_B		110	CG8781-PA, drosophila Y14; RNA recognition motif,	97.51
2cq2_A		114	Hypothetical protein LOC91801; RRM domain, structu	97.5
1nu4_A		97	U1A RNA binding domain; RNA recognition motif, U1	97.5
2dnh_A		105	Bruno-like 5, RNA binding protein; RRM domain, RBD	97.5
2lxi_A		91	RNA-binding protein 10; NMR {Homo sapiens}	97.5
1wg1_A		88	KIAA1579 protein, homolog EXC-7; RBD, structural g	97.5
2cpd_A		99	Apobec-1 stimulating protein; RNA recognition moti	97.49
2hzc_A		87	Splicing factor U2AF 65 kDa subunit; RNA splicing,	97.49
2cq1_A		101	PTB-like protein L; RRM domain, structural genomic	97.49
2dnl_A		114	Cytoplasmic polyadenylation element binding protei	97.49
1whx_A		111	Hypothetical protein riken cDNA 1200009A02; RNA re	97.49
4fxv_A		99	ELAV-like protein 1; RNA recognition motif, putati	97.48
2ad9_A		119	Polypyrimidine tract-binding protein 1; RBD, RRM,	97.48
1x4f_A		112	Matrin 3; structural genomics, RRM domain, NPPSFA,	97.48
4f25_A		115	Polyadenylate-binding protein 1; RRM fold, transla	97.48
2cpi_A		111	CCR4-NOT transcription complex subunit 4; RNA reco	97.48
2hvz_A		101	Splicing factor, arginine/serine-rich 7; RRM, RNA	97.47
2ytc_A		85	PRE-mRNA-splicing factor RBM22; RRM domain, RBD, s	97.46
1x4h_A		111	RNA-binding protein 28; structural genomics, RRM d	97.46
2dis_A		109	Unnamed protein product; structural genomics, RRM	97.45
2err_A		109	Ataxin-2-binding protein 1; protein-RNA complex, R	97.45
2cqp_A		98	RNA-binding protein 12; RNA recognition motif, RRM	97.45
3ulh_A		107	THO complex subunit 4; nuclear protein, RNA bindin	97.44
1ufw_A		95	Synaptojanin 2; RNP domain, structural genomics, r	97.43
2lkz_A		95	RNA-binding protein 5; RRM; NMR {Homo sapiens}	97.42
2dgx_A		96	KIAA0430 protein; RRM domain, structural genomics,	97.41
1fjc_A		96	Nucleolin RBD2, protein C23; RNP, RRM, RNA binding	97.41
2e44_A		96	Insulin-like growth factor 2 mRNA binding protein	97.4
2khc_A		118	Testis-specific RNP-type RNA binding protein; RRM,	97.4
2fy1_A		116	RNA-binding motif protein, Y chromosome, family 1	97.39
3s8s_A		110	Histone-lysine N-methyltransferase SETD1A; chromat	97.36
1x4g_A		109	Nucleolysin TIAR; structural genomics, RRM domain,	97.36
2kt5_A		124	RNA and export factor-binding protein 2; chaperone	97.36
2cqd_A		116	RNA-binding region containing protein 1; RNA recog	97.36
2dhg_A		104	TRNA selenocysteine associated protein (SECP43); R	97.35
1fj7_A		101	Nucleolin RBD1, protein C23; RNP, RRM, RNA binding	97.35
1sjq_A		105	Polypyrimidine tract-binding protein 1; babbab mot	97.35
2kxn_B		129	Transformer-2 protein homolog beta; SR protein, RR	97.35
3beg_B		115	Splicing factor, arginine/serine-rich 1; kinase, S	97.34
2jrs_A		108	RNA-binding protein 39; RNA binding motif of RBM39	97.33
3ucg_A		89	Polyadenylate-binding protein 2; ferredoxin-like,	97.32
1wi8_A		104	EIF-4B, eukaryotic translation initiation factor 4	97.32
2jvr_A		111	Nucleolar protein 3; RNA recognition motif, nucleu	97.31
2e5g_A		94	U6 snRNA-specific terminal uridylyltransferase 1;	97.3
2cq4_A		114	RNA binding motif protein 23; RRM domain, structur	97.29
1u6f_A		139	Tcubp1, RNA-binding protein UBP1; trypanosome, mRN	97.29
1uaw_A		77	Mouse-musashi-1; RNP-type structure, RNA binding p	97.28
3p5t_L		90	Cleavage and polyadenylation specificity factor S;	97.27
3ns6_A		100	Eukaryotic translation initiation factor 3 subuni;	97.25
2hgn_A		139	Heterogeneous nuclear ribonucleoprotein F; RNA rec	97.24
2mss_A		75	Protein (musashi1); RNA-binding domain, RNA bindin	97.24
2nlw_A		105	Eukaryotic translation initiation factor 3 subunit	97.23
1x5o_A		114	RNA binding motif, single-stranded interacting pro	97.22
2dh8_A		105	DAZ-associated protein 1; RRM domain, structural g	97.22
2db1_A		118	Heterogeneous nuclear ribonucleoprotein F; RRM dom	97.22
2j76_E		100	EIF-4B, EIF4B, eukaryotic translation initiation f	97.2
1h2v_Z		156	20 kDa nuclear CAP binding protein; CAP-binding-co	97.2
2fc8_A		102	NCL protein; structure genomics, RRM_1 domain, str	97.2
2cqg_A		103	TDP-43, TAR DNA-binding protein-43; RNA recognitio	97.2
1s79_A		103	Lupus LA protein; RRM, alpha/beta, RNA binding pro	97.18
3egn_A		143	RNA-binding protein 40; RNA recognition motif (RRM	97.15
2z73_A		448	Rhodopsin; visual pigment, GQ-type, G-protein coup	97.13
2jwn_A		124	Embryonic polyadenylate-binding protein 2-B; epabp	97.12
2a3j_A		127	U1 small nuclear ribonucleoprotein A; computationa	97.1
2rs2_A		109	Musashi-1, RNA-binding protein musashi homolog 1;	97.09
2m2b_A		131	RNA-binding protein 10; T-cell, JCSG, MPP, PSI-bio	97.07
2dng_A		103	Eukaryotic translation initiation factor 4H; RRM d	97.07
2lmi_A		107	GRSF-1, G-rich sequence factor 1; G-rich RNA seque	97.06
3n9u_C		156	Cleavage and polyadenylation specificity factor S;	97.05
2f3j_A		177	RNA and export factor binding protein 2; RRM domai	97.03
3s7r_A		87	Heterogeneous nuclear ribonucleoprotein A/B; ferre	97.03
2cpy_A		114	RNA-binding protein 12; RRM domain, structural gen	97.01
3tht_A		345	Alkylated DNA repair protein ALKB homolog 8; struc	97.01
2wbr_A		89	GW182, gawky, LD47780P; DNA-binding protein, RRM,	97.0
2dgw_A		91	Probable RNA-binding protein 19; RRM domain, struc	97.0
1wf0_A		88	TDP-43, TAR DNA-binding protein-43; structural gen	96.98
1x4b_A		116	Heterogeneous nuclear ribonucleoproteins A2/B1; st	96.97
3u1l_A		240	PRE-mRNA-splicing factor CWC2; CSMP, zinc finger;	96.97
2ki2_A		90	SS-DNA binding protein 12RNP2; HP0827, RRM, SS-DNA	96.96
1sjr_A		164	Polypyrimidine tract-binding protein 1; extended b	96.93
1wel_A		124	RNA-binding protein 12; structural genomics, NPPSF	96.92
1wg5_A		104	Heterogeneous nuclear ribonucleoprotein H; structu	96.9
1x5p_A		97	Negative elongation factor E; structure genomics,	96.87
2lcw_A		116	RNA-binding protein FUS; RRM, nucleic acid binding	95.9
2xs2_A		102	Deleted in azoospermia-like; RNA binding protein-R	96.83
3zzy_A		130	Polypyrimidine tract-binding protein 1; protein bi	96.8
1iqt_A		75	AUF1, heterogeneous nuclear ribonucleoprotein D0;	96.77
2e5i_A		124	Heterogeneous nuclear ribonucleoprotein L-like; RR	96.74
3d2w_A		89	TAR DNA-binding protein 43; DP-43 proteinopathy, T	96.73
2bz2_A		121	Negative elongation factor E; NELF E, RNA recognit	96.67
1wez_A		102	HnRNP H', FTP-3, heterogeneous nuclear ribonucleop	96.58
3q2s_C		229	Cleavage and polyadenylation specificity factor S;	96.49
2dit_A		112	HIV TAT specific factor 1 variant; structural geno	96.46
1wey_A		104	Calcipressin 1; structural genomics, RRM domain, r	96.43
2hgm_A		126	HNRPF protein, heterogeneous nuclear ribonucleopro	96.42
2diu_A		96	KIAA0430 protein; structural genomics, RRM domain,	96.22
2dha_A		123	FLJ20171 protein; RRM domain, structural genomics,	96.18
2dnn_A		109	RNA-binding protein 12; RRM domain, RBD, structura	96.16
2pe8_A		105	Splicing factor 45; RRM, protein binding; 2.00A {H	95.97
2voo_A		193	Lupus LA protein; RNA-binding protein, RNA recogni	95.85
1uw4_A		91	UPF3X; nonsense mediated mRNA decay protein, RNA-b	95.59
2l9w_A		117	U4/U6 snRNA-associated-splicing factor PRP24; RRM,	94.31
3s6e_A		114	RNA-binding protein 39; ferredoxin-like, structura	94.16
3pq1_A		464	Poly(A) RNA polymerase; nucleotidyl transferase, R	93.58
3v4m_A		105	Splicing factor U2AF 65 kDa subunit; canonical RNA	93.56
3ue2_A		118	Poly(U)-binding-splicing factor PUF60; RNA recogni	92.4
3u0r_A		507	Apoptosis inhibitor 5; heat repeat, armadillo repe	91.88
1owx_A		121	Lupus LA protein, SS-B, LA; RRM, transcription; NM	91.68
1wwh_A		119	Nucleoporin 35, nucleoporin; structural genomics,	90.62
2dhx_A		104	Poly (ADP-ribose) polymerase family, member 10 var	89.01
2l08_A		97	Regulator of nonsense transcripts 3A; NESG, nonsen	88.92
1jmt_A		104	Splicing factor U2AF 35 kDa subunit; RRM, RNA spli	88.54
1whv_A		100	Poly(A)-specific ribonuclease; RNA recognition mot	88.25
3ctr_A		101	Poly(A)-specific ribonuclease PARN; protein-RNA-co	87.11
2d9o_A		100	DNAJ (HSP40) homolog, subfamily C, member 17; RRM	85.35
3d45_A		507	Poly(A)-specific ribonuclease PARN; CAP analogue,	81.56
3h0g_A		1752	DNA-directed RNA polymerase II subunit RPB1; trans	80.69

>1fxl_A Paraneoplastic encephalomyelitis antigen HUD; protein-RNA complex, AU-rich element, transcription/RNA complex; 1.80A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1g2e_A 1fnx_H 1d8z_A 1d9a_A 3hi9_A	Back alignment and structure

Probab=99.83  E-value=2.5e-20  Score=174.36  Aligned_cols=142  Identities=18%  Similarity=0.204  Sum_probs=120.2

Q ss_pred             ccceEEeccCCCcccHHHHHHHhhccCCcceEEEeccC------ceEEEEecCHHHHHHHHHhhcCCcee----EEEEee
Q 001325          569 ASKQLWLGSFGPEASEAHIRFQIDRFGPLEHFFFFPIK------GFALVEYINIIDAIRAREYIRNHFSW----RVKFMD  638 (1100)
Q Consensus       569 ~Sr~LWVGnLg~~vte~dL~~~F~~fGpLe~V~~~~~r------gfAFVeF~~i~DAv~A~~~LqG~~~~----RI~F~r  638 (1100)
                      .+++||||||+.+++++||+++|++||+|.++.+.+.+      |||||+|.+.+||..|++.|+|..+.    +|++++
T Consensus         1 s~~~l~v~nlp~~~~~~~l~~~f~~~G~i~~v~~~~~~~~~~~~g~afV~f~~~~~A~~a~~~l~~~~~~g~~l~v~~~~   80 (167)
T 1fxl_A            1 SKTNLIVNYLPQNMTQEEFRSLFGSIGEIESCKLVRDKITGQSLGYGFVNYIDPKDAEKAINTLNGLRLQTKTIKVSYAR   80 (167)
T ss_dssp             CCSEEEEESCCTTCCHHHHHHHHHTTSCEEEEEEEECTTTCCEEEEEEEEESSHHHHHHHHHHHTTCEETTEECEEEECC
T ss_pred             CcceEEEcCCCCCCCHHHHHHHHHhcCCeEEEEEEeCCCCCcceeEEEEEECCHHHHHHHHHHcCCCccCCceEEEEecC
Confidence            36899999999999999999999999999999997654      99999999999999999999998775    777776


Q ss_pred             ccCCCCcccccccccccceEEEccCCCcchhHHHHHhhhcccccCCceee-c---CCCCcccccccCCHHHHHHHHHHhh
Q 001325          639 VGLGTKGVINGVAVGSCFHVYVGNIPNQWAKDEILHESYKVVYKGPYMVT-D---LSCEGALLMEFRTPEEATTAMAHLR  714 (1100)
Q Consensus       639 ~~~gsrg~~~Gva~~~Sr~LwVG~Iss~~~kEELfsE~dkag~kgPv~f~-D---lsee~aLLmEF~s~eEA~~Ak~~l~  714 (1100)
                      +..         .....+.|||++++..++.++|...|..+|.+..+.+. +   ...++.++++|.+.++|..|++.|+
T Consensus        81 ~~~---------~~~~~~~l~v~nl~~~~t~~~l~~~f~~~G~i~~~~i~~~~~~g~~~g~afV~f~~~~~A~~A~~~l~  151 (167)
T 1fxl_A           81 PSS---------ASIRDANLYVSGLPKTMTQKELEQLFSQYGRIITSRILVDQVTGVSRGVGFIRFDKRIEAEEAIKGLN  151 (167)
T ss_dssp             CCC---------GGGTTCEEEEESCCTTCCHHHHHHHHGGGSCEEEEEEEECTTTCCEEEEEEEEESSHHHHHHHHHHHT
T ss_pred             CCc---------ccCCCCcEEECCCCCcCCHHHHHHHHHhcCCEeEEEEEecCCCCCccceEEEEeCCHHHHHHHHHHhc
Confidence            521         12357899999999999999999999987755555442 2   2235789999999999999999999


Q ss_pred             hhccc
Q 001325          715 QHRKS  719 (1100)
Q Consensus       715 ~~r~~  719 (1100)
                      ++..+
T Consensus       152 g~~~~  156 (167)
T 1fxl_A          152 GQKPS  156 (167)
T ss_dssp             TCCCT
T ss_pred             CCccC
Confidence            87653

PyMOL of 1fxl

>3nmr_A Cugbp ELAV-like family member 1; RRM, PRE-mRNA splicing, RNA binding protein-RNA complex; 1.85A {Homo sapiens} PDB: 3nna_A 3nnc_A 2dhs_A 3nnh_A	Back alignment and structure

>3md3_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNP, RBD, poly(U) binding, tandem, acetylation, cytopla nucleus; 2.70A {Saccharomyces cerevisiae}	Back alignment and structure

>1b7f_A Protein (SXL-lethal protein), RNA (5'-R(PGPUPUPGPUPUPUPUPUPUPUPU)-3; splicing regulation, RNP domain, RNA complex; 2.60A {Drosophila melanogaster} SCOP: d.58.7.1 d.58.7.1 PDB: 3sxl_A* 1sxl_A 2sxl_A	Back alignment and structure

>4f02_A Polyadenylate-binding protein 1; mRNA, eukaryotic initiation factors PAIP1 and PAIP2, translation-RNA complex; 2.00A {Homo sapiens} PDB: 1cvj_A*	Back alignment and structure

>3tyt_A Heterogeneous nuclear ribonucleoprotein L; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG; 1.60A {Mus musculus} PDB: 3s01_A 3to8_A	Back alignment and structure

>2g4b_A Splicing factor U2AF 65 kDa subunit; protein-RNA complex, RNA splicing factor, RNA recognition motif, RNA binding protein/RNA complex; 2.50A {Homo sapiens} PDB: 2u2f_A	Back alignment and structure

>2qfj_A FBP-interacting repressor; protein-DNA complex; HET: DNA; 2.10A {Homo sapiens} PDB: 3uwt_A 2kxf_A 2kxh_A	Back alignment and structure

>1qm9_A Polypyrimidine tract-binding protein; ribonucleoprotein, RNP, RNA, spicing, translation; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1	Back alignment and structure

>2adc_A Polypyrimidine tract-binding protein 1; RBD, RRM, protein-RNA complex, RNA binding protein/RNA complex; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 2evz_A	Back alignment and structure

>2yh0_A Splicing factor U2AF 65 kDa subunit; PRE-mRNA splicing, transcription, RNA binding protein, mRNA processing; NMR {Homo sapiens} PDB: 2yh1_A	Back alignment and structure

>3pgw_A U1-A; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 1fht_A 2u1a_A 2aym_A 2b0g_A	Back alignment and structure

>3sde_A Paraspeckle component 1; RRM, anti parallel right handed coiled-coil, NOPS, DBHS, RNA protein, RNA binding; 1.90A {Homo sapiens} PDB: 3sde_B	Back alignment and structure

>3smz_A Protein raver-1, ribonucleoprotein PTB-binding 1; RNA binding, RNA recognition motif, vincu alpha-actinin, nucleus, RNA binding protein; 1.99A {Homo sapiens} PDB: 3vf0_B* 3h2u_B 3h2v_E	Back alignment and structure

>1l3k_A Heterogeneous nuclear ribonucleoprotein A1; nuclear protein hnRNP A1, RNA-recognition motif, RNA- binding, UP1, RNA binding protein; 1.10A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1u1k_A* 1u1l_A* 1u1m_A* 1u1n_A* 1u1o_A 1u1p_A* 1u1q_A 1u1r_A* 1pgz_A* 1ha1_A 1po6_A* 2up1_A* 1up1_A	Back alignment and structure

>2cjk_A Nuclear polyadenylated RNA-binding protein 4; HRP1, RNA-binding, RNA processing, mRNA processing, nonsense-mediated mRNA decay, cleavage; NMR {Saccharomyces cerevisiae} PDB: 2km8_C	Back alignment and structure

>1fje_B Nucleolin RBD12, protein C23; RNP, RRM, RNA binding domain, RNA-protein complex, nucleolus, structural protein/RNA complex; NMR {Mesocricetus auratus} SCOP: d.58.7.1 d.58.7.1 PDB: 1rkj_A 2krr_A	Back alignment and structure

>2ghp_A U4/U6 snRNA-associated splicing factor PRP24; RNA chaperone, RNA binding domain, RNA recognition motif, SP factor, snRNP, spliceosome; 2.70A {Saccharomyces cerevisiae} SCOP: d.58.7.1 d.58.7.1 d.58.7.1 PDB: 2go9_A 2kh9_A	Back alignment and structure

>3smz_A Protein raver-1, ribonucleoprotein PTB-binding 1; RNA binding, RNA recognition motif, vincu alpha-actinin, nucleus, RNA binding protein; 1.99A {Homo sapiens} PDB: 3vf0_B* 3h2u_B 3h2v_E	Back alignment and structure

>2ghp_A U4/U6 snRNA-associated splicing factor PRP24; RNA chaperone, RNA binding domain, RNA recognition motif, SP factor, snRNP, spliceosome; 2.70A {Saccharomyces cerevisiae} SCOP: d.58.7.1 d.58.7.1 d.58.7.1 PDB: 2go9_A 2kh9_A	Back alignment and structure

>4f25_A Polyadenylate-binding protein 1; RRM fold, translation initiation, RNA-binding, EIF4G-binding translation; 1.90A {Homo sapiens} PDB: 4f26_A 2k8g_A	Back alignment and structure

>2cpj_A Non-POU domain-containing octamer-binding protein; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1	Back alignment and structure

>2hvz_A Splicing factor, arginine/serine-rich 7; RRM, RNA binding protein; NMR {Homo sapiens}	Back alignment and structure

>3r27_A HnRNP L, heterogeneous nuclear ribonucleoprotein L; RBD fold, protein binding, nucleus; 2.04A {Homo sapiens}	Back alignment and structure

>1wex_A Hypothetical protein (riken cDNA 2810036L13); structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.58.7.1	Back alignment and structure

>2cq1_A PTB-like protein L; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1	Back alignment and structure

>2cq2_A Hypothetical protein LOC91801; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1	Back alignment and structure

>1x4d_A Matrin 3; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1	Back alignment and structure

>4fxv_A ELAV-like protein 1; RNA recognition motif, putative RNA-binding domain, transcri structural genomics, joint center for structural genomics; 1.90A {Homo sapiens}	Back alignment and structure

>2ytc_A PRE-mRNA-splicing factor RBM22; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}	Back alignment and structure

>1why_A Hypothetical protein riken cDNA 1810017N16; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1	Back alignment and structure

>1sjq_A Polypyrimidine tract-binding protein 1; babbab motif, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1	Back alignment and structure

>2ad9_A Polypyrimidine tract-binding protein 1; RBD, RRM, protein-RNA complex, RNA binding protein/RNA complex; NMR {Homo sapiens} SCOP: d.58.7.1	Back alignment and structure

>1x5s_A Cold-inducible RNA-binding protein; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1	Back alignment and structure

>2cqi_A Nucleolysin TIAR; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, ST genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1	Back alignment and structure

>1x4f_A Matrin 3; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1	Back alignment and structure

>2la4_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNA recognition, stress granules, nucleus, RNA-binding, transcription; NMR {Saccharomyces cerevisiae}	Back alignment and structure

>2x1f_A MRNA 3'-END-processing protein RNA15; transcription-RNA complex, mRNA processing; 1.60A {Saccharomyces cerevisiae} PDB: 2x1b_A 2x1a_A 2km8_B	Back alignment and structure

>3md1_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RBD, RNP, poly(U) binding, nucleus, RNA-binding, binding protein; 1.60A {Saccharomyces cerevisiae} SCOP: d.58.7.0	Back alignment and structure

>2dnz_A Probable RNA-binding protein 23; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>3mdf_A Peptidyl-prolyl CIS-trans isomerase E; RRM domain, PHD finger, CYP33, MLL, RNA binding protein, ISO mRNA processing, mRNA splicing, nucleus; 1.85A {Homo sapiens} SCOP: d.58.7.1 PDB: 2kyx_A 3lpy_A*	Back alignment and structure

>3bs9_A Nucleolysin TIA-1 isoform P40; RNA recognition motif, RRM, RNA binding domain, RBD, RNA splicing, apoptosis, phosphoprotein, RNA-binding; 1.95A {Homo sapiens}	Back alignment and structure

>2wbr_A GW182, gawky, LD47780P; DNA-binding protein, RRM, RBD, TNRC6A, mirnas, P-bodies, argonaute, mRNA decay; NMR {Drosophila melanogaster}	Back alignment and structure

>1x4g_A Nucleolysin TIAR; structural genomics, RRM domain, TIA-1 related protein, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1	Back alignment and structure

>2ywk_A Putative RNA-binding protein 11; RRM-domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; 1.54A {Homo sapiens}	Back alignment and structure

>2cqb_A Peptidyl-prolyl CIS-trans isomerase E; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1	Back alignment and structure

>2dnq_A RNA-binding protein 4B; RRM domain,RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}	Back alignment and structure

>2cqc_A Arginine/serine-rich splicing factor 10; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1	Back alignment and structure

>1x5t_A Splicing factor 3B subunit 4; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1	Back alignment and structure

>3s8s_A Histone-lysine N-methyltransferase SETD1A; chromatin modification, transcription regulation, structural genomics, structural genomics consortium; 1.30A {Homo sapiens}	Back alignment and structure

>2kvi_A Nuclear polyadenylated RNA-binding protein 3; RNA-binding motif, RRM, transcription termination, NUC phosphoprotein; NMR {Saccharomyces cerevisiae}	Back alignment and structure

>2cph_A RNA binding motif protein 19; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1	Back alignment and structure

>2cpf_A RNA binding motif protein 19; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1	Back alignment and structure

>1whx_A Hypothetical protein riken cDNA 1200009A02; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1	Back alignment and structure

>2dgt_A RNA-binding protein 30; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}	Back alignment and structure

>2cq3_A RNA-binding protein 9; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1	Back alignment and structure

>2xnq_A Nuclear polyadenylated RNA-binding protein 3; transcription termination, RNA processi recognition, RRM; HET: CAF; 1.30A {Saccharomyces cerevisiae} PDB: 2xnr_A 2l41_A	Back alignment and structure

>2dnh_A Bruno-like 5, RNA binding protein; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dnk_A 2dno_A	Back alignment and structure

>1x4a_A Splicing factor, arginine/serine-rich 1 (splicing factor 2, alternate splicing factor)...; structure genomics, SURP domain, splicing factor SF2; NMR {Homo sapiens} SCOP: d.58.7.1	Back alignment and structure

>2dnp_A RNA-binding protein 14; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}	Back alignment and structure

>3lqv_A PRE-mRNA branch site protein P14; cysless mutant, PRE-mRNA splicing, adenine, mRNA processing, nucleus, phosphoprotein, RNA-binding; HET: ADE; 2.38A {Homo sapiens} SCOP: d.58.7.1 PDB: 2f9d_A 2f9j_A 2fho_B	Back alignment and structure

>4a8x_A RNA-binding protein with serine-rich domain 1; transcription, splicing, RNA processing, nonsense mediated D NMD, HDAC, histone deacetylation; 1.90A {Homo sapiens}	Back alignment and structure

>1u6f_A Tcubp1, RNA-binding protein UBP1; trypanosome, mRNA-binding protein, GU-rich RNA, structure; NMR {Trypanosoma cruzi} SCOP: d.58.7.1	Back alignment and structure

>2dgx_A KIAA0430 protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1	Back alignment and structure

>2d9p_A Polyadenylate-binding protein 3; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}	Back alignment and structure

>2e5h_A Zinc finger CCHC-type and RNA-binding motif- containing protein 1; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>2dgp_A Bruno-like 4, RNA binding protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dgq_A	Back alignment and structure

>2div_A TRNA selenocysteine associated protein; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}	Back alignment and structure

>2fy1_A RNA-binding motif protein, Y chromosome, family 1 member A1; RNA binding protein, structure, protein-RNA complex, RNA stem-loop, structural protein/RNA complex; NMR {Homo sapiens}	Back alignment and structure

>2dgv_A HnRNP M, heterogeneous nuclear ribonucleoprotein M; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2dh9_A	Back alignment and structure

>2cqh_A IGF-II mRNA-binding protein 2 isoform A; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1	Back alignment and structure

>1fjc_A Nucleolin RBD2, protein C23; RNP, RRM, RNA binding domain, nucleolus, structural protein; NMR {Mesocricetus auratus} SCOP: d.58.7.1	Back alignment and structure

>1p27_B RNA-binding protein 8A; nuclear protein, mRNA splicing; 2.00A {Homo sapiens} SCOP: d.58.7.1	Back alignment and structure

>2la6_A RNA-binding protein FUS; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, RNA recognition; NMR {Homo sapiens}	Back alignment and structure

>1whw_A Hypothetical protein riken cDNA 1200009A02; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1	Back alignment and structure

>2err_A Ataxin-2-binding protein 1; protein-RNA complex, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1	Back alignment and structure

>2cpe_A RNA-binding protein EWS; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1	Back alignment and structure

>2dgo_A Cytotoxic granule-associated RNA binding protein 1; RRM domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2rne_A 2dh7_A	Back alignment and structure

>2e5i_A Heterogeneous nuclear ribonucleoprotein L-like; RRM domain, RBD, structural genomics, NPPSFA; NMR {Mus musculus}	Back alignment and structure

>1nu4_A U1A RNA binding domain; RNA recognition motif, U1 small nuclear ribonucleoprotein, R binding domain, RNA binding protein; HET: MLA; 1.80A {Homo sapiens} SCOP: d.58.7.1 PDB: 1drz_A* 1urn_A 3hhn_B* 3egz_A* 1zzn_A* 1u6b_A* 3cun_A* 3cul_A* 3g8s_A* 3g8t_A* 3g96_A* 3g9c_A* 3irw_P* 3mum_P* 3mur_P* 3mut_P* 3muv_P* 3mxh_P* 3p49_B 3r1h_A* ...	Back alignment and structure

>1x4e_A RNA binding motif, single-stranded interacting protein 2; structural genomics, RRM domain, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1	Back alignment and structure

>2do0_A HnRNP M, heterogeneous nuclear ribonucleoprotein M; RNA recognition motif, RRM, RNA binding domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>2jvo_A Nucleolar protein 3; nucleus, phosphorylation, ribonucleoprotein, ribosome biogenesis, RNA-binding, rRNA processing; NMR {Saccharomyces cerevisiae} PDB: 2osq_A	Back alignment and structure

>2do4_A Squamous cell carcinoma antigen recognized by T- cells 3; RRM domaim, RDB, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>3ex7_B RNA-binding protein 8A; protein-RNA complex, mRNA processing, mRNA splicing, mRNA transport, nonsense-mediated mRNA decay, nucleus; HET: ADP; 2.30A {Homo sapiens} PDB: 2j0q_D*	Back alignment and structure

>1wf1_A RNA-binding protein RALY; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wf2_A	Back alignment and structure

>2dgs_A DAZ-associated protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}	Back alignment and structure

>2lxi_A RNA-binding protein 10; NMR {Homo sapiens}	Back alignment and structure

>2e5j_A Methenyltetrahydrofolate synthetase domain containing; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>2dis_A Unnamed protein product; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1	Back alignment and structure

>1x5o_A RNA binding motif, single-stranded interacting protein 1; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1	Back alignment and structure

>2cq0_A Eukaryotic translation initiation factor 3 subunit 4; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1	Back alignment and structure

>2dgu_A Heterogeneous nuclear ribonucleoprotein Q; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dk2_A	Back alignment and structure

>1p1t_A Cleavage stimulation factor, 64 kDa subunit; RNA recognition motif, C-terminal helix, N-terminal helix, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1	Back alignment and structure

>1oo0_B CG8781-PA, drosophila Y14; RNA recognition motif, splicing, protein complex, EXON junct complex, signaling protein; 1.85A {Drosophila melanogaster} SCOP: d.58.7.1 PDB: 2hyi_B* 2j0s_D* 2xb2_D*	Back alignment and structure

>3tht_A Alkylated DNA repair protein ALKB homolog 8; structural genomics, PSI-biology, northeast structural genom consortium, NESG; HET: AKG; 3.01A {Homo sapiens} PDB: 3thp_A*	Back alignment and structure

>2cpz_A CUG triplet repeat RNA-binding protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 2rq4_A 2rqc_A	Back alignment and structure

>2dnm_A SRP46 splicing factor; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}	Back alignment and structure

>2hzc_A Splicing factor U2AF 65 kDa subunit; RNA splicing, RRM, RNA recognition, alternative conformation binding protein; HET: P6G; 1.47A {Homo sapiens} PDB: 1u2f_A	Back alignment and structure

>2cpd_A Apobec-1 stimulating protein; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1	Back alignment and structure

>1x4h_A RNA-binding protein 28; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1	Back alignment and structure

>2khc_A Testis-specific RNP-type RNA binding protein; RRM, RNA recognition motif, bruno; NMR {Drosophila melanogaster}	Back alignment and structure

>2ek1_A RNA-binding protein 12; RNA recognition motif, dimer, structural genomics, NPPSFA, national project on protein structural and functional analyses; 2.00A {Homo sapiens} PDB: 2ek6_A	Back alignment and structure

>1x5p_A Negative elongation factor E; structure genomics, RRM domain, PARP14, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1	Back alignment and structure

>3ulh_A THO complex subunit 4; nuclear protein, RNA binding, structural genomi center for structural genomics, JCSG, protein structure INI PSI-biology; 2.54A {Homo sapiens} PDB: 1no8_A	Back alignment and structure

>1x5u_A Splicing factor 3B subunit 4 (spliceosome associated protein 49) (SAP 49) (SF3B50)...; structure genomics,RRM domain,splicing factor 3B; NMR {Homo sapiens} SCOP: d.58.7.1	Back alignment and structure

>2a3j_A U1 small nuclear ribonucleoprotein A; computationally designed protein, RRM, U1A, RNA binding protein; NMR {Homo sapiens}	Back alignment and structure

>2krb_A Eukaryotic translation initiation factor 3 subunit B; EIF3, eukaryotic initiation factor, EIF3B, EIF3J; NMR {Homo sapiens}	Back alignment and structure

>2kt5_A RNA and export factor-binding protein 2; chaperone, mRNA processing, mRNA splicing, transport, nucleus, RNA-binding, spliceosome, transport; NMR {Mus musculus}	Back alignment and structure

>2jrs_A RNA-binding protein 39; RNA binding motif of RBM39_human (caper), RRM2 domain, solution structure, structural genomics, PSI-2; NMR {Homo sapiens}	Back alignment and structure

>2i2y_A Fusion protein consists of immunoglobin G- binding protein G and splicing factor,...; protein-RNA complex RRM alpha-beta sandwich BETA1-alpha1- BETA2-BETA3-alpha2-BETA4; NMR {Streptococcus SP} PDB: 2i38_A	Back alignment and structure

>3zzy_A Polypyrimidine tract-binding protein 1; protein binding, peptide binding, RNA recognition motif; 1.40A {Homo sapiens} PDB: 3zzz_A	Back alignment and structure

>2dhg_A TRNA selenocysteine associated protein (SECP43); RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>2ku7_A MLL1 PHD3-CYP33 RRM chimeric protein; transcriptional regulation, RRM domain, transcr; NMR {Homo sapiens}	Back alignment and structure

>2cpi_A CCR4-NOT transcription complex subunit 4; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1	Back alignment and structure

>1x4c_A Splicing factor, arginine/serine-rich 1; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1	Back alignment and structure

>3ucg_A Polyadenylate-binding protein 2; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG, protein structure initiative; HET: PGE; 1.95A {Homo sapiens} PDB: 3b4d_A 3b4m_A	Back alignment and structure

>1sjr_A Polypyrimidine tract-binding protein 1; extended babbab motif, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 2adb_A	Back alignment and structure

>2lkz_A RNA-binding protein 5; RRM; NMR {Homo sapiens}	Back alignment and structure

>2cqd_A RNA-binding region containing protein 1; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1	Back alignment and structure

>2kxn_B Transformer-2 protein homolog beta; SR protein, RRM, splicing factor, RNA protein complex, SMN, binding protein-RNA complex; NMR {Homo sapiens} PDB: 2rra_A 2rrb_A	Back alignment and structure

>1wi8_A EIF-4B, eukaryotic translation initiation factor 4B; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Homo sapiens} SCOP: d.58.7.1	Back alignment and structure

>1wg1_A KIAA1579 protein, homolog EXC-7; RBD, structural genomics, riken structural genomics/proteomics initiative, RSGI, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wi6_A	Back alignment and structure

>1h2v_Z 20 kDa nuclear CAP binding protein; CAP-binding-complex, RNP domain, MIF4G domain, RNA maturation, RNA export, nuclear protein, RNA-binding; 2.0A {Homo sapiens} SCOP: d.58.7.1 PDB: 1h2u_X* 1h2t_Z 1n52_B* 1n54_B 3fex_B 3fey_B 1h6k_X	Back alignment and structure

>2cpx_A Hypothetical protein FLJ11016; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1	Back alignment and structure

>2cqp_A RNA-binding protein 12; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1	Back alignment and structure

>3p5t_L Cleavage and polyadenylation specificity factor S; RRM domain, poly(A) site recognition, RNA, nuclear, RNA BIND protein; 2.70A {Homo sapiens} PDB: 3p6y_C	Back alignment and structure

>2jvr_A Nucleolar protein 3; RNA recognition motif, nucleus, phosphorylation, ribonucleoprotein, ribosome biogenesis, RNA-binding; NMR {Saccharomyces cerevisiae} PDB: 2osr_A	Back alignment and structure

>3ns6_A Eukaryotic translation initiation factor 3 subuni; 1.25A {Saccharomyces cerevisiae} PDB: 3ns5_A	Back alignment and structure

>2ki2_A SS-DNA binding protein 12RNP2; HP0827, RRM, SS-DNA binding proteins, RNA binding protein/SS-DNA binding protein complex; NMR {Helicobacter pylori}	Back alignment and structure

>2jwn_A Embryonic polyadenylate-binding protein 2-B; epabp2, poly(A) binding, structural genomics, protein structure initiative, PSI-2; NMR {Xenopus laevis}	Back alignment and structure

>2cq4_A RNA binding motif protein 23; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1	Back alignment and structure

>1s79_A Lupus LA protein; RRM, alpha/beta, RNA binding protein, translation; NMR {Homo sapiens} SCOP: d.58.7.1	Back alignment and structure

>2kn4_A Immunoglobulin G-binding protein G, splicing FACT arginine/serine-rich 2, S35, splicing factor SC35,; RRM domain, cell WALL; NMR {Streptococcus SP}	Back alignment and structure

>2dng_A Eukaryotic translation initiation factor 4H; RRM domain, RBD, structural genomics, NPPSFA; NMR {Mus musculus}	Back alignment and structure

>1fj7_A Nucleolin RBD1, protein C23; RNP, RRM, RNA binding domain, nucleolus, structural protein; NMR {Mesocricetus auratus} SCOP: d.58.7.1	Back alignment and structure

>2nlw_A Eukaryotic translation initiation factor 3 subunit 9; eukaryotic initiation factor 3 complex, RNA recognition motif; NMR {Homo sapiens}	Back alignment and structure

>3egn_A RNA-binding protein 40; RNA recognition motif (RRM), RNP motif, U11/U12-65K protein, DI-snRNP, U1A protein, U2B protein; 2.50A {Homo sapiens}	Back alignment and structure

>2m2b_A RNA-binding protein 10; T-cell, JCSG, MPP, PSI-biology; NMR {Homo sapiens}	Back alignment and structure

>3s7r_A Heterogeneous nuclear ribonucleoprotein A/B; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG; 2.15A {Homo sapiens} PDB: 1hd0_A 1hd1_A	Back alignment and structure

>2fc9_A NCL protein; structure genomics, RRM_1 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}	Back alignment and structure

>2rs2_A Musashi-1, RNA-binding protein musashi homolog 1; protein-RNA complex, RRM, RBD, RNA binding protein- complex; NMR {Mus musculus}	Back alignment and structure

>2j76_E EIF-4B, EIF4B, eukaryotic translation initiation factor 4B; protein biosynthesis, RNA recognition motif, RNA binding domain, RRM, RBD, RNP; NMR {Homo sapiens}	Back alignment and structure

>3nmr_A Cugbp ELAV-like family member 1; RRM, PRE-mRNA splicing, RNA binding protein-RNA complex; 1.85A {Homo sapiens} PDB: 3nna_A 3nnc_A 2dhs_A 3nnh_A	Back alignment and structure

>3n9u_C Cleavage and polyadenylation specificity factor S; protein-protein complex, coexpression, heterotetramer, mRNA maturation, mRNA cleavage; 1.92A {Homo sapiens}	Back alignment and structure

>2mss_A Protein (musashi1); RNA-binding domain, RNA binding protein; NMR {Mus musculus} SCOP: d.58.7.1 PDB: 2mst_A	Back alignment and structure

>2lea_A Serine/arginine-rich splicing factor 2; SR protein, RNA binding protein; NMR {Homo sapiens} PDB: 2leb_A 2lec_A	Back alignment and structure

>1uaw_A Mouse-musashi-1; RNP-type structure, RNA binding protein; NMR {Mus musculus} SCOP: d.58.7.1	Back alignment and structure

>2dh8_A DAZ-associated protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}	Back alignment and structure

>3d2w_A TAR DNA-binding protein 43; DP-43 proteinopathy, TDP-43 inclusions, RNA recognition MOTI U, ALS, RRM; HET: DNA; 1.65A {Mus musculus}	Back alignment and structure

>1x4b_A Heterogeneous nuclear ribonucleoproteins A2/B1; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1	Back alignment and structure

>1rk8_A CG8781-PA, CG8781-PA protein; mRNA processing, RRM, RBD, NMD, oskar mRNA localization, translation; 1.90A {Drosophila melanogaster} SCOP: d.58.7.1 PDB: 1hl6_A 2x1g_A	Back alignment and structure

>3u1l_A PRE-mRNA-splicing factor CWC2; CSMP, zinc finger; 1.64A {Saccharomyces cerevisiae} PDB: 3u1m_A 3tp2_A	Back alignment and structure

>3beg_B Splicing factor, arginine/serine-rich 1; kinase, SR protein kinase, SR protein, PRE-mRNA splicing, at binding, chromosome partition; HET: SEP ANP; 2.90A {Homo sapiens} SCOP: d.58.7.1 PDB: 2o3d_A 1wg4_A	Back alignment and structure

>2e5g_A U6 snRNA-specific terminal uridylyltransferase 1; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>2cqg_A TDP-43, TAR DNA-binding protein-43; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1	Back alignment and structure

>1wf0_A TDP-43, TAR DNA-binding protein-43; structural genomics, RRM domain, riken structural genomics/proteomics initiative RSGI, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1	Back alignment and structure

>2cpy_A RNA-binding protein 12; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1	Back alignment and structure

>3md3_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNP, RBD, poly(U) binding, tandem, acetylation, cytopla nucleus; 2.70A {Saccharomyces cerevisiae}	Back alignment and structure

>2e44_A Insulin-like growth factor 2 mRNA binding protein 3; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>1qm9_A Polypyrimidine tract-binding protein; ribonucleoprotein, RNP, RNA, spicing, translation; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1	Back alignment and structure

>2fc8_A NCL protein; structure genomics, RRM_1 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}	Back alignment and structure

>2dnl_A Cytoplasmic polyadenylation element binding protein 3; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>2dgw_A Probable RNA-binding protein 19; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}	Back alignment and structure

>1iqt_A AUF1, heterogeneous nuclear ribonucleoprotein D0; RNA-binding protein, hnRNP, telomere, DNA-binding protein, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wtb_A 1x0f_A	Back alignment and structure

>1wez_A HnRNP H', FTP-3, heterogeneous nuclear ribonucleoprotein H'; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1	Back alignment and structure

>2lcw_A RNA-binding protein FUS; RRM, nucleic acid binding protein; NMR {Homo sapiens}	Back alignment and structure

>2qfj_A FBP-interacting repressor; protein-DNA complex; HET: DNA; 2.10A {Homo sapiens} PDB: 3uwt_A 2kxf_A 2kxh_A	Back alignment and structure

>3pgw_A U1-A; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 1fht_A 2u1a_A 2aym_A 2b0g_A	Back alignment and structure

>1fxl_A Paraneoplastic encephalomyelitis antigen HUD; protein-RNA complex, AU-rich element, transcription/RNA complex; 1.80A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1g2e_A 1fnx_H 1d8z_A 1d9a_A 3hi9_A	Back alignment and structure

>2adc_A Polypyrimidine tract-binding protein 1; RBD, RRM, protein-RNA complex, RNA binding protein/RNA complex; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 2evz_A	Back alignment and structure

>1wel_A RNA-binding protein 12; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1	Back alignment and structure

>2xs2_A Deleted in azoospermia-like; RNA binding protein-RNA complex; 1.35A {Mus musculus} PDB: 2xs7_A 2xs5_A 2xsf_A	Back alignment and structure

>2f3j_A RNA and export factor binding protein 2; RRM domain, RBD domain., transport protein; NMR {Mus musculus}	Back alignment and structure

>2g4b_A Splicing factor U2AF 65 kDa subunit; protein-RNA complex, RNA splicing factor, RNA recognition motif, RNA binding protein/RNA complex; 2.50A {Homo sapiens} PDB: 2u2f_A	Back alignment and structure

>2yh0_A Splicing factor U2AF 65 kDa subunit; PRE-mRNA splicing, transcription, RNA binding protein, mRNA processing; NMR {Homo sapiens} PDB: 2yh1_A	Back alignment and structure

>1b7f_A Protein (SXL-lethal protein), RNA (5'-R(PGPUPUPGPUPUPUPUPUPUPUPU)-3; splicing regulation, RNP domain, RNA complex; 2.60A {Drosophila melanogaster} SCOP: d.58.7.1 d.58.7.1 PDB: 3sxl_A* 1sxl_A 2sxl_A	Back alignment and structure

>3q2s_C Cleavage and polyadenylation specificity factor S; CFIM, CFIM25, CFIM68, CPSF5, CPSF6, CPSF, 3' END processing, processing, cleavage factor; 2.90A {Homo sapiens} PDB: 3q2t_C	Back alignment and structure

>4f02_A Polyadenylate-binding protein 1; mRNA, eukaryotic initiation factors PAIP1 and PAIP2, translation-RNA complex; 2.00A {Homo sapiens} PDB: 1cvj_A*	Back alignment and structure

>2db1_A Heterogeneous nuclear ribonucleoprotein F; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus}	Back alignment and structure

>1wg5_A Heterogeneous nuclear ribonucleoprotein H; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1	Back alignment and structure

>2lmi_A GRSF-1, G-rich sequence factor 1; G-rich RNA sequence binding factor, RNA binding domain, STRU genomics, joint center for structural genomics, JCSG; NMR {Homo sapiens}	Back alignment and structure

>2cjk_A Nuclear polyadenylated RNA-binding protein 4; HRP1, RNA-binding, RNA processing, mRNA processing, nonsense-mediated mRNA decay, cleavage; NMR {Saccharomyces cerevisiae} PDB: 2km8_C	Back alignment and structure

>3tyt_A Heterogeneous nuclear ribonucleoprotein L; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG; 1.60A {Mus musculus} PDB: 3s01_A 3to8_A	Back alignment and structure

>2pe8_A Splicing factor 45; RRM, protein binding; 2.00A {Homo sapiens} PDB: 2peh_A	Back alignment and structure

>2hgl_A HNRPF protein, heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative, splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kfy_A	Back alignment and structure

>3pgw_S U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 3cw1_K 2l5i_A 2l5j_A*	Back alignment and structure

>1l3k_A Heterogeneous nuclear ribonucleoprotein A1; nuclear protein hnRNP A1, RNA-recognition motif, RNA- binding, UP1, RNA binding protein; 1.10A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1u1k_A* 1u1l_A* 1u1m_A* 1u1n_A* 1u1o_A 1u1p_A* 1u1q_A 1u1r_A* 1pgz_A* 1ha1_A 1po6_A* 2up1_A* 1up1_A	Back alignment and structure

>1fje_B Nucleolin RBD12, protein C23; RNP, RRM, RNA binding domain, RNA-protein complex, nucleolus, structural protein/RNA complex; NMR {Mesocricetus auratus} SCOP: d.58.7.1 d.58.7.1 PDB: 1rkj_A 2krr_A	Back alignment and structure

>2dit_A HIV TAT specific factor 1 variant; structural genomics, RRM_1 domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1	Back alignment and structure

>2diu_A KIAA0430 protein; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}	Back alignment and structure

>3sde_A Paraspeckle component 1; RRM, anti parallel right handed coiled-coil, NOPS, DBHS, RNA protein, RNA binding; 1.90A {Homo sapiens} PDB: 3sde_B	Back alignment and structure

>2hgn_A Heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kg1_A	Back alignment and structure

>2dnn_A RNA-binding protein 12; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}	Back alignment and structure

>2dha_A FLJ20171 protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}	Back alignment and structure

>2voo_A Lupus LA protein; RNA-binding protein, RNA recognition motif, systemic lupus erythematosus, phosphoprotein, RNA maturation; 1.8A {Homo sapiens} SCOP: a.4.5.46 d.58.7.1 PDB: 2von_A 2vod_A 2vop_A 1zh5_A 1yty_A 1s7a_A	Back alignment and structure

>2hgm_A HNRPF protein, heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kg0_A	Back alignment and structure

>3v4m_A Splicing factor U2AF 65 kDa subunit; canonical RNA binding protein, RNA splicing, structural GENO joint center for structural genomics, JCSG; HET: MSE; 1.80A {Mus musculus} PDB: 1o0p_A 1opi_A	Back alignment and structure

>2kn4_A Immunoglobulin G-binding protein G, splicing FACT arginine/serine-rich 2, S35, splicing factor SC35,; RRM domain, cell WALL; NMR {Streptococcus SP}	Back alignment and structure

>2d9o_A DNAJ (HSP40) homolog, subfamily C, member 17; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>3ue2_A Poly(U)-binding-splicing factor PUF60; RNA recognition motif, RRM, RNA binding domain, ST genomics, joint center for structural genomics, JCSG; HET: MSE; 1.23A {Homo sapiens} SCOP: d.58.7.0 PDB: 3us5_A 2dny_A	Back alignment and structure

>1jmt_A Splicing factor U2AF 35 kDa subunit; RRM, RNA splicing, proline, PPII helix, peptide recognition, RNA binding protein; 2.20A {Homo sapiens} SCOP: d.58.7.3	Back alignment and structure

>2j8a_A Histone-lysine N-methyltransferase, H3 lysine-4 specific; histone methyltransferase, RRM fold, telomere, nuclear protein; 3.0A {Saccharomyces cerevisiae}	Back alignment and structure

>3s6e_A RNA-binding protein 39; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG, protein structure initiative, PSI-biology; HET: MSE CIT; 0.95A {Mus musculus} PDB: 2lq5_A	Back alignment and structure

>2i2y_A Fusion protein consists of immunoglobin G- binding protein G and splicing factor,...; protein-RNA complex RRM alpha-beta sandwich BETA1-alpha1- BETA2-BETA3-alpha2-BETA4; NMR {Streptococcus SP} PDB: 2i38_A	Back alignment and structure

>1owx_A Lupus LA protein, SS-B, LA; RRM, transcription; NMR {Homo sapiens} SCOP: d.58.7.1	Back alignment and structure

>2lea_A Serine/arginine-rich splicing factor 2; SR protein, RNA binding protein; NMR {Homo sapiens} PDB: 2leb_A 2lec_A	Back alignment and structure

>3dxb_A Thioredoxin N-terminally fused to PUF60(UHM); splicing, FBP interacting repressor, RRM, electron TRAN redox-active center, transport; 2.20A {Escherichia coli O157}	Back alignment and structure

>1rk8_A CG8781-PA, CG8781-PA protein; mRNA processing, RRM, RBD, NMD, oskar mRNA localization, translation; 1.90A {Drosophila melanogaster} SCOP: d.58.7.1 PDB: 1hl6_A 2x1g_A	Back alignment and structure

>3pgw_S U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 3cw1_K 2l5i_A 2l5j_A*	Back alignment and structure

>2e5h_A Zinc finger CCHC-type and RNA-binding motif- containing protein 1; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>1why_A Hypothetical protein riken cDNA 1810017N16; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1	Back alignment and structure

>3mdf_A Peptidyl-prolyl CIS-trans isomerase E; RRM domain, PHD finger, CYP33, MLL, RNA binding protein, ISO mRNA processing, mRNA splicing, nucleus; 1.85A {Homo sapiens} SCOP: d.58.7.1 PDB: 2kyx_A 3lpy_A*	Back alignment and structure

>1x4a_A Splicing factor, arginine/serine-rich 1 (splicing factor 2, alternate splicing factor)...; structure genomics, SURP domain, splicing factor SF2; NMR {Homo sapiens} SCOP: d.58.7.1	Back alignment and structure

>2cpj_A Non-POU domain-containing octamer-binding protein; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1	Back alignment and structure

>2dnq_A RNA-binding protein 4B; RRM domain,RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}	Back alignment and structure

>2cqb_A Peptidyl-prolyl CIS-trans isomerase E; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1	Back alignment and structure

>1x5t_A Splicing factor 3B subunit 4; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1	Back alignment and structure

>2x1f_A MRNA 3'-END-processing protein RNA15; transcription-RNA complex, mRNA processing; 1.60A {Saccharomyces cerevisiae} PDB: 2x1b_A 2x1a_A 2km8_B	Back alignment and structure

>1x4e_A RNA binding motif, single-stranded interacting protein 2; structural genomics, RRM domain, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1	Back alignment and structure

>2e5j_A Methenyltetrahydrofolate synthetase domain containing; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>2dnr_A Synaptojanin-1; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}	Back alignment and structure

>1whw_A Hypothetical protein riken cDNA 1200009A02; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1	Back alignment and structure

>2la4_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNA recognition, stress granules, nucleus, RNA-binding, transcription; NMR {Saccharomyces cerevisiae}	Back alignment and structure

>2hgl_A HNRPF protein, heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative, splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kfy_A	Back alignment and structure

>1wex_A Hypothetical protein (riken cDNA 2810036L13); structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.58.7.1	Back alignment and structure

>2dgu_A Heterogeneous nuclear ribonucleoprotein Q; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dk2_A	Back alignment and structure

>2div_A TRNA selenocysteine associated protein; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}	Back alignment and structure

>2do0_A HnRNP M, heterogeneous nuclear ribonucleoprotein M; RNA recognition motif, RRM, RNA binding domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>2cqc_A Arginine/serine-rich splicing factor 10; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1	Back alignment and structure

>2jvo_A Nucleolar protein 3; nucleus, phosphorylation, ribonucleoprotein, ribosome biogenesis, RNA-binding, rRNA processing; NMR {Saccharomyces cerevisiae} PDB: 2osq_A	Back alignment and structure

>2cq3_A RNA-binding protein 9; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1	Back alignment and structure

>2cpx_A Hypothetical protein FLJ11016; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1	Back alignment and structure

>2dnz_A Probable RNA-binding protein 23; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>3r27_A HnRNP L, heterogeneous nuclear ribonucleoprotein L; RBD fold, protein binding, nucleus; 2.04A {Homo sapiens}	Back alignment and structure

>3lqv_A PRE-mRNA branch site protein P14; cysless mutant, PRE-mRNA splicing, adenine, mRNA processing, nucleus, phosphoprotein, RNA-binding; HET: ADE; 2.38A {Homo sapiens} SCOP: d.58.7.1 PDB: 2f9d_A 2f9j_A 2fho_B	Back alignment and structure

>2kvi_A Nuclear polyadenylated RNA-binding protein 3; RNA-binding motif, RRM, transcription termination, NUC phosphoprotein; NMR {Saccharomyces cerevisiae}	Back alignment and structure

>2fc9_A NCL protein; structure genomics, RRM_1 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}	Back alignment and structure

>2cqh_A IGF-II mRNA-binding protein 2 isoform A; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1	Back alignment and structure

>3bs9_A Nucleolysin TIA-1 isoform P40; RNA recognition motif, RRM, RNA binding domain, RBD, RNA splicing, apoptosis, phosphoprotein, RNA-binding; 1.95A {Homo sapiens}	Back alignment and structure

>2cqi_A Nucleolysin TIAR; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, ST genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1	Back alignment and structure

>2cpe_A RNA-binding protein EWS; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1	Back alignment and structure

>1x4d_A Matrin 3; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1	Back alignment and structure

>2dgv_A HnRNP M, heterogeneous nuclear ribonucleoprotein M; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2dh9_A	Back alignment and structure

>2cq0_A Eukaryotic translation initiation factor 3 subunit 4; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1	Back alignment and structure

>2dgt_A RNA-binding protein 30; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}	Back alignment and structure

>2ku7_A MLL1 PHD3-CYP33 RRM chimeric protein; transcriptional regulation, RRM domain, transcr; NMR {Homo sapiens}	Back alignment and structure

>4a8x_A RNA-binding protein with serine-rich domain 1; transcription, splicing, RNA processing, nonsense mediated D NMD, HDAC, histone deacetylation; 1.90A {Homo sapiens}	Back alignment and structure

>1x5s_A Cold-inducible RNA-binding protein; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1	Back alignment and structure

>2xnq_A Nuclear polyadenylated RNA-binding protein 3; transcription termination, RNA processi recognition, RRM; HET: CAF; 1.30A {Saccharomyces cerevisiae} PDB: 2xnr_A 2l41_A	Back alignment and structure

>2dgp_A Bruno-like 4, RNA binding protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dgq_A	Back alignment and structure

>2d9p_A Polyadenylate-binding protein 3; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}	Back alignment and structure

>2dgo_A Cytotoxic granule-associated RNA binding protein 1; RRM domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2rne_A 2dh7_A	Back alignment and structure

>2cph_A RNA binding motif protein 19; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1	Back alignment and structure

>2cpf_A RNA binding motif protein 19; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1	Back alignment and structure

>2ywk_A Putative RNA-binding protein 11; RRM-domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; 1.54A {Homo sapiens}	Back alignment and structure

>3ex7_B RNA-binding protein 8A; protein-RNA complex, mRNA processing, mRNA splicing, mRNA transport, nonsense-mediated mRNA decay, nucleus; HET: ADP; 2.30A {Homo sapiens} PDB: 2j0q_D*	Back alignment and structure

>2dnp_A RNA-binding protein 14; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}	Back alignment and structure

>1x5u_A Splicing factor 3B subunit 4 (spliceosome associated protein 49) (SAP 49) (SF3B50)...; structure genomics,RRM domain,splicing factor 3B; NMR {Homo sapiens} SCOP: d.58.7.1	Back alignment and structure

>1p1t_A Cleavage stimulation factor, 64 kDa subunit; RNA recognition motif, C-terminal helix, N-terminal helix, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1	Back alignment and structure

>2dnm_A SRP46 splicing factor; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}	Back alignment and structure

>2ek1_A RNA-binding protein 12; RNA recognition motif, dimer, structural genomics, NPPSFA, national project on protein structural and functional analyses; 2.00A {Homo sapiens} PDB: 2ek6_A	Back alignment and structure

>2do4_A Squamous cell carcinoma antigen recognized by T- cells 3; RRM domaim, RDB, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>2dgs_A DAZ-associated protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}	Back alignment and structure

>1x4c_A Splicing factor, arginine/serine-rich 1; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1	Back alignment and structure

>2cpz_A CUG triplet repeat RNA-binding protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 2rq4_A 2rqc_A	Back alignment and structure

>3md1_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RBD, RNP, poly(U) binding, nucleus, RNA-binding, binding protein; 1.60A {Saccharomyces cerevisiae} SCOP: d.58.7.0	Back alignment and structure

>1p27_B RNA-binding protein 8A; nuclear protein, mRNA splicing; 2.00A {Homo sapiens} SCOP: d.58.7.1	Back alignment and structure

>2krb_A Eukaryotic translation initiation factor 3 subunit B; EIF3, eukaryotic initiation factor, EIF3B, EIF3J; NMR {Homo sapiens}	Back alignment and structure

>1wf1_A RNA-binding protein RALY; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wf2_A	Back alignment and structure

>2la6_A RNA-binding protein FUS; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, RNA recognition; NMR {Homo sapiens}	Back alignment and structure

>1oo0_B CG8781-PA, drosophila Y14; RNA recognition motif, splicing, protein complex, EXON junct complex, signaling protein; 1.85A {Drosophila melanogaster} SCOP: d.58.7.1 PDB: 2hyi_B* 2j0s_D* 2xb2_D*	Back alignment and structure

>2cq2_A Hypothetical protein LOC91801; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1	Back alignment and structure

>1nu4_A U1A RNA binding domain; RNA recognition motif, U1 small nuclear ribonucleoprotein, R binding domain, RNA binding protein; HET: MLA; 1.80A {Homo sapiens} SCOP: d.58.7.1 PDB: 1drz_A* 1urn_A 3hhn_B* 3egz_A* 1zzn_A* 1u6b_A* 3cun_A* 3cul_A* 3g8s_A* 3g8t_A* 3g96_A* 3g9c_A* 3irw_P* 3mum_P* 3mur_P* 3mut_P* 3muv_P* 3mxh_P* 3p49_B 3r1h_A* ...	Back alignment and structure

>2dnh_A Bruno-like 5, RNA binding protein; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dnk_A 2dno_A	Back alignment and structure

>2lxi_A RNA-binding protein 10; NMR {Homo sapiens}	Back alignment and structure

>1wg1_A KIAA1579 protein, homolog EXC-7; RBD, structural genomics, riken structural genomics/proteomics initiative, RSGI, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wi6_A	Back alignment and structure

>2cpd_A Apobec-1 stimulating protein; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1	Back alignment and structure

>2hzc_A Splicing factor U2AF 65 kDa subunit; RNA splicing, RRM, RNA recognition, alternative conformation binding protein; HET: P6G; 1.47A {Homo sapiens} PDB: 1u2f_A	Back alignment and structure

>2cq1_A PTB-like protein L; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1	Back alignment and structure

>2dnl_A Cytoplasmic polyadenylation element binding protein 3; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>1whx_A Hypothetical protein riken cDNA 1200009A02; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1	Back alignment and structure

>4fxv_A ELAV-like protein 1; RNA recognition motif, putative RNA-binding domain, transcri structural genomics, joint center for structural genomics; 1.90A {Homo sapiens}	Back alignment and structure

>2ad9_A Polypyrimidine tract-binding protein 1; RBD, RRM, protein-RNA complex, RNA binding protein/RNA complex; NMR {Homo sapiens} SCOP: d.58.7.1	Back alignment and structure

>1x4f_A Matrin 3; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1	Back alignment and structure

>4f25_A Polyadenylate-binding protein 1; RRM fold, translation initiation, RNA-binding, EIF4G-binding translation; 1.90A {Homo sapiens} PDB: 4f26_A 2k8g_A	Back alignment and structure

>2cpi_A CCR4-NOT transcription complex subunit 4; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1	Back alignment and structure

>2hvz_A Splicing factor, arginine/serine-rich 7; RRM, RNA binding protein; NMR {Homo sapiens}	Back alignment and structure

>2ytc_A PRE-mRNA-splicing factor RBM22; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}	Back alignment and structure

>1x4h_A RNA-binding protein 28; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1	Back alignment and structure

>2dis_A Unnamed protein product; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1	Back alignment and structure

>2err_A Ataxin-2-binding protein 1; protein-RNA complex, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1	Back alignment and structure

>2cqp_A RNA-binding protein 12; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1	Back alignment and structure

>3ulh_A THO complex subunit 4; nuclear protein, RNA binding, structural genomi center for structural genomics, JCSG, protein structure INI PSI-biology; 2.54A {Homo sapiens} PDB: 1no8_A	Back alignment and structure

>1ufw_A Synaptojanin 2; RNP domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1	Back alignment and structure

>2lkz_A RNA-binding protein 5; RRM; NMR {Homo sapiens}	Back alignment and structure

>2dgx_A KIAA0430 protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1	Back alignment and structure

>1fjc_A Nucleolin RBD2, protein C23; RNP, RRM, RNA binding domain, nucleolus, structural protein; NMR {Mesocricetus auratus} SCOP: d.58.7.1	Back alignment and structure

>2e44_A Insulin-like growth factor 2 mRNA binding protein 3; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>2khc_A Testis-specific RNP-type RNA binding protein; RRM, RNA recognition motif, bruno; NMR {Drosophila melanogaster}	Back alignment and structure

>2fy1_A RNA-binding motif protein, Y chromosome, family 1 member A1; RNA binding protein, structure, protein-RNA complex, RNA stem-loop, structural protein/RNA complex; NMR {Homo sapiens}	Back alignment and structure

>3s8s_A Histone-lysine N-methyltransferase SETD1A; chromatin modification, transcription regulation, structural genomics, structural genomics consortium; 1.30A {Homo sapiens}	Back alignment and structure

>1x4g_A Nucleolysin TIAR; structural genomics, RRM domain, TIA-1 related protein, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1	Back alignment and structure

>2kt5_A RNA and export factor-binding protein 2; chaperone, mRNA processing, mRNA splicing, transport, nucleus, RNA-binding, spliceosome, transport; NMR {Mus musculus}	Back alignment and structure

>2cqd_A RNA-binding region containing protein 1; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1	Back alignment and structure

>2dhg_A TRNA selenocysteine associated protein (SECP43); RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>1fj7_A Nucleolin RBD1, protein C23; RNP, RRM, RNA binding domain, nucleolus, structural protein; NMR {Mesocricetus auratus} SCOP: d.58.7.1	Back alignment and structure

>1sjq_A Polypyrimidine tract-binding protein 1; babbab motif, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1	Back alignment and structure

>2kxn_B Transformer-2 protein homolog beta; SR protein, RRM, splicing factor, RNA protein complex, SMN, binding protein-RNA complex; NMR {Homo sapiens} PDB: 2rra_A 2rrb_A	Back alignment and structure

>3beg_B Splicing factor, arginine/serine-rich 1; kinase, SR protein kinase, SR protein, PRE-mRNA splicing, at binding, chromosome partition; HET: SEP ANP; 2.90A {Homo sapiens} SCOP: d.58.7.1 PDB: 2o3d_A 1wg4_A	Back alignment and structure

>2jrs_A RNA-binding protein 39; RNA binding motif of RBM39_human (caper), RRM2 domain, solution structure, structural genomics, PSI-2; NMR {Homo sapiens}	Back alignment and structure

>3ucg_A Polyadenylate-binding protein 2; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG, protein structure initiative; HET: PGE; 1.95A {Homo sapiens} PDB: 3b4d_A 3b4m_A	Back alignment and structure

>1wi8_A EIF-4B, eukaryotic translation initiation factor 4B; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Homo sapiens} SCOP: d.58.7.1	Back alignment and structure

>2jvr_A Nucleolar protein 3; RNA recognition motif, nucleus, phosphorylation, ribonucleoprotein, ribosome biogenesis, RNA-binding; NMR {Saccharomyces cerevisiae} PDB: 2osr_A	Back alignment and structure

>2e5g_A U6 snRNA-specific terminal uridylyltransferase 1; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>2cq4_A RNA binding motif protein 23; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1	Back alignment and structure

>1u6f_A Tcubp1, RNA-binding protein UBP1; trypanosome, mRNA-binding protein, GU-rich RNA, structure; NMR {Trypanosoma cruzi} SCOP: d.58.7.1	Back alignment and structure

>1uaw_A Mouse-musashi-1; RNP-type structure, RNA binding protein; NMR {Mus musculus} SCOP: d.58.7.1	Back alignment and structure

>3p5t_L Cleavage and polyadenylation specificity factor S; RRM domain, poly(A) site recognition, RNA, nuclear, RNA BIND protein; 2.70A {Homo sapiens} PDB: 3p6y_C	Back alignment and structure

>3ns6_A Eukaryotic translation initiation factor 3 subuni; 1.25A {Saccharomyces cerevisiae} PDB: 3ns5_A	Back alignment and structure

>2hgn_A Heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kg1_A	Back alignment and structure

>2mss_A Protein (musashi1); RNA-binding domain, RNA binding protein; NMR {Mus musculus} SCOP: d.58.7.1 PDB: 2mst_A	Back alignment and structure

>2nlw_A Eukaryotic translation initiation factor 3 subunit 9; eukaryotic initiation factor 3 complex, RNA recognition motif; NMR {Homo sapiens}	Back alignment and structure

>1x5o_A RNA binding motif, single-stranded interacting protein 1; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1	Back alignment and structure

>2dh8_A DAZ-associated protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}	Back alignment and structure

>2db1_A Heterogeneous nuclear ribonucleoprotein F; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus}	Back alignment and structure

>2j76_E EIF-4B, EIF4B, eukaryotic translation initiation factor 4B; protein biosynthesis, RNA recognition motif, RNA binding domain, RRM, RBD, RNP; NMR {Homo sapiens}	Back alignment and structure

>1h2v_Z 20 kDa nuclear CAP binding protein; CAP-binding-complex, RNP domain, MIF4G domain, RNA maturation, RNA export, nuclear protein, RNA-binding; 2.0A {Homo sapiens} SCOP: d.58.7.1 PDB: 1h2u_X* 1h2t_Z 1n52_B* 1n54_B 3fex_B 3fey_B 1h6k_X	Back alignment and structure

>2fc8_A NCL protein; structure genomics, RRM_1 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}	Back alignment and structure

>2cqg_A TDP-43, TAR DNA-binding protein-43; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1	Back alignment and structure

>1s79_A Lupus LA protein; RRM, alpha/beta, RNA binding protein, translation; NMR {Homo sapiens} SCOP: d.58.7.1	Back alignment and structure

>3egn_A RNA-binding protein 40; RNA recognition motif (RRM), RNP motif, U11/U12-65K protein, DI-snRNP, U1A protein, U2B protein; 2.50A {Homo sapiens}	Back alignment and structure

>2z73_A Rhodopsin; visual pigment, GQ-type, G-protein coupled receptor, chromophore, glycoprotein, lipoprotein, membrane, palmitate phosphorylation; HET: BOG RET PLM TWT PC1; 2.50A {Todarodes pacificus} PDB: 3aym_A* 3ayn_A* 2ziy_A*	Back alignment and structure

>2jwn_A Embryonic polyadenylate-binding protein 2-B; epabp2, poly(A) binding, structural genomics, protein structure initiative, PSI-2; NMR {Xenopus laevis}	Back alignment and structure

>2a3j_A U1 small nuclear ribonucleoprotein A; computationally designed protein, RRM, U1A, RNA binding protein; NMR {Homo sapiens}	Back alignment and structure

>2rs2_A Musashi-1, RNA-binding protein musashi homolog 1; protein-RNA complex, RRM, RBD, RNA binding protein- complex; NMR {Mus musculus}	Back alignment and structure

>2m2b_A RNA-binding protein 10; T-cell, JCSG, MPP, PSI-biology; NMR {Homo sapiens}	Back alignment and structure

>2dng_A Eukaryotic translation initiation factor 4H; RRM domain, RBD, structural genomics, NPPSFA; NMR {Mus musculus}	Back alignment and structure

>2lmi_A GRSF-1, G-rich sequence factor 1; G-rich RNA sequence binding factor, RNA binding domain, STRU genomics, joint center for structural genomics, JCSG; NMR {Homo sapiens}	Back alignment and structure

>3n9u_C Cleavage and polyadenylation specificity factor S; protein-protein complex, coexpression, heterotetramer, mRNA maturation, mRNA cleavage; 1.92A {Homo sapiens}	Back alignment and structure

>2f3j_A RNA and export factor binding protein 2; RRM domain, RBD domain., transport protein; NMR {Mus musculus}	Back alignment and structure

>3s7r_A Heterogeneous nuclear ribonucleoprotein A/B; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG; 2.15A {Homo sapiens} PDB: 1hd0_A 1hd1_A	Back alignment and structure

>2cpy_A RNA-binding protein 12; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1	Back alignment and structure

>3tht_A Alkylated DNA repair protein ALKB homolog 8; structural genomics, PSI-biology, northeast structural genom consortium, NESG; HET: AKG; 3.01A {Homo sapiens} PDB: 3thp_A*	Back alignment and structure

>2wbr_A GW182, gawky, LD47780P; DNA-binding protein, RRM, RBD, TNRC6A, mirnas, P-bodies, argonaute, mRNA decay; NMR {Drosophila melanogaster}	Back alignment and structure

>2dgw_A Probable RNA-binding protein 19; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}	Back alignment and structure

>1wf0_A TDP-43, TAR DNA-binding protein-43; structural genomics, RRM domain, riken structural genomics/proteomics initiative RSGI, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1	Back alignment and structure

>1x4b_A Heterogeneous nuclear ribonucleoproteins A2/B1; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1	Back alignment and structure

>3u1l_A PRE-mRNA-splicing factor CWC2; CSMP, zinc finger; 1.64A {Saccharomyces cerevisiae} PDB: 3u1m_A 3tp2_A	Back alignment and structure

>2ki2_A SS-DNA binding protein 12RNP2; HP0827, RRM, SS-DNA binding proteins, RNA binding protein/SS-DNA binding protein complex; NMR {Helicobacter pylori}	Back alignment and structure

>1sjr_A Polypyrimidine tract-binding protein 1; extended babbab motif, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 2adb_A	Back alignment and structure

>1wel_A RNA-binding protein 12; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1	Back alignment and structure

>1wg5_A Heterogeneous nuclear ribonucleoprotein H; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1	Back alignment and structure

>1x5p_A Negative elongation factor E; structure genomics, RRM domain, PARP14, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1	Back alignment and structure

>2lcw_A RNA-binding protein FUS; RRM, nucleic acid binding protein; NMR {Homo sapiens}	Back alignment and structure

>2xs2_A Deleted in azoospermia-like; RNA binding protein-RNA complex; 1.35A {Mus musculus} PDB: 2xs7_A 2xs5_A 2xsf_A	Back alignment and structure

>3zzy_A Polypyrimidine tract-binding protein 1; protein binding, peptide binding, RNA recognition motif; 1.40A {Homo sapiens} PDB: 3zzz_A	Back alignment and structure

>1iqt_A AUF1, heterogeneous nuclear ribonucleoprotein D0; RNA-binding protein, hnRNP, telomere, DNA-binding protein, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wtb_A 1x0f_A	Back alignment and structure

>2e5i_A Heterogeneous nuclear ribonucleoprotein L-like; RRM domain, RBD, structural genomics, NPPSFA; NMR {Mus musculus}	Back alignment and structure

>3d2w_A TAR DNA-binding protein 43; DP-43 proteinopathy, TDP-43 inclusions, RNA recognition MOTI U, ALS, RRM; HET: DNA; 1.65A {Mus musculus}	Back alignment and structure

>1wez_A HnRNP H', FTP-3, heterogeneous nuclear ribonucleoprotein H'; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1	Back alignment and structure

>3q2s_C Cleavage and polyadenylation specificity factor S; CFIM, CFIM25, CFIM68, CPSF5, CPSF6, CPSF, 3' END processing, processing, cleavage factor; 2.90A {Homo sapiens} PDB: 3q2t_C	Back alignment and structure

>2dit_A HIV TAT specific factor 1 variant; structural genomics, RRM_1 domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1	Back alignment and structure

>1wey_A Calcipressin 1; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI, RNA binding protein; NMR {Mus musculus} SCOP: d.58.7.1	Back alignment and structure

>2hgm_A HNRPF protein, heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kg0_A	Back alignment and structure

>2diu_A KIAA0430 protein; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}	Back alignment and structure

>2dha_A FLJ20171 protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}	Back alignment and structure

>2dnn_A RNA-binding protein 12; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}	Back alignment and structure

>2pe8_A Splicing factor 45; RRM, protein binding; 2.00A {Homo sapiens} PDB: 2peh_A	Back alignment and structure

>2voo_A Lupus LA protein; RNA-binding protein, RNA recognition motif, systemic lupus erythematosus, phosphoprotein, RNA maturation; 1.8A {Homo sapiens} SCOP: a.4.5.46 d.58.7.1 PDB: 2von_A 2vod_A 2vop_A 1zh5_A 1yty_A 1s7a_A	Back alignment and structure

>1uw4_A UPF3X; nonsense mediated mRNA decay protein, RNA-binding protein, N domain, MIF4G domain; 1.95A {Homo sapiens} SCOP: d.58.7.4	Back alignment and structure

>2l9w_A U4/U6 snRNA-associated-splicing factor PRP24; RRM, U6 snRNP, RNA binding protein; NMR {Saccharomyces cerevisiae}	Back alignment and structure

>3s6e_A RNA-binding protein 39; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG, protein structure initiative, PSI-biology; HET: MSE CIT; 0.95A {Mus musculus} PDB: 2lq5_A	Back alignment and structure

>3pq1_A Poly(A) RNA polymerase; nucleotidyl transferase, RNP-type RNA binding domain, poly(A polymerase, mitochondria, transferase; 3.10A {Homo sapiens}	Back alignment and structure

>3v4m_A Splicing factor U2AF 65 kDa subunit; canonical RNA binding protein, RNA splicing, structural GENO joint center for structural genomics, JCSG; HET: MSE; 1.80A {Mus musculus} PDB: 1o0p_A 1opi_A	Back alignment and structure

>3ue2_A Poly(U)-binding-splicing factor PUF60; RNA recognition motif, RRM, RNA binding domain, ST genomics, joint center for structural genomics, JCSG; HET: MSE; 1.23A {Homo sapiens} SCOP: d.58.7.0 PDB: 3us5_A 2dny_A	Back alignment and structure

>3u0r_A Apoptosis inhibitor 5; heat repeat, armadillo repeat, lysine acetylation; 2.50A {Homo sapiens} PDB: 3v6a_A	Back alignment and structure

>1owx_A Lupus LA protein, SS-B, LA; RRM, transcription; NMR {Homo sapiens} SCOP: d.58.7.1	Back alignment and structure

>1wwh_A Nucleoporin 35, nucleoporin; structural genomics, MPPN, riken structural genomics/proteomics initiative, RSGI, protein transport; 2.70A {Mus musculus} SCOP: d.58.7.1	Back alignment and structure

>2dhx_A Poly (ADP-ribose) polymerase family, member 10 variant; RRM domain, RNA- binding, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>2l08_A Regulator of nonsense transcripts 3A; NESG, nonsense regulator, structural genomics, PSI-2, protei structure initiative; NMR {Homo sapiens}	Back alignment and structure

>1jmt_A Splicing factor U2AF 35 kDa subunit; RRM, RNA splicing, proline, PPII helix, peptide recognition, RNA binding protein; 2.20A {Homo sapiens} SCOP: d.58.7.3	Back alignment and structure

>1whv_A Poly(A)-specific ribonuclease; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, PARN, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 PDB: 2rok_A*	Back alignment and structure

>3ctr_A Poly(A)-specific ribonuclease PARN; protein-RNA-complex, M7G-CAP, M7GTP, RNA recognition motif, RRM, cytoplasm, exonuclease, hydrolase, magnesium; HET: MGP; 2.10A {Homo sapiens}	Back alignment and structure

>2d9o_A DNAJ (HSP40) homolog, subfamily C, member 17; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>3d45_A Poly(A)-specific ribonuclease PARN; CAP analogue, exonuclease, hydrolase, magnesium, metal nonsense-mediated mRNA decay, nucleus; HET: 7MG GDP; 3.00A {Mus musculus}	Back alignment and structure

>3h0g_A DNA-directed RNA polymerase II subunit RPB1; transcription, multi-protein complex, DNA- binding, magnesium; 3.65A {Schizosaccharomyces pombe}	Back alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST

Original result of RPS-BLAST against SCOP70(version1.75) database

ID	Alignment Graph	Length	Definition	E-value
Query		1100
d2f9da1		114	d.58.7.1 (A:12-125) Pre-mRNA branch site protein p	3e-04
d1x4aa1		95	d.58.7.1 (A:9-103) Splicing factor, arginine/serin	3e-04
d2disa1		96	d.58.7.1 (A:8-103) Hypothetical protein FLJ20273 {	4e-04
d2cpja1		86	d.58.7.1 (A:65-150) Non-POU domain-containing octa	8e-04
d2cpja1		86	d.58.7.1 (A:65-150) Non-POU domain-containing octa	0.004
d1p1ta_		104	d.58.7.1 (A:) Cleavage stimulation factor, 64 kda	0.003
d2adba1		108	d.58.7.1 (A:177-284) Polypyrimidine tract-binding	0.004
d2cqha1		80	d.58.7.1 (A:2-81) IGF-II mRNA-binding protein 2 is	0.004

>d2f9da1 d.58.7.1 (A:12-125) Pre-mRNA branch site protein p14 {Human (Homo sapiens) [TaxId: 9606]} Length = 114	Back information, alignment and structure


class: Alpha and beta proteins (a+b)
fold: Ferredoxin-like
superfamily: RNA-binding domain, RBD
family: Canonical RBD
domain: Pre-mRNA branch site protein p14
species: Human (Homo sapiens) [TaxId: 9606]

 Score = 39.2 bits (91), Expect = 3e-04
 Identities = 11/64 (17%), Positives = 27/64 (42%), Gaps = 3/64 (4%)

Query: 569 ASKQLWLGSFGPEASEAHIRFQIDRFGPLEHFFFFPI---KGFALVEYINIIDAIRAREY 625
            ++ L++ +   + +   +     ++GP+           +G A V Y +I DA  A ++
Sbjct: 6   VNRILYIRNLPYKITAEEMYDIFGKYGPIRQIRVGNTPETRGTAYVVYEDIFDAKNACDH 65

Query: 626 IRNH 629
           +   
Sbjct: 66  LSGF 69

PyMOL of d2f9da1

>d1x4aa1 d.58.7.1 (A:9-103) Splicing factor, arginine/serine-rich 1, SFRS1 {Human (Homo sapiens) [TaxId: 9606]} Length = 95	Back information, alignment and structure

>d2disa1 d.58.7.1 (A:8-103) Hypothetical protein FLJ20273 {Human (Homo sapiens) [TaxId: 9606]} Length = 96	Back information, alignment and structure

>d2cpja1 d.58.7.1 (A:65-150) Non-POU domain-containing octamer-binding protein, NonO {Mouse (Mus musculus) [TaxId: 10090]} Length = 86	Back information, alignment and structure

>d2cpja1 d.58.7.1 (A:65-150) Non-POU domain-containing octamer-binding protein, NonO {Mouse (Mus musculus) [TaxId: 10090]} Length = 86	Back information, alignment and structure

>d1p1ta_ d.58.7.1 (A:) Cleavage stimulation factor, 64 kda subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 104	Back information, alignment and structure

>d2adba1 d.58.7.1 (A:177-284) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 108	Back information, alignment and structure

>d2cqha1 d.58.7.1 (A:2-81) IGF-II mRNA-binding protein 2 isoform A {Human (Homo sapiens) [TaxId: 9606]} Length = 80	Back information, alignment and structure

Homologous Domains Detected by HHsearch

Original result of HHsearch against SCOP70(version1.75) database

ID	Alignment Graph	Length	Definition	Probability
Query		1100
d1u1qa_		183	Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human	99.72
d2adca2		88	Polypyrimidine tract-binding protein {Human (Homo	99.6
d1whya_		97	Putative RNA-binding protein 15B, Rbm15b {Mouse (M	99.58
d2cpda1		86	APOBEC1 stimulating protein {Human (Homo sapiens)	99.57
d2b0ga1		83	Splicesomal U1A protein {Drosophila melanogaster [	99.54
d1b7fa1		82	Sex-lethal protein {Drosophila melanogaster [TaxId	99.54
d1wexa_		104	Heterogeneous nuclear ribonucleoprotein L-like {Mo	99.53
d1x4ga1		96	Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 960	99.52
d2cpja1		86	Non-POU domain-containing octamer-binding protein,	99.51
d1h2vz_		93	CBP20, 20KDa nuclear cap-binding protein {Human (H	99.5
d1fxla1		82	Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9	99.49
d2cq1a1		88	Polypyrimidine tract-binding protein 2, PTBP2 {Hum	99.48
d2cqha1		80	IGF-II mRNA-binding protein 2 isoform A {Human (Ho	99.48
d1whxa_		111	Probable RNA-binding protein 19, Rbm19 {Mouse (Mus	99.47
d2bz2a1		79	Negative elongation factor E, NELF-E {Human (Homo	99.47
d2f9da1		114	Pre-mRNA branch site protein p14 {Human (Homo sapi	99.47
d2cqba1		89	Peptidyl-prolyl cis-trans isomerase E, N-terminal	99.47
d1fjca_		96	Nucleolin {Golden hamster (Mesocricetus auratus) [	99.47
d2cqia1		90	Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 960	99.46
d2ghpa1		81	U4/U6 snRNA-associated-splicing factor PRP24 {Bake	99.45
d1x4aa1		95	Splicing factor, arginine/serine-rich 1, SFRS1 {Hu	99.45
d1wg1a_		88	Probable RNA-binding protein KIAA1579 {Human (Homo	99.45
d2adba1		108	Polypyrimidine tract-binding protein {Human (Homo	99.45
d2adca1		109	Polypyrimidine tract-binding protein {Human (Homo	99.45
d2cq0a1		90	Eukaryotic translation initiation factor 3 subunit	99.43
d1u6fa1		139	RNA-binding protein UBP1 {Trypanosoma cruzi [TaxId	99.43
d1fxla2		85	Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9	99.43
d1cvja1		80	Poly(A)-binding protein {Human (Homo sapiens) [Tax	99.43
d1wf2a_		98	Heterogeneous nuclear ribonucleoproteins C1/C2 {Hu	99.43
d1no8a_		78	Nuclear factor Aly {Mouse (Mus musculus) [TaxId: 1	99.42
d1x5sa1		90	Cold-inducible RNA-binding protein {Human (Homo sa	99.42
d1cvja2		89	Poly(A)-binding protein {Human (Homo sapiens) [Tax	99.42
d2cpza1		102	CUG triplet repeat RNA-binding protein 1 {Human (H	99.42
d2cpha1		94	Probable RNA-binding protein 19, Rbm19 {Mouse (Mus	99.42
d2cq2a1		101	Alkylation repair AlkB homolog 8, ALKBH8 {Human (H	99.42
d2cpfa1		85	Probable RNA-binding protein 19, Rbm19 {Mouse (Mus	99.41
d2u2fa_		85	Splicing factor U2AF 65 KDa subunit {Human (Homo s	99.41
d1rk8a_		88	RNA-binding protein 8 {Fruit fly (Drosophila melan	99.41
d2cq3a1		93	RNA-binding protein 9 {Human (Homo sapiens) [TaxId	99.4
d1x5ua1		93	Splicing factor 3B subunit 4 {Human (Homo sapiens)	99.4
d1nu4a_		91	Splicesomal U1A protein {Human (Homo sapiens) [Tax	99.39
d1whwa_		99	Probable RNA-binding protein 19, Rbm19 {Mouse (Mus	99.38
d1x4da1		89	Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]}	99.38
d1weya_		104	Calcipressin-1 {Mouse (Mus musculus) [TaxId: 10090	99.37
d2cqca1		83	Arginine/serine-rich splicing factor 10 {Human (Ho	99.37
d1b7fa2		85	Sex-lethal protein {Drosophila melanogaster [TaxId	99.36
d3begb1		87	Splicing factor, arginine/serine-rich 1, SFRS1 {Hu	99.36
d1wf0a_		88	TAR DNA-binding protein 43, TDP-43 {Human (Homo sa	99.34
d2cpxa1		102	RNA-binding protein 41, RBM41 {Human (Homo sapiens	99.34
d1wi6a1		75	Ribonucleoprotein PTB-binding 1, Raver-1 {Mouse (M	99.34
d1x4fa1		99	Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]}	99.33
d1wg4a_		98	Splicing factor, arginine/serine-rich 9 (SFRS9) {M	99.33
d1x5ta1		83	Splicing factor 3B subunit 4 {Human (Homo sapiens)	99.32
d2disa1		96	Hypothetical protein FLJ20273 {Human (Homo sapiens	99.32
d1x5oa1		101	RNA-binding motif, single-stranded-interacting pro	99.31
d1p1ta_		104	Cleavage stimulation factor, 64 kda subunit {Human	99.31
d2ghpa3		86	U4/U6 snRNA-associated-splicing factor PRP24 {Bake	99.3
d1x4ha1		98	RNA-binding protein 28 {Mouse (Mus musculus) [TaxI	99.3
d1uawa_		77	Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]}	99.28
d2cqda1		103	RNA-binding region containing protein 1 {Human (Ho	99.28
d2msta_		75	Neural RNA-binding protein Musashi-1 {Mouse (Mus m	99.28
d1x4ea1		72	RNA-binding motif, single-stranded-interacting pro	99.27
d2cpia1		89	E3 ubiquitin protein ligase CNOT4 {Mouse (Mus musc	99.27
d1l3ka2		79	Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human	99.26
d2cqga1		90	TAR DNA-binding protein 43, TDP-43 {Human (Homo sa	99.26
d2cq4a1		101	RNA binding protein 23 {Human (Homo sapiens) [TaxI	99.25
d1fjeb1		91	Nucleolin {Golden hamster (Mesocricetus auratus) [	99.25
d2cpea1		101	RNA-binding protein EWS {Human (Homo sapiens) [Tax	99.24
d1x4ba1		103	Heterogeneous nuclear ribonucleoproteins A2/B1 {Hu	99.24
d1hd0a_		75	Heterogeneous nuclear ribonucleoprotein d0 {Human	99.23
d1zh5a2		85	Lupus LA protein {Human (Homo sapiens) [TaxId: 960	99.22
d1l3ka1		84	Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human	99.21
d1x0fa1		75	Nuclear ribonucleoprotein D0 (AUF1) {Human (Homo s	99.18
d1wi8a_		104	Eukaryotic translation initiation factor 4B {Human	99.17
d1u2fa_		90	Splicing factor U2AF 65 KDa subunit {Human (Homo s	99.13
d1owxa_		113	Lupus LA protein {Human (Homo sapiens) [TaxId: 960	99.12
d2ghpa2		75	U4/U6 snRNA-associated-splicing factor PRP24 {Bake	99.12
d2cqpa1		86	RNA-binding protein 12 {Mouse (Mus musculus) [TaxI	99.11
d2cpya1		103	RNA-binding protein 12 {Human (Homo sapiens) [TaxI	99.02
d1weza_		102	Heterogeneous nuclear ribonucleoprotein H' {Human	99.01
d1wg5a_		104	Heterogeneous nuclear ribonucleoprotein H' {Human	98.95
d1u1qa_		183	Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human	98.92
U2AF35 (35 KDa subunit) {Human (Homo sapiens) [TaxId: 9606]}" target="_blank" href="http://scop.mrc-lmb.cam.ac.uk/scop/search.cgi?sid=d1jmta_">d1jmta_		104	U2	98.88
d1wwha1		81	Nucleoporin 35 {Mouse (Mus musculus) [TaxId: 10090	98.84
d2dita1		99	HIV Tat-specific factor 1 {Human (Homo sapiens) [T	98.83
d1o0pa_		104	Splicing factor U2AF 65 KDa subunit {Human (Homo s	98.81
d1wela1		112	RNA-binding protein 12 {Human (Homo sapiens) [TaxI	98.8
d2adca2		88	Polypyrimidine tract-binding protein {Human (Homo	98.22
d1x4aa1		95	Splicing factor, arginine/serine-rich 1, SFRS1 {Hu	98.13
d2b0ga1		83	Splicesomal U1A protein {Drosophila melanogaster [	98.03
d1whya_		97	Putative RNA-binding protein 15B, Rbm15b {Mouse (M	98.0
d2cq1a1		88	Polypyrimidine tract-binding protein 2, PTBP2 {Hum	97.94
d1wexa_		104	Heterogeneous nuclear ribonucleoprotein L-like {Mo	97.89
d1b7fa1		82	Sex-lethal protein {Drosophila melanogaster [TaxId	97.89
d2f9da1		114	Pre-mRNA branch site protein p14 {Human (Homo sapi	97.82
d2cqba1		89	Peptidyl-prolyl cis-trans isomerase E, N-terminal	97.79
d2cpda1		86	APOBEC1 stimulating protein {Human (Homo sapiens)	97.77
d2adba1		108	Polypyrimidine tract-binding protein {Human (Homo	97.75
d2ghpa1		81	U4/U6 snRNA-associated-splicing factor PRP24 {Bake	97.74
d1fxla1		82	Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9	97.73
d1wg1a_		88	Probable RNA-binding protein KIAA1579 {Human (Homo	97.73
d1x4ga1		96	Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 960	97.71
d2cqia1		90	Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 960	97.71
d2cqca1		83	Arginine/serine-rich splicing factor 10 {Human (Ho	97.71
d2cqha1		80	IGF-II mRNA-binding protein 2 isoform A {Human (Ho	97.69
d2cpja1		86	Non-POU domain-containing octamer-binding protein,	97.69
d1fxla2		85	Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9	97.68
d1whwa_		99	Probable RNA-binding protein 19, Rbm19 {Mouse (Mus	97.67
d1h2vz_		93	CBP20, 20KDa nuclear cap-binding protein {Human (H	97.67
d1nu4a_		91	Splicesomal U1A protein {Human (Homo sapiens) [Tax	97.67
d1x5sa1		90	Cold-inducible RNA-binding protein {Human (Homo sa	97.66
d1wg4a_		98	Splicing factor, arginine/serine-rich 9 (SFRS9) {M	97.66
d1whxa_		111	Probable RNA-binding protein 19, Rbm19 {Mouse (Mus	97.66
d2cpza1		102	CUG triplet repeat RNA-binding protein 1 {Human (H	97.65
d2disa1		96	Hypothetical protein FLJ20273 {Human (Homo sapiens	97.65
d1fjca_		96	Nucleolin {Golden hamster (Mesocricetus auratus) [	97.65
d1x4da1		89	Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]}	97.65
d2u2fa_		85	Splicing factor U2AF 65 KDa subunit {Human (Homo s	97.6
d2cpxa1		102	RNA-binding protein 41, RBM41 {Human (Homo sapiens	97.59
d1fjeb1		91	Nucleolin {Golden hamster (Mesocricetus auratus) [	97.59
d3begb1		87	Splicing factor, arginine/serine-rich 1, SFRS1 {Hu	97.57
d1rk8a_		88	RNA-binding protein 8 {Fruit fly (Drosophila melan	97.56
d1x4ea1		72	RNA-binding motif, single-stranded-interacting pro	97.55
d1x5oa1		101	RNA-binding motif, single-stranded-interacting pro	97.55
d1cvja2		89	Poly(A)-binding protein {Human (Homo sapiens) [Tax	97.53
d2adca1		109	Polypyrimidine tract-binding protein {Human (Homo	97.53
d1x5ua1		93	Splicing factor 3B subunit 4 {Human (Homo sapiens)	97.5
d1no8a_		78	Nuclear factor Aly {Mouse (Mus musculus) [TaxId: 1	97.48
d2cpia1		89	E3 ubiquitin protein ligase CNOT4 {Mouse (Mus musc	97.46
d1p1ta_		104	Cleavage stimulation factor, 64 kda subunit {Human	97.46
d1cvja1		80	Poly(A)-binding protein {Human (Homo sapiens) [Tax	97.46
d2cpha1		94	Probable RNA-binding protein 19, Rbm19 {Mouse (Mus	97.45
d2cq0a1		90	Eukaryotic translation initiation factor 3 subunit	97.45
d2msta_		75	Neural RNA-binding protein Musashi-1 {Mouse (Mus m	97.44
d1x4fa1		99	Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]}	97.44
d1b7fa2		85	Sex-lethal protein {Drosophila melanogaster [TaxId	97.44
d1x4ha1		98	RNA-binding protein 28 {Mouse (Mus musculus) [TaxI	97.42
d2cq2a1		101	Alkylation repair AlkB homolog 8, ALKBH8 {Human (H	97.4
d1x5ta1		83	Splicing factor 3B subunit 4 {Human (Homo sapiens)	97.39
d2cq3a1		93	RNA-binding protein 9 {Human (Homo sapiens) [TaxId	97.39
d2cpfa1		85	Probable RNA-binding protein 19, Rbm19 {Mouse (Mus	97.38
d1weya_		104	Calcipressin-1 {Mouse (Mus musculus) [TaxId: 10090	97.35
d2cpea1		101	RNA-binding protein EWS {Human (Homo sapiens) [Tax	97.35
d2bz2a1		79	Negative elongation factor E, NELF-E {Human (Homo	97.32
d2ghpa3		86	U4/U6 snRNA-associated-splicing factor PRP24 {Bake	97.31
d1wi6a1		75	Ribonucleoprotein PTB-binding 1, Raver-1 {Mouse (M	97.29
d1wi8a_		104	Eukaryotic translation initiation factor 4B {Human	97.28
d1u6fa1		139	RNA-binding protein UBP1 {Trypanosoma cruzi [TaxId	97.28
d2cqpa1		86	RNA-binding protein 12 {Mouse (Mus musculus) [TaxI	97.25
d2cq4a1		101	RNA binding protein 23 {Human (Homo sapiens) [TaxI	97.24
d1uawa_		77	Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]}	97.24
d1wf2a_		98	Heterogeneous nuclear ribonucleoproteins C1/C2 {Hu	97.24
d1wf0a_		88	TAR DNA-binding protein 43, TDP-43 {Human (Homo sa	97.23
d1l3ka1		84	Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human	97.21
d1l3ka2		79	Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human	97.19
d1hd0a_		75	Heterogeneous nuclear ribonucleoprotein d0 {Human	97.11
d2cqda1		103	RNA-binding region containing protein 1 {Human (Ho	97.07
d1zh5a2		85	Lupus LA protein {Human (Homo sapiens) [TaxId: 960	97.01
d2cqga1		90	TAR DNA-binding protein 43, TDP-43 {Human (Homo sa	97.0
d1x0fa1		75	Nuclear ribonucleoprotein D0 (AUF1) {Human (Homo s	96.84
d1u2fa_		90	Splicing factor U2AF 65 KDa subunit {Human (Homo s	96.78
d1x4ba1		103	Heterogeneous nuclear ribonucleoproteins A2/B1 {Hu	96.71
d2ghpa2		75	U4/U6 snRNA-associated-splicing factor PRP24 {Bake	96.66
d1wwha1		81	Nucleoporin 35 {Mouse (Mus musculus) [TaxId: 10090	96.39
d2cpya1		103	RNA-binding protein 12 {Human (Homo sapiens) [TaxI	96.28
d1wela1		112	RNA-binding protein 12 {Human (Homo sapiens) [TaxI	96.24
d1wg5a_		104	Heterogeneous nuclear ribonucleoprotein H' {Human	96.03
d1weza_		102	Heterogeneous nuclear ribonucleoprotein H' {Human	95.94
d1o0pa_		104	Splicing factor U2AF 65 KDa subunit {Human (Homo s	95.37
d2dita1		99	HIV Tat-specific factor 1 {Human (Homo sapiens) [T	95.32
d1owxa_		113	Lupus LA protein {Human (Homo sapiens) [TaxId: 960	95.14
d1uw4a_		91	RNA processing protein UPF3x, RRM domain {Human (H	94.59
U2AF35 (35 KDa subunit) {Human (Homo sapiens) [TaxId: 9606]}" target="_blank" href="http://scop.mrc-lmb.cam.ac.uk/scop/search.cgi?sid=d1jmta_">d1jmta_		104	U2	91.22
d2dgxa1		73	Limkain-b1, LKAP {Human (Homo sapiens) [TaxId: 960	80.33

>d1u1qa_ d.58.7.1 (A:) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: Ferredoxin-like
superfamily: RNA-binding domain, RBD
family: Canonical RBD
domain: Nuclear ribonucleoprotein A1 (RNP A1, UP1)
species: Human (Homo sapiens) [TaxId: 9606]

Probab=99.72  E-value=6.5e-18  Score=161.88  Aligned_cols=145  Identities=14%  Similarity=0.212  Sum_probs=110.6

Q ss_pred             cceEEeccCCCcccHHHHHHHhhccCCcceEEEe------ccCceEEEEecCHHHHHHHHHhhcCCceeE-EEEeeccCC
Q 001325          570 SKQLWLGSFGPEASEAHIRFQIDRFGPLEHFFFF------PIKGFALVEYINIIDAIRAREYIRNHFSWR-VKFMDVGLG  642 (1100)
Q Consensus       570 Sr~LWVGnLg~~vte~dL~~~F~~fGpLe~V~~~------~~rgfAFVeF~~i~DAv~A~~~LqG~~~~R-I~F~r~~~g  642 (1100)
                      .|+||||||++++||+||+++|++||.|+++.+.      ..||||||+|.+.++|.+|++.+.+....+ +...+. ..
T Consensus         6 ~r~lfV~nLp~~~te~~L~~~F~~~G~v~~~~~~~~~~~~~~~g~afv~f~~~~~a~~a~~~~~~~~~~~~~~~~~~-~~   84 (183)
T d1u1qa_           6 LRKLFIGGLSFETTDESLRSHFEQWGTLTDCVVMRDPNTKRSRGFGFVTYATVEEVDAAMNARPHKVDGRVVEPKRA-VS   84 (183)
T ss_dssp             HHEEEEESCCTTCCHHHHHHHHGGGSCEEEEEEEECTTTCCEEEEEEEEESSHHHHHHHHHTCSCEETTEECEEEEC-CC
T ss_pred             CCEEEEECCCCCCCHHHHHHHHHHcCCEEEEEeeecccCCCccCceecccCCHHHHHHHHHhcCCcccccchhhhhh-hh
Confidence            4799999999999999999999999999999974      368999999999999999999877653322 221111 11


Q ss_pred             CCcccccccccccceEEEccCCCcchhHHHHHhhhcccccCCceee-c---CCCCcccccccCCHHHHHHHHHHhhhh
Q 001325          643 TKGVINGVAVGSCFHVYVGNIPNQWAKDEILHESYKVVYKGPYMVT-D---LSCEGALLMEFRTPEEATTAMAHLRQH  716 (1100)
Q Consensus       643 srg~~~Gva~~~Sr~LwVG~Iss~~~kEELfsE~dkag~kgPv~f~-D---lsee~aLLmEF~s~eEA~~Ak~~l~~~  716 (1100)
                      ............++.||||+|+..+++++|...|..+|.+..+.+. +   ...++..+|+|.+.++|.+|+. ++++
T Consensus        85 ~~~~~~~~~~~~~~~i~V~~lp~~~te~~L~~~f~~~G~v~~~~i~~~~~~~~~~g~~fV~f~~~e~A~~Al~-~~~~  161 (183)
T d1u1qa_          85 REDSQRPGAHLTVKKIFVGGIKEDTEEHHLRDYFEQYGKIEVIEIMTDRGSGKKRGFAFVTFDDHDSVDKIVI-QKYH  161 (183)
T ss_dssp             TTGGGSTTTTCCCSEEEEECCCTTCCHHHHHHHHGGGSCEEEEEEEECTTTCCEEEEEEEEESCHHHHHHHHT-SSCE
T ss_pred             cccccccccccccceeEEccCCCcCCHHHHhhhhccCCceeeeeeecccccCccceeEEEEECCHHHHHHHHH-hCCC
Confidence            1111112223468899999999999999999999988766666443 2   3445689999999999999986 3443

PyMOL of d1u1qa_

>d2adca2 d.58.7.1 (A:444-531) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1whya_ d.58.7.1 (A:) Putative RNA-binding protein 15B, Rbm15b {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d2cpda1 d.58.7.1 (A:223-308) APOBEC1 stimulating protein {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2b0ga1 d.58.7.1 (A:1-83) Splicesomal U1A protein {Drosophila melanogaster [TaxId: 7227]}	Back information, alignment and structure

>d1b7fa1 d.58.7.1 (A:123-204) Sex-lethal protein {Drosophila melanogaster [TaxId: 7227]}	Back information, alignment and structure

>d1wexa_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein L-like {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1x4ga1 d.58.7.1 (A:8-103) Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2cpja1 d.58.7.1 (A:65-150) Non-POU domain-containing octamer-binding protein, NonO {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1h2vz_ d.58.7.1 (Z:) CBP20, 20KDa nuclear cap-binding protein {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1fxla1 d.58.7.1 (A:37-118) Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2cq1a1 d.58.7.1 (A:51-138) Polypyrimidine tract-binding protein 2, PTBP2 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2cqha1 d.58.7.1 (A:2-81) IGF-II mRNA-binding protein 2 isoform A {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1whxa_ d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d2bz2a1 d.58.7.1 (A:35-113) Negative elongation factor E, NELF-E {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2f9da1 d.58.7.1 (A:12-125) Pre-mRNA branch site protein p14 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2cqba1 d.58.7.1 (A:1-89) Peptidyl-prolyl cis-trans isomerase E, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1fjca_ d.58.7.1 (A:) Nucleolin {Golden hamster (Mesocricetus auratus) [TaxId: 10036]}	Back information, alignment and structure

>d2cqia1 d.58.7.1 (A:1-90) Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2ghpa1 d.58.7.1 (A:116-196) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1x4aa1 d.58.7.1 (A:9-103) Splicing factor, arginine/serine-rich 1, SFRS1 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1wg1a_ d.58.7.1 (A:) Probable RNA-binding protein KIAA1579 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2adba1 d.58.7.1 (A:177-284) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2adca1 d.58.7.1 (A:335-443) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2cq0a1 d.58.7.1 (A:231-320) Eukaryotic translation initiation factor 3 subunit 4 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1u6fa1 d.58.7.1 (A:1-139) RNA-binding protein UBP1 {Trypanosoma cruzi [TaxId: 5693]}	Back information, alignment and structure

>d1fxla2 d.58.7.1 (A:119-203) Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1cvja1 d.58.7.1 (A:11-90) Poly(A)-binding protein {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1wf2a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoproteins C1/C2 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1no8a_ d.58.7.1 (A:) Nuclear factor Aly {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1x5sa1 d.58.7.1 (A:8-97) Cold-inducible RNA-binding protein {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1cvja2 d.58.7.1 (A:91-179) Poly(A)-binding protein {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2cpza1 d.58.7.1 (A:383-484) CUG triplet repeat RNA-binding protein 1 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2cpha1 d.58.7.1 (A:454-547) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d2cq2a1 d.58.7.1 (A:25-125) Alkylation repair AlkB homolog 8, ALKBH8 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2cpfa1 d.58.7.1 (A:362-446) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d2u2fa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1rk8a_ d.58.7.1 (A:) RNA-binding protein 8 {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}	Back information, alignment and structure

>d2cq3a1 d.58.7.1 (A:110-202) RNA-binding protein 9 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1x5ua1 d.58.7.1 (A:7-99) Splicing factor 3B subunit 4 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1nu4a_ d.58.7.1 (A:) Splicesomal U1A protein {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1whwa_ d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1x4da1 d.58.7.1 (A:8-96) Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1weya_ d.58.7.1 (A:) Calcipressin-1 {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d2cqca1 d.58.7.1 (A:109-191) Arginine/serine-rich splicing factor 10 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1b7fa2 d.58.7.1 (A:205-289) Sex-lethal protein {Drosophila melanogaster [TaxId: 7227]}	Back information, alignment and structure

>d3begb1 d.58.7.1 (B:121-207) Splicing factor, arginine/serine-rich 1, SFRS1 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1wf0a_ d.58.7.1 (A:) TAR DNA-binding protein 43, TDP-43 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2cpxa1 d.58.7.1 (A:291-392) RNA-binding protein 41, RBM41 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1wi6a1 d.58.7.1 (A:69-143) Ribonucleoprotein PTB-binding 1, Raver-1 {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1x4fa1 d.58.7.1 (A:8-106) Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1wg4a_ d.58.7.1 (A:) Splicing factor, arginine/serine-rich 9 (SFRS9) {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1x5ta1 d.58.7.1 (A:8-90) Splicing factor 3B subunit 4 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2disa1 d.58.7.1 (A:8-103) Hypothetical protein FLJ20273 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1x5oa1 d.58.7.1 (A:8-108) RNA-binding motif, single-stranded-interacting protein 1, RBMS1 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1p1ta_ d.58.7.1 (A:) Cleavage stimulation factor, 64 kda subunit {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2ghpa3 d.58.7.1 (A:206-291) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1x4ha1 d.58.7.1 (A:8-105) RNA-binding protein 28 {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1uawa_ d.58.7.1 (A:) Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d2cqda1 d.58.7.1 (A:1-103) RNA-binding region containing protein 1 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2msta_ d.58.7.1 (A:) Neural RNA-binding protein Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1x4ea1 d.58.7.1 (A:8-79) RNA-binding motif, single-stranded-interacting protein 2, RBMS2 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2cpia1 d.58.7.1 (A:101-189) E3 ubiquitin protein ligase CNOT4 {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1l3ka2 d.58.7.1 (A:103-181) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2cqga1 d.58.7.1 (A:96-185) TAR DNA-binding protein 43, TDP-43 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2cq4a1 d.58.7.1 (A:132-232) RNA binding protein 23 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1fjeb1 d.58.7.1 (B:1-91) Nucleolin {Golden hamster (Mesocricetus auratus) [TaxId: 10036]}	Back information, alignment and structure

>d2cpea1 d.58.7.1 (A:353-453) RNA-binding protein EWS {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1x4ba1 d.58.7.1 (A:8-110) Heterogeneous nuclear ribonucleoproteins A2/B1 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1hd0a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein d0 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1zh5a2 d.58.7.1 (A:105-189) Lupus LA protein {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1l3ka1 d.58.7.1 (A:8-91) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1x0fa1 d.58.7.1 (A:183-257) Nuclear ribonucleoprotein D0 (AUF1) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1wi8a_ d.58.7.1 (A:) Eukaryotic translation initiation factor 4B {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1u2fa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1owxa_ d.58.7.1 (A:) Lupus LA protein {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2ghpa2 d.58.7.1 (A:41-115) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d2cqpa1 d.58.7.1 (A:917-1002) RNA-binding protein 12 {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d2cpya1 d.58.7.1 (A:536-638) RNA-binding protein 12 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1weza_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein H' {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1wg5a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein H' {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1u1qa_ d.58.7.1 (A:) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1jmta_ d.58.7.3 (A:) U2AF35 (35 KDa subunit) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1wwha1 d.58.7.1 (A:169-249) Nucleoporin 35 {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d2dita1 d.58.7.1 (A:8-106) HIV Tat-specific factor 1 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1o0pa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1wela1 d.58.7.1 (A:412-523) RNA-binding protein 12 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2adca2 d.58.7.1 (A:444-531) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1x4aa1 d.58.7.1 (A:9-103) Splicing factor, arginine/serine-rich 1, SFRS1 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2b0ga1 d.58.7.1 (A:1-83) Splicesomal U1A protein {Drosophila melanogaster [TaxId: 7227]}	Back information, alignment and structure

>d1whya_ d.58.7.1 (A:) Putative RNA-binding protein 15B, Rbm15b {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d2cq1a1 d.58.7.1 (A:51-138) Polypyrimidine tract-binding protein 2, PTBP2 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1wexa_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein L-like {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1b7fa1 d.58.7.1 (A:123-204) Sex-lethal protein {Drosophila melanogaster [TaxId: 7227]}	Back information, alignment and structure

>d2f9da1 d.58.7.1 (A:12-125) Pre-mRNA branch site protein p14 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2cqba1 d.58.7.1 (A:1-89) Peptidyl-prolyl cis-trans isomerase E, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2cpda1 d.58.7.1 (A:223-308) APOBEC1 stimulating protein {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2adba1 d.58.7.1 (A:177-284) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2ghpa1 d.58.7.1 (A:116-196) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1fxla1 d.58.7.1 (A:37-118) Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1wg1a_ d.58.7.1 (A:) Probable RNA-binding protein KIAA1579 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1x4ga1 d.58.7.1 (A:8-103) Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2cqia1 d.58.7.1 (A:1-90) Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2cqca1 d.58.7.1 (A:109-191) Arginine/serine-rich splicing factor 10 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2cqha1 d.58.7.1 (A:2-81) IGF-II mRNA-binding protein 2 isoform A {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2cpja1 d.58.7.1 (A:65-150) Non-POU domain-containing octamer-binding protein, NonO {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1fxla2 d.58.7.1 (A:119-203) Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1whwa_ d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1h2vz_ d.58.7.1 (Z:) CBP20, 20KDa nuclear cap-binding protein {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1nu4a_ d.58.7.1 (A:) Splicesomal U1A protein {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1x5sa1 d.58.7.1 (A:8-97) Cold-inducible RNA-binding protein {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1wg4a_ d.58.7.1 (A:) Splicing factor, arginine/serine-rich 9 (SFRS9) {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1whxa_ d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d2cpza1 d.58.7.1 (A:383-484) CUG triplet repeat RNA-binding protein 1 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2disa1 d.58.7.1 (A:8-103) Hypothetical protein FLJ20273 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1fjca_ d.58.7.1 (A:) Nucleolin {Golden hamster (Mesocricetus auratus) [TaxId: 10036]}	Back information, alignment and structure

>d1x4da1 d.58.7.1 (A:8-96) Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d2u2fa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2cpxa1 d.58.7.1 (A:291-392) RNA-binding protein 41, RBM41 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1fjeb1 d.58.7.1 (B:1-91) Nucleolin {Golden hamster (Mesocricetus auratus) [TaxId: 10036]}	Back information, alignment and structure

>d3begb1 d.58.7.1 (B:121-207) Splicing factor, arginine/serine-rich 1, SFRS1 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1rk8a_ d.58.7.1 (A:) RNA-binding protein 8 {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}	Back information, alignment and structure

>d1x4ea1 d.58.7.1 (A:8-79) RNA-binding motif, single-stranded-interacting protein 2, RBMS2 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1x5oa1 d.58.7.1 (A:8-108) RNA-binding motif, single-stranded-interacting protein 1, RBMS1 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1cvja2 d.58.7.1 (A:91-179) Poly(A)-binding protein {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2adca1 d.58.7.1 (A:335-443) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1x5ua1 d.58.7.1 (A:7-99) Splicing factor 3B subunit 4 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1no8a_ d.58.7.1 (A:) Nuclear factor Aly {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d2cpia1 d.58.7.1 (A:101-189) E3 ubiquitin protein ligase CNOT4 {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1p1ta_ d.58.7.1 (A:) Cleavage stimulation factor, 64 kda subunit {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1cvja1 d.58.7.1 (A:11-90) Poly(A)-binding protein {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2cpha1 d.58.7.1 (A:454-547) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d2cq0a1 d.58.7.1 (A:231-320) Eukaryotic translation initiation factor 3 subunit 4 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2msta_ d.58.7.1 (A:) Neural RNA-binding protein Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1x4fa1 d.58.7.1 (A:8-106) Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1b7fa2 d.58.7.1 (A:205-289) Sex-lethal protein {Drosophila melanogaster [TaxId: 7227]}	Back information, alignment and structure

>d1x4ha1 d.58.7.1 (A:8-105) RNA-binding protein 28 {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d2cq2a1 d.58.7.1 (A:25-125) Alkylation repair AlkB homolog 8, ALKBH8 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1x5ta1 d.58.7.1 (A:8-90) Splicing factor 3B subunit 4 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2cq3a1 d.58.7.1 (A:110-202) RNA-binding protein 9 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2cpfa1 d.58.7.1 (A:362-446) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1weya_ d.58.7.1 (A:) Calcipressin-1 {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d2cpea1 d.58.7.1 (A:353-453) RNA-binding protein EWS {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2bz2a1 d.58.7.1 (A:35-113) Negative elongation factor E, NELF-E {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2ghpa3 d.58.7.1 (A:206-291) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1wi6a1 d.58.7.1 (A:69-143) Ribonucleoprotein PTB-binding 1, Raver-1 {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1wi8a_ d.58.7.1 (A:) Eukaryotic translation initiation factor 4B {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1u6fa1 d.58.7.1 (A:1-139) RNA-binding protein UBP1 {Trypanosoma cruzi [TaxId: 5693]}	Back information, alignment and structure

>d2cqpa1 d.58.7.1 (A:917-1002) RNA-binding protein 12 {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d2cq4a1 d.58.7.1 (A:132-232) RNA binding protein 23 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1uawa_ d.58.7.1 (A:) Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1wf2a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoproteins C1/C2 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1wf0a_ d.58.7.1 (A:) TAR DNA-binding protein 43, TDP-43 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1l3ka1 d.58.7.1 (A:8-91) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1l3ka2 d.58.7.1 (A:103-181) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1hd0a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein d0 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2cqda1 d.58.7.1 (A:1-103) RNA-binding region containing protein 1 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1zh5a2 d.58.7.1 (A:105-189) Lupus LA protein {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2cqga1 d.58.7.1 (A:96-185) TAR DNA-binding protein 43, TDP-43 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1x0fa1 d.58.7.1 (A:183-257) Nuclear ribonucleoprotein D0 (AUF1) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1u2fa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1x4ba1 d.58.7.1 (A:8-110) Heterogeneous nuclear ribonucleoproteins A2/B1 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2ghpa2 d.58.7.1 (A:41-115) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1wwha1 d.58.7.1 (A:169-249) Nucleoporin 35 {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d2cpya1 d.58.7.1 (A:536-638) RNA-binding protein 12 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1wela1 d.58.7.1 (A:412-523) RNA-binding protein 12 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1wg5a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein H' {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1weza_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein H' {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1o0pa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2dita1 d.58.7.1 (A:8-106) HIV Tat-specific factor 1 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1owxa_ d.58.7.1 (A:) Lupus LA protein {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1uw4a_ d.58.7.4 (A:) RNA processing protein UPF3x, RRM domain {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1jmta_ d.58.7.3 (A:) U2AF35 (35 KDa subunit) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2dgxa1 d.58.7.1 (A:563-635) Limkain-b1, LKAP {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure