Citrus Sinensis ID: 001331

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820-------830-------840-------850-------860-------870-------880-------890-------900-------910-------920-------930-------940-------950-------960-------970-------980-------990------1000------1010------1020------1030------1040------1050------1060------1070------1080------1090------110
MLPRKRASEGVVVVNEETQNAAQESQNDIEIANASSATKKHRISATADSNNNSSSSSSNNVVTGKEGENHSISASIAEVPIMTLGNSNQTDIDEDLHSRQLAVYGRETMRRLFASNILVSGMQGLGAEIAKNLILAGVKSVTLHDEGTVELWDLSSNFVFSDNDIGKNRALASVQKLQELNNAVVLSTLTSKLTKEQLSDFQAVVFTDISLDKAIEFDDFCHNHQPAISFIKAEVRGLFGSVFCDFGPEFTVVDVDGEDPHTGIIASISNDNPALVSCVDDERLEFQDGDLVVFSEVHGMTELNDGKPRKIKSARPYSFTLEEDTTNYGTYVKGGIVTQVKQPKVLNFKPLREALEDPGDFLLSDFSKFDRPPPLHLAFQALDKFVSELGRFPVAGSEEDAQKLISVATNINESLGDGRVEDINTKLLRHFAFGARAVLNPMAAMFGGIVGQEVVKACSGKFHPLYQFFYFDSVESLPTEPLDSTEFKPINSRYDAQISVFGAKLQKKLEDAKVFIVGSGALGCEFLKNVALMGVSCGNQGKLTITDDDVIEKSNLSRQFLFRDWNIGQAKSTVAASAATSINPRLNIEALQNRVGPETENVFDDTFWENITCVINALDNVNARLYVDQRCLYFQKPLLESGTLGAKCNTQMVIPHLTENYGASRDPPEKQAPMCTVHSFPHNIDHCLTWARSEFEGLLEKTPAEVNAYLSNPVEYTTSMANAGDAQARDNLERVLECLDKEKCEIFQDCITWARLKFEDYFSNRVKQLIFTFPEDAATSTGAPFWSAPKRFPHPLQFSSADPSHLHFVMAASILRAETFGIPIPDWTNNPKMLAEAVDKVMVPDFLPKKDAKILTDEKATTLSTASVDDAAVINDLIIKLEQCRKNLPSGFRLKPIQFEKDDDTNYHMDMIAGLANMRARNYSIPEVDKLKAKFIAGRIIPAIATSTAMATGLVCLELYKVLDGGHKLEDYRNTFANLALPLFSMAEPVPPKVIKHRDMSWTVWDRWILKDNPTLRELIQWLKDKGLNAYSISCGSCLLFNSMFPRHKERMDKKVVDLAREVAKVELPPYRRHLDVVVACEDDEDNDIDIPLISIYFR
cccccccccccccccccccHHHHcccccHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHccHHHHHHHHcccEEEEccccHHHHHHHHHHHccccEEEEEccccccccccccccccccccccccHHHHHHHHHHHHccccEEEEccccccHHHHccccEEEEEcccHHHHHHHHHHHHHcccccEEEEccccccEEEEEccccccEEEEccccccccEEEEEEEccccccEEEEEcccccccccccEEEEEEEcccccccccccEEEEEccccEEEEccccccccccccccEEEEEcccEEEEcccHHHHHcccccEEEccccccccccHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHcccccccccEEEEccccccccccccccccccccccccHHHHcccHHHHHHHHHccEEEEcccccHHHHHHHHHHccccccccccEEEEEcccccccccccccccccccccccHHHHHHHHHHHHcccccEEEEEccccccccccccHHHHccccEEEEccccHHHHHHHHHHHHHccccEEEccccccccEEEEEEcccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHcccHHHHcccccccHHHHHHHHccccHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHcccccccccccHHHHHHHHHccccccccccccccccccHHHHccccccccHHHHHHHHHHHHHHHHHcccccccccccccccccccHHHHHHHHHHHHHHHHHcccccccHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccEEEEEEEcccccHHHHHHHHHHcccccccEEccccEEEccccccHHHcccccHHHHHHHccccccccccEEEEEEEEEEcccccccccccEEEEEc
cccccccccccEEccHcHHHHccccccccccccccccHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHEEEEcHHHHHHHHHccEEEEcccHHHHHHHHHHHHHcccEEEEEcccccEHccccHcccccHHHccccHHHHHHHHHHHHcccccEEEEcccccHHHHHcccEEEEEcccHHHHHHHHHHHHHcccccEEEEEcccccEEEEEEEccccEEEEcccccccccEEEEEEccccccEEEEEcHHccccccccEEEEEEEcccHHHcccccEEEEEcccEEEEEccccccccccccccEEEEEEccEEEEcccHHHHHHccccEEEEcccccccHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHcccccccHHHccccccccccEEEEEcHHHHHHHHHccEEEEcccHHHHHHHHHHHHHccccccccEEEEEcccHEEEccccHHHcEccccccccHHHHHHHHHHHHcccccEEEcccccccccHHcccHHHHHcccHHHHHcccccHHHHHHcHcEEEcccccccccccccccEEEEEcccccccccccccccccccEEEccccccHHHHHHHHHHHHHHHHHcccHHHHHHHHccHHHHHHHHHHcccccHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccEEccccHHHHHHHHHHHHHHHHHcccccccccccHHHHHHHHHccccccccccccEEEEEccccccccccccccHHHHHHHHHHHHccccccccccccEEEEEEccccccHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHcccccccccccccEcccEEEEEEEEEEcccccHHHHHHHHHHccccEEEEEccHHHHHHcccccHHHHccccHHHHHHHHHccccccccEEEEEEEEEcccccccccccEEEEEEc
mlprkrasegvvVVNEETQNAAQESQNDIEIANASSATKKHRIsatadsnnnssssssnnvvtgkegenhsisasiaevpimtlgnsnqtdideDLHSRQLAVYGRETMRRLFASNILVSGMQGLGAEIAKNLILAGvksvtlhdegtvelwdlssnfvfsdndigknRALASVQKLQELNNAVVLSTLTSKLTKEQLSDFQAVVFTdisldkaiefddfchnhqpAISFIKAEVRGlfgsvfcdfgpeftvvdvdgedphtgiiasisndnpalvscvdderlefqdgdlvvfsevhgmtelndgkprkiksarpysftleedttnygtyvkggivtqvkqpkvlnfkplrealedpgdfllsdfskfdrppplhlAFQALDKFVSElgrfpvagseEDAQKLISVATNINeslgdgrvedINTKLLRHFAFGARAVLNPMAAMFGGIVGQEVVKacsgkfhplyqffyfdsveslptepldstefkpinsryDAQISVFGAKLQKKLEDAKVFIVGSGALGCEFLKNVALMgvscgnqgkltitdddvieksnlsrqflfrdwnigqaksTVAAsaatsinprlNIEALqnrvgpetenvfddTFWENITCVINALDNVNARLYVDQRCLYfqkpllesgtlgakcntqmviphltenygasrdppekqapmctvhsfphnidhCLTWARSEFEGLLEKTPAEVNAYLsnpveyttsmanagdaqaRDNLERVLECLDKEKCEIFQDCITWARLKFEDYFSNRVKQLIFtfpedaatstgapfwsapkrfphplqfssadpshLHFVMAASILRaetfgipipdwtnnpKMLAEAVDKvmvpdflpkkdakiltdekattlstasvddAAVINDLIIKLEQCrknlpsgfrlkpiqfekdddtnYHMDMIAGLANMRarnysipevdKLKAKFIAGRIIPAIATSTAMATGLVCLELYKVldgghkleDYRNTFANlalplfsmaepvppkvikhrdmswtvwdrwilkdnpTLRELIQWLKDkglnaysiscgscllfnsmfprhkermdKKVVDLAREVAkvelppyrrhlDVVVaceddedndidiplisiyfr
mlprkrasegvvvvneetqnaaqesqndiEIANASSATKKHRIsatadsnnnssssssnNVVTGKEGENHSISASIAEVPIMTLGNSNQTDIDEDLHSRQLAVYGRETMRRLFASNILVSGMQGLGAEIAKNLILAGVKSVTLHDEGTVELWDLSSNFVFSDNDIGKNRALASVQKLQELNNAVVLSTLTSKLTKEQLSDFQAVVFTDISLDKAIEFDDFCHNHQPAISFIKAEVRGLFGSVFCDFGPEFTVVDVDGEDPHTGIIasisndnpALVSCVDDERLEFQDGDLVVFSEVHgmtelndgkprkiksarpysftleedttnygtyVKGGIVTQVKQPKVLNFKPLREALEDPGDFLLSDFSKFDRPPPLHLAFQALDKFVSELGRFPVAGSEEDAQKLISVATnineslgdgRVEDINTKLLRHFAFGARAVLNPMAAMFGGIVGQEVVKACSGKFHPLYQFFYFDSVESLPTEPLDSTEFKPINSRYDAQISVFGAKLQKKLEDAKVFIVGSGALGCEFLKNVALMGVSCGNQGKLTITDDDVIEKSNLSRQFLFRDWNIGQAKSTVAAsaatsinprlNIEALQNRVGPETENVFDDTFWENITCVINALDNVNARLYVDQRCLYFQKPLLESGTLGAKCNTQMVIPHLTENYGASRDPPEKQAPMCTVHSFPHNIDHCLTWARSEFEGLLEKTPAEVNAYLSNPVEYTTSMANAGDAQARDNLERVLECLDKEKCEIFQDCITWARLKFEDYFSNRVKQLIFTFPEDAATSTGAPFWSAPKRFPHPLQFSSADPSHLHFVMAASILRAETFGIPIPDWTNNPKMLAEAVDKVMVPDFLPKkdakiltdekattlstasvddaaVINDLIIKLEQcrknlpsgfrlkpiqfekdddtNYHMDMIAGLANMRARNYSIPEVDKLKAKFIAGRIIPAIATSTAMATGLVCLELYKVLDGGHKLEDYRNTFANLALPLFSMAEPVPPKVIKHRDMSWTVWDRWILKDNPTLRELIQWLKDKGLNAYSISCGSCLLFNSMFPRHKERMDKKVVDLAREvakvelppyrrhldvvvaceddedndidiplisiyfr
MLPRKRASEGVVVVNEETQNAAQESQNDIEIANASSATKKHRISATADsnnnssssssnnVVTGKEGENHSISASIAEVPIMTLGNSNQTDIDEDLHSRQLAVYGRETMRRLFASNILVSGMQGLGAEIAKNLILAGVKSVTLHDEGTVELWDLSSNFVFSDNDIGKNRALASVQKLQELNNAVVLSTLTSKLTKEQLSDFQAVVFTDISLDKAIEFDDFCHNHQPAISFIKAEVRGLFGSVFCDFGPEFTVVDVDGEDPHTGIIASISNDNPALVSCVDDERLEFQDGDLVVFSEVHGMTELNDGKPRKIKSARPYSFTLEEDTTNYGTYVKGGIVTQVKQPKVLNFKPLREALEDPGDFLLSDFSKFDRPPPLHLAFQALDKFVSELGRFPVAGSEEDAQKLISVATNINESLGDGRVEDINTKLLRHFAFGARAVLNPMAAMFGGIVGQEVVKACSGKFHPLYQFFYFDSVESLPTEPLDSTEFKPINSRYDAQISVFGAKLQKKLEDAKVFIVGSGALGCEFLKNVALMGVSCGNQGKLTITDDDVIEKSNLSRQFLFRDWNIGQakstvaasaatsINPRLNIEALQNRVGPETENVFDDTFWENITCVINALDNVNARLYVDQRCLYFQKPLLESGTLGAKCNTQMVIPHLTENYGASRDPPEKQAPMCTVHSFPHNIDHCLTWARSEFEGLLEKTPAEVNAYLSNPVEYTTSMANAGDAQARDNLERVLECLDKEKCEIFQDCITWARLKFEDYFSNRVKQLIFTFPEDAATSTGAPFWSAPKRFPHPLQFSSADPSHLHFVMAASILRAETFGIPIPDWTNNPKMLAEAVDKVMVPDFLPKKDAKILTDEKATTLSTASVDDAAVINDLIIKLEQCRKNLPSGFRLKPIQFEKDDDTNYHMDMIAGLANMRARNYSIPEVDKLKAKFIAGRIIPAIATSTAMATGLVCLELYKVLDGGHKLEDYRNTFANLALPLFSMAEPVPPKVIKHRDMSWTVWDRWILKDNPTLRELIQWLKDKGLNAYSISCGSCLLFNSMFPRHKERMDKKVVDLAREVAKVELPPYRRHLDVVVACEDDEDNDIDIPLISIYFR
***********************************************************************************************LHSRQLAVYGRETMRRLFASNILVSGMQGLGAEIAKNLILAGVKSVTLHDEGTVELWDLSSNFVFSDNDIGKNRALASVQKLQELNNAVVLSTLTSKLTKEQLSDFQAVVFTDISLDKAIEFDDFCHNHQPAISFIKAEVRGLFGSVFCDFGPEFTVVDVDGEDPHTGIIASISNDNPALVSCVDDERLEFQDGDLVVFSEVHGMTE*************PYSFTLEEDTTNYGTYVKGGIVTQVKQPKVLNFKPLREALEDPGDFLLSDFSKFDRPPPLHLAFQALDKFVSEL********************NINESLGDGRVEDINTKLLRHFAFGARAVLNPMAAMFGGIVGQEVVKACSGKFHPLYQFFYFDSVESLP*******EFKPINSRYDAQISVFGAKLQKKLEDAKVFIVGSGALGCEFLKNVALMGVSCGNQGKLTITDDDVIEKSNLSRQFLFRDWNIGQAKSTVAASAATSINPRLNIEALQNRVGPETENVFDDTFWENITCVINALDNVNARLYVDQRCLYFQKPLLESGTLGAKCNTQMVIPHLTENY************MCTVHSFPHNIDHCLTWARSEFEGLLEKTPAEVNAYLSNPVEYTTSMA******ARDNLERVLECLDKEKCEIFQDCITWARLKFEDYFSNRVKQLIFTFPEDAATSTGAPFWSAPKRFPHPLQF**ADPSHLHFVMAASILRAETFGIPIPDWTNNPKMLAEAVDKVMVPDFLPKKDAKILTDEKATTLSTASVDDAAVINDLIIKLEQCRKNLPSGFRLKPIQFEKDDDTNYHMDMIAGLANMRARNYSIPEVDKLKAKFIAGRIIPAIATSTAMATGLVCLELYKVLDGGHKLEDYRNTFANLALPLFSMAEPVPPKVIKHRDMSWTVWDRWILKDNPTLRELIQWLKDKGLNAYSISCGSCLLFNSMFPRHKERMDKKVVDLAREVAKVELPPYRRHLDVVVACEDDEDNDIDIPLISIYF*
***********************************************************************************************LHSRQLAVYGRETMRRLFASNILVSGMQGLGAEIAKNLILAGVKSVTLHDEGTVELWDLSSNFVFSDNDIGKNRALASVQKLQELNNAVVLSTLTSKLTKEQLSDFQAVVFTDISLDKAIEFDDFCHNHQPAISFIKAEVRGLFGSVFCDFGPEFTVVDVDGEDPHTGIIASISNDNPALVSCVDDERLEFQDGDLVVFSEVHGMT***DGKPRKIKSARPYSFTLEEDTTNYGTYVKGGIVTQVKQPKVLNFKPLREALEDPGDFLLSDFSKFDRPPPLHLAFQALDKFVSELGRFPVAGSEEDAQKLISVATNINES******EDINTKLLRHFAFGARAVLNPMAAMFGGIVGQEVVKACSGKFHPLYQFFYFDSVESLPTEPLDSTEFKPINSRYDAQISVFGAKLQKKLEDAKVFIVGSGALGCEFLKNVALMGVSCGNQGKLTITDDDVIEKSNLSRQFLFRDWNIGQAKSTVAASAATSINPRLNIEALQNRVGPETENVFDDTFWENITCVINALDNVNARLYVDQRCLYFQKPLLESGTLGAKCNTQMVIPHLTENY********KQAPMCTVHSFPHNIDHCLTWARSEFEGLLEKTPAEVNAYLSNPVEYTT***********DNLERVLECLDKEKCEIFQDCITWARLKFEDYFSNRVKQLIFTFPEDAATSTGAPFWSAPKRFPHPLQFSSADPSHLHFVMAASILRAETFGIPIPDWTNNPKMLAEAVDKVMV****************************AVINDLIIKLEQ**********LKPIQFEKDDDTNYHMDMIAGLANMRARNYSIPEVDKLKAKFIAGRIIPAIATSTAMATGLVCLELYKVLDGGHKLEDYRNTFANLALPLFSMAEPVPPKVIKHRDMSWTVWDRWILKDNPTLRELIQWLKDKGLNAYSISCGSCLLFNSMFPRHKERMDKKVVDLAREVAKVELPPYRRHLDVVVACEDDEDNDIDIPLISIYFR
**********VVVVNEETQNAAQESQNDIEIANA**********************************NHSISASIAEVPIMTLGNSNQTDIDEDLHSRQLAVYGRETMRRLFASNILVSGMQGLGAEIAKNLILAGVKSVTLHDEGTVELWDLSSNFVFSDNDIGKNRALASVQKLQELNNAVVLSTLTSKLTKEQLSDFQAVVFTDISLDKAIEFDDFCHNHQPAISFIKAEVRGLFGSVFCDFGPEFTVVDVDGEDPHTGIIASISNDNPALVSCVDDERLEFQDGDLVVFSEVHGMTELNDGKPRKIKSARPYSFTLEEDTTNYGTYVKGGIVTQVKQPKVLNFKPLREALEDPGDFLLSDFSKFDRPPPLHLAFQALDKFVSELGRFPVAGSEEDAQKLISVATNINESLGDGRVEDINTKLLRHFAFGARAVLNPMAAMFGGIVGQEVVKACSGKFHPLYQFFYFDSVESLPTEPLDSTEFKPINSRYDAQISVFGAKLQKKLEDAKVFIVGSGALGCEFLKNVALMGVSCGNQGKLTITDDDVIEKSNLSRQFLFRDWNIGQAKSTVAASAATSINPRLNIEALQNRVGPETENVFDDTFWENITCVINALDNVNARLYVDQRCLYFQKPLLESGTLGAKCNTQMVIPHLTENYGASRDPPEKQAPMCTVHSFPHNIDHCLTWARSEFEGLLEKTPAEVNAYLSNPVEYTTSMANAGDAQARDNLERVLECLDKEKCEIFQDCITWARLKFEDYFSNRVKQLIFTFPEDAATSTGAPFWSAPKRFPHPLQFSSADPSHLHFVMAASILRAETFGIPIPDWTNNPKMLAEAVDKVMVPDFLPKKDAKILTDEKATTLSTASVDDAAVINDLIIKLEQCRKNLPSGFRLKPIQFEKDDDTNYHMDMIAGLANMRARNYSIPEVDKLKAKFIAGRIIPAIATSTAMATGLVCLELYKVLDGGHKLEDYRNTFANLALPLFSMAEPVPPKVIKHRDMSWTVWDRWILKDNPTLRELIQWLKDKGLNAYSISCGSCLLFNSMFPRHKERMDKKVVDLAREVAKVELPPYRRHLDVVVACEDDEDNDIDIPLISIYFR
******************************************************************************************DIDEDLHSRQLAVYGRETMRRLFASNILVSGMQGLGAEIAKNLILAGVKSVTLHDEGTVELWDLSSNFVFSDNDIGKNRALASVQKLQELNNAVVLSTLTSKLTKEQLSDFQAVVFTDISLDKAIEFDDFCHNHQPAISFIKAEVRGLFGSVFCDFGPEFTVVDVDGEDPHTGIIASISNDNPALVSCVDDERLEFQDGDLVVFSEVHGMTELNDGKPRKIKSARPYSFTLEEDTTNYGTYVKGGIVTQVKQPKVLNFKPLREALEDPGDFLLSDFSKFDRPPPLHLAFQALDKFVSELGRFPVAGSEEDAQKLISVATNINESLGDGRVEDINTKLLRHFAFGARAVLNPMAAMFGGIVGQEVVKACSGKFHPLYQFFYFDSVESLPTEPLDSTEFKPINSRYDAQISVFGAKLQKKLEDAKVFIVGSGALGCEFLKNVALMGVSCGNQGKLTITDDDVIEKSNLSRQFLFRDWNIGQAKSTVAASAATSINPRLNIEALQNRVGPETENVFDDTFWENITCVINALDNVNARLYVDQRCLYFQKPLLESGTLGAKCNTQMVIPHLTENYGASRDPPEKQAPMCTVHSFPHNIDHCLTWARSEFEGLLEKTPAEVNAYLSNPVEYTTSMANAGDAQARDNLERVLECLDKEKCEIFQDCITWARLKFEDYFSNRVKQLIFTFPEDAATSTGAPFWSAPKRFPHPLQFSSADPSHLHFVMAASILRAETFGIPIPDWTNNPKMLAEAVDKVMVPDFLPKKDAKILTDEK*********DDAAVINDLIIKLEQCRKNLPSGFRLKPIQFEKDDDTNYHMDMIAGLANMRARNYSIPEVDKLKAKFIAGRIIPAIATSTAMATGLVCLELYKVLDGGHKLEDYRNTFANLALPLFSMAEPVPPKVIKHRDMSWTVWDRWILKDNPTLRELIQWLKDKGLNAYSISCGSCLLFNSMFPRHKERMDKKVVDLAREVAKVELPPYRRHLDVVVACEDDEDNDIDIPLISIYFR
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MLPRKRASEGVVVVxxxxxxxxxxxxxxxxxxxxxSATKKHRISATADSNNNSSSSSSNNVVTGKEGENHSISASIAEVPIMTLGNSNQTDIDEDLHSRQLAVYGRETMRRLFASNILVSGMQGLGAEIAKNLILAGVKSVTLHDEGTVELWDLSSNFVFSDNDIGKNRALASVQKLQELNNAVVLSTLTSKLTKEQLSDFQAVVFTDISLDKAIEFDDFCHNHQPAISFIKAEVRGLFGSVFCDFGPEFTVVDVDGEDPHTGIIASISNDNPALVSCVDDERLEFQDGDLVVFSEVHGMTELNDGKPRKIKSARPYSFTLEEDTTNYGTYVKGGIVTQVKQPKVLNFKPLREALEDPGDFLLSDFSKFDRPPPLHLAFQALDKFVSELGRFPVAGSEEDAQKLISVATNINESLGDGRVEDINTKLLRHFAFGARAVLNPMAAMFGGIVGQEVVKACSGKFHPLYQFFYFDSVESLPTEPLDSTEFKPINSRYDAQISVFGAKLQKKLEDAKVFIVGSGALGCEFLKNVALMGVSCGNQGKLTITDDDVIEKSNLSRQFLFRDWNIGQAKSTVAASAATSINPRLNIEALQNRVGPETENVFDDTFWENITCVINALDNVNARLYVDQRCLYFQKPLLESGTLGAKCNTQMVIPHLTENYGASRDPPEKQAPMCTVHSFPHNIDHCLTWARSEFEGLLEKTPAEVNAYLSNPVEYTTSMANAGDAQARDNLERVLECLDKEKCEIFQDCITWARLKFEDYFSNRVKQLIFTFPEDAATSTGAPFWSAPKRFPHPLQFSSADPSHLHFVMAASILRAETFGIPIPDWTNNPKMLAEAVDKVMVPDFLPKKDAKILTDEKATTLSTASVDDAAVINDLIIKLEQCRKNLPSGFRLKPIQFEKDDDTNYHMDMIAGLANMRARNYSIPEVDKLKAKFIAGRIIPAIATSTAMATGLVCLELYKVLDGGHKLEDYRNTFANLALPLFSMAEPVPPKVIKHRDMSWTVWDRWILKDNPTLRELIQWLKDKGLNAYSISCGSCLLFNSMFPRHKERMDKKVVDLAREVAKVELPPYRRHLDVVVACEDDEDNDIDIPLISIYFR
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query1099 2.2.26 [Sep-21-2011]
P930281080 Ubiquitin-activating enzy yes no 0.979 0.997 0.810 0.0
P929741077 Ubiquitin-activating enzy no no 0.968 0.987 0.801 0.0
P312511051 Ubiquitin-activating enzy N/A no 0.918 0.960 0.8 0.0
P209731051 Ubiquitin-activating enzy N/A no 0.918 0.960 0.8 0.0
P312521053 Ubiquitin-activating enzy N/A no 0.918 0.958 0.770 0.0
A3KMV51058 Ubiquitin-like modifier-a yes no 0.937 0.973 0.447 0.0
P223141058 Ubiquitin-like modifier-a yes no 0.937 0.973 0.449 0.0
Q295041058 Ubiquitin-like modifier-a yes no 0.937 0.973 0.447 0.0
P312541058 Ubiquitin-like modifier-a yes no 0.945 0.982 0.433 0.0
Q5U3001058 Ubiquitin-like modifier-a yes no 0.943 0.980 0.434 0.0
>sp|P93028|UBE11_ARATH Ubiquitin-activating enzyme E1 1 OS=Arabidopsis thaliana GN=UBA1 PE=1 SV=1 Back     alignment and function desciption
 Score = 1844 bits (4776), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 887/1095 (81%), Positives = 986/1095 (90%), Gaps = 18/1095 (1%)

Query: 5    KRASEGVVVVNEETQNAAQESQNDIEIANASSATKKHRISATADSNNNSSSSSSNNVVTG 64
            KRASE            A +  ++  I +  +++KK RI  T  S++ SSS  ++    G
Sbjct: 4    KRASE------------ANDKNDNTIIGSDLASSKKRRIDFTESSSDKSSSILASGSSRG 51

Query: 65   KEGENHSISASIAEVPIMTLGNSNQTDIDEDLHSRQLAVYGRETMRRLFASNILVSGMQG 124
              G+      S+ +   M  GNSN+ +IDEDLHSRQLAVYGRETMRRLFASN+L+SGM G
Sbjct: 52   FHGD------SVVQQIDMAFGNSNRQEIDEDLHSRQLAVYGRETMRRLFASNVLISGMHG 105

Query: 125  LGAEIAKNLILAGVKSVTLHDEGTVELWDLSSNFVFSDNDIGKNRALASVQKLQELNNAV 184
            LGAEIAKNLILAGVKSVTLHDE  VELWDLSSNFVFS++D+GKNRA ASVQKLQ+LNNAV
Sbjct: 106  LGAEIAKNLILAGVKSVTLHDERVVELWDLSSNFVFSEDDVGKNRADASVQKLQDLNNAV 165

Query: 185  VLSTLTSKLTKEQLSDFQAVVFTDISLDKAIEFDDFCHNHQPAISFIKAEVRGLFGSVFC 244
            V+S+LT  L KE LS FQ VVF+DIS+++AIEFDD+CH+HQP I+F+KA+VRGLFGSVFC
Sbjct: 166  VVSSLTKSLNKEDLSGFQVVVFSDISMERAIEFDDYCHSHQPPIAFVKADVRGLFGSVFC 225

Query: 245  DFGPEFTVVDVDGEDPHTGIIASISNDNPALVSCVDDERLEFQDGDLVVFSEVHGMTELN 304
            DFGPEF V+DVDGE+PHTGIIASISN+N A +SCVDDERLEF+DGDLVVFSEV GMTELN
Sbjct: 226  DFGPEFAVLDVDGEEPHTGIIASISNENQAFISCVDDERLEFEDGDLVVFSEVEGMTELN 285

Query: 305  DGKPRKIKSARPYSFTLEEDTTNYGTYVKGGIVTQVKQPKVLNFKPLREALEDPGDFLLS 364
            DGKPRKIKS RPYSFTL+EDTTNYGTYVKGGIVTQVKQPK+LNFKPLREAL+DPGDFL S
Sbjct: 286  DGKPRKIKSTRPYSFTLDEDTTNYGTYVKGGIVTQVKQPKLLNFKPLREALKDPGDFLFS 345

Query: 365  DFSKFDRPPPLHLAFQALDKFVSELGRFPVAGSEEDAQKLISVATNINESLGDGRVEDIN 424
            DFSKFDRPP LHLAFQALD F +E GRFPVAGSEEDAQKLIS+AT IN   GD +VE+++
Sbjct: 346  DFSKFDRPPLLHLAFQALDHFKAEAGRFPVAGSEEDAQKLISIATAINTGQGDLKVENVD 405

Query: 425  TKLLRHFAFGARAVLNPMAAMFGGIVGQEVVKACSGKFHPLYQFFYFDSVESLPTEPLDS 484
             KLLRHF+FGA+AVLNPMAAMFGGIVGQEVVKACSGKFHPL+QFFYFDSVESLP+EP+DS
Sbjct: 406  QKLLRHFSFGAKAVLNPMAAMFGGIVGQEVVKACSGKFHPLFQFFYFDSVESLPSEPVDS 465

Query: 485  TEFKPINSRYDAQISVFGAKLQKKLEDAKVFIVGSGALGCEFLKNVALMGVSCGNQGKLT 544
            ++F P NSRYDAQISVFGAK QKKLEDAKVF VGSGALGCEFLKN+ALMGVSCG+QGKLT
Sbjct: 466  SDFAPRNSRYDAQISVFGAKFQKKLEDAKVFTVGSGALGCEFLKNLALMGVSCGSQGKLT 525

Query: 545  ITDDDVIEKSNLSRQFLFRDWNIGQAKSTVAASAATSINPRLNIEALQNRVGPETENVFD 604
            +TDDD+IEKSNLSRQFLFRDWNIGQAKSTVAASAA  INPR NIEALQNRVG ETENVFD
Sbjct: 526  VTDDDIIEKSNLSRQFLFRDWNIGQAKSTVAASAAAVINPRFNIEALQNRVGAETENVFD 585

Query: 605  DTFWENITCVINALDNVNARLYVDQRCLYFQKPLLESGTLGAKCNTQMVIPHLTENYGAS 664
            D FWEN+T V+NALDNVNARLYVD RCLYFQKPLLESGTLG KCNTQ VIPHLTENYGAS
Sbjct: 586  DAFWENLTVVVNALDNVNARLYVDSRCLYFQKPLLESGTLGTKCNTQSVIPHLTENYGAS 645

Query: 665  RDPPEKQAPMCTVHSFPHNIDHCLTWARSEFEGLLEKTPAEVNAYLSNPVEYTTSMANAG 724
            RDPPEKQAPMCTVHSFPHNIDHCLTWARSEFEGLLEKTPAEVNAYLS+PVEYT SM +AG
Sbjct: 646  RDPPEKQAPMCTVHSFPHNIDHCLTWARSEFEGLLEKTPAEVNAYLSSPVEYTNSMMSAG 705

Query: 725  DAQARDNLERVLECLDKEKCEIFQDCITWARLKFEDYFSNRVKQLIFTFPEDAATSTGAP 784
            DAQARD LER++ECL+KEKCE FQDC+TWARL+FEDYF NRVKQLI+TFPEDAATSTGAP
Sbjct: 706  DAQARDTLERIVECLEKEKCETFQDCLTWARLRFEDYFVNRVKQLIYTFPEDAATSTGAP 765

Query: 785  FWSAPKRFPHPLQFSSADPSHLHFVMAASILRAETFGIPIPDWTNNPKMLAEAVDKVMVP 844
            FWSAPKRFP PLQ+SS+DPS L+F+ A +ILRAETFGIPIP+WT NPK  AEAVD+V+VP
Sbjct: 766  FWSAPKRFPRPLQYSSSDPSLLNFITATAILRAETFGIPIPEWTKNPKEAAEAVDRVIVP 825

Query: 845  DFLPKKDAKILTDEKATTLSTASVDDAAVINDLIIKLEQCRKNLPSGFRLKPIQFEKDDD 904
            DF P++DAKI+TDEKATTL+TASVDDAAVI+DLI K++QCR NL   FR+KPIQFEKDDD
Sbjct: 826  DFEPRQDAKIVTDEKATTLTTASVDDAAVIDDLIAKIDQCRHNLSPDFRMKPIQFEKDDD 885

Query: 905  TNYHMDMIAGLANMRARNYSIPEVDKLKAKFIAGRIIPAIATSTAMATGLVCLELYKVLD 964
            TNYHMD+IAGLANMRARNYSIPEVDKLKAKFIAGRIIPAIATSTAMATGLVCLELYKVLD
Sbjct: 886  TNYHMDVIAGLANMRARNYSIPEVDKLKAKFIAGRIIPAIATSTAMATGLVCLELYKVLD 945

Query: 965  GGHKLEDYRNTFANLALPLFSMAEPVPPKVIKHRDMSWTVWDRWILKDNPTLRELIQWLK 1024
            GGHK+E YRNTFANLALPLFSMAEP+PPKV+KHRDM+WTVWDRW+LK NPTLRE++QWL+
Sbjct: 946  GGHKVEAYRNTFANLALPLFSMAEPLPPKVVKHRDMAWTVWDRWVLKGNPTLREVLQWLE 1005

Query: 1025 DKGLNAYSISCGSCLLFNSMFPRHKERMDKKVVDLAREVAKVELPPYRRHLDVVVACEDD 1084
            DKGL+AYSISCGSCLLFNSMF RHKERMDKKVVDLAR+VAKVELPPYR HLDVVVACED+
Sbjct: 1006 DKGLSAYSISCGSCLLFNSMFTRHKERMDKKVVDLARDVAKVELPPYRNHLDVVVACEDE 1065

Query: 1085 EDNDIDIPLISIYFR 1099
            +DND+DIPL+SIYFR
Sbjct: 1066 DDNDVDIPLVSIYFR 1080
Activates ubiquitin by first adenylating its C-terminal glycine residue with ATP, and thereafter linking this residue to the side chain of a cysteine residue in E1, yielding an ubiquitin-E1 thioester and free AMP.
Arabidopsis thaliana (taxid: 3702)
>sp|P92974|UBE12_ARATH Ubiquitin-activating enzyme E1 2 OS=Arabidopsis thaliana GN=UBA2 PE=2 SV=1 Back     alignment and function description
>sp|P31251|UBE12_WHEAT Ubiquitin-activating enzyme E1 2 OS=Triticum aestivum GN=UBA2 PE=2 SV=1 Back     alignment and function description
>sp|P20973|UBE11_WHEAT Ubiquitin-activating enzyme E1 1 OS=Triticum aestivum GN=UBA1 PE=1 SV=1 Back     alignment and function description
>sp|P31252|UBE13_WHEAT Ubiquitin-activating enzyme E1 3 OS=Triticum aestivum GN=UBA3 PE=2 SV=1 Back     alignment and function description
>sp|A3KMV5|UBA1_BOVIN Ubiquitin-like modifier-activating enzyme 1 OS=Bos taurus GN=UBA1 PE=2 SV=1 Back     alignment and function description
>sp|P22314|UBA1_HUMAN Ubiquitin-like modifier-activating enzyme 1 OS=Homo sapiens GN=UBA1 PE=1 SV=3 Back     alignment and function description
>sp|Q29504|UBA1_RABIT Ubiquitin-like modifier-activating enzyme 1 OS=Oryctolagus cuniculus GN=UBA1 PE=2 SV=1 Back     alignment and function description
>sp|P31254|UBA1Y_MOUSE Ubiquitin-like modifier-activating enzyme 1 Y OS=Mus musculus GN=Ube1ay PE=2 SV=2 Back     alignment and function description
>sp|Q5U300|UBA1_RAT Ubiquitin-like modifier-activating enzyme 1 OS=Rattus norvegicus GN=Uba1 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query1099
3594787031100 PREDICTED: ubiquitin-activating enzyme E 0.982 0.981 0.857 0.0
2555713361107 ubiquitin-activating enzyme E1, putative 0.995 0.988 0.840 0.0
3564989721106 PREDICTED: ubiquitin-activating enzyme E 0.993 0.987 0.852 0.0
3574910291180 Ubiquitin-activating enzyme E1 [Medicago 0.985 0.917 0.832 0.0
3574910271179 Ubiquitin-activating enzyme E1 [Medicago 0.985 0.918 0.832 0.0
3565531021108 PREDICTED: ubiquitin-activating enzyme E 0.994 0.986 0.848 0.0
4494508341152 PREDICTED: ubiquitin-activating enzyme E 0.989 0.943 0.824 0.0
3416576461094 ubiquitin activating enzyme E1 [Camellia 0.934 0.938 0.853 0.0
2978264051083 hypothetical protein ARALYDRAFT_481921 [ 0.926 0.939 0.858 0.0
3565659981018 PREDICTED: ubiquitin-activating enzyme E 0.926 1.0 0.879 0.0
>gi|359478703|ref|XP_002275617.2| PREDICTED: ubiquitin-activating enzyme E1 1 [Vitis vinifera] Back     alignment and taxonomy information
 Score = 1946 bits (5042), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 947/1104 (85%), Positives = 1017/1104 (92%), Gaps = 24/1104 (2%)

Query: 1    MLPRKRASEGVVVVNEETQNAAQESQNDIEIANASSATKKHRISATAD------SNNNSS 54
            MLPRKRA  G VV ++++ N              +S+ KKHRIS++A       +NNNS 
Sbjct: 14   MLPRKRAVAGEVV-DDDSDNTG------------TSSIKKHRISSSAAGTETTVNNNNSG 60

Query: 55   SSSSNNVVTGKEGENHSISASIAEVPIMTLGNSNQTDIDEDLHSRQLAVYGRETMRRLFA 114
            SS  NN        NHS   S  E+ IM LG+ +  DIDEDLHSRQLAVYGRETMRRLFA
Sbjct: 61   SSLGNN----SGNSNHS-GGSEVELQIMALGDGHPPDIDEDLHSRQLAVYGRETMRRLFA 115

Query: 115  SNILVSGMQGLGAEIAKNLILAGVKSVTLHDEGTVELWDLSSNFVFSDNDIGKNRALASV 174
            SN+LVSG+QGLGAEIAKNLILAGVKSVTLHDEGTVELWD+SSNF+FS+ND+GKNRALASV
Sbjct: 116  SNVLVSGLQGLGAEIAKNLILAGVKSVTLHDEGTVELWDMSSNFIFSENDVGKNRALASV 175

Query: 175  QKLQELNNAVVLSTLTSKLTKEQLSDFQAVVFTDISLDKAIEFDDFCHNHQPAISFIKAE 234
            QKLQELNNAVV+STLT+KLTKE LSDFQAVVFTDI  +KAIEF+D+CH+HQP I+FIKAE
Sbjct: 176  QKLQELNNAVVISTLTTKLTKEDLSDFQAVVFTDIYFEKAIEFNDYCHSHQPPIAFIKAE 235

Query: 235  VRGLFGSVFCDFGPEFTVVDVDGEDPHTGIIASISNDNPALVSCVDDERLEFQDGDLVVF 294
            VRGLFGSVFCDFGPEFTV DVDGE+PHTGIIASISNDNPALVSCVDDERLEFQDGDLVVF
Sbjct: 236  VRGLFGSVFCDFGPEFTVFDVDGEEPHTGIIASISNDNPALVSCVDDERLEFQDGDLVVF 295

Query: 295  SEVHGMTELNDGKPRKIKSARPYSFTLEEDTTNYGTYVKGGIVTQVKQPKVLNFKPLREA 354
            SEVHGMTELNDGKPRKIK+ARPYSFTLEEDTTN+GTY KGGIVTQVKQPKVLNFKPLREA
Sbjct: 296  SEVHGMTELNDGKPRKIKNARPYSFTLEEDTTNFGTYEKGGIVTQVKQPKVLNFKPLREA 355

Query: 355  LEDPGDFLLSDFSKFDRPPPLHLAFQALDKFVSELGRFPVAGSEEDAQKLISVATNINES 414
            L DPGDFLLSDFSKFDRPP LHLAFQALD+F+SELGRFPVAGSEEDAQKLI +++NINE 
Sbjct: 356  LSDPGDFLLSDFSKFDRPPLLHLAFQALDRFISELGRFPVAGSEEDAQKLIFISSNINEG 415

Query: 415  LGDGRVEDINTKLLRHFAFGARAVLNPMAAMFGGIVGQEVVKACSGKFHPLYQFFYFDSV 474
            LGDG++EDIN KLLRHFAFGARAVLNPMAAMFGGIVGQEVVKACSGKFHPL+QFFYFDSV
Sbjct: 416  LGDGKLEDINPKLLRHFAFGARAVLNPMAAMFGGIVGQEVVKACSGKFHPLFQFFYFDSV 475

Query: 475  ESLPTEPLDSTEFKPINSRYDAQISVFGAKLQKKLEDAKVFIVGSGALGCEFLKNVALMG 534
            ESLPTE  DS++FKP+NSRYDAQISVFG+KLQKKLEDA VF+VGSGALGCEFLKNVALMG
Sbjct: 476  ESLPTEAPDSSDFKPLNSRYDAQISVFGSKLQKKLEDAVVFMVGSGALGCEFLKNVALMG 535

Query: 535  VSCGNQGKLTITDDDVIEKSNLSRQFLFRDWNIGQAKSTVAASAATSINPRLNIEALQNR 594
            VSCGNQGKLTITDDDVIEKSNLSRQFLFRDWNIGQAKSTVAASAA +INP L+IEALQNR
Sbjct: 536  VSCGNQGKLTITDDDVIEKSNLSRQFLFRDWNIGQAKSTVAASAAQTINPCLHIEALQNR 595

Query: 595  VGPETENVFDDTFWENITCVINALDNVNARLYVDQRCLYFQKPLLESGTLGAKCNTQMVI 654
            VGPETENVF+D FWEN++ VINALDNVNARLYVDQRCLYFQKPLLESGTLGAKCNTQMVI
Sbjct: 596  VGPETENVFNDAFWENLSVVINALDNVNARLYVDQRCLYFQKPLLESGTLGAKCNTQMVI 655

Query: 655  PHLTENYGASRDPPEKQAPMCTVHSFPHNIDHCLTWARSEFEGLLEKTPAEVNAYLSNPV 714
            PHLTENYGASRDPPEKQAPMCTVHSFPHNIDHCLTWARSEFEGLLEKTPAEVNA+LSNP 
Sbjct: 656  PHLTENYGASRDPPEKQAPMCTVHSFPHNIDHCLTWARSEFEGLLEKTPAEVNAFLSNPT 715

Query: 715  EYTTSMANAGDAQARDNLERVLECLDKEKCEIFQDCITWARLKFEDYFSNRVKQLIFTFP 774
            EY ++M NAGDAQARDNLERVLECL++E+CE FQDCITWARL+FEDYF NRVKQLIFTFP
Sbjct: 716  EYASAMRNAGDAQARDNLERVLECLERERCETFQDCITWARLRFEDYFVNRVKQLIFTFP 775

Query: 775  EDAATSTGAPFWSAPKRFPHPLQFSSADPSHLHFVMAASILRAETFGIPIPDWTNNPKML 834
            EDAATSTGAPFWSAPKRFPHPLQFS+AD  HL+FVMAASILRAETFGIPIPDW  +PK L
Sbjct: 776  EDAATSTGAPFWSAPKRFPHPLQFSAADAGHLYFVMAASILRAETFGIPIPDWAKHPKKL 835

Query: 835  AEAVDKVMVPDFLPKKDAKILTDEKATTLSTASVDDAAVINDLIIKLEQCRKNLPSGFRL 894
            AEAVDKV+VP+F PK D KI+TDEKAT+LSTASVDDAAVIN+L+ K+EQ  K+LP GFR+
Sbjct: 836  AEAVDKVIVPEFQPKTDVKIVTDEKATSLSTASVDDAAVINELLAKIEQSWKSLPPGFRM 895

Query: 895  KPIQFEKDDDTNYHMDMIAGLANMRARNYSIPEVDKLKAKFIAGRIIPAIATSTAMATGL 954
             PIQFEKDDDTNYHMD+IAGLANMRARNYSIPEVDKLKAKFIAGRIIPAIATSTAMATGL
Sbjct: 896  NPIQFEKDDDTNYHMDLIAGLANMRARNYSIPEVDKLKAKFIAGRIIPAIATSTAMATGL 955

Query: 955  VCLELYKVLDGGHKLEDYRNTFANLALPLFSMAEPVPPKVIKHRDMSWTVWDRWILKDNP 1014
            VCLELYKVLDGGHKLEDYRNTFANLALPLFSMAEPVPPKVIKHRDMSWTVWDRWILKDNP
Sbjct: 956  VCLELYKVLDGGHKLEDYRNTFANLALPLFSMAEPVPPKVIKHRDMSWTVWDRWILKDNP 1015

Query: 1015 TLRELIQWLKDKGLNAYSISCGSCLLFNSMFPRHKERMDKKVVDLAREVAKVELPPYRRH 1074
            TLREL+QWLKDKGLNAYSISCGSCLL+NSMFPRH+ERMDKKVVDLAREVAKVELP YR H
Sbjct: 1016 TLRELLQWLKDKGLNAYSISCGSCLLYNSMFPRHRERMDKKVVDLAREVAKVELPAYRSH 1075

Query: 1075 LDVVVACEDDEDNDIDIPLISIYF 1098
            LDVVVACEDDEDNDIDIP +SIYF
Sbjct: 1076 LDVVVACEDDEDNDIDIPQVSIYF 1099

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|255571336|ref|XP_002526617.1| ubiquitin-activating enzyme E1, putative [Ricinus communis] gi|223534057|gb|EEF35776.1| ubiquitin-activating enzyme E1, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|356498972|ref|XP_003518319.1| PREDICTED: ubiquitin-activating enzyme E1 2-like [Glycine max] Back     alignment and taxonomy information
>gi|357491029|ref|XP_003615802.1| Ubiquitin-activating enzyme E1 [Medicago truncatula] gi|355517137|gb|AES98760.1| Ubiquitin-activating enzyme E1 [Medicago truncatula] Back     alignment and taxonomy information
>gi|357491027|ref|XP_003615801.1| Ubiquitin-activating enzyme E1 [Medicago truncatula] gi|355517136|gb|AES98759.1| Ubiquitin-activating enzyme E1 [Medicago truncatula] Back     alignment and taxonomy information
>gi|356553102|ref|XP_003544897.1| PREDICTED: ubiquitin-activating enzyme E1 2-like [Glycine max] Back     alignment and taxonomy information
>gi|449450834|ref|XP_004143167.1| PREDICTED: ubiquitin-activating enzyme E1 2-like [Cucumis sativus] gi|449519322|ref|XP_004166684.1| PREDICTED: ubiquitin-activating enzyme E1 2-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|341657646|gb|AEK86562.1| ubiquitin activating enzyme E1 [Camellia sinensis] Back     alignment and taxonomy information
>gi|297826405|ref|XP_002881085.1| hypothetical protein ARALYDRAFT_481921 [Arabidopsis lyrata subsp. lyrata] gi|297326924|gb|EFH57344.1| hypothetical protein ARALYDRAFT_481921 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|356565998|ref|XP_003551222.1| PREDICTED: ubiquitin-activating enzyme E1 1-like [Glycine max] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query1099
TAIR|locus:20608541080 UBA1 "ubiquitin-activating enz 0.982 1.0 0.800 0.0
TAIR|locus:21642701077 UBA 2 "ubiquitin activating en 0.968 0.987 0.791 0.0
UNIPROTKB|A3KMV51058 UBA1 "Ubiquitin-like modifier- 0.930 0.966 0.449 6.1e-245
UNIPROTKB|P223141058 UBA1 "Ubiquitin-like modifier- 0.930 0.966 0.451 8.9e-244
UNIPROTKB|F1RWX81058 UBA1 "Uncharacterized protein" 0.931 0.967 0.444 1.9e-241
ZFIN|ZDB-GENE-040426-20091058 uba1 "ubiquitin-like modifier 0.928 0.964 0.442 6.7e-239
RGD|13593271058 Uba1 "ubiquitin-like modifier 0.930 0.966 0.439 7.6e-238
MGI|MGI:988911058 Uba1y "ubiquitin-activating en 0.927 0.963 0.436 8.8e-237
UNIPROTKB|E2RGH51057 UBA1 "Uncharacterized protein" 0.929 0.966 0.438 2.3e-236
MGI|MGI:988901058 Uba1 "ubiquitin-like modifier 0.930 0.966 0.439 6.2e-236
TAIR|locus:2060854 UBA1 "ubiquitin-activating enzyme 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 4634 (1636.3 bits), Expect = 0., P = 0.
 Identities = 870/1087 (80%), Positives = 968/1087 (89%)

Query:    13 VVNEETQNAAQESQNDIEIANASSATKKHRISATADXXXXXXXXXXXXVVTGKEGENHSI 72
             ++++    A  ++ N I I +  +++KK RI  T                 G  G+    
Sbjct:     1 MLHKRASEANDKNDNTI-IGSDLASSKKRRIDFTESSSDKSSSILASGSSRGFHGD---- 55

Query:    73 SASIAEVPIMTLGNSNQTDIDEDLHSRQLAVYGRETMRRLFASNILVSGMQGLGAEIAKN 132
               S+ +   M  GNSN+ +IDEDLHSRQLAVYGRETMRRLFASN+L+SGM GLGAEIAKN
Sbjct:    56 --SVVQQIDMAFGNSNRQEIDEDLHSRQLAVYGRETMRRLFASNVLISGMHGLGAEIAKN 113

Query:   133 LILAGVKSVTLHDEGTVELWDLSSNFVFSDNDIGKNRALASVQKLQELNNAVVLSTLTSK 192
             LILAGVKSVTLHDE  VELWDLSSNFVFS++D+GKNRA ASVQKLQ+LNNAVV+S+LT  
Sbjct:   114 LILAGVKSVTLHDERVVELWDLSSNFVFSEDDVGKNRADASVQKLQDLNNAVVVSSLTKS 173

Query:   193 LTKEQLSDFQAVVFTDISLDKAIEFDDFCHNHQPAISFIKAEVRGLFGSVFCDFGPEFTV 252
             L KE LS FQ VVF+DIS+++AIEFDD+CH+HQP I+F+KA+VRGLFGSVFCDFGPEF V
Sbjct:   174 LNKEDLSGFQVVVFSDISMERAIEFDDYCHSHQPPIAFVKADVRGLFGSVFCDFGPEFAV 233

Query:   253 VDVDGEDPHTGIIASISNDNPALVSCVDDERLEFQDGDLVVFSEVHGMTELNDGKPRKIK 312
             +DVDGE+PHTGIIASISN+N A +SCVDDERLEF+DGDLVVFSEV GMTELNDGKPRKIK
Sbjct:   234 LDVDGEEPHTGIIASISNENQAFISCVDDERLEFEDGDLVVFSEVEGMTELNDGKPRKIK 293

Query:   313 SARPYSFTLEEDTTNYGTYVKGGIVTQVKQPKVLNFKPLREALEDPGDFLLSDFSKFDRP 372
             S RPYSFTL+EDTTNYGTYVKGGIVTQVKQPK+LNFKPLREAL+DPGDFL SDFSKFDRP
Sbjct:   294 STRPYSFTLDEDTTNYGTYVKGGIVTQVKQPKLLNFKPLREALKDPGDFLFSDFSKFDRP 353

Query:   373 PPLHLAFQALDKFVSELGRFPVAGSEEDAQKLISVATNINESLGDGRVEDINTKLLRHFA 432
             P LHLAFQALD F +E GRFPVAGSEEDAQKLIS+AT IN   GD +VE+++ KLLRHF+
Sbjct:   354 PLLHLAFQALDHFKAEAGRFPVAGSEEDAQKLISIATAINTGQGDLKVENVDQKLLRHFS 413

Query:   433 FGARAVLNPMAAMFGGIVGQEVVKACSGKFHPLYQFFYFDSVESLPTEPLDSTEFKPINS 492
             FGA+AVLNPMAAMFGGIVGQEVVKACSGKFHPL+QFFYFDSVESLP+EP+DS++F P NS
Sbjct:   414 FGAKAVLNPMAAMFGGIVGQEVVKACSGKFHPLFQFFYFDSVESLPSEPVDSSDFAPRNS 473

Query:   493 RYDAQISVFGAKLQKKLEDAKVFIVGSGALGCEFLKNVALMGVSCGNQGKLTITDDDVIE 552
             RYDAQISVFGAK QKKLEDAKVF VGSGALGCEFLKN+ALMGVSCG+QGKLT+TDDD+IE
Sbjct:   474 RYDAQISVFGAKFQKKLEDAKVFTVGSGALGCEFLKNLALMGVSCGSQGKLTVTDDDIIE 533

Query:   553 KSNLSRQFLFRDWNIGQXXXXXXXXXXXXINPRLNIEALQNRVGPETENVFDDTFWENIT 612
             KSNLSRQFLFRDWNIGQ            INPR NIEALQNRVG ETENVFDD FWEN+T
Sbjct:   534 KSNLSRQFLFRDWNIGQAKSTVAASAAAVINPRFNIEALQNRVGAETENVFDDAFWENLT 593

Query:   613 CVINALDNVNARLYVDQRCLYFQKPLLESGTLGAKCNTQMVIPHLTENYGASRDPPEKQA 672
              V+NALDNVNARLYVD RCLYFQKPLLESGTLG KCNTQ VIPHLTENYGASRDPPEKQA
Sbjct:   594 VVVNALDNVNARLYVDSRCLYFQKPLLESGTLGTKCNTQSVIPHLTENYGASRDPPEKQA 653

Query:   673 PMCTVHSFPHNIDHCLTWARSEFEGLLEKTPAEVNAYLSNPVEYTTSMANAGDAQARDNL 732
             PMCTVHSFPHNIDHCLTWARSEFEGLLEKTPAEVNAYLS+PVEYT SM +AGDAQARD L
Sbjct:   654 PMCTVHSFPHNIDHCLTWARSEFEGLLEKTPAEVNAYLSSPVEYTNSMMSAGDAQARDTL 713

Query:   733 ERVLECLDKEKCEIFQDCITWARLKFEDYFSNRVKQLIFTFPEDAATSTGAPFWSAPKRF 792
             ER++ECL+KEKCE FQDC+TWARL+FEDYF NRVKQLI+TFPEDAATSTGAPFWSAPKRF
Sbjct:   714 ERIVECLEKEKCETFQDCLTWARLRFEDYFVNRVKQLIYTFPEDAATSTGAPFWSAPKRF 773

Query:   793 PHPLQFSSADPSHLHFVMAASILRAETFGIPIPDWTNNPKMLAEAVDKVMVPDFLPKKDA 852
             P PLQ+SS+DPS L+F+ A +ILRAETFGIPIP+WT NPK  AEAVD+V+VPDF P++DA
Sbjct:   774 PRPLQYSSSDPSLLNFITATAILRAETFGIPIPEWTKNPKEAAEAVDRVIVPDFEPRQDA 833

Query:   853 KILTDEKATTLSTASVDDAAVINDLIIKLEQCRKNLPSGFRLKPIQFEKDDDTNYHMDMI 912
             KI+TDEKATTL+TASVDDAAVI+DLI K++QCR NL   FR+KPIQFEKDDDTNYHMD+I
Sbjct:   834 KIVTDEKATTLTTASVDDAAVIDDLIAKIDQCRHNLSPDFRMKPIQFEKDDDTNYHMDVI 893

Query:   913 AGLANMRARNYSIPEVDKLKAKFIAGRIIPAIATSTAMATGLVCLELYKVLDGGHKLEDY 972
             AGLANMRARNYSIPEVDKLKAKFIAGRIIPAIATSTAMATGLVCLELYKVLDGGHK+E Y
Sbjct:   894 AGLANMRARNYSIPEVDKLKAKFIAGRIIPAIATSTAMATGLVCLELYKVLDGGHKVEAY 953

Query:   973 RNTFANLALPLFSMAEPVPPKVIKHRDMSWTVWDRWILKDNPTLRELIQWLKDKGLNAYS 1032
             RNTFANLALPLFSMAEP+PPKV+KHRDM+WTVWDRW+LK NPTLRE++QWL+DKGL+AYS
Sbjct:   954 RNTFANLALPLFSMAEPLPPKVVKHRDMAWTVWDRWVLKGNPTLREVLQWLEDKGLSAYS 1013

Query:  1033 ISCGSCLLFNSMFPRHKERMDKKVVDLAREVAKVELPPYRRHLDVVVACEDDEDNDIDIP 1092
             ISCGSCLLFNSMF RHKERMDKKVVDLAR+VAKVELPPYR HLDVVVACED++DND+DIP
Sbjct:  1014 ISCGSCLLFNSMFTRHKERMDKKVVDLARDVAKVELPPYRNHLDVVVACEDEDDNDVDIP 1073

Query:  1093 LISIYFR 1099
             L+SIYFR
Sbjct:  1074 LVSIYFR 1080
GO:0000166 "nucleotide binding" evidence=IEA
GO:0003824 "catalytic activity" evidence=IEA
GO:0004839 "ubiquitin activating enzyme activity" evidence=ISS;IMP
GO:0005524 "ATP binding" evidence=IEA
GO:0005634 "nucleus" evidence=ISM
GO:0006464 "cellular protein modification process" evidence=IEA
GO:0008641 "small protein activating enzyme activity" evidence=IEA
GO:0006511 "ubiquitin-dependent protein catabolic process" evidence=TAS
GO:0046686 "response to cadmium ion" evidence=IEP
GO:0051707 "response to other organism" evidence=IMP
GO:0005886 "plasma membrane" evidence=IDA
GO:0005829 "cytosol" evidence=IDA
GO:0009506 "plasmodesma" evidence=IDA
GO:0006486 "protein glycosylation" evidence=RCA
GO:0006487 "protein N-linked glycosylation" evidence=RCA
GO:0006635 "fatty acid beta-oxidation" evidence=RCA
GO:0006888 "ER to Golgi vesicle-mediated transport" evidence=RCA
GO:0009407 "toxin catabolic process" evidence=RCA
GO:0043090 "amino acid import" evidence=RCA
GO:0043161 "proteasomal ubiquitin-dependent protein catabolic process" evidence=RCA
GO:0051788 "response to misfolded protein" evidence=RCA
GO:0080129 "proteasome core complex assembly" evidence=RCA
GO:0004842 "ubiquitin-protein ligase activity" evidence=IDA
GO:0016567 "protein ubiquitination" evidence=IDA
TAIR|locus:2164270 UBA 2 "ubiquitin activating enzyme 2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|A3KMV5 UBA1 "Ubiquitin-like modifier-activating enzyme 1" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|P22314 UBA1 "Ubiquitin-like modifier-activating enzyme 1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F1RWX8 UBA1 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-040426-2009 uba1 "ubiquitin-like modifier activating enzyme 1" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
RGD|1359327 Uba1 "ubiquitin-like modifier activating enzyme 1" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
MGI|MGI:98891 Uba1y "ubiquitin-activating enzyme, Chr Y" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|E2RGH5 UBA1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
MGI|MGI:98890 Uba1 "ubiquitin-like modifier activating enzyme 1" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
P93028UBE11_ARATHNo assigned EC number0.81000.97990.9972yesno
P31254UBA1Y_MOUSENo assigned EC number0.43350.94540.9820yesno
P31252UBE13_WHEATNo assigned EC number0.77000.91810.9582N/Ano
P31251UBE12_WHEATNo assigned EC number0.80.91810.9600N/Ano
P20973UBE11_WHEATNo assigned EC number0.80.91810.9600N/Ano
Q55C16UBA1_DICDINo assigned EC number0.44600.89440.9665yesno
O94609UBA1_SCHPONo assigned EC number0.44800.90260.9802yesno
P22314UBA1_HUMANNo assigned EC number0.44930.93720.9735yesno
A3KMV5UBA1_BOVINNo assigned EC number0.44740.93720.9735yesno
Q29504UBA1_RABITNo assigned EC number0.44740.93720.9735yesno
P92974UBE12_ARATHNo assigned EC number0.80180.96810.9879nono
P22515UBA1_YEASTNo assigned EC number0.45190.91080.9775yesno
Q5U300UBA1_RATNo assigned EC number0.43420.94350.9801yesno

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query1099
TIGR014081008 TIGR01408, Ube1, ubiquitin-activating enzyme E1 0.0
cd01490435 cd01490, Ube1_repeat2, Ubiquitin activating enzyme 1e-174
cd01491286 cd01491, Ube1_repeat1, Ubiquitin activating enzyme 1e-131
cd01490435 cd01490, Ube1_repeat2, Ubiquitin activating enzyme 3e-76
cd01484234 cd01484, E1-2_like, Ubiquitin activating enzyme (E 1e-63
pfam09358124 pfam09358, UBA_e1_C, Ubiquitin-activating enzyme e 7e-52
smart00985128 smart00985, UBA_e1_C, Ubiquitin-activating enzyme 8e-45
cd01489312 cd01489, Uba2_SUMO, Ubiquitin activating enzyme (E 4e-44
pfam00899134 pfam00899, ThiF, ThiF family 7e-39
cd01492197 cd01492, Aos1_SUMO, Ubiquitin activating enzyme (E 1e-35
cd01485198 cd01485, E1-1_like, Ubiquitin activating enzyme (E 2e-35
COG0476254 COG0476, ThiF, Dinucleotide-utilizing enzymes invo 1e-34
cd00757228 cd00757, ThiF_MoeB_HesA_family, ThiF_MoeB_HesA 5e-33
cd01488291 cd01488, Uba3_RUB, Ubiquitin activating enzyme (E1 2e-31
cd01483143 cd01483, E1_enzyme_family, Superfamily of activati 2e-31
COG0476254 COG0476, ThiF, Dinucleotide-utilizing enzymes invo 8e-29
TIGR02356202 TIGR02356, adenyl_thiF, thiazole biosynthesis aden 6e-25
pfam0213466 pfam02134, UBACT, Repeat in ubiquitin-activating ( 1e-23
cd01493425 cd01493, APPBP1_RUB, Ubiquitin activating enzyme ( 4e-22
TIGR02355240 TIGR02355, moeB, molybdopterin synthase sulfurylas 6e-22
cd01491286 cd01491, Ube1_repeat1, Ubiquitin activating enzyme 1e-21
PRK05690245 PRK05690, PRK05690, molybdopterin biosynthesis pro 2e-21
PRK08762376 PRK08762, PRK08762, molybdopterin biosynthesis pro 2e-19
pfam1058544 pfam10585, UBA_e1_thiolCys, Ubiquitin-activating e 4e-18
cd01492197 cd01492, Aos1_SUMO, Ubiquitin activating enzyme (E 1e-17
PRK08644212 PRK08644, PRK08644, thiamine biosynthesis protein 5e-17
TIGR02356202 TIGR02356, adenyl_thiF, thiazole biosynthesis aden 1e-16
pfam00899134 pfam00899, ThiF, ThiF family 3e-15
PRK07688339 PRK07688, PRK07688, thiamine/molybdopterin biosynt 1e-14
PRK05597355 PRK05597, PRK05597, molybdopterin biosynthesis pro 2e-14
PRK05600370 PRK05600, PRK05600, thiamine biosynthesis protein 2e-14
cd00757228 cd00757, ThiF_MoeB_HesA_family, ThiF_MoeB_HesA 3e-14
PRK12475338 PRK12475, PRK12475, thiamine/molybdopterin biosynt 3e-14
cd00755231 cd00755, YgdL_like, Family of activating enzymes ( 5e-14
cd01485198 cd01485, E1-1_like, Ubiquitin activating enzyme (E 2e-13
cd01483143 cd01483, E1_enzyme_family, Superfamily of activati 2e-13
PRK08328231 PRK08328, PRK08328, hypothetical protein; Provisio 2e-13
cd01484234 cd01484, E1-2_like, Ubiquitin activating enzyme (E 3e-13
cd01489312 cd01489, Uba2_SUMO, Ubiquitin activating enzyme (E 4e-13
PRK08328231 PRK08328, PRK08328, hypothetical protein; Provisio 9e-13
COG1179263 COG1179, COG1179, Dinucleotide-utilizing enzymes i 1e-12
PRK07878392 PRK07878, PRK07878, molybdopterin biosynthesis-lik 4e-12
cd01491286 cd01491, Ube1_repeat1, Ubiquitin activating enzyme 2e-11
TIGR02354200 TIGR02354, thiF_fam2, thiamine biosynthesis protei 2e-11
PTZ00245287 PTZ00245, PTZ00245, ubiquitin activating enzyme; P 6e-11
PRK05600370 PRK05600, PRK05600, thiamine biosynthesis protein 3e-10
PRK07411390 PRK07411, PRK07411, hypothetical protein; Validate 5e-10
cd01493425 cd01493, APPBP1_RUB, Ubiquitin activating enzyme ( 6e-10
PRK08223287 PRK08223, PRK08223, hypothetical protein; Validate 9e-10
cd01487174 cd01487, E1_ThiF_like, E1_ThiF_like 2e-09
TIGR02355240 TIGR02355, moeB, molybdopterin synthase sulfurylas 2e-08
PRK14852989 PRK14852, PRK14852, hypothetical protein; Provisio 4e-08
cd01488291 cd01488, Uba3_RUB, Ubiquitin activating enzyme (E1 1e-07
PRK05690245 PRK05690, PRK05690, molybdopterin biosynthesis pro 1e-07
PRK05597355 PRK05597, PRK05597, molybdopterin biosynthesis pro 2e-07
PRK14851679 PRK14851, PRK14851, hypothetical protein; Provisio 2e-07
cd01485198 cd01485, E1-1_like, Ubiquitin activating enzyme (E 4e-07
cd01489312 cd01489, Uba2_SUMO, Ubiquitin activating enzyme (E 3e-06
cd01487174 cd01487, E1_ThiF_like, E1_ThiF_like 5e-06
PRK07688339 PRK07688, PRK07688, thiamine/molybdopterin biosynt 6e-06
PRK15116268 PRK15116, PRK15116, sulfur acceptor protein CsdL; 8e-06
cd01484234 cd01484, E1-2_like, Ubiquitin activating enzyme (E 2e-05
TIGR02354200 TIGR02354, thiF_fam2, thiamine biosynthesis protei 2e-05
PRK08644212 PRK08644, PRK08644, thiamine biosynthesis protein 5e-05
cd01492197 cd01492, Aos1_SUMO, Ubiquitin activating enzyme (E 1e-04
cd00755231 cd00755, YgdL_like, Family of activating enzymes ( 1e-04
COG1179263 COG1179, COG1179, Dinucleotide-utilizing enzymes i 1e-04
pfam0213466 pfam02134, UBACT, Repeat in ubiquitin-activating ( 2e-04
PRK08762376 PRK08762, PRK08762, molybdopterin biosynthesis pro 3e-04
cd01486307 cd01486, Apg7, Apg7 is an E1-like protein, that ac 5e-04
PRK12475338 PRK12475, PRK12475, thiamine/molybdopterin biosynt 6e-04
cd01488291 cd01488, Uba3_RUB, Ubiquitin activating enzyme (E1 0.001
cd01486307 cd01486, Apg7, Apg7 is an E1-like protein, that ac 0.002
>gnl|CDD|130475 TIGR01408, Ube1, ubiquitin-activating enzyme E1 Back     alignment and domain information 
 Score = 1629 bits (4221), Expect = 0.0
 Identities = 526/1012 (51%), Positives = 683/1012 (67%), Gaps = 7/1012 (0%)

Query: 91   DIDEDLHSRQLAVYGRETMRRLFASNILVSGMQGLGAEIAKNLILAGVKSVTLHDEGTVE 150
            +IDE L+SRQL V G E M+++  SN+L+SGM GLG EIAKNL+LAGVKSVTLHD    +
Sbjct: 1    EIDEALYSRQLYVLGDEAMQKMAKSNVLISGMGGLGLEIAKNLVLAGVKSVTLHDTEKCQ 60

Query: 151  LWDLSSNFVFSDNDIGKNRALASVQKLQELNNAVVLSTLTSKLTKEQLSDFQAVVFTDIS 210
             WDLSSNF  S++D+G+NRA A V+KL ELN  V +S+ +    +E L  FQ VV T++S
Sbjct: 61   AWDLSSNFFLSEDDVGRNRAEAVVKKLAELNPYVHVSSSSVPFNEEFLDKFQCVVLTEMS 120

Query: 211  LDKAIEFDDFCHNHQPAISFIKAEVRGLFGSVFCDFGPEFTVVDVDGEDPHTGIIASISN 270
            L    E +DFCH+  P I+FI A+VRGLFGS+FCDFG EF V+D DGE+P TG IASI+ 
Sbjct: 121  LPLQKEINDFCHSQCPPIAFISADVRGLFGSLFCDFGDEFEVLDTDGEEPKTGFIASITQ 180

Query: 271  DNPALVSCVDDERLEFQDGDLVVFSEVHGMTELNDGKPRKIKSARPYSFTLEEDTTNYGT 330
             NP +V+C+++ R + + GD V F EV+GMT LNDG PRKI    PYSF++ + T   G 
Sbjct: 181  ANPGIVTCLENHRHKLETGDFVTFREVNGMTGLNDGSPRKITVISPYSFSIGDTTE-LGP 239

Query: 331  YVKGGIVTQVKQPKVLNFKPLREALEDPGDFLLSDFSKFDRPPPLHLAFQALDKFVSELG 390
            Y+ GGI TQVK PK + FK LRE L+DP   L+ DFSK +RPP +H AFQALD+F  +  
Sbjct: 240  YLHGGIATQVKTPKTVFFKSLREQLKDP-KCLIVDFSKPERPPEIHTAFQALDQFQEKYS 298

Query: 391  RFPVAGSEEDAQKLISVATNINESLGDGRVEDINTKLLRHFAFGARAVLNPMAAMFGGIV 450
            R P  G ++DA++L+ +AT+I+E+  + +V D++ KL+   ++ A+  L+PMAA  GG+V
Sbjct: 299  RKPNVGCQQDAEELLKLATSISET-LEEKVPDVDAKLVHWLSWTAQGFLSPMAAAVGGVV 357

Query: 451  GQEVVKACSGKFHPLYQFFYFDSVESLPTE-PLDSTEFKPINSRYDAQISVFGAKLQKKL 509
             QEV+KA +GKF PL Q+FYFDS ESLP+    +  EF P   RYDAQI+VFG   Q+KL
Sbjct: 358  SQEVLKAVTGKFSPLCQWFYFDSAESLPSLGKPECEEFLPRGDRYDAQIAVFGDTFQQKL 417

Query: 510  EDAKVFIVGSGALGCEFLKNVALMGVSCGNQGKLTITDDDVIEKSNLSRQFLFRDWNIGQ 569
            ++  +F+VG GA+GCE LKN ALMGV  G +G +T+TD D+IEKSNL+RQFLFR  +IG+
Sbjct: 418  QNLNIFLVGCGAIGCEMLKNFALMGVGTGKKGMITVTDPDLIEKSNLNRQFLFRPHHIGK 477

Query: 570  AKSTVAASAATSINPRLNIEALQNRVGPETENVFDDTFWENITCVINALDNVNARLYVDQ 629
             KS  AA A   INP++ I+A QNRVGPETE +F+D F+E +  VINALDNV AR YVD 
Sbjct: 478  PKSYTAADATLKINPQIKIDAHQNRVGPETETIFNDEFYEKLDVVINALDNVEARRYVDS 537

Query: 630  RCLYFQKPLLESGTLGAKCNTQMVIPHLTENYGASRDPPEKQAPMCTVHSFPHNIDHCLT 689
            RCL F KPLLESGTLG K NTQ+V+PHLTE+YG+SRDPPEK+ P CT+ SFP  I+H + 
Sbjct: 538  RCLAFLKPLLESGTLGTKGNTQVVVPHLTESYGSSRDPPEKEIPFCTLKSFPAAIEHTIQ 597

Query: 690  WARSEFEGLLEKTPAEVNAYLSNPVEYTTSMANAGDAQARDNLERVLECLDKEKCEIFQD 749
            WAR +FEGL    P+ VN YLS+P      +       +R+ LE++++ L KEK   F  
Sbjct: 598  WARDKFEGLFSHKPSLVNKYLSSPSSAEEVLQKIQSGHSREGLEQIIKLLSKEKPRNFSQ 657

Query: 750  CITWARLKFEDYFSNRVKQLIFTFPEDAATSTGAPFWSAPKRFPHPLQFSSADPSHLHFV 809
            C+ WARLKFE YF+N+  QL+  FP D  TSTG+PFWS+PKR P PL+F   +P HL F+
Sbjct: 658  CVEWARLKFEKYFNNKALQLLHCFPLDIRTSTGSPFWSSPKRPPSPLKFDLNEPLHLSFI 717

Query: 810  MAASILRAETFGIPIPDWTNNPKMLAEAVDKVMVPDFLPKKDAKILTDEKATTLSTASVD 869
             AA+ L A  +GIP  +   +   L   + +V +P+F P+ + KI TDE A    TA  D
Sbjct: 718  QAAAKLYATVYGIPFAEEDLSADALLNILSEVKIPEFKPRSNKKIQTDETARKPDTAPED 777

Query: 870  DAAVINDLIIKLEQCRKNLPSGFRLKPIQFEKDDDTNYHMDMIAGLANMRARNYSIPEVD 929
            D   I  L   +        S FR+ P+ FEKDDD N H+D I   +N+RA+NYSI   D
Sbjct: 778  DRNAIFQLEKAILSNEATK-SDFRMAPLSFEKDDDHNGHIDFITAASNLRAKNYSIEPAD 836

Query: 930  KLKAKFIAGRIIPAIATSTAMATGLVCLELYKVLDGGHKLEDYRNTFANLALPLFSMAEP 989
            + K KFIAG+IIPAIATSTA  +GLVCLEL KV DGG+K E Y+N F NLA+PLF   EP
Sbjct: 837  RFKTKFIAGKIIPAIATSTATVSGLVCLELIKVTDGGYKFEVYKNCFLNLAIPLFVFTEP 896

Query: 990  VPPKVIKHRDMSW-TVWDRWILKDNPTLRELIQWLK-DKGLNAYSISCGSCLLFNSMFPR 1047
               +  K R+    T+WDRW L  + TL E I  +K   GL    +S G  LL+  + P 
Sbjct: 897  TEVRKTKIRNGISFTIWDRWTLHGDFTLLEFINAVKEKYGLEPTMVSQGVKLLYVPVMPG 956

Query: 1048 HKERMDKKVVDLAREVAKVELPPYRRHLDVVVACEDDEDNDIDIPLISIYFR 1099
            H ER+  K+  L +   K +LPPYR HL V  AC+DD D D+  P + IYF 
Sbjct: 957  HAERLKLKMHKLVKPTTKKKLPPYRVHLTVSFACDDDGDEDVPGPPVRIYFS 1008

This model represents the full length, over a thousand amino acids, of a multicopy family of eukaryotic proteins, many of which are designated ubiquitin-activating enzyme E1. Members have two copies of the ThiF family domain (pfam00899), a repeat found in ubiquitin-activating proteins (pfam02134), and other regions. Length = 1008
>gnl|CDD|238767 cd01490, Ube1_repeat2, Ubiquitin activating enzyme (E1), repeat 2 Back     alignment and domain information
>gnl|CDD|238768 cd01491, Ube1_repeat1, Ubiquitin activating enzyme (E1), repeat 1 Back     alignment and domain information
>gnl|CDD|238767 cd01490, Ube1_repeat2, Ubiquitin activating enzyme (E1), repeat 2 Back     alignment and domain information
>gnl|CDD|238761 cd01484, E1-2_like, Ubiquitin activating enzyme (E1), repeat 2-like Back     alignment and domain information
>gnl|CDD|220201 pfam09358, UBA_e1_C, Ubiquitin-activating enzyme e1 C-terminal domain Back     alignment and domain information
>gnl|CDD|214955 smart00985, UBA_e1_C, Ubiquitin-activating enzyme e1 C-terminal domain Back     alignment and domain information
>gnl|CDD|238766 cd01489, Uba2_SUMO, Ubiquitin activating enzyme (E1) subunit UBA2 Back     alignment and domain information
>gnl|CDD|216180 pfam00899, ThiF, ThiF family Back     alignment and domain information
>gnl|CDD|238769 cd01492, Aos1_SUMO, Ubiquitin activating enzyme (E1) subunit Aos1 Back     alignment and domain information
>gnl|CDD|238762 cd01485, E1-1_like, Ubiquitin activating enzyme (E1), repeat 1-like Back     alignment and domain information
>gnl|CDD|223552 COG0476, ThiF, Dinucleotide-utilizing enzymes involved in molybdopterin and thiamine biosynthesis family 2 [Coenzyme metabolism] Back     alignment and domain information
>gnl|CDD|238386 cd00757, ThiF_MoeB_HesA_family, ThiF_MoeB_HesA Back     alignment and domain information
>gnl|CDD|238765 cd01488, Uba3_RUB, Ubiquitin activating enzyme (E1) subunit UBA3 Back     alignment and domain information
>gnl|CDD|238760 cd01483, E1_enzyme_family, Superfamily of activating enzymes (E1) of the ubiquitin-like proteins Back     alignment and domain information
>gnl|CDD|223552 COG0476, ThiF, Dinucleotide-utilizing enzymes involved in molybdopterin and thiamine biosynthesis family 2 [Coenzyme metabolism] Back     alignment and domain information
>gnl|CDD|162820 TIGR02356, adenyl_thiF, thiazole biosynthesis adenylyltransferase ThiF, E Back     alignment and domain information
>gnl|CDD|202124 pfam02134, UBACT, Repeat in ubiquitin-activating (UBA) protein Back     alignment and domain information
>gnl|CDD|238770 cd01493, APPBP1_RUB, Ubiquitin activating enzyme (E1) subunit APPBP1 Back     alignment and domain information
>gnl|CDD|131408 TIGR02355, moeB, molybdopterin synthase sulfurylase MoeB Back     alignment and domain information
>gnl|CDD|238768 cd01491, Ube1_repeat1, Ubiquitin activating enzyme (E1), repeat 1 Back     alignment and domain information
>gnl|CDD|180204 PRK05690, PRK05690, molybdopterin biosynthesis protein MoeB; Provisional Back     alignment and domain information
>gnl|CDD|236337 PRK08762, PRK08762, molybdopterin biosynthesis protein MoeB; Validated Back     alignment and domain information
>gnl|CDD|192635 pfam10585, UBA_e1_thiolCys, Ubiquitin-activating enzyme active site Back     alignment and domain information
>gnl|CDD|238769 cd01492, Aos1_SUMO, Ubiquitin activating enzyme (E1) subunit Aos1 Back     alignment and domain information
>gnl|CDD|236320 PRK08644, PRK08644, thiamine biosynthesis protein ThiF; Provisional Back     alignment and domain information
>gnl|CDD|162820 TIGR02356, adenyl_thiF, thiazole biosynthesis adenylyltransferase ThiF, E Back     alignment and domain information
>gnl|CDD|216180 pfam00899, ThiF, ThiF family Back     alignment and domain information
>gnl|CDD|181084 PRK07688, PRK07688, thiamine/molybdopterin biosynthesis ThiF/MoeB-like protein; Validated Back     alignment and domain information
>gnl|CDD|235526 PRK05597, PRK05597, molybdopterin biosynthesis protein MoeB; Validated Back     alignment and domain information
>gnl|CDD|235528 PRK05600, PRK05600, thiamine biosynthesis protein ThiF; Validated Back     alignment and domain information
>gnl|CDD|238386 cd00757, ThiF_MoeB_HesA_family, ThiF_MoeB_HesA Back     alignment and domain information
>gnl|CDD|183547 PRK12475, PRK12475, thiamine/molybdopterin biosynthesis MoeB-like protein; Provisional Back     alignment and domain information
>gnl|CDD|238384 cd00755, YgdL_like, Family of activating enzymes (E1) of ubiquitin-like proteins related to the E Back     alignment and domain information
>gnl|CDD|238762 cd01485, E1-1_like, Ubiquitin activating enzyme (E1), repeat 1-like Back     alignment and domain information
>gnl|CDD|238760 cd01483, E1_enzyme_family, Superfamily of activating enzymes (E1) of the ubiquitin-like proteins Back     alignment and domain information
>gnl|CDD|169382 PRK08328, PRK08328, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|238761 cd01484, E1-2_like, Ubiquitin activating enzyme (E1), repeat 2-like Back     alignment and domain information
>gnl|CDD|238766 cd01489, Uba2_SUMO, Ubiquitin activating enzyme (E1) subunit UBA2 Back     alignment and domain information
>gnl|CDD|169382 PRK08328, PRK08328, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|224100 COG1179, COG1179, Dinucleotide-utilizing enzymes involved in molybdopterin and thiamine biosynthesis family 1 [Coenzyme metabolism] Back     alignment and domain information
>gnl|CDD|181156 PRK07878, PRK07878, molybdopterin biosynthesis-like protein MoeZ; Validated Back     alignment and domain information
>gnl|CDD|238768 cd01491, Ube1_repeat1, Ubiquitin activating enzyme (E1), repeat 1 Back     alignment and domain information
>gnl|CDD|162819 TIGR02354, thiF_fam2, thiamine biosynthesis protein ThiF, family 2 Back     alignment and domain information
>gnl|CDD|140272 PTZ00245, PTZ00245, ubiquitin activating enzyme; Provisional Back     alignment and domain information
>gnl|CDD|235528 PRK05600, PRK05600, thiamine biosynthesis protein ThiF; Validated Back     alignment and domain information
>gnl|CDD|180967 PRK07411, PRK07411, hypothetical protein; Validated Back     alignment and domain information
>gnl|CDD|238770 cd01493, APPBP1_RUB, Ubiquitin activating enzyme (E1) subunit APPBP1 Back     alignment and domain information
>gnl|CDD|181302 PRK08223, PRK08223, hypothetical protein; Validated Back     alignment and domain information
>gnl|CDD|238764 cd01487, E1_ThiF_like, E1_ThiF_like Back     alignment and domain information
>gnl|CDD|131408 TIGR02355, moeB, molybdopterin synthase sulfurylase MoeB Back     alignment and domain information
>gnl|CDD|184854 PRK14852, PRK14852, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|238765 cd01488, Uba3_RUB, Ubiquitin activating enzyme (E1) subunit UBA3 Back     alignment and domain information
>gnl|CDD|180204 PRK05690, PRK05690, molybdopterin biosynthesis protein MoeB; Provisional Back     alignment and domain information
>gnl|CDD|235526 PRK05597, PRK05597, molybdopterin biosynthesis protein MoeB; Validated Back     alignment and domain information
>gnl|CDD|184853 PRK14851, PRK14851, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|238762 cd01485, E1-1_like, Ubiquitin activating enzyme (E1), repeat 1-like Back     alignment and domain information
>gnl|CDD|238766 cd01489, Uba2_SUMO, Ubiquitin activating enzyme (E1) subunit UBA2 Back     alignment and domain information
>gnl|CDD|238764 cd01487, E1_ThiF_like, E1_ThiF_like Back     alignment and domain information
>gnl|CDD|181084 PRK07688, PRK07688, thiamine/molybdopterin biosynthesis ThiF/MoeB-like protein; Validated Back     alignment and domain information
>gnl|CDD|185071 PRK15116, PRK15116, sulfur acceptor protein CsdL; Provisional Back     alignment and domain information
>gnl|CDD|238761 cd01484, E1-2_like, Ubiquitin activating enzyme (E1), repeat 2-like Back     alignment and domain information
>gnl|CDD|162819 TIGR02354, thiF_fam2, thiamine biosynthesis protein ThiF, family 2 Back     alignment and domain information
>gnl|CDD|236320 PRK08644, PRK08644, thiamine biosynthesis protein ThiF; Provisional Back     alignment and domain information
>gnl|CDD|238769 cd01492, Aos1_SUMO, Ubiquitin activating enzyme (E1) subunit Aos1 Back     alignment and domain information
>gnl|CDD|238384 cd00755, YgdL_like, Family of activating enzymes (E1) of ubiquitin-like proteins related to the E Back     alignment and domain information
>gnl|CDD|224100 COG1179, COG1179, Dinucleotide-utilizing enzymes involved in molybdopterin and thiamine biosynthesis family 1 [Coenzyme metabolism] Back     alignment and domain information
>gnl|CDD|202124 pfam02134, UBACT, Repeat in ubiquitin-activating (UBA) protein Back     alignment and domain information
>gnl|CDD|236337 PRK08762, PRK08762, molybdopterin biosynthesis protein MoeB; Validated Back     alignment and domain information
>gnl|CDD|238763 cd01486, Apg7, Apg7 is an E1-like protein, that activates two different ubiquitin-like proteins, Apg12 and Apg8, and assigns them to specific E2 enzymes, Apg10 and Apg3, respectively Back     alignment and domain information
>gnl|CDD|183547 PRK12475, PRK12475, thiamine/molybdopterin biosynthesis MoeB-like protein; Provisional Back     alignment and domain information
>gnl|CDD|238765 cd01488, Uba3_RUB, Ubiquitin activating enzyme (E1) subunit UBA3 Back     alignment and domain information
>gnl|CDD|238763 cd01486, Apg7, Apg7 is an E1-like protein, that activates two different ubiquitin-like proteins, Apg12 and Apg8, and assigns them to specific E2 enzymes, Apg10 and Apg3, respectively Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 1099
KOG20121013 consensus Ubiquitin activating enzyme UBA1 [Posttr 100.0
TIGR014081008 Ube1 ubiquitin-activating enzyme E1. This model re 100.0
cd01490435 Ube1_repeat2 Ubiquitin activating enzyme (E1), rep 100.0
KOG2013603 consensus SMT3/SUMO-activating complex, catalytic 100.0
cd01489312 Uba2_SUMO Ubiquitin activating enzyme (E1) subunit 100.0
cd01491286 Ube1_repeat1 Ubiquitin activating enzyme (E1), rep 100.0
cd01484234 E1-2_like Ubiquitin activating enzyme (E1), repeat 100.0
KOG2015422 consensus NEDD8-activating complex, catalytic comp 100.0
cd01488291 Uba3_RUB Ubiquitin activating enzyme (E1) subunit 100.0
cd01493425 APPBP1_RUB Ubiquitin activating enzyme (E1) subuni 100.0
KOG2014331 consensus SMT3/SUMO-activating complex, AOS1/RAD31 100.0
KOG2016523 consensus NEDD8-activating complex, APP-BP1/UBA5 c 100.0
cd01492197 Aos1_SUMO Ubiquitin activating enzyme (E1) subunit 100.0
cd01485198 E1-1_like Ubiquitin activating enzyme (E1), repeat 100.0
PRK08223287 hypothetical protein; Validated 100.0
TIGR02356202 adenyl_thiF thiazole biosynthesis adenylyltransfer 100.0
cd00757228 ThiF_MoeB_HesA_family ThiF_MoeB_HesA. Family of E1 100.0
PRK05690245 molybdopterin biosynthesis protein MoeB; Provision 100.0
PRK07411390 hypothetical protein; Validated 100.0
PRK08328231 hypothetical protein; Provisional 100.0
PRK05597355 molybdopterin biosynthesis protein MoeB; Validated 100.0
TIGR02355240 moeB molybdopterin synthase sulfurylase MoeB. This 100.0
cd01492197 Aos1_SUMO Ubiquitin activating enzyme (E1) subunit 100.0
PRK05600370 thiamine biosynthesis protein ThiF; Validated 100.0
cd01493425 APPBP1_RUB Ubiquitin activating enzyme (E1) subuni 100.0
PRK07878392 molybdopterin biosynthesis-like protein MoeZ; Vali 100.0
cd01491286 Ube1_repeat1 Ubiquitin activating enzyme (E1), rep 100.0
cd01485198 E1-1_like Ubiquitin activating enzyme (E1), repeat 100.0
PRK07878392 molybdopterin biosynthesis-like protein MoeZ; Vali 100.0
PRK12475338 thiamine/molybdopterin biosynthesis MoeB-like prot 99.98
cd01489312 Uba2_SUMO Ubiquitin activating enzyme (E1) subunit 99.98
PRK07688339 thiamine/molybdopterin biosynthesis ThiF/MoeB-like 99.98
PRK08223287 hypothetical protein; Validated 99.97
PRK05690245 molybdopterin biosynthesis protein MoeB; Provision 99.97
TIGR02356202 adenyl_thiF thiazole biosynthesis adenylyltransfer 99.97
PRK08762376 molybdopterin biosynthesis protein MoeB; Validated 99.97
TIGR03736244 PRTRC_ThiF PRTRC system ThiF family protein. A nov 99.97
cd00757228 ThiF_MoeB_HesA_family ThiF_MoeB_HesA. Family of E1 99.97
COG0476254 ThiF Dinucleotide-utilizing enzymes involved in mo 99.97
PF09358125 UBA_e1_C: Ubiquitin-activating enzyme e1 C-termina 99.97
PRK07411390 hypothetical protein; Validated 99.97
KOG2017427 consensus Molybdopterin synthase sulfurylase [Coen 99.97
PRK05597355 molybdopterin biosynthesis protein MoeB; Validated 99.97
PRK14851679 hypothetical protein; Provisional 99.97
PRK08328231 hypothetical protein; Provisional 99.97
cd01488291 Uba3_RUB Ubiquitin activating enzyme (E1) subunit 99.97
PRK14852989 hypothetical protein; Provisional 99.96
TIGR02355240 moeB molybdopterin synthase sulfurylase MoeB. This 99.96
PRK05600370 thiamine biosynthesis protein ThiF; Validated 99.96
PRK15116268 sulfur acceptor protein CsdL; Provisional 99.96
cd01484234 E1-2_like Ubiquitin activating enzyme (E1), repeat 99.95
PRK07688339 thiamine/molybdopterin biosynthesis ThiF/MoeB-like 99.95
PRK12475338 thiamine/molybdopterin biosynthesis MoeB-like prot 99.95
cd00755231 YgdL_like Family of activating enzymes (E1) of ubi 99.95
PRK08644212 thiamine biosynthesis protein ThiF; Provisional 99.95
PRK07877722 hypothetical protein; Provisional 99.95
TIGR014081008 Ube1 ubiquitin-activating enzyme E1. This model re 99.95
PF00899135 ThiF: ThiF family; InterPro: IPR000594 Ubiquitin-a 99.95
PRK15116268 sulfur acceptor protein CsdL; Provisional 99.95
COG0476254 ThiF Dinucleotide-utilizing enzymes involved in mo 99.94
PTZ00245287 ubiquitin activating enzyme; Provisional 99.94
PRK14852989 hypothetical protein; Provisional 99.94
TIGR01381664 E1_like_apg7 E1-like protein-activating enzyme Gsa 99.94
COG1179263 Dinucleotide-utilizing enzymes involved in molybdo 99.94
cd01490435 Ube1_repeat2 Ubiquitin activating enzyme (E1), rep 99.94
PRK08762376 molybdopterin biosynthesis protein MoeB; Validated 99.94
PRK14851679 hypothetical protein; Provisional 99.94
KOG2015422 consensus NEDD8-activating complex, catalytic comp 99.94
KOG2013603 consensus SMT3/SUMO-activating complex, catalytic 99.93
cd01483143 E1_enzyme_family Superfamily of activating enzymes 99.93
TIGR03603318 cyclo_dehy_ocin bacteriocin biosynthesis cyclodehy 99.93
cd01486307 Apg7 Apg7 is an E1-like protein, that activates tw 99.93
PF00899135 ThiF: ThiF family; InterPro: IPR000594 Ubiquitin-a 99.93
KOG2017427 consensus Molybdopterin synthase sulfurylase [Coen 99.92
cd01487174 E1_ThiF_like E1_ThiF_like. Member of superfamily o 99.92
PRK08644212 thiamine biosynthesis protein ThiF; Provisional 99.92
cd00755231 YgdL_like Family of activating enzymes (E1) of ubi 99.92
cd01483143 E1_enzyme_family Superfamily of activating enzymes 99.92
TIGR02354200 thiF_fam2 thiamine biosynthesis protein ThiF, fami 99.91
PTZ00245287 ubiquitin activating enzyme; Provisional 99.9
PRK07877722 hypothetical protein; Provisional 99.89
PRK06153393 hypothetical protein; Provisional 99.89
COG1179263 Dinucleotide-utilizing enzymes involved in molybdo 99.89
cd01486307 Apg7 Apg7 is an E1-like protein, that activates tw 99.86
KOG2014331 consensus SMT3/SUMO-activating complex, AOS1/RAD31 99.86
cd01487174 E1_ThiF_like E1_ThiF_like. Member of superfamily o 99.86
KOG2336422 consensus Molybdopterin biosynthesis-related prote 99.86
TIGR02354200 thiF_fam2 thiamine biosynthesis protein ThiF, fami 99.86
TIGR01381664 E1_like_apg7 E1-like protein-activating enzyme Gsa 99.85
TIGR03603318 cyclo_dehy_ocin bacteriocin biosynthesis cyclodehy 99.85
KOG2016523 consensus NEDD8-activating complex, APP-BP1/UBA5 c 99.84
PF0213467 UBACT: Repeat in ubiquitin-activating (UBA) protei 99.83
KOG2018430 consensus Predicted dinucleotide-utilizing enzyme 99.82
PRK06153393 hypothetical protein; Provisional 99.79
KOG20121013 consensus Ubiquitin activating enzyme UBA1 [Posttr 99.79
TIGR03736244 PRTRC_ThiF PRTRC system ThiF family protein. A nov 99.75
KOG2018430 consensus Predicted dinucleotide-utilizing enzyme 99.72
PF1058545 UBA_e1_thiolCys: Ubiquitin-activating enzyme activ 99.57
KOG2336422 consensus Molybdopterin biosynthesis-related prote 99.53
TIGR03693637 ocin_ThiF_like putative thiazole-containing bacter 99.46
KOG2337669 consensus Ubiquitin activating E1 enzyme-like prot 99.39
TIGR03693637 ocin_ThiF_like putative thiazole-containing bacter 99.13
KOG2337669 consensus Ubiquitin activating E1 enzyme-like prot 99.09
PF0213467 UBACT: Repeat in ubiquitin-activating (UBA) protei 98.2
COG4015217 Predicted dinucleotide-utilizing enzyme of the Thi 97.93
PF0882584 E2_bind: E2 binding domain; InterPro: IPR014929 E1 97.58
PRK06718202 precorrin-2 dehydrogenase; Reviewed 97.49
TIGR03882193 cyclo_dehyd_2 bacteriocin biosynthesis cyclodehydr 97.43
TIGR01470205 cysG_Nterm siroheme synthase, N-terminal domain. T 97.38
COG1748389 LYS9 Saccharopine dehydrogenase and related protei 97.18
PF01488135 Shikimate_DH: Shikimate / quinate 5-dehydrogenase; 97.17
PRK06719157 precorrin-2 dehydrogenase; Validated 97.11
PRK12549284 shikimate 5-dehydrogenase; Reviewed 96.97
PF13241103 NAD_binding_7: Putative NAD(P)-binding; PDB: 3DFZ_ 96.94
PRK06718202 precorrin-2 dehydrogenase; Reviewed 96.93
COG1748389 LYS9 Saccharopine dehydrogenase and related protei 96.9
PRK12549284 shikimate 5-dehydrogenase; Reviewed 96.88
PRK05562223 precorrin-2 dehydrogenase; Provisional 96.87
COG4015217 Predicted dinucleotide-utilizing enzyme of the Thi 96.85
PF01488135 Shikimate_DH: Shikimate / quinate 5-dehydrogenase; 96.82
PRK06719157 precorrin-2 dehydrogenase; Validated 96.47
TIGR01470205 cysG_Nterm siroheme synthase, N-terminal domain. T 96.44
PF13241103 NAD_binding_7: Putative NAD(P)-binding; PDB: 3DFZ_ 96.43
PRK05562223 precorrin-2 dehydrogenase; Provisional 95.95
PRK10637457 cysG siroheme synthase; Provisional 95.89
PF03435386 Saccharop_dh: Saccharopine dehydrogenase ; InterPr 95.87
COG1648210 CysG Siroheme synthase (precorrin-2 oxidase/ferroc 95.85
PRK14027283 quinate/shikimate dehydrogenase; Provisional 95.62
PRK12548289 shikimate 5-dehydrogenase; Provisional 94.87
PRK14027283 quinate/shikimate dehydrogenase; Provisional 94.84
TIGR01809282 Shik-DH-AROM shikimate-5-dehydrogenase, fungal ARO 94.84
PF00056141 Ldh_1_N: lactate/malate dehydrogenase, NAD binding 94.69
COG0169283 AroE Shikimate 5-dehydrogenase [Amino acid transpo 94.66
COG0373414 HemA Glutamyl-tRNA reductase [Coenzyme metabolism] 94.65
PRK00258278 aroE shikimate 5-dehydrogenase; Reviewed 94.57
PRK12548289 shikimate 5-dehydrogenase; Provisional 94.56
PRK14106450 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 94.5
PRK07819286 3-hydroxybutyryl-CoA dehydrogenase; Validated 94.32
TIGR01809282 Shik-DH-AROM shikimate-5-dehydrogenase, fungal ARO 94.28
TIGR03882193 cyclo_dehyd_2 bacteriocin biosynthesis cyclodehydr 94.24
PF03435386 Saccharop_dh: Saccharopine dehydrogenase ; InterPr 94.21
PRK13940414 glutamyl-tRNA reductase; Provisional 94.18
COG1648210 CysG Siroheme synthase (precorrin-2 oxidase/ferroc 94.11
PF0523784 MoeZ_MoeB: MoeZ/MoeB domain; InterPro: IPR007901 T 93.98
PF01113124 DapB_N: Dihydrodipicolinate reductase, N-terminus; 93.9
cd05291306 HicDH_like L-2-hydroxyisocapronate dehydrogenases 93.86
PF03446163 NAD_binding_2: NAD binding domain of 6-phosphogluc 93.84
PRK00258278 aroE shikimate 5-dehydrogenase; Reviewed 93.73
PRK14106450 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 93.73
PRK07066321 3-hydroxybutyryl-CoA dehydrogenase; Validated 93.58
COG0373414 HemA Glutamyl-tRNA reductase [Coenzyme metabolism] 93.52
PRK12749288 quinate/shikimate dehydrogenase; Reviewed 93.49
PRK13940414 glutamyl-tRNA reductase; Provisional 93.47
PRK04148134 hypothetical protein; Provisional 93.35
cd01065155 NAD_bind_Shikimate_DH NAD(P) binding domain of Shi 93.33
PRK12749288 quinate/shikimate dehydrogenase; Reviewed 93.31
COG0569225 TrkA K+ transport systems, NAD-binding component [ 93.3
PF0007080 Pyr_redox: Pyridine nucleotide-disulphide oxidored 93.28
PRK10637457 cysG siroheme synthase; Provisional 93.21
PF02254116 TrkA_N: TrkA-N domain; InterPro: IPR003148 The reg 93.16
PF02737180 3HCDH_N: 3-hydroxyacyl-CoA dehydrogenase, NAD bind 93.16
PF1473287 UAE_UbL: Ubiquitin/SUMO-activating enzyme ubiquiti 93.12
PLN00203519 glutamyl-tRNA reductase 93.01
PF02826178 2-Hacid_dh_C: D-isomer specific 2-hydroxyacid dehy 92.97
PRK05808282 3-hydroxybutyryl-CoA dehydrogenase; Validated 92.94
KOG4169261 consensus 15-hydroxyprostaglandin dehydrogenase an 92.92
cd01080168 NAD_bind_m-THF_DH_Cyclohyd NADP binding domain of 92.63
cd00300300 LDH_like L-lactate dehydrogenase-like enzymes. Mem 92.6
cd05213311 NAD_bind_Glutamyl_tRNA_reduct NADP-binding domain 92.58
cd01065155 NAD_bind_Shikimate_DH NAD(P) binding domain of Shi 92.57
PRK00066315 ldh L-lactate dehydrogenase; Reviewed 92.43
COG0569225 TrkA K+ transport systems, NAD-binding component [ 92.4
PRK05708305 2-dehydropantoate 2-reductase; Provisional 92.26
PRK09260288 3-hydroxybutyryl-CoA dehydrogenase; Validated 92.12
TIGR01035417 hemA glutamyl-tRNA reductase. This enzyme, togethe 92.09
PRK04148134 hypothetical protein; Provisional 92.0
KOG4169261 consensus 15-hydroxyprostaglandin dehydrogenase an 91.98
COG0169283 AroE Shikimate 5-dehydrogenase [Amino acid transpo 91.91
PF01118121 Semialdhyde_dh: Semialdehyde dehydrogenase, NAD bi 91.76
PRK06130311 3-hydroxybutyryl-CoA dehydrogenase; Validated 91.63
cd05290307 LDH_3 A subgroup of L-lactate dehydrogenases. L-la 91.59
cd05311226 NAD_bind_2_malic_enz NAD(P) binding domain of mali 91.55
cd05311226 NAD_bind_2_malic_enz NAD(P) binding domain of mali 91.54
PLN02602350 lactate dehydrogenase 91.35
cd05213311 NAD_bind_Glutamyl_tRNA_reduct NADP-binding domain 91.28
PLN028191042 lysine-ketoglutarate reductase/saccharopine dehydr 91.25
cd05293312 LDH_1 A subgroup of L-lactate dehydrogenases. L-la 91.1
cd05291306 HicDH_like L-2-hydroxyisocapronate dehydrogenases 90.88
PF1058545 UBA_e1_thiolCys: Ubiquitin-activating enzyme activ 90.79
PRK08293287 3-hydroxybutyryl-CoA dehydrogenase; Validated 90.73
PRK05476425 S-adenosyl-L-homocysteine hydrolase; Provisional 90.68
PRK01710458 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 90.67
cd01078194 NAD_bind_H4MPT_DH NADP binding domain of methylene 90.35
PF00056141 Ldh_1_N: lactate/malate dehydrogenase, NAD binding 90.32
PRK07819286 3-hydroxybutyryl-CoA dehydrogenase; Validated 90.28
PRK01438480 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 90.14
cd05290307 LDH_3 A subgroup of L-lactate dehydrogenases. L-la 90.13
PF03446163 NAD_binding_2: NAD binding domain of 6-phosphogluc 90.11
PRK00141473 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 90.08
cd01078194 NAD_bind_H4MPT_DH NADP binding domain of methylene 90.04
PRK00066315 ldh L-lactate dehydrogenase; Reviewed 89.98
PRK09599301 6-phosphogluconate dehydrogenase-like protein; Rev 89.9
COG0111324 SerA Phosphoglycerate dehydrogenase and related de 89.87
PRK14192283 bifunctional 5,10-methylene-tetrahydrofolate dehyd 89.56
PF0380796 F420_oxidored: NADP oxidoreductase coenzyme F420-d 89.45
PRK05808282 3-hydroxybutyryl-CoA dehydrogenase; Validated 89.25
PTZ00117319 malate dehydrogenase; Provisional 89.1
TIGR02992326 ectoine_eutC ectoine utilization protein EutC. Mem 89.07
cd01075200 NAD_bind_Leu_Phe_Val_DH NAD(P) binding domain of l 89.06
PRK00045423 hemA glutamyl-tRNA reductase; Reviewed 89.02
PRK00048257 dihydrodipicolinate reductase; Provisional 89.0
PRK06197306 short chain dehydrogenase; Provisional 88.96
PF0007080 Pyr_redox: Pyridine nucleotide-disulphide oxidored 88.95
PRK08618325 ornithine cyclodeaminase; Validated 88.95
PF02737180 3HCDH_N: 3-hydroxyacyl-CoA dehydrogenase, NAD bind 88.93
PRK07063260 short chain dehydrogenase; Provisional 88.9
PRK06130311 3-hydroxybutyryl-CoA dehydrogenase; Validated 88.88
PRK09496453 trkA potassium transporter peripheral membrane com 88.72
PRK05854313 short chain dehydrogenase; Provisional 88.63
TIGR00507270 aroE shikimate 5-dehydrogenase. This model finds p 88.61
PRK08410311 2-hydroxyacid dehydrogenase; Provisional 88.59
TIGR00507270 aroE shikimate 5-dehydrogenase. This model finds p 88.54
PRK13243333 glyoxylate reductase; Reviewed 88.5
PRK15469312 ghrA bifunctional glyoxylate/hydroxypyruvate reduc 88.37
PRK06197306 short chain dehydrogenase; Provisional 88.36
cd00401413 AdoHcyase S-adenosyl-L-homocysteine hydrolase (Ado 88.26
PLN00203519 glutamyl-tRNA reductase 88.26
PRK07574385 formate dehydrogenase; Provisional 88.22
PRK07066321 3-hydroxybutyryl-CoA dehydrogenase; Validated 88.22
PF01210157 NAD_Gly3P_dh_N: NAD-dependent glycerol-3-phosphate 88.19
PRK14619308 NAD(P)H-dependent glycerol-3-phosphate dehydrogena 88.11
PRK06035291 3-hydroxyacyl-CoA dehydrogenase; Validated 88.09
PRK03562621 glutathione-regulated potassium-efflux system prot 88.09
PRK06487317 glycerate dehydrogenase; Provisional 88.08
PTZ00082321 L-lactate dehydrogenase; Provisional 87.94
cd00401413 AdoHcyase S-adenosyl-L-homocysteine hydrolase (Ado 87.81
PRK07530292 3-hydroxybutyryl-CoA dehydrogenase; Validated 87.8
PRK03659601 glutathione-regulated potassium-efflux system prot 87.72
PLN03209576 translocon at the inner envelope of chloroplast su 87.69
PRK02705459 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 87.6
PRK09242257 tropinone reductase; Provisional 87.53
PRK07502307 cyclohexadienyl dehydrogenase; Validated 87.48
PRK11908347 NAD-dependent epimerase/dehydratase family protein 87.34
PRK06932314 glycerate dehydrogenase; Provisional 87.33
TIGR01759323 MalateDH-SF1 malate dehydrogenase. This model repr 87.25
PF02056183 Glyco_hydro_4: Family 4 glycosyl hydrolase; InterP 87.23
PRK07831262 short chain dehydrogenase; Provisional 87.04
cd0519186 NAD_bind_amino_acid_DH NAD(P) binding domain of am 87.02
PRK06141314 ornithine cyclodeaminase; Validated 86.98
PRK11880267 pyrroline-5-carboxylate reductase; Reviewed 86.89
PRK07634245 pyrroline-5-carboxylate reductase; Reviewed 86.88
PRK15438378 erythronate-4-phosphate dehydrogenase PdxB; Provis 86.84
PRK07062265 short chain dehydrogenase; Provisional 86.81
PRK05476425 S-adenosyl-L-homocysteine hydrolase; Provisional 86.78
PLN02206442 UDP-glucuronate decarboxylase 86.78
PRK14175286 bifunctional 5,10-methylene-tetrahydrofolate dehyd 86.75
cd0519186 NAD_bind_amino_acid_DH NAD(P) binding domain of am 86.74
COG0039313 Mdh Malate/lactate dehydrogenases [Energy producti 86.73
COG0300265 DltE Short-chain dehydrogenases of various substra 86.71
PLN03139386 formate dehydrogenase; Provisional 86.67
PRK07340304 ornithine cyclodeaminase; Validated 86.62
cd05293312 LDH_1 A subgroup of L-lactate dehydrogenases. L-la 86.61
COG0771448 MurD UDP-N-acetylmuramoylalanine-D-glutamate ligas 86.61
TIGR00936406 ahcY adenosylhomocysteinase. This enzyme hydrolyze 86.58
PTZ00325321 malate dehydrogenase; Provisional 86.47
PF01113124 DapB_N: Dihydrodipicolinate reductase, N-terminus; 86.42
PF0380796 F420_oxidored: NADP oxidoreductase coenzyme F420-d 86.38
TIGR00872298 gnd_rel 6-phosphogluconate dehydrogenase (decarbox 86.36
PLN028191042 lysine-ketoglutarate reductase/saccharopine dehydr 86.32
TIGR00872298 gnd_rel 6-phosphogluconate dehydrogenase (decarbox 86.31
PRK06436303 glycerate dehydrogenase; Provisional 86.15
PRK00257381 erythronate-4-phosphate dehydrogenase; Validated 86.12
PRK06522304 2-dehydropantoate 2-reductase; Reviewed 86.1
PRK04308445 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 86.09
PF02254116 TrkA_N: TrkA-N domain; InterPro: IPR003148 The reg 86.06
PRK09599301 6-phosphogluconate dehydrogenase-like protein; Rev 85.97
PRK10537393 voltage-gated potassium channel; Provisional 85.91
PLN02545295 3-hydroxybutyryl-CoA dehydrogenase 85.85
COG1086588 Predicted nucleoside-diphosphate sugar epimerases 85.79
PRK15469312 ghrA bifunctional glyoxylate/hydroxypyruvate reduc 85.72
PLN02602350 lactate dehydrogenase 85.53
PRK06035291 3-hydroxyacyl-CoA dehydrogenase; Validated 85.42
PRK08618325 ornithine cyclodeaminase; Validated 85.41
PRK07531495 bifunctional 3-hydroxyacyl-CoA dehydrogenase/thioe 85.39
PLN02350493 phosphogluconate dehydrogenase (decarboxylating) 85.31
PRK08293287 3-hydroxybutyryl-CoA dehydrogenase; Validated 85.25
PRK07576264 short chain dehydrogenase; Provisional 85.23
PRK07680273 late competence protein ComER; Validated 85.22
PRK08251248 short chain dehydrogenase; Provisional 85.18
PF02826178 2-Hacid_dh_C: D-isomer specific 2-hydroxyacid dehy 85.13
cd00300300 LDH_like L-lactate dehydrogenase-like enzymes. Mem 85.08
PRK02006498 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 84.92
COG1063350 Tdh Threonine dehydrogenase and related Zn-depende 84.92
PRK00094325 gpsA NAD(P)H-dependent glycerol-3-phosphate dehydr 84.92
PRK12826251 3-ketoacyl-(acyl-carrier-protein) reductase; Revie 84.89
PF13460183 NAD_binding_10: NADH(P)-binding ; PDB: 3OH8_A 3E8X 84.84
PRK07417279 arogenate dehydrogenase; Reviewed 84.8
TIGR00465314 ilvC ketol-acid reductoisomerase. This is the seco 84.72
PRK05708305 2-dehydropantoate 2-reductase; Provisional 84.68
cd05296419 GH4_P_beta_glucosidase Glycoside Hydrolases Family 84.66
PF02558151 ApbA: Ketopantoate reductase PanE/ApbA; InterPro: 84.64
cd01075200 NAD_bind_Leu_Phe_Val_DH NAD(P) binding domain of l 84.64
PRK05854313 short chain dehydrogenase; Provisional 84.6
PRK09496453 trkA potassium transporter peripheral membrane com 84.5
PRK06223307 malate dehydrogenase; Reviewed 84.5
PRK07679279 pyrroline-5-carboxylate reductase; Reviewed 84.15
PRK02472447 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 84.15
PRK03562621 glutathione-regulated potassium-efflux system prot 84.12
cd01339300 LDH-like_MDH L-lactate dehydrogenase-like malate d 84.03
PRK04690468 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 83.97
PRK12921305 2-dehydropantoate 2-reductase; Provisional 83.91
PRK09242257 tropinone reductase; Provisional 83.8
PLN02206442 UDP-glucuronate decarboxylase 83.76
PRK14618328 NAD(P)H-dependent glycerol-3-phosphate dehydrogena 83.75
PRK05867253 short chain dehydrogenase; Provisional 83.75
PRK09260288 3-hydroxybutyryl-CoA dehydrogenase; Validated 83.71
PF01118121 Semialdhyde_dh: Semialdehyde dehydrogenase, NAD bi 83.67
cd01338322 MDH_choloroplast_like Chloroplast-like malate dehy 83.67
PLN03209576 translocon at the inner envelope of chloroplast su 83.57
PRK05335436 tRNA (uracil-5-)-methyltransferase Gid; Reviewed 83.5
PLN02928347 oxidoreductase family protein 83.47
PRK07531495 bifunctional 3-hydroxyacyl-CoA dehydrogenase/thioe 83.46
PRK12490299 6-phosphogluconate dehydrogenase-like protein; Rev 83.41
PRK06249313 2-dehydropantoate 2-reductase; Provisional 83.26
PRK14620326 NAD(P)H-dependent glycerol-3-phosphate dehydrogena 83.22
PRK06928277 pyrroline-5-carboxylate reductase; Reviewed 83.2
cd05292308 LDH_2 A subgroup of L-lactate dehydrogenases. L-la 83.2
PRK07523255 gluconate 5-dehydrogenase; Provisional 83.17
PTZ00142470 6-phosphogluconate dehydrogenase; Provisional 83.15
PRK14619308 NAD(P)H-dependent glycerol-3-phosphate dehydrogena 83.14
PRK09186256 flagellin modification protein A; Provisional 83.07
PRK08217253 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 83.05
PRK11154708 fadJ multifunctional fatty acid oxidation complex 82.98
PRK06523260 short chain dehydrogenase; Provisional 82.96
PRK03803448 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 82.88
PRK05479330 ketol-acid reductoisomerase; Provisional 82.79
KOG0069336 consensus Glyoxylate/hydroxypyruvate reductase (D- 82.73
PRK08339263 short chain dehydrogenase; Provisional 82.73
PRK13304265 L-aspartate dehydrogenase; Reviewed 82.73
PRK08291330 ectoine utilization protein EutC; Validated 82.73
PLN03129581 NADP-dependent malic enzyme; Provisional 82.69
PRK04663438 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 82.59
PF00106167 adh_short: short chain dehydrogenase alcohol dehyd 82.59
COG1893307 ApbA Ketopantoate reductase [Coenzyme metabolism] 82.58
PRK11880267 pyrroline-5-carboxylate reductase; Reviewed 82.56
PTZ00431260 pyrroline carboxylate reductase; Provisional 82.55
TIGR01757387 Malate-DH_plant malate dehydrogenase, NADP-depende 82.46
PRK10669558 putative cation:proton antiport protein; Provision 82.42
TIGR00518370 alaDH alanine dehydrogenase. The family of known L 82.38
TIGR00065349 ftsZ cell division protein FtsZ. This family consi 82.38
PLN02780320 ketoreductase/ oxidoreductase 82.35
PRK06476258 pyrroline-5-carboxylate reductase; Reviewed 82.32
TIGR01915219 npdG NADPH-dependent F420 reductase. This model re 82.31
PRK13529563 malate dehydrogenase; Provisional 82.29
PRK13243333 glyoxylate reductase; Reviewed 82.13
PLN02306386 hydroxypyruvate reductase 82.12
PRK11790409 D-3-phosphoglycerate dehydrogenase; Provisional 81.98
cd05296419 GH4_P_beta_glucosidase Glycoside Hydrolases Family 81.95
PRK07067257 sorbitol dehydrogenase; Provisional 81.93
TIGR00873467 gnd 6-phosphogluconate dehydrogenase, decarboxylat 81.85
TIGR01763305 MalateDH_bact malate dehydrogenase, NAD-dependent. 81.84
PRK07478254 short chain dehydrogenase; Provisional 81.79
PRK07062265 short chain dehydrogenase; Provisional 81.79
PLN02240352 UDP-glucose 4-epimerase 81.75
PRK07063260 short chain dehydrogenase; Provisional 81.73
PF02558151 ApbA: Ketopantoate reductase PanE/ApbA; InterPro: 81.66
PTZ00082321 L-lactate dehydrogenase; Provisional 81.65
PF13460183 NAD_binding_10: NADH(P)-binding ; PDB: 3OH8_A 3E8X 81.58
PF00106167 adh_short: short chain dehydrogenase alcohol dehyd 81.57
cd00650263 LDH_MDH_like NAD-dependent, lactate dehydrogenase- 81.56
PRK08229341 2-dehydropantoate 2-reductase; Provisional 81.56
PRK08655437 prephenate dehydrogenase; Provisional 81.43
PLN02350493 phosphogluconate dehydrogenase (decarboxylating) 81.42
PRK09880343 L-idonate 5-dehydrogenase; Provisional 81.4
PRK12384259 sorbitol-6-phosphate dehydrogenase; Provisional 81.37
PLN02427386 UDP-apiose/xylose synthase 81.37
PLN02240352 UDP-glucose 4-epimerase 81.35
PRK07634245 pyrroline-5-carboxylate reductase; Reviewed 81.34
TIGR01771299 L-LDH-NAD L-lactate dehydrogenase. This model repr 81.18
TIGR01035417 hemA glutamyl-tRNA reductase. This enzyme, togethe 81.17
PF01210157 NAD_Gly3P_dh_N: NAD-dependent glycerol-3-phosphate 81.16
TIGR02279503 PaaC-3OHAcCoADH 3-hydroxyacyl-CoA dehydrogenase Pa 81.14
KOG0024354 consensus Sorbitol dehydrogenase [Secondary metabo 81.14
PLN02253280 xanthoxin dehydrogenase 81.11
PRK06139330 short chain dehydrogenase; Provisional 80.95
TIGR02992326 ectoine_eutC ectoine utilization protein EutC. Mem 80.95
PTZ00117319 malate dehydrogenase; Provisional 80.92
PRK05442326 malate dehydrogenase; Provisional 80.8
PRK11730715 fadB multifunctional fatty acid oxidation complex 80.79
TIGR03466328 HpnA hopanoid-associated sugar epimerase. The sequ 80.77
PRK05565247 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 80.71
cd01337310 MDH_glyoxysomal_mitochondrial Glyoxysomal and mito 80.62
PRK12491272 pyrroline-5-carboxylate reductase; Reviewed 80.62
PRK05866293 short chain dehydrogenase; Provisional 80.56
PTZ00431260 pyrroline carboxylate reductase; Provisional 80.51
PRK06141314 ornithine cyclodeaminase; Validated 80.49
PLN02166436 dTDP-glucose 4,6-dehydratase 80.41
PLN02166436 dTDP-glucose 4,6-dehydratase 80.28
PRK08251248 short chain dehydrogenase; Provisional 80.28
PF10727127 Rossmann-like: Rossmann-like domain; InterPro: IPR 80.28
PRK12550272 shikimate 5-dehydrogenase; Reviewed 80.2
cd01080168 NAD_bind_m-THF_DH_Cyclohyd NADP binding domain of 80.07
PRK07340304 ornithine cyclodeaminase; Validated 80.05
PRK06057255 short chain dehydrogenase; Provisional 80.02
>KOG2012 consensus Ubiquitin activating enzyme UBA1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information 
Probab=100.00  E-value=1.9e-264  Score=2258.35  Aligned_cols=1005  Identities=60%  Similarity=1.014  Sum_probs=976.5

Q ss_pred             ccCCCCCCCchhHhHhhhhhhccCHHHHHHhhcCeEEEEcCChHHHHHHHHHHHhCCCeEEEEeCCccCcccCCcccccC
Q 001331           82 MTLGNSNQTDIDEDLHSRQLAVYGRETMRRLFASNILVSGMQGLGAEIAKNLILAGVKSVTLHDEGTVELWDLSSNFVFS  161 (1099)
Q Consensus        82 ~~~~~~~~~~~~~~~YsRQi~l~G~e~q~kL~~s~VlIiG~gglG~EiaKnLvlaGVg~itlvD~d~V~~~dL~~qf~~~  161 (1099)
                      |..++++..++|+++||||++++|.++|+||..++|||.||+|||.||||||+|+||+++||+|...+.++||++|||++
T Consensus         5 ~~~~~~a~~~IDE~LYSRQLYVlG~eAM~~m~~S~VLisGl~GLGvEIAKNliLaGVksvTlhD~~~~~~~DLssqf~L~   84 (1013)
T KOG2012|consen    5 MMDGNSASQEIDESLYSRQLYVLGHEAMRRMQGSNVLISGLQGLGVEIAKNLILAGVKSVTLHDPRPVQLSDLSSQFYLS   84 (1013)
T ss_pred             ccccCcchhhhhhhhhhhhhhhccHHHHHHHhhCcEEEecCCcccHHHHhhHhhhccceEEeeCCCcccHHhhccceeee
Confidence            34455557899999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             CCcccchHHHHHHHHHHHhCCCcEEEEEecCCChhhccCCcEEEEecCCHHHHHHHHHHHHhcCCCceeEEEeecceeEE
Q 001331          162 DNDIGKNRALASVQKLQELNNAVVLSTLTSKLTKEQLSDFQAVVFTDISLDKAIEFDDFCHNHQPAISFIKAEVRGLFGS  241 (1099)
Q Consensus       162 ~~diGk~Kaea~~~~L~eLNp~V~v~~~~~~l~~~~l~~~dvVV~~~~~~~~~~~ln~~c~~~~~~ipfI~~~~~G~~G~  241 (1099)
                      ++|||++||+++.++|++||++|.|.++++.++++++++|+|||+|+.+++.+.+|+++||+++  |.||.++++|++|+
T Consensus        85 E~DigknRA~as~~~LaeLN~yV~V~v~t~~~~~e~L~~FqvVVlt~~~le~q~~i~~fch~~~--i~fi~ad~RGLfg~  162 (1013)
T KOG2012|consen   85 EEDIGKNRAEASVEKLAELNNYVPVVVLTGPLTEEFLSDFQVVVLTDASLEEQLKINDFCHSHG--IAFIAADTRGLFGQ  162 (1013)
T ss_pred             HHhcCCchHHHHHHHHHHhhcceeeEEecCcccHHHHhCCcEEEEecCchHHHHHHHHHHHhcC--eEEEEeccchhhhh
Confidence            9999999999999999999999999999999999999999999999999999999999999999  99999999999999


Q ss_pred             EEEEcCCceEEEcCCCCCCcceeecccccCCCceeeeccccccccccCCeeEEEEeecccccCCCCCccccccCCceeee
Q 001331          242 VFCDFGPEFTVVDVDGEDPHTGIIASISNDNPALVSCVDDERLEFQDGDLVVFSEVHGMTELNDGKPRKIKSARPYSFTL  321 (1099)
Q Consensus       242 vf~d~g~~~~v~d~~ge~p~~~~i~~I~~~~~~lv~~~~~~~~~~~dgd~v~f~ev~gm~eln~~~~~~i~~~~~~~f~i  321 (1099)
                      +|||||++|+|.|.+|++|.+++|++|++++|++|||+++.||+|+|||+|+|+||+||+++|+++|++|+++++|+|+|
T Consensus       163 lFCDFG~eF~v~D~tGeeP~t~mI~~Is~d~pGvvT~ld~~rH~lEdGd~V~FsEveGm~eLN~~~P~kI~v~~p~sf~I  242 (1013)
T KOG2012|consen  163 LFCDFGEEFTVLDPTGEEPLTGMIASISQDNPGVVTCLDGARHGFEDGDLVTFSEVEGMTELNDCKPRKITVLGPYSFSI  242 (1013)
T ss_pred             hhccCCCceEEeCCCCCcchhhHHhhccCCCCceEEEecCccccCccCCEEEEEeeccccccCCCCceEEEEecCceEEe
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             ccccccccceeecceEEEeeCCeeecccchHHhhcCCCCcccccCccCCCCChHHHHHHHHHHHHHHhCCCCCCCCHHHH
Q 001331          322 EEDTTNYGTYVKGGIVTQVKQPKVLNFKPLREALEDPGDFLLSDFSKFDRPPPLHLAFQALDKFVSELGRFPVAGSEEDA  401 (1099)
Q Consensus       322 ~~Dt~~f~~y~~gg~~~qvk~p~~i~f~sL~e~l~~p~~~l~~d~~k~~~~~~l~~~~~al~~F~~~~gr~P~~~~~~D~  401 (1099)
                       +|++.|+.|.+||+++|||+|++++|+||+++|.+| +++.+|++|++||+++|++|+||++|.++|||+|.+++++|+
T Consensus       243 -gdt~~f~~y~~GGi~tQVK~Pk~isfKsL~~~L~~P-~fl~~df~k~~rp~~lH~af~AL~~F~~~~Gr~P~p~~e~DA  320 (1013)
T KOG2012|consen  243 -GDTTEFGEYKKGGIFTQVKVPKTISFKSLREALKEP-EFLISDFAKFDRPPQLHLAFQALHQFQEAHGRLPRPGNEEDA  320 (1013)
T ss_pred             -ccccchhhhhcCceeEEeecCceEecccHHHhhcCC-CeeeeccccccccHHHHHHHHHHHHHHHHhCCCCCCCChhhH
Confidence             579999999999999999999999999999999999 899999999999999999999999999999999999999999


Q ss_pred             HHHHHHHHHHHHhcCCCCCCCCCHHHHHHHHhhcccccCchhhhhhhhhhHHHHHhhcCCccccceeeeeccCCCCCCC-
Q 001331          402 QKLISVATNINESLGDGRVEDINTKLLRHFAFGARAVLNPMAAMFGGIVGQEVVKACSGKFHPLYQFFYFDSVESLPTE-  480 (1099)
Q Consensus       402 ~~l~~~a~~i~~~~~~~~~~~i~~~~i~~~a~~~~~el~pvaA~iGGiaAQEVIKaiTgkf~PI~q~~~fD~~e~l~~~-  480 (1099)
                      ++|++++..+.+..+.  ..++++++|++|+..+++.|.||+|++||+|||||+|+|||||+||.||||||++|+||++ 
T Consensus       321 ~~l~~l~~~i~~~~~~--~~~vde~Lir~~s~~a~g~L~pm~A~~GG~vaQEvlKa~sgKF~PL~Q~lYfDale~LP~d~  398 (1013)
T KOG2012|consen  321 EELVELARDISEGLGL--EEDVDEKLIRHFSFSARGDLNPMVAFFGGIVAQEVLKACSGKFTPLKQWLYFDALESLPSDN  398 (1013)
T ss_pred             HHHHHHHHHhhhhccc--cccchHHHHHHHHHhhccCcchHHHHHhhhhHHHHHHhhccCccchhHheehhhHhhCCCcC
Confidence            9999999999887652  4689999999999999999999999999999999999999999999999999999999975 


Q ss_pred             -CCCCCCCCCccCchhhhhhhcCHHHHHHHhcCcEEEEcCCcchHHHHHHHHHcCCCCCCCccEEEecCCccccccCCcc
Q 001331          481 -PLDSTEFKPINSRYDAQISVFGAKLQKKLEDAKVFIVGSGALGCEFLKNVALMGVSCGNQGKLTITDDDVIEKSNLSRQ  559 (1099)
Q Consensus       481 -~~~~~~~~~~~~Rydrqi~l~G~~~q~~L~~~~v~vvG~GglG~evlk~La~~Gv~~~~~g~i~ivD~D~Ie~sNLnRQ  559 (1099)
                       ++++++++|.++|||.||++||...|+||.++|+|+|||||||||+|||||+||++||..|+|+|+|||.||.||||||
T Consensus       399 ~~~~e~d~~prgsRYD~qiavfG~~fqeKL~~~~~FlVGaGAIGCE~LKN~am~Gvg~g~~g~ItVTDmD~IEkSNLnRQ  478 (1013)
T KOG2012|consen  399 LPPSEEDCQPRGSRYDGQIAVFGAKFQEKLADQKVFLVGAGAIGCELLKNFALMGVGCGNSGKITVTDMDHIEKSNLNRQ  478 (1013)
T ss_pred             CCCCHHHcccccCccccchhhhchHHHHHHhhCcEEEEccchhhHHHHHhhhheeeccCCCCceEEeccchhhhccccce
Confidence             7889999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             cccccCcccchHHHHHHHHHHhhCCCCeEEEEecccCcccccccchhhhcCCCEEEEccCchHHHHHHHhhcccccccEE
Q 001331          560 FLFRDWNIGQAKSTVAASAATSINPRLNIEALQNRVGPETENVFDDTFWENITCVINALDNVNARLYVDQRCLYFQKPLL  639 (1099)
Q Consensus       560 flf~~~diG~~Ka~vaa~~l~~~np~~~i~~~~~~v~~~~e~~~~~~~~~~~DvVi~alDn~~ar~~i~~~c~~~~~Pli  639 (1099)
                      ||||++|||++|+++||+++..|||+++|+++..++++++|++|+|+||++.|+|.+||||+.||+|++++|+.+.+||+
T Consensus       479 FLFR~~dVgk~KSe~AA~A~~~mNp~l~I~a~~~rvgpeTE~If~D~Ff~~ld~VanALDNVdAR~YvD~RCv~~~kPLL  558 (1013)
T KOG2012|consen  479 FLFRPWDVGKPKSEVAAAAARGMNPDLNIIALQNRVGPETEHIFNDEFFENLDGVANALDNVDARRYVDRRCVYYRKPLL  558 (1013)
T ss_pred             eeccccccCchHHHHHHHHHHhcCCCceeeehhhccCcccccccchhHHhhhHHHHHhhcchhhhhhhhhhhhhhccchh
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             EcCcCcccceeEEEeCcccccCCCCCCCCCCCCCcccccCCCCCcchhHHHHHHHhhhhccCChhhhhhhcCCChhhhhh
Q 001331          640 ESGTLGAKCNTQMVIPHLTENYGASRDPPEKQAPMCTVHSFPHNIDHCLTWARSEFEGLLEKTPAEVNAYLSNPVEYTTS  719 (1099)
Q Consensus       640 ~sgt~G~~G~~~v~ip~~t~cy~c~~~p~~~~~p~Ct~~~~P~~~~Hci~wAr~~F~~lF~~~~~~~~~~l~~~~~~~~~  719 (1099)
                      ++||+|++|++||++|++||+|++++|||||++|+||++|||+.|+|||+|||+.||++|.+.++++|+||++|..+...
T Consensus       559 ESGTlGTKGntQVvvPhlTEsY~SS~DPPEksiP~CTlknFPn~IeHTiqWAR~eFEg~F~~~~e~vN~yls~p~f~e~s  638 (1013)
T KOG2012|consen  559 ESGTLGTKGNTQVVVPHLTESYGSSRDPPEKSIPVCTLKSFPNAIEHTIQWARDEFEGLFKQSAENVNKYLSDPVFYETS  638 (1013)
T ss_pred             hccCcCCccceeEEeccccccccccCCCcccCCceeeeccCchHHHHHHHHHHHHHHHHhhCCHHHHHHHhcCchHHHHH
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999977777


Q ss_pred             hhhcCchhHHHHHHHHHHHhhhhcccchHHHHHHHHHHHHHHHHHHHHHHhhhCCccccccCCCCCccCCCCCCCccccC
Q 001331          720 MANAGDAQARDNLERVLECLDKEKCEIFQDCITWARLKFEDYFSNRVKQLIFTFPEDAATSTGAPFWSAPKRFPHPLQFS  799 (1099)
Q Consensus       720 ~~~~~~~~~~~~l~~~~~~l~~~~~~~~~~c~~~a~~~f~~~F~~~i~~ll~~~p~d~~~~~g~~fWs~~kr~P~pl~fd  799 (1099)
                      ++..++.+.++.|+++.++|. .+|.+|+||++|||..|+++|+++|+|||++||+|++|++|+||||||||||+||+||
T Consensus       639 l~~~~~~~~~~~l~~v~~~l~-~rp~~~~dCv~warl~f~~~f~~~ikqLl~~FP~d~~t~~G~pFWs~pKr~P~pl~Fd  717 (1013)
T KOG2012|consen  639 LKLIGEPQSLETLERVVDCLS-ERPQNWQDCVEWARLHFEKYFHNRIKQLLHNFPPDAKTSDGAPFWSGPKRCPRPLEFD  717 (1013)
T ss_pred             HhhccCcchhHHHHHHHHHhh-cCCccHHHHHHHHHHHHHHHhhHHHHHhhcCCCcccccCCCCcCCCCCCCCCCceeec
Confidence            888888999999999999998 9999999999999999999999999999999999999999999999999999999999


Q ss_pred             CCCCchhHHHHHHHHHHHHHcCCCCCCCCCChHHHHHHhhhcCCCCCCCCCCcceecccccccccccCcCcHHHHHHHHH
Q 001331          800 SADPSHLHFVMAASILRAETFGIPIPDWTNNPKMLAEAVDKVMVPDFLPKKDAKILTDEKATTLSTASVDDAAVINDLII  879 (1099)
Q Consensus       800 ~~~~~h~~fi~~~a~l~a~~~~i~~~~~~~~~~~~~~~~~~~~~~~f~~~~~~~~~~~e~~~~~~~~~~~~~~~~~~l~~  879 (1099)
                      .+|++|+.||++||+|||++|||+..   .+...++.++..+++|+|+|+++++|.+++.+...++.+.|+.+.|++|..
T Consensus       718 ~n~~~hl~fv~Aaa~l~a~~~gi~~~---~d~~~~~~~~~~v~~p~f~P~~~~~i~~~~~~~~~~~~s~d~~~~i~~l~~  794 (1013)
T KOG2012|consen  718 VNDPLHLNFVQAAANLRAEVYGIPGS---QDREALAELLERVIVPEFEPKQKVKIVVEEAELAASSASVDDSAAIDQLNK  794 (1013)
T ss_pred             CCCchhHHHHHHHHHHHHHhcCCCcc---cCHHHhhhhHhhcCCCccccccCCeecccccccccccccCCchHHHHHHhh
Confidence            99999999999999999999999984   567799999999999999999999999999888877788899999999999


Q ss_pred             HHHHhhhcCCCCCCcCCceeeccCCCCchhHHHHHHhhhhhhccCCCCccHHHHHHHhccccchhhhhHHHHHHHHHHHH
Q 001331          880 KLEQCRKNLPSGFRLKPIQFEKDDDTNYHMDMIAGLANMRARNYSIPEVDKLKAKFIAGRIIPAIATSTAMATGLVCLEL  959 (1099)
Q Consensus       880 ~l~~~~~~~~~~~~~~p~~FeKDDd~n~hidFI~aasNLRA~ny~I~~~d~~~~K~iAG~IIPAIATTtA~VaGl~~lEl  959 (1099)
                      .|..+..  ..+++|.|+.||||||+|+|||||+|||||||.||+||++||+++|+|||+||||||||||+|+||+||||
T Consensus       795 ~l~~~~~--~~~~~~~p~~FEKDDDsN~H~dfi~aasnlRA~nY~I~~adr~k~K~IaGkIIPAIATtTa~v~Glv~LEl  872 (1013)
T KOG2012|consen  795 ALPSPSV--LPSFKMKPLDFEKDDDSNFHMDFITAASNLRAQNYSIPPADRLKTKRIAGKIIPAIATTTAAVSGLVCLEL  872 (1013)
T ss_pred             ccccccc--CCCCceeeeeeccccccccchHHHHHHhhhhhhccCCCccchhhhheeeeeEEEEEeehhHHHHHHHHhhh
Confidence            9988766  45589999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHhcCCCCcccccccccccccCcccccCCCCCccccc-CCcceeEEeEEEcCCCCcHHHHHHHHHHc-CCceeeeecCC
Q 001331          960 YKVLDGGHKLEDYRNTFANLALPLFSMAEPVPPKVIKH-RDMSWTVWDRWILKDNPTLRELIQWLKDK-GLNAYSISCGS 1037 (1099)
Q Consensus       960 ~K~l~~~~~~~~~rn~f~nla~p~~~~~eP~~~~~~~~-~~~~~t~Wd~~~v~~~~TL~~li~~~~~~-~l~~~~i~~g~ 1037 (1099)
                      ||++.|+.+++.|||+|+|||+|+|.++||.++++..+ .+.+||+||||++.|++||++||++++++ |++++||++|+
T Consensus       873 yKv~~G~~~~e~~Kn~flnLAlp~f~~~ep~~~pk~~~~~~~~~tlWdR~~v~g~~tL~~~L~~~~~~~gl~i~mls~G~  952 (1013)
T KOG2012|consen  873 YKVVDGKRPVEAYKNTFLNLALPFFSFAEPLAAPKVQYHNDLSWTLWDRWEVKGEPTLREFLDHLEEQHGLEITMLSQGV  952 (1013)
T ss_pred             hhhccCCCchHHhhhhhhcccccceeecccCCCcceeeecccceeeeEEEEecCCCCHHHHHHHHhhhcCceEEEEeccc
Confidence            99999988999999999999999999999999777664 55699999999999999999999999988 99999999999


Q ss_pred             ceeecCCCcchhccccCcHHHHHHHhhccCCCCceeEEEEEEEeecCCCCccccCeEEEEe
Q 001331         1038 CLLFNSMFPRHKERMDKKVVDLAREVAKVELPPYRRHLDVVVACEDDEDNDIDIPLISIYF 1098 (1099)
Q Consensus      1038 ~~LY~~~~~~~~~~l~~~l~~l~~~~~~~~~~~~~~~~~l~~~~~d~~~~~v~~P~v~~~~ 1098 (1099)
                      +|||++|||++++||+++++||++.++++++|+++++|+|+++|+|++|+|+++|+|||+|
T Consensus       953 ~lly~~~~~k~~erl~~~v~elv~~~~k~~~~~~~~~lvle~~~~d~~~eDve~P~v~y~f 1013 (1013)
T KOG2012|consen  953 SLLYASFMPKHAERLPLRVTELVRDVTKKKLPPHVRHLVLEVACEDDDDEDVEVPPVRYYF 1013 (1013)
T ss_pred             eeehhhhhhHHHHhcCCcHHHHHHHHhcccCCCcceEEEEEEecCCCCCCcCCCCceEEeC
Confidence            9999999999999999999999999999999999999999999999999999999999986

>TIGR01408 Ube1 ubiquitin-activating enzyme E1 Back     alignment and domain information
>cd01490 Ube1_repeat2 Ubiquitin activating enzyme (E1), repeat 2 Back     alignment and domain information
>KOG2013 consensus SMT3/SUMO-activating complex, catalytic component UBA2 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd01489 Uba2_SUMO Ubiquitin activating enzyme (E1) subunit UBA2 Back     alignment and domain information
>cd01491 Ube1_repeat1 Ubiquitin activating enzyme (E1), repeat 1 Back     alignment and domain information
>cd01484 E1-2_like Ubiquitin activating enzyme (E1), repeat 2-like Back     alignment and domain information
>KOG2015 consensus NEDD8-activating complex, catalytic component UBA3 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd01488 Uba3_RUB Ubiquitin activating enzyme (E1) subunit UBA3 Back     alignment and domain information
>cd01493 APPBP1_RUB Ubiquitin activating enzyme (E1) subunit APPBP1 Back     alignment and domain information
>KOG2014 consensus SMT3/SUMO-activating complex, AOS1/RAD31 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2016 consensus NEDD8-activating complex, APP-BP1/UBA5 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd01492 Aos1_SUMO Ubiquitin activating enzyme (E1) subunit Aos1 Back     alignment and domain information
>cd01485 E1-1_like Ubiquitin activating enzyme (E1), repeat 1-like Back     alignment and domain information
>PRK08223 hypothetical protein; Validated Back     alignment and domain information
>TIGR02356 adenyl_thiF thiazole biosynthesis adenylyltransferase ThiF, E Back     alignment and domain information
>cd00757 ThiF_MoeB_HesA_family ThiF_MoeB_HesA Back     alignment and domain information
>PRK05690 molybdopterin biosynthesis protein MoeB; Provisional Back     alignment and domain information
>PRK07411 hypothetical protein; Validated Back     alignment and domain information
>PRK08328 hypothetical protein; Provisional Back     alignment and domain information
>PRK05597 molybdopterin biosynthesis protein MoeB; Validated Back     alignment and domain information
>TIGR02355 moeB molybdopterin synthase sulfurylase MoeB Back     alignment and domain information
>cd01492 Aos1_SUMO Ubiquitin activating enzyme (E1) subunit Aos1 Back     alignment and domain information
>PRK05600 thiamine biosynthesis protein ThiF; Validated Back     alignment and domain information
>cd01493 APPBP1_RUB Ubiquitin activating enzyme (E1) subunit APPBP1 Back     alignment and domain information
>PRK07878 molybdopterin biosynthesis-like protein MoeZ; Validated Back     alignment and domain information
>cd01491 Ube1_repeat1 Ubiquitin activating enzyme (E1), repeat 1 Back     alignment and domain information
>cd01485 E1-1_like Ubiquitin activating enzyme (E1), repeat 1-like Back     alignment and domain information
>PRK07878 molybdopterin biosynthesis-like protein MoeZ; Validated Back     alignment and domain information
>PRK12475 thiamine/molybdopterin biosynthesis MoeB-like protein; Provisional Back     alignment and domain information
>cd01489 Uba2_SUMO Ubiquitin activating enzyme (E1) subunit UBA2 Back     alignment and domain information
>PRK07688 thiamine/molybdopterin biosynthesis ThiF/MoeB-like protein; Validated Back     alignment and domain information
>PRK08223 hypothetical protein; Validated Back     alignment and domain information
>PRK05690 molybdopterin biosynthesis protein MoeB; Provisional Back     alignment and domain information
>TIGR02356 adenyl_thiF thiazole biosynthesis adenylyltransferase ThiF, E Back     alignment and domain information
>PRK08762 molybdopterin biosynthesis protein MoeB; Validated Back     alignment and domain information
>TIGR03736 PRTRC_ThiF PRTRC system ThiF family protein Back     alignment and domain information
>cd00757 ThiF_MoeB_HesA_family ThiF_MoeB_HesA Back     alignment and domain information
>COG0476 ThiF Dinucleotide-utilizing enzymes involved in molybdopterin and thiamine biosynthesis family 2 [Coenzyme metabolism] Back     alignment and domain information
>PF09358 UBA_e1_C: Ubiquitin-activating enzyme e1 C-terminal domain; InterPro: IPR018965 This presumed domain found at the C terminus of Ubiquitin-activating enzyme e1 proteins is functionally uncharacterised Back     alignment and domain information
>PRK07411 hypothetical protein; Validated Back     alignment and domain information
>KOG2017 consensus Molybdopterin synthase sulfurylase [Coenzyme transport and metabolism] Back     alignment and domain information
>PRK05597 molybdopterin biosynthesis protein MoeB; Validated Back     alignment and domain information
>PRK14851 hypothetical protein; Provisional Back     alignment and domain information
>PRK08328 hypothetical protein; Provisional Back     alignment and domain information
>cd01488 Uba3_RUB Ubiquitin activating enzyme (E1) subunit UBA3 Back     alignment and domain information
>PRK14852 hypothetical protein; Provisional Back     alignment and domain information
>TIGR02355 moeB molybdopterin synthase sulfurylase MoeB Back     alignment and domain information
>PRK05600 thiamine biosynthesis protein ThiF; Validated Back     alignment and domain information
>PRK15116 sulfur acceptor protein CsdL; Provisional Back     alignment and domain information
>cd01484 E1-2_like Ubiquitin activating enzyme (E1), repeat 2-like Back     alignment and domain information
>PRK07688 thiamine/molybdopterin biosynthesis ThiF/MoeB-like protein; Validated Back     alignment and domain information
>PRK12475 thiamine/molybdopterin biosynthesis MoeB-like protein; Provisional Back     alignment and domain information
>cd00755 YgdL_like Family of activating enzymes (E1) of ubiquitin-like proteins related to the E Back     alignment and domain information
>PRK08644 thiamine biosynthesis protein ThiF; Provisional Back     alignment and domain information
>PRK07877 hypothetical protein; Provisional Back     alignment and domain information
>TIGR01408 Ube1 ubiquitin-activating enzyme E1 Back     alignment and domain information
>PF00899 ThiF: ThiF family; InterPro: IPR000594 Ubiquitin-activating enzyme (E1 enzyme) [, ] activates ubiquitin by first adenylating with ATP its C-terminal glycine residue and thereafter linking this residue to the side chain of a cysteine residue in E1, yielding an ubiquitin-E1 thiolester and free AMP Back     alignment and domain information
>PRK15116 sulfur acceptor protein CsdL; Provisional Back     alignment and domain information
>COG0476 ThiF Dinucleotide-utilizing enzymes involved in molybdopterin and thiamine biosynthesis family 2 [Coenzyme metabolism] Back     alignment and domain information
>PTZ00245 ubiquitin activating enzyme; Provisional Back     alignment and domain information
>PRK14852 hypothetical protein; Provisional Back     alignment and domain information
>TIGR01381 E1_like_apg7 E1-like protein-activating enzyme Gsa7p/Apg7p Back     alignment and domain information
>COG1179 Dinucleotide-utilizing enzymes involved in molybdopterin and thiamine biosynthesis family 1 [Coenzyme metabolism] Back     alignment and domain information
>cd01490 Ube1_repeat2 Ubiquitin activating enzyme (E1), repeat 2 Back     alignment and domain information
>PRK08762 molybdopterin biosynthesis protein MoeB; Validated Back     alignment and domain information
>PRK14851 hypothetical protein; Provisional Back     alignment and domain information
>KOG2015 consensus NEDD8-activating complex, catalytic component UBA3 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2013 consensus SMT3/SUMO-activating complex, catalytic component UBA2 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd01483 E1_enzyme_family Superfamily of activating enzymes (E1) of the ubiquitin-like proteins Back     alignment and domain information
>TIGR03603 cyclo_dehy_ocin bacteriocin biosynthesis cyclodehydratase, SagC family Back     alignment and domain information
>cd01486 Apg7 Apg7 is an E1-like protein, that activates two different ubiquitin-like proteins, Apg12 and Apg8, and assigns them to specific E2 enzymes, Apg10 and Apg3, respectively Back     alignment and domain information
>PF00899 ThiF: ThiF family; InterPro: IPR000594 Ubiquitin-activating enzyme (E1 enzyme) [, ] activates ubiquitin by first adenylating with ATP its C-terminal glycine residue and thereafter linking this residue to the side chain of a cysteine residue in E1, yielding an ubiquitin-E1 thiolester and free AMP Back     alignment and domain information
>KOG2017 consensus Molybdopterin synthase sulfurylase [Coenzyme transport and metabolism] Back     alignment and domain information
>cd01487 E1_ThiF_like E1_ThiF_like Back     alignment and domain information
>PRK08644 thiamine biosynthesis protein ThiF; Provisional Back     alignment and domain information
>cd00755 YgdL_like Family of activating enzymes (E1) of ubiquitin-like proteins related to the E Back     alignment and domain information
>cd01483 E1_enzyme_family Superfamily of activating enzymes (E1) of the ubiquitin-like proteins Back     alignment and domain information
>TIGR02354 thiF_fam2 thiamine biosynthesis protein ThiF, family 2 Back     alignment and domain information
>PTZ00245 ubiquitin activating enzyme; Provisional Back     alignment and domain information
>PRK07877 hypothetical protein; Provisional Back     alignment and domain information
>PRK06153 hypothetical protein; Provisional Back     alignment and domain information
>COG1179 Dinucleotide-utilizing enzymes involved in molybdopterin and thiamine biosynthesis family 1 [Coenzyme metabolism] Back     alignment and domain information
>cd01486 Apg7 Apg7 is an E1-like protein, that activates two different ubiquitin-like proteins, Apg12 and Apg8, and assigns them to specific E2 enzymes, Apg10 and Apg3, respectively Back     alignment and domain information
>KOG2014 consensus SMT3/SUMO-activating complex, AOS1/RAD31 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd01487 E1_ThiF_like E1_ThiF_like Back     alignment and domain information
>KOG2336 consensus Molybdopterin biosynthesis-related protein [Coenzyme transport and metabolism] Back     alignment and domain information
>TIGR02354 thiF_fam2 thiamine biosynthesis protein ThiF, family 2 Back     alignment and domain information
>TIGR01381 E1_like_apg7 E1-like protein-activating enzyme Gsa7p/Apg7p Back     alignment and domain information
>TIGR03603 cyclo_dehy_ocin bacteriocin biosynthesis cyclodehydratase, SagC family Back     alignment and domain information
>KOG2016 consensus NEDD8-activating complex, APP-BP1/UBA5 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF02134 UBACT: Repeat in ubiquitin-activating (UBA) protein; InterPro: IPR000127 The post-translational attachment of ubiquitin (IPR000626 from INTERPRO) to proteins (ubiquitinylation) alters the function, location or trafficking of a protein, or targets it to the 26S proteasome for degradation [, , ] Back     alignment and domain information
>KOG2018 consensus Predicted dinucleotide-utilizing enzyme involved in molybdopterin and thiamine biosynthesis [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK06153 hypothetical protein; Provisional Back     alignment and domain information
>KOG2012 consensus Ubiquitin activating enzyme UBA1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR03736 PRTRC_ThiF PRTRC system ThiF family protein Back     alignment and domain information
>KOG2018 consensus Predicted dinucleotide-utilizing enzyme involved in molybdopterin and thiamine biosynthesis [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF10585 UBA_e1_thiolCys: Ubiquitin-activating enzyme active site ; InterPro: IPR019572 Ubiquitin-activating enzyme (E1 enzyme) activates ubiquitin by first adenylating with ATP its C-terminal glycine residue and thereafter linking this residue to the side chain of a cysteine residue in E1, yielding an ubiquitin-E1 thiolester and free AMP Back     alignment and domain information
>KOG2336 consensus Molybdopterin biosynthesis-related protein [Coenzyme transport and metabolism] Back     alignment and domain information
>TIGR03693 ocin_ThiF_like putative thiazole-containing bacteriocin maturation protein Back     alignment and domain information
>KOG2337 consensus Ubiquitin activating E1 enzyme-like protein [Coenzyme transport and metabolism] Back     alignment and domain information
>TIGR03693 ocin_ThiF_like putative thiazole-containing bacteriocin maturation protein Back     alignment and domain information
>KOG2337 consensus Ubiquitin activating E1 enzyme-like protein [Coenzyme transport and metabolism] Back     alignment and domain information
>PF02134 UBACT: Repeat in ubiquitin-activating (UBA) protein; InterPro: IPR000127 The post-translational attachment of ubiquitin (IPR000626 from INTERPRO) to proteins (ubiquitinylation) alters the function, location or trafficking of a protein, or targets it to the 26S proteasome for degradation [, , ] Back     alignment and domain information
>COG4015 Predicted dinucleotide-utilizing enzyme of the ThiF/HesA family [General function prediction only] Back     alignment and domain information
>PF08825 E2_bind: E2 binding domain; InterPro: IPR014929 E1 and E2 enzymes play a central role in ubiquitin and ubiquitin-like protein transfer cascades Back     alignment and domain information
>PRK06718 precorrin-2 dehydrogenase; Reviewed Back     alignment and domain information
>TIGR03882 cyclo_dehyd_2 bacteriocin biosynthesis cyclodehydratase domain Back     alignment and domain information
>TIGR01470 cysG_Nterm siroheme synthase, N-terminal domain Back     alignment and domain information
>COG1748 LYS9 Saccharopine dehydrogenase and related proteins [Amino acid transport and metabolism] Back     alignment and domain information
>PF01488 Shikimate_DH: Shikimate / quinate 5-dehydrogenase; InterPro: IPR006151 This entry represents a domain found in shikimate and quinate dehydrogenases, as well as glutamyl-tRNA reductases Back     alignment and domain information
>PRK06719 precorrin-2 dehydrogenase; Validated Back     alignment and domain information
>PRK12549 shikimate 5-dehydrogenase; Reviewed Back     alignment and domain information
>PF13241 NAD_binding_7: Putative NAD(P)-binding; PDB: 3DFZ_B 1PJT_A 1PJS_A 1PJQ_A 1KYQ_B Back     alignment and domain information
>PRK06718 precorrin-2 dehydrogenase; Reviewed Back     alignment and domain information
>COG1748 LYS9 Saccharopine dehydrogenase and related proteins [Amino acid transport and metabolism] Back     alignment and domain information
>PRK12549 shikimate 5-dehydrogenase; Reviewed Back     alignment and domain information
>PRK05562 precorrin-2 dehydrogenase; Provisional Back     alignment and domain information
>COG4015 Predicted dinucleotide-utilizing enzyme of the ThiF/HesA family [General function prediction only] Back     alignment and domain information
>PF01488 Shikimate_DH: Shikimate / quinate 5-dehydrogenase; InterPro: IPR006151 This entry represents a domain found in shikimate and quinate dehydrogenases, as well as glutamyl-tRNA reductases Back     alignment and domain information
>PRK06719 precorrin-2 dehydrogenase; Validated Back     alignment and domain information
>TIGR01470 cysG_Nterm siroheme synthase, N-terminal domain Back     alignment and domain information
>PF13241 NAD_binding_7: Putative NAD(P)-binding; PDB: 3DFZ_B 1PJT_A 1PJS_A 1PJQ_A 1KYQ_B Back     alignment and domain information
>PRK05562 precorrin-2 dehydrogenase; Provisional Back     alignment and domain information
>PRK10637 cysG siroheme synthase; Provisional Back     alignment and domain information
>PF03435 Saccharop_dh: Saccharopine dehydrogenase ; InterPro: IPR005097 This entry represents saccharopine dehydrogenase and homospermidine synthase Back     alignment and domain information
>COG1648 CysG Siroheme synthase (precorrin-2 oxidase/ferrochelatase domain) [Coenzyme metabolism] Back     alignment and domain information
>PRK14027 quinate/shikimate dehydrogenase; Provisional Back     alignment and domain information
>PRK12548 shikimate 5-dehydrogenase; Provisional Back     alignment and domain information
>PRK14027 quinate/shikimate dehydrogenase; Provisional Back     alignment and domain information
>TIGR01809 Shik-DH-AROM shikimate-5-dehydrogenase, fungal AROM-type Back     alignment and domain information
>PF00056 Ldh_1_N: lactate/malate dehydrogenase, NAD binding domain Prosite entry for lactate dehydrogenase Prosite entry for malate dehydrogenase; InterPro: IPR001236 L-lactate dehydrogenases are metabolic enzymes which catalyse the conversion of L-lactate to pyruvate, the last step in anaerobic glycolysis [] Back     alignment and domain information
>COG0169 AroE Shikimate 5-dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information
>COG0373 HemA Glutamyl-tRNA reductase [Coenzyme metabolism] Back     alignment and domain information
>PRK00258 aroE shikimate 5-dehydrogenase; Reviewed Back     alignment and domain information
>PRK12548 shikimate 5-dehydrogenase; Provisional Back     alignment and domain information
>PRK14106 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK07819 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>TIGR01809 Shik-DH-AROM shikimate-5-dehydrogenase, fungal AROM-type Back     alignment and domain information
>TIGR03882 cyclo_dehyd_2 bacteriocin biosynthesis cyclodehydratase domain Back     alignment and domain information
>PF03435 Saccharop_dh: Saccharopine dehydrogenase ; InterPro: IPR005097 This entry represents saccharopine dehydrogenase and homospermidine synthase Back     alignment and domain information
>PRK13940 glutamyl-tRNA reductase; Provisional Back     alignment and domain information
>COG1648 CysG Siroheme synthase (precorrin-2 oxidase/ferrochelatase domain) [Coenzyme metabolism] Back     alignment and domain information
>PF05237 MoeZ_MoeB: MoeZ/MoeB domain; InterPro: IPR007901 This putative domain is found in the MoeZ protein and the MoeB protein Back     alignment and domain information
>PF01113 DapB_N: Dihydrodipicolinate reductase, N-terminus; InterPro: IPR000846 Dihydrodipicolinate reductase catalyzes the second step in the biosynthesis of diaminopimelic acid and lysine, the NAD or NADP-dependent reduction of 2,3-dihydrodipicolinate into 2,3,4,5-tetrahydrodipicolinate [, , ] Back     alignment and domain information
>cd05291 HicDH_like L-2-hydroxyisocapronate dehydrogenases and some bacterial L-lactate dehydrogenases Back     alignment and domain information
>PF03446 NAD_binding_2: NAD binding domain of 6-phosphogluconate dehydrogenase; InterPro: IPR006115 6-Phosphogluconate dehydrogenase (1 Back     alignment and domain information
>PRK00258 aroE shikimate 5-dehydrogenase; Reviewed Back     alignment and domain information
>PRK14106 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK07066 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>COG0373 HemA Glutamyl-tRNA reductase [Coenzyme metabolism] Back     alignment and domain information
>PRK12749 quinate/shikimate dehydrogenase; Reviewed Back     alignment and domain information
>PRK13940 glutamyl-tRNA reductase; Provisional Back     alignment and domain information
>PRK04148 hypothetical protein; Provisional Back     alignment and domain information
>cd01065 NAD_bind_Shikimate_DH NAD(P) binding domain of Shikimate dehydrogenase Back     alignment and domain information
>PRK12749 quinate/shikimate dehydrogenase; Reviewed Back     alignment and domain information
>COG0569 TrkA K+ transport systems, NAD-binding component [Inorganic ion transport and metabolism] Back     alignment and domain information
>PF00070 Pyr_redox: Pyridine nucleotide-disulphide oxidoreductase; InterPro: IPR001327 FAD flavoproteins belonging to the family of pyridine nucleotide-disulphide oxidoreductases (glutathione reductase, trypanothione reductase, lipoamide dehydrogenase, mercuric reductase, thioredoxin reductase, alkyl hydroperoxide reductase) share sequence similarity with a number of other flavoprotein oxidoreductases, in particular with ferredoxin-NAD+ reductases involved in oxidative metabolism of a variety of hydrocarbons (rubredoxin reductase, putidaredoxin reductase, terpredoxin reductase, ferredoxin-NAD+ reductase components of benzene 1,2-dioxygenase, toluene 1,2-dioxygenase, chlorobenzene dioxygenase, biphenyl dioxygenase), NADH oxidase and NADH peroxidase [, , ] Back     alignment and domain information
>PRK10637 cysG siroheme synthase; Provisional Back     alignment and domain information
>PF02254 TrkA_N: TrkA-N domain; InterPro: IPR003148 The regulator of K+ conductance (RCK) domain is found in many ligand-gated K+ channels, most often attached to the intracellular carboxy terminus Back     alignment and domain information
>PF02737 3HCDH_N: 3-hydroxyacyl-CoA dehydrogenase, NAD binding domain; InterPro: IPR006176 3-hydroxyacyl-CoA dehydrogenase (1 Back     alignment and domain information
>PF14732 UAE_UbL: Ubiquitin/SUMO-activating enzyme ubiquitin-like domain; PDB: 1Y8Q_B 1Y8R_E 3KYD_B 3KYC_B Back     alignment and domain information
>PLN00203 glutamyl-tRNA reductase Back     alignment and domain information
>PF02826 2-Hacid_dh_C: D-isomer specific 2-hydroxyacid dehydrogenase, NAD binding domain; InterPro: IPR006140 A number of NAD-dependent 2-hydroxyacid dehydrogenases which seem to be specific for the D-isomer of their substrate have been shown to be functionally and structurally related Back     alignment and domain information
>PRK05808 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>KOG4169 consensus 15-hydroxyprostaglandin dehydrogenase and related dehydrogenases [Lipid transport and metabolism; General function prediction only] Back     alignment and domain information
>cd01080 NAD_bind_m-THF_DH_Cyclohyd NADP binding domain of methylene-tetrahydrofolate dehydrogenase/cyclohydrolase Back     alignment and domain information
>cd00300 LDH_like L-lactate dehydrogenase-like enzymes Back     alignment and domain information
>cd05213 NAD_bind_Glutamyl_tRNA_reduct NADP-binding domain of glutamyl-tRNA reductase Back     alignment and domain information
>cd01065 NAD_bind_Shikimate_DH NAD(P) binding domain of Shikimate dehydrogenase Back     alignment and domain information
>PRK00066 ldh L-lactate dehydrogenase; Reviewed Back     alignment and domain information
>COG0569 TrkA K+ transport systems, NAD-binding component [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK05708 2-dehydropantoate 2-reductase; Provisional Back     alignment and domain information
>PRK09260 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>TIGR01035 hemA glutamyl-tRNA reductase Back     alignment and domain information
>PRK04148 hypothetical protein; Provisional Back     alignment and domain information
>KOG4169 consensus 15-hydroxyprostaglandin dehydrogenase and related dehydrogenases [Lipid transport and metabolism; General function prediction only] Back     alignment and domain information
>COG0169 AroE Shikimate 5-dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information
>PF01118 Semialdhyde_dh: Semialdehyde dehydrogenase, NAD binding domain; InterPro: IPR000534 The semialdehyde dehydrogenase family is found in N-acetyl-glutamine semialdehyde dehydrogenase (AgrC), which is involved in arginine biosynthesis, and aspartate-semialdehyde dehydrogenase [], an enzyme involved in the biosynthesis of various amino acids from aspartate Back     alignment and domain information
>PRK06130 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>cd05290 LDH_3 A subgroup of L-lactate dehydrogenases Back     alignment and domain information
>cd05311 NAD_bind_2_malic_enz NAD(P) binding domain of malic enzyme (ME), subgroup 2 Back     alignment and domain information
>cd05311 NAD_bind_2_malic_enz NAD(P) binding domain of malic enzyme (ME), subgroup 2 Back     alignment and domain information
>PLN02602 lactate dehydrogenase Back     alignment and domain information
>cd05213 NAD_bind_Glutamyl_tRNA_reduct NADP-binding domain of glutamyl-tRNA reductase Back     alignment and domain information
>PLN02819 lysine-ketoglutarate reductase/saccharopine dehydrogenase Back     alignment and domain information
>cd05293 LDH_1 A subgroup of L-lactate dehydrogenases Back     alignment and domain information
>cd05291 HicDH_like L-2-hydroxyisocapronate dehydrogenases and some bacterial L-lactate dehydrogenases Back     alignment and domain information
>PF10585 UBA_e1_thiolCys: Ubiquitin-activating enzyme active site ; InterPro: IPR019572 Ubiquitin-activating enzyme (E1 enzyme) activates ubiquitin by first adenylating with ATP its C-terminal glycine residue and thereafter linking this residue to the side chain of a cysteine residue in E1, yielding an ubiquitin-E1 thiolester and free AMP Back     alignment and domain information
>PRK08293 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK05476 S-adenosyl-L-homocysteine hydrolase; Provisional Back     alignment and domain information
>PRK01710 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>cd01078 NAD_bind_H4MPT_DH NADP binding domain of methylene tetrahydromethanopterin dehydrogenase Back     alignment and domain information
>PF00056 Ldh_1_N: lactate/malate dehydrogenase, NAD binding domain Prosite entry for lactate dehydrogenase Prosite entry for malate dehydrogenase; InterPro: IPR001236 L-lactate dehydrogenases are metabolic enzymes which catalyse the conversion of L-lactate to pyruvate, the last step in anaerobic glycolysis [] Back     alignment and domain information
>PRK07819 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK01438 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>cd05290 LDH_3 A subgroup of L-lactate dehydrogenases Back     alignment and domain information
>PF03446 NAD_binding_2: NAD binding domain of 6-phosphogluconate dehydrogenase; InterPro: IPR006115 6-Phosphogluconate dehydrogenase (1 Back     alignment and domain information
>PRK00141 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>cd01078 NAD_bind_H4MPT_DH NADP binding domain of methylene tetrahydromethanopterin dehydrogenase Back     alignment and domain information
>PRK00066 ldh L-lactate dehydrogenase; Reviewed Back     alignment and domain information
>PRK09599 6-phosphogluconate dehydrogenase-like protein; Reviewed Back     alignment and domain information
>COG0111 SerA Phosphoglycerate dehydrogenase and related dehydrogenases [Amino acid transport and metabolism] Back     alignment and domain information
>PRK14192 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PF03807 F420_oxidored: NADP oxidoreductase coenzyme F420-dependent; InterPro: IPR004455 The function of F420-dependent NADP reductase is the transfer of electrons from reduced coenzyme F420 into an electron transport chain Back     alignment and domain information
>PRK05808 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>PTZ00117 malate dehydrogenase; Provisional Back     alignment and domain information
>TIGR02992 ectoine_eutC ectoine utilization protein EutC Back     alignment and domain information
>cd01075 NAD_bind_Leu_Phe_Val_DH NAD(P) binding domain of leucine dehydrogenase, phenylalanine dehydrogenase, and valine dehydrogenase Back     alignment and domain information
>PRK00045 hemA glutamyl-tRNA reductase; Reviewed Back     alignment and domain information
>PRK00048 dihydrodipicolinate reductase; Provisional Back     alignment and domain information
>PRK06197 short chain dehydrogenase; Provisional Back     alignment and domain information
>PF00070 Pyr_redox: Pyridine nucleotide-disulphide oxidoreductase; InterPro: IPR001327 FAD flavoproteins belonging to the family of pyridine nucleotide-disulphide oxidoreductases (glutathione reductase, trypanothione reductase, lipoamide dehydrogenase, mercuric reductase, thioredoxin reductase, alkyl hydroperoxide reductase) share sequence similarity with a number of other flavoprotein oxidoreductases, in particular with ferredoxin-NAD+ reductases involved in oxidative metabolism of a variety of hydrocarbons (rubredoxin reductase, putidaredoxin reductase, terpredoxin reductase, ferredoxin-NAD+ reductase components of benzene 1,2-dioxygenase, toluene 1,2-dioxygenase, chlorobenzene dioxygenase, biphenyl dioxygenase), NADH oxidase and NADH peroxidase [, , ] Back     alignment and domain information
>PRK08618 ornithine cyclodeaminase; Validated Back     alignment and domain information
>PF02737 3HCDH_N: 3-hydroxyacyl-CoA dehydrogenase, NAD binding domain; InterPro: IPR006176 3-hydroxyacyl-CoA dehydrogenase (1 Back     alignment and domain information
>PRK07063 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06130 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK09496 trkA potassium transporter peripheral membrane component; Reviewed Back     alignment and domain information
>PRK05854 short chain dehydrogenase; Provisional Back     alignment and domain information
>TIGR00507 aroE shikimate 5-dehydrogenase Back     alignment and domain information
>PRK08410 2-hydroxyacid dehydrogenase; Provisional Back     alignment and domain information
>TIGR00507 aroE shikimate 5-dehydrogenase Back     alignment and domain information
>PRK13243 glyoxylate reductase; Reviewed Back     alignment and domain information
>PRK15469 ghrA bifunctional glyoxylate/hydroxypyruvate reductase A; Provisional Back     alignment and domain information
>PRK06197 short chain dehydrogenase; Provisional Back     alignment and domain information
>cd00401 AdoHcyase S-adenosyl-L-homocysteine hydrolase (AdoHycase) catalyzes the hydrolysis of S-adenosyl-L-homocysteine (AdoHyc) to form adenosine (Ado) and homocysteine (Hcy) Back     alignment and domain information
>PLN00203 glutamyl-tRNA reductase Back     alignment and domain information
>PRK07574 formate dehydrogenase; Provisional Back     alignment and domain information
>PRK07066 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>PF01210 NAD_Gly3P_dh_N: NAD-dependent glycerol-3-phosphate dehydrogenase N-terminus; InterPro: IPR011128 NAD-dependent glycerol-3-phosphate dehydrogenase (GPDH) catalyses the interconversion of dihydroxyacetone phosphate and L-glycerol-3-phosphate Back     alignment and domain information
>PRK14619 NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>PRK06035 3-hydroxyacyl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK03562 glutathione-regulated potassium-efflux system protein KefC; Provisional Back     alignment and domain information
>PRK06487 glycerate dehydrogenase; Provisional Back     alignment and domain information
>PTZ00082 L-lactate dehydrogenase; Provisional Back     alignment and domain information
>cd00401 AdoHcyase S-adenosyl-L-homocysteine hydrolase (AdoHycase) catalyzes the hydrolysis of S-adenosyl-L-homocysteine (AdoHyc) to form adenosine (Ado) and homocysteine (Hcy) Back     alignment and domain information
>PRK07530 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK03659 glutathione-regulated potassium-efflux system protein KefB; Provisional Back     alignment and domain information
>PLN03209 translocon at the inner envelope of chloroplast subunit 62; Provisional Back     alignment and domain information
>PRK02705 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK09242 tropinone reductase; Provisional Back     alignment and domain information
>PRK07502 cyclohexadienyl dehydrogenase; Validated Back     alignment and domain information
>PRK11908 NAD-dependent epimerase/dehydratase family protein; Provisional Back     alignment and domain information
>PRK06932 glycerate dehydrogenase; Provisional Back     alignment and domain information
>TIGR01759 MalateDH-SF1 malate dehydrogenase Back     alignment and domain information
>PF02056 Glyco_hydro_4: Family 4 glycosyl hydrolase; InterPro: IPR001088 O-Glycosyl hydrolases 3 Back     alignment and domain information
>PRK07831 short chain dehydrogenase; Provisional Back     alignment and domain information
>cd05191 NAD_bind_amino_acid_DH NAD(P) binding domain of amino acid dehydrogenase-like proteins Back     alignment and domain information
>PRK06141 ornithine cyclodeaminase; Validated Back     alignment and domain information
>PRK11880 pyrroline-5-carboxylate reductase; Reviewed Back     alignment and domain information
>PRK07634 pyrroline-5-carboxylate reductase; Reviewed Back     alignment and domain information
>PRK15438 erythronate-4-phosphate dehydrogenase PdxB; Provisional Back     alignment and domain information
>PRK07062 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05476 S-adenosyl-L-homocysteine hydrolase; Provisional Back     alignment and domain information
>PLN02206 UDP-glucuronate decarboxylase Back     alignment and domain information
>PRK14175 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>cd05191 NAD_bind_amino_acid_DH NAD(P) binding domain of amino acid dehydrogenase-like proteins Back     alignment and domain information
>COG0039 Mdh Malate/lactate dehydrogenases [Energy production and conversion] Back     alignment and domain information
>COG0300 DltE Short-chain dehydrogenases of various substrate specificities [General function prediction only] Back     alignment and domain information
>PLN03139 formate dehydrogenase; Provisional Back     alignment and domain information
>PRK07340 ornithine cyclodeaminase; Validated Back     alignment and domain information
>cd05293 LDH_1 A subgroup of L-lactate dehydrogenases Back     alignment and domain information
>COG0771 MurD UDP-N-acetylmuramoylalanine-D-glutamate ligase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>TIGR00936 ahcY adenosylhomocysteinase Back     alignment and domain information
>PTZ00325 malate dehydrogenase; Provisional Back     alignment and domain information
>PF01113 DapB_N: Dihydrodipicolinate reductase, N-terminus; InterPro: IPR000846 Dihydrodipicolinate reductase catalyzes the second step in the biosynthesis of diaminopimelic acid and lysine, the NAD or NADP-dependent reduction of 2,3-dihydrodipicolinate into 2,3,4,5-tetrahydrodipicolinate [, , ] Back     alignment and domain information
>PF03807 F420_oxidored: NADP oxidoreductase coenzyme F420-dependent; InterPro: IPR004455 The function of F420-dependent NADP reductase is the transfer of electrons from reduced coenzyme F420 into an electron transport chain Back     alignment and domain information
>TIGR00872 gnd_rel 6-phosphogluconate dehydrogenase (decarboxylating) Back     alignment and domain information
>PLN02819 lysine-ketoglutarate reductase/saccharopine dehydrogenase Back     alignment and domain information
>TIGR00872 gnd_rel 6-phosphogluconate dehydrogenase (decarboxylating) Back     alignment and domain information
>PRK06436 glycerate dehydrogenase; Provisional Back     alignment and domain information
>PRK00257 erythronate-4-phosphate dehydrogenase; Validated Back     alignment and domain information
>PRK06522 2-dehydropantoate 2-reductase; Reviewed Back     alignment and domain information
>PRK04308 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PF02254 TrkA_N: TrkA-N domain; InterPro: IPR003148 The regulator of K+ conductance (RCK) domain is found in many ligand-gated K+ channels, most often attached to the intracellular carboxy terminus Back     alignment and domain information
>PRK09599 6-phosphogluconate dehydrogenase-like protein; Reviewed Back     alignment and domain information
>PRK10537 voltage-gated potassium channel; Provisional Back     alignment and domain information
>PLN02545 3-hydroxybutyryl-CoA dehydrogenase Back     alignment and domain information
>COG1086 Predicted nucleoside-diphosphate sugar epimerases [Cell envelope biogenesis, outer membrane / Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK15469 ghrA bifunctional glyoxylate/hydroxypyruvate reductase A; Provisional Back     alignment and domain information
>PLN02602 lactate dehydrogenase Back     alignment and domain information
>PRK06035 3-hydroxyacyl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK08618 ornithine cyclodeaminase; Validated Back     alignment and domain information
>PRK07531 bifunctional 3-hydroxyacyl-CoA dehydrogenase/thioesterase; Validated Back     alignment and domain information
>PLN02350 phosphogluconate dehydrogenase (decarboxylating) Back     alignment and domain information
>PRK08293 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK07576 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07680 late competence protein ComER; Validated Back     alignment and domain information
>PRK08251 short chain dehydrogenase; Provisional Back     alignment and domain information
>PF02826 2-Hacid_dh_C: D-isomer specific 2-hydroxyacid dehydrogenase, NAD binding domain; InterPro: IPR006140 A number of NAD-dependent 2-hydroxyacid dehydrogenases which seem to be specific for the D-isomer of their substrate have been shown to be functionally and structurally related Back     alignment and domain information
>cd00300 LDH_like L-lactate dehydrogenase-like enzymes Back     alignment and domain information
>PRK02006 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>COG1063 Tdh Threonine dehydrogenase and related Zn-dependent dehydrogenases [Amino acid transport and metabolism / General function prediction only] Back     alignment and domain information
>PRK00094 gpsA NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Validated Back     alignment and domain information
>PRK12826 3-ketoacyl-(acyl-carrier-protein) reductase; Reviewed Back     alignment and domain information
>PF13460 NAD_binding_10: NADH(P)-binding ; PDB: 3OH8_A 3E8X_A 3GPI_A 3QVO_A 2Q46_B 1YBM_B 1XQ6_B 2Q4B_B 3EW7_A 3IUS_B Back     alignment and domain information
>PRK07417 arogenate dehydrogenase; Reviewed Back     alignment and domain information
>TIGR00465 ilvC ketol-acid reductoisomerase Back     alignment and domain information
>PRK05708 2-dehydropantoate 2-reductase; Provisional Back     alignment and domain information
>cd05296 GH4_P_beta_glucosidase Glycoside Hydrolases Family 4; Phospho-beta-glucosidase Back     alignment and domain information
>PF02558 ApbA: Ketopantoate reductase PanE/ApbA; InterPro: IPR013332 ApbA, the ketopantoate reductase enzyme 1 Back     alignment and domain information
>cd01075 NAD_bind_Leu_Phe_Val_DH NAD(P) binding domain of leucine dehydrogenase, phenylalanine dehydrogenase, and valine dehydrogenase Back     alignment and domain information
>PRK05854 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK09496 trkA potassium transporter peripheral membrane component; Reviewed Back     alignment and domain information
>PRK06223 malate dehydrogenase; Reviewed Back     alignment and domain information
>PRK07679 pyrroline-5-carboxylate reductase; Reviewed Back     alignment and domain information
>PRK02472 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK03562 glutathione-regulated potassium-efflux system protein KefC; Provisional Back     alignment and domain information
>cd01339 LDH-like_MDH L-lactate dehydrogenase-like malate dehydrogenase proteins Back     alignment and domain information
>PRK04690 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK12921 2-dehydropantoate 2-reductase; Provisional Back     alignment and domain information
>PRK09242 tropinone reductase; Provisional Back     alignment and domain information
>PLN02206 UDP-glucuronate decarboxylase Back     alignment and domain information
>PRK14618 NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>PRK05867 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK09260 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>PF01118 Semialdhyde_dh: Semialdehyde dehydrogenase, NAD binding domain; InterPro: IPR000534 The semialdehyde dehydrogenase family is found in N-acetyl-glutamine semialdehyde dehydrogenase (AgrC), which is involved in arginine biosynthesis, and aspartate-semialdehyde dehydrogenase [], an enzyme involved in the biosynthesis of various amino acids from aspartate Back     alignment and domain information
>cd01338 MDH_choloroplast_like Chloroplast-like malate dehydrogenases Back     alignment and domain information
>PLN03209 translocon at the inner envelope of chloroplast subunit 62; Provisional Back     alignment and domain information
>PRK05335 tRNA (uracil-5-)-methyltransferase Gid; Reviewed Back     alignment and domain information
>PLN02928 oxidoreductase family protein Back     alignment and domain information
>PRK07531 bifunctional 3-hydroxyacyl-CoA dehydrogenase/thioesterase; Validated Back     alignment and domain information
>PRK12490 6-phosphogluconate dehydrogenase-like protein; Reviewed Back     alignment and domain information
>PRK06249 2-dehydropantoate 2-reductase; Provisional Back     alignment and domain information
>PRK14620 NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>PRK06928 pyrroline-5-carboxylate reductase; Reviewed Back     alignment and domain information
>cd05292 LDH_2 A subgroup of L-lactate dehydrogenases Back     alignment and domain information
>PRK07523 gluconate 5-dehydrogenase; Provisional Back     alignment and domain information
>PTZ00142 6-phosphogluconate dehydrogenase; Provisional Back     alignment and domain information
>PRK14619 NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>PRK09186 flagellin modification protein A; Provisional Back     alignment and domain information
>PRK08217 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK11154 fadJ multifunctional fatty acid oxidation complex subunit alpha; Reviewed Back     alignment and domain information
>PRK06523 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK03803 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK05479 ketol-acid reductoisomerase; Provisional Back     alignment and domain information
>KOG0069 consensus Glyoxylate/hydroxypyruvate reductase (D-isomer-specific 2-hydroxy acid dehydrogenase superfamily) [Energy production and conversion] Back     alignment and domain information
>PRK08339 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK13304 L-aspartate dehydrogenase; Reviewed Back     alignment and domain information
>PRK08291 ectoine utilization protein EutC; Validated Back     alignment and domain information
>PLN03129 NADP-dependent malic enzyme; Provisional Back     alignment and domain information
>PRK04663 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PF00106 adh_short: short chain dehydrogenase alcohol dehydrogenase superfamily signature glucose/ribitol dehydrogenase family signature; InterPro: IPR002198 The short-chain dehydrogenases/reductases family (SDR) [] is a very large family of enzymes, most of which are known to be NAD- or NADP-dependent oxidoreductases Back     alignment and domain information
>COG1893 ApbA Ketopantoate reductase [Coenzyme metabolism] Back     alignment and domain information
>PRK11880 pyrroline-5-carboxylate reductase; Reviewed Back     alignment and domain information
>PTZ00431 pyrroline carboxylate reductase; Provisional Back     alignment and domain information
>TIGR01757 Malate-DH_plant malate dehydrogenase, NADP-dependent Back     alignment and domain information
>PRK10669 putative cation:proton antiport protein; Provisional Back     alignment and domain information
>TIGR00518 alaDH alanine dehydrogenase Back     alignment and domain information
>TIGR00065 ftsZ cell division protein FtsZ Back     alignment and domain information
>PLN02780 ketoreductase/ oxidoreductase Back     alignment and domain information
>PRK06476 pyrroline-5-carboxylate reductase; Reviewed Back     alignment and domain information
>TIGR01915 npdG NADPH-dependent F420 reductase Back     alignment and domain information
>PRK13529 malate dehydrogenase; Provisional Back     alignment and domain information
>PRK13243 glyoxylate reductase; Reviewed Back     alignment and domain information
>PLN02306 hydroxypyruvate reductase Back     alignment and domain information
>PRK11790 D-3-phosphoglycerate dehydrogenase; Provisional Back     alignment and domain information
>cd05296 GH4_P_beta_glucosidase Glycoside Hydrolases Family 4; Phospho-beta-glucosidase Back     alignment and domain information
>PRK07067 sorbitol dehydrogenase; Provisional Back     alignment and domain information
>TIGR00873 gnd 6-phosphogluconate dehydrogenase, decarboxylating Back     alignment and domain information
>TIGR01763 MalateDH_bact malate dehydrogenase, NAD-dependent Back     alignment and domain information
>PRK07478 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07062 short chain dehydrogenase; Provisional Back     alignment and domain information
>PLN02240 UDP-glucose 4-epimerase Back     alignment and domain information
>PRK07063 short chain dehydrogenase; Provisional Back     alignment and domain information
>PF02558 ApbA: Ketopantoate reductase PanE/ApbA; InterPro: IPR013332 ApbA, the ketopantoate reductase enzyme 1 Back     alignment and domain information
>PTZ00082 L-lactate dehydrogenase; Provisional Back     alignment and domain information
>PF13460 NAD_binding_10: NADH(P)-binding ; PDB: 3OH8_A 3E8X_A 3GPI_A 3QVO_A 2Q46_B 1YBM_B 1XQ6_B 2Q4B_B 3EW7_A 3IUS_B Back     alignment and domain information
>PF00106 adh_short: short chain dehydrogenase alcohol dehydrogenase superfamily signature glucose/ribitol dehydrogenase family signature; InterPro: IPR002198 The short-chain dehydrogenases/reductases family (SDR) [] is a very large family of enzymes, most of which are known to be NAD- or NADP-dependent oxidoreductases Back     alignment and domain information
>cd00650 LDH_MDH_like NAD-dependent, lactate dehydrogenase-like, 2-hydroxycarboxylate dehydrogenase family Back     alignment and domain information
>PRK08229 2-dehydropantoate 2-reductase; Provisional Back     alignment and domain information
>PRK08655 prephenate dehydrogenase; Provisional Back     alignment and domain information
>PLN02350 phosphogluconate dehydrogenase (decarboxylating) Back     alignment and domain information
>PRK09880 L-idonate 5-dehydrogenase; Provisional Back     alignment and domain information
>PRK12384 sorbitol-6-phosphate dehydrogenase; Provisional Back     alignment and domain information
>PLN02427 UDP-apiose/xylose synthase Back     alignment and domain information
>PLN02240 UDP-glucose 4-epimerase Back     alignment and domain information
>PRK07634 pyrroline-5-carboxylate reductase; Reviewed Back     alignment and domain information
>TIGR01771 L-LDH-NAD L-lactate dehydrogenase Back     alignment and domain information
>TIGR01035 hemA glutamyl-tRNA reductase Back     alignment and domain information
>PF01210 NAD_Gly3P_dh_N: NAD-dependent glycerol-3-phosphate dehydrogenase N-terminus; InterPro: IPR011128 NAD-dependent glycerol-3-phosphate dehydrogenase (GPDH) catalyses the interconversion of dihydroxyacetone phosphate and L-glycerol-3-phosphate Back     alignment and domain information
>TIGR02279 PaaC-3OHAcCoADH 3-hydroxyacyl-CoA dehydrogenase PaaC Back     alignment and domain information
>KOG0024 consensus Sorbitol dehydrogenase [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PLN02253 xanthoxin dehydrogenase Back     alignment and domain information
>PRK06139 short chain dehydrogenase; Provisional Back     alignment and domain information
>TIGR02992 ectoine_eutC ectoine utilization protein EutC Back     alignment and domain information
>PTZ00117 malate dehydrogenase; Provisional Back     alignment and domain information
>PRK05442 malate dehydrogenase; Provisional Back     alignment and domain information
>PRK11730 fadB multifunctional fatty acid oxidation complex subunit alpha; Reviewed Back     alignment and domain information
>TIGR03466 HpnA hopanoid-associated sugar epimerase Back     alignment and domain information
>PRK05565 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>cd01337 MDH_glyoxysomal_mitochondrial Glyoxysomal and mitochondrial malate dehydrogenases Back     alignment and domain information
>PRK12491 pyrroline-5-carboxylate reductase; Reviewed Back     alignment and domain information
>PRK05866 short chain dehydrogenase; Provisional Back     alignment and domain information
>PTZ00431 pyrroline carboxylate reductase; Provisional Back     alignment and domain information
>PRK06141 ornithine cyclodeaminase; Validated Back     alignment and domain information
>PLN02166 dTDP-glucose 4,6-dehydratase Back     alignment and domain information
>PLN02166 dTDP-glucose 4,6-dehydratase Back     alignment and domain information
>PRK08251 short chain dehydrogenase; Provisional Back     alignment and domain information
>PF10727 Rossmann-like: Rossmann-like domain; InterPro: IPR019665 This entry represents an NAD/NADP-binding domain with a core Rossmann-type fold, found in an uncharacterised protein family thought to be putative NADP oxidoreductase coenzyme F420-dependent proteins and/or NAD-dependent glycerol-3-phosphate dehydrogenase-like proteins Back     alignment and domain information
>PRK12550 shikimate 5-dehydrogenase; Reviewed Back     alignment and domain information
>cd01080 NAD_bind_m-THF_DH_Cyclohyd NADP binding domain of methylene-tetrahydrofolate dehydrogenase/cyclohydrolase Back     alignment and domain information
>PRK07340 ornithine cyclodeaminase; Validated Back     alignment and domain information
>PRK06057 short chain dehydrogenase; Provisional Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query1099
3cmm_A1015 Crystal Structure Of The Uba1-Ubiquitin Complex Len 0.0
4ii2_A1001 Crystal Structure Of Ubiquitin Activating Enzyme 1 0.0
1z7l_A276 Crystal Structure Of Fragment Of Mouse Ubiquitin-Ac 7e-56
1y8q_A346 Sumo E1 Activating Enzyme Sae1-Sae2-Mg-Atp Complex 8e-30
1y8q_A346 Sumo E1 Activating Enzyme Sae1-Sae2-Mg-Atp Complex 1e-07
3kyd_B551 Human Sumo E1~sumo1-amp Tetrahedral Intermediate Mi 2e-25
3kyd_B551 Human Sumo E1~sumo1-amp Tetrahedral Intermediate Mi 6e-07
3kyc_B660 Human Sumo E1 Complex With A Sumo1-Amp Mimic Length 2e-25
3kyc_B660 Human Sumo E1 Complex With A Sumo1-Amp Mimic Length 6e-07
1y8q_B640 Sumo E1 Activating Enzyme Sae1-Sae2-Mg-Atp Complex 2e-24
1y8q_B640 Sumo E1 Activating Enzyme Sae1-Sae2-Mg-Atp Complex 6e-07
2v31_A112 Structure Of First Catalytic Cysteine Half-Domain O 8e-24
2nvu_B805 Structure Of Appbp1-Uba3~nedd8-Nedd8-Mgatp-Ubc12(C1 3e-22
3gzn_B463 Structure Of Nedd8-Activating Enzyme In Complex Wit 4e-22
1yov_B444 Insights Into The Ubiquitin Transfer Cascade From T 4e-22
1tt5_B434 Structure Of Appbp1-Uba3-Ubc12n26: A Unique E1-E2 I 4e-22
3dbr_B434 Structural Dissection Of A Gating Mechanism Prevent 2e-21
3dbl_B434 Structural Dissection Of A Gating Mechanism Prevent 5e-21
1r4m_B431 Appbp1-Uba3-Nedd8, An E1-Ubiquitin-Like Protein Com 6e-21
3dbh_B434 Structural Dissection Of A Gating Mechanism Prevent 9e-21
1zfn_A253 Structural Analysis Of Escherichia Coli Thif Length 5e-10
1zud_1251 Structure Of This-Thif Protein Complex Length = 251 6e-10
2nvu_A536 Structure Of Appbp1-Uba3~nedd8-Nedd8-Mgatp-Ubc12(C1 7e-10
2nvu_A536 Structure Of Appbp1-Uba3~nedd8-Nedd8-Mgatp-Ubc12(C1 2e-04
3gzn_A534 Structure Of Nedd8-Activating Enzyme In Complex Wit 8e-10
3gzn_A534 Structure Of Nedd8-Activating Enzyme In Complex Wit 3e-04
1r4m_A529 Appbp1-Uba3-Nedd8, An E1-Ubiquitin-Like Protein Com 8e-10
1r4m_A529 Appbp1-Uba3-Nedd8, An E1-Ubiquitin-Like Protein Com 3e-04
1yov_A537 Insights Into The Ubiquitin Transfer Cascade From T 8e-10
1yov_A537 Insights Into The Ubiquitin Transfer Cascade From T 3e-04
1tt5_A531 Structure Of Appbp1-Uba3-Ubc12n26: A Unique E1-E2 I 8e-10
1tt5_A531 Structure Of Appbp1-Uba3-Ubc12n26: A Unique E1-E2 I 3e-04
1jwb_B249 Structure Of The Covalent Acyl-Adenylate Form Of Th 3e-09
3h5n_A353 Crystal Structure Of E. Coli Mccb + Atp Length = 35 2e-06
3h5a_A358 Crystal Structure Of E. Coli Mccb Length = 358 2e-06
>pdb|3CMM|A Chain A, Crystal Structure Of The Uba1-Ubiquitin Complex Length = 1015 Back     alignment and structure 
Iteration: 1

 Score =  879 bits (2271), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 458/1025 (44%), Positives = 662/1025 (64%), Gaps = 30/1025 (2%)
Query: 91   DIDEDLHSRQLAVYGRETMRRLFASNILVSGMQGLGAEIAKNLILAGVKSVTLHDEGTVE 150
            +IDE L+SRQL V G+E M ++  SN+L+ G++GLG EIAKN++LAGVKS+T+ D   V+
Sbjct: 4    EIDESLYSRQLYVLGKEAMLKMQTSNVLILGLKGLGVEIAKNVVLAGVKSMTVFDPEPVQ 63
Query: 151  LWDLSSNFVFSDNDIGKNRALASVQKLQELNNAVVLSTLTSKLTKEQLSDFQAVVFTD-I 209
            L DLS+ F  ++ DIG+ R   +  KL ELN  V ++ L S     QLS FQ VV TD +
Sbjct: 64   LADLSTQFFLTEKDIGQKRGDVTRAKLAELNAYVPVNVLDSLDDVTQLSQFQVVVATDTV 123
Query: 210  SLDKAIEFDDFCHNHQPAISFIKAEVRGLFGSVFCDFGPEFTVVDVDGEDPHTGIIASIS 269
            SL+  ++ ++FCH+    I FI +E RGLFG+ F D G EFTV+D  GE+P TG+++ I 
Sbjct: 124  SLEDKVKINEFCHSS--GIRFISSETRGLFGNTFVDLGDEFTVLDPTGEEPRTGMVSDIE 181
Query: 270  NDNPALVSCVDDERLEFQDGDLVVFSEVHGMTELNDGKPRKIKSARPYSFTLEEDTTNYG 329
             D    V+ +DD R   +DG+ V FSEV G+ +LNDG   K++   P++F +      YG
Sbjct: 182  PD--GTVTMLDDNRHGLEDGNFVRFSEVEGLDKLNDGTLFKVEVLGPFAFRIGS-VKEYG 238
Query: 330  TYVKGGIVTQVKQPKVLNFKPLREALEDPGDFLLSDFSKFDRPPPLHLAFQALDKF-VSE 388
             Y KGGI T+VK P+ ++FK L++ L +P +F+ SDF+KFDR   LHL FQAL +F V  
Sbjct: 239  EYKKGGIFTEVKVPRKISFKSLKQQLSNP-EFVFSDFAKFDRAAQLHLGFQALHQFAVRH 297
Query: 389  LGRFPVAGSEEDAQKLISVATNIN----ESLGDGRVEDINTKLLRHFAFGARAVLNPMAA 444
             G  P   ++EDA +LI + T+++    E LG+G   D+N  L++  ++ AR  +  + A
Sbjct: 298  NGELPRTMNDEDANELIKLVTDLSVQQPEVLGEGV--DVNEDLIKELSYQARGDIPGVVA 355
Query: 445  MFGGIVGQEVVKACSGKFHPLYQFFYFDSVESLPTE---PLDSTEFKPINSRYDAQISVF 501
             FGG+V QEV+KACSGKF PL QF YFDS+ESLP     P +    +P+NSRYD QI+VF
Sbjct: 356  FFGGLVAQEVLKACSGKFTPLKQFMYFDSLESLPDPKNFPRNEKTTQPVNSRYDNQIAVF 415
Query: 502  GAKLQKKLEDAKVFIVGSGALGCEFLKNVALMGVSCGNQGKLTITDDDVIEKSNLSRQFL 561
            G   QKK+ ++KVF+VGSGA+GCE LKN AL+G+  G+ G + +TD+D IEKSNL+RQFL
Sbjct: 416  GLDFQKKIANSKVFLVGSGAIGCEMLKNWALLGLGSGSDGYIVVTDNDSIEKSNLNRQFL 475
Query: 562  FRDWNIGQXXXXXXXXXXXXINPRLN--IEALQNRVGPETENVFDDTFWENITCVINALD 619
            FR  ++G+            +NP L   I A  ++VGPETE +F+D+FWE++  V NALD
Sbjct: 476  FRPKDVGKNKSEVAAEAVCAMNPDLKGKINAKIDKVGPETEEIFNDSFWESLDFVTNALD 535
Query: 620  NVNARLYVDQRCLYFQKPLLESGTLGAKCNTQMVIPHLTENYGASRDPPEKQAPMCTVHS 679
            NV+AR YVD+RC++++KPLLESGTLG K NTQ++IP LTE+Y +SRDPPEK  P+CT+ S
Sbjct: 536  NVDARTYVDRRCVFYRKPLLESGTLGTKGNTQVIIPRLTESYSSSRDPPEKSIPLCTLRS 595
Query: 680  FPHNIDHCLTWARSEFEGLLEKTPAEVNAYLSNPVEYTTSMANAGDAQARDNLERVLECL 739
            FP+ IDH + WA+S F+G    +   VN YL+ P     ++  +GD +    LE + + L
Sbjct: 596  FPNKIDHTIAWAKSLFQGYFTDSAENVNMYLTQPNFVEQTLKQSGDVKGV--LESISDSL 653
Query: 740  DKEKCEIFQDCITWARLKFEDYFSNRVKQLIFTFPEDAATSTGAPFWSAPKRFPHPLQFS 799
               K   F+DCI WARL+FE  F++ +KQL+F FP+DA TS G PFWS  KR P PL+F 
Sbjct: 654  -SSKPHNFEDCIKWARLEFEKKFNHDIKQLLFNFPKDAKTSNGEPFWSGAKRAPTPLEFD 712
Query: 800  SADPSHLHFVMAASILRAETFGIPIPDWTNNPKM--LAEAVDKVMVPDFLPKKDAKILTD 857
              +  H HFV+A + LRA  +GI   D  + P +      +D +++P+F P  + KI  +
Sbjct: 713  IYNNDHFHFVVAGASLRAYNYGIKSDDSNSKPNVDEYKSVIDHMIIPEFTPNANLKIQVN 772
Query: 858  EKATTLSTASVDDAAVINDLIIKLEQCRKNLPSGFRLKPIQFEKDDDTNYHMDMIAGLAN 917
            +     +  + + +  I+ L+  L     +  +GF+L+P+ FEKDDDTN+H++ I   +N
Sbjct: 773  DDDPDPNANAANGSDEIDQLVSSLPD--PSTLAGFKLEPVDFEKDDDTNHHIEFITACSN 830
Query: 918  MRARNYSIPEVDKLKAKFIAGRIIPAIATSTAMATGLVCLELYKVLDGGHKLEDYRNTFA 977
             RA+NY I   D+ K KFIAGRIIPAIAT+T++ TGLV LELYK++D    +E Y+N F 
Sbjct: 831  CRAQNYFIETADRQKTKFIAGRIIPAIATTTSLVTGLVNLELYKLIDNKTDIEQYKNGFV 890
Query: 978  NLALPLFSMAEPVPPKVIKHRDMSW-TVWDRWILKDNPTLRELIQWL-KDKGLNAYSISC 1035
            NLALP F  +EP+     ++ +  +  +WDR+ +K +  L +LI+   KD+GL    +S 
Sbjct: 891  NLALPFFGFSEPIASPKGEYNNKKYDKIWDRFDIKGDIKLSDLIEHFEKDEGLEITMLSY 950
Query: 1036 GSCLLFNSMFP--RHKERMDKKVVDLAREVAKVELPPYRRHLDVVVACEDDEDNDIDIPL 1093
            G  LL+ S FP  + KER++  +  L + V K ++P +   + + +  +D E  D+++P 
Sbjct: 951  GVSLLYASFFPPKKLKERLNLPITQLVKLVTKKDIPAHVSTMILEICADDKEGEDVEVPF 1010
Query: 1094 ISIYF 1098
            I+I+ 
Sbjct: 1011 ITIHL 1015
>pdb|4II2|A Chain A, Crystal Structure Of Ubiquitin Activating Enzyme 1 (uba1) In Complex With The Ub E2 Ubc4, Ubiquitin, And Atp/mg Length = 1001 Back     alignment and structure
>pdb|1Z7L|A Chain A, Crystal Structure Of Fragment Of Mouse Ubiquitin-Activating Enzyme Length = 276 Back     alignment and structure
>pdb|1Y8Q|A Chain A, Sumo E1 Activating Enzyme Sae1-Sae2-Mg-Atp Complex Length = 346 Back     alignment and structure
>pdb|1Y8Q|A Chain A, Sumo E1 Activating Enzyme Sae1-Sae2-Mg-Atp Complex Length = 346 Back     alignment and structure
>pdb|3KYD|B Chain B, Human Sumo E1~sumo1-amp Tetrahedral Intermediate Mimic Length = 551 Back     alignment and structure
>pdb|3KYD|B Chain B, Human Sumo E1~sumo1-amp Tetrahedral Intermediate Mimic Length = 551 Back     alignment and structure
>pdb|3KYC|B Chain B, Human Sumo E1 Complex With A Sumo1-Amp Mimic Length = 660 Back     alignment and structure
>pdb|3KYC|B Chain B, Human Sumo E1 Complex With A Sumo1-Amp Mimic Length = 660 Back     alignment and structure
>pdb|1Y8Q|B Chain B, Sumo E1 Activating Enzyme Sae1-Sae2-Mg-Atp Complex Length = 640 Back     alignment and structure
>pdb|1Y8Q|B Chain B, Sumo E1 Activating Enzyme Sae1-Sae2-Mg-Atp Complex Length = 640 Back     alignment and structure
>pdb|2V31|A Chain A, Structure Of First Catalytic Cysteine Half-Domain Of Mouse Ubiquitin-Activating Enzyme Length = 112 Back     alignment and structure
>pdb|2NVU|B Chain B, Structure Of Appbp1-Uba3~nedd8-Nedd8-Mgatp-Ubc12(C111a), A Trapped Ubiquitin-Like Protein Activation Complex Length = 805 Back     alignment and structure
>pdb|3GZN|B Chain B, Structure Of Nedd8-Activating Enzyme In Complex With Nedd8 And Mln4924 Length = 463 Back     alignment and structure
>pdb|1YOV|B Chain B, Insights Into The Ubiquitin Transfer Cascade From The Refined Structure Of The Activating Enzyme For Nedd8 Length = 444 Back     alignment and structure
>pdb|1TT5|B Chain B, Structure Of Appbp1-Uba3-Ubc12n26: A Unique E1-E2 Interaction Required For Optimal Conjugation Of The Ubiquitin-Like Protein Nedd8 Length = 434 Back     alignment and structure
>pdb|3DBR|B Chain B, Structural Dissection Of A Gating Mechanism Preventing Misactivation Of Ubiquitin By Nedd8's E1 (Appbp1- Uba3arg190gln-Nedd8ala72arg) Length = 434 Back     alignment and structure
>pdb|3DBL|B Chain B, Structural Dissection Of A Gating Mechanism Preventing Misactivation Of Ubiquitin By Nedd8's E1 (Appbp1- Uba3arg190wt-Nedd8ala72gln) Length = 434 Back     alignment and structure
>pdb|1R4M|B Chain B, Appbp1-Uba3-Nedd8, An E1-Ubiquitin-Like Protein Complex Length = 431 Back     alignment and structure
>pdb|3DBH|B Chain B, Structural Dissection Of A Gating Mechanism Preventing Misactivation Of Ubiquitin By Nedd8's E1 (Appbp1- Uba3arg190ala-Nedd8ala72arg) Length = 434 Back     alignment and structure
>pdb|1ZFN|A Chain A, Structural Analysis Of Escherichia Coli Thif Length = 253 Back     alignment and structure
>pdb|1ZUD|1 Chain 1, Structure Of This-Thif Protein Complex Length = 251 Back     alignment and structure
>pdb|2NVU|A Chain A, Structure Of Appbp1-Uba3~nedd8-Nedd8-Mgatp-Ubc12(C111a), A Trapped Ubiquitin-Like Protein Activation Complex Length = 536 Back     alignment and structure
>pdb|2NVU|A Chain A, Structure Of Appbp1-Uba3~nedd8-Nedd8-Mgatp-Ubc12(C111a), A Trapped Ubiquitin-Like Protein Activation Complex Length = 536 Back     alignment and structure
>pdb|3GZN|A Chain A, Structure Of Nedd8-Activating Enzyme In Complex With Nedd8 And Mln4924 Length = 534 Back     alignment and structure
>pdb|3GZN|A Chain A, Structure Of Nedd8-Activating Enzyme In Complex With Nedd8 And Mln4924 Length = 534 Back     alignment and structure
>pdb|1R4M|A Chain A, Appbp1-Uba3-Nedd8, An E1-Ubiquitin-Like Protein Complex Length = 529 Back     alignment and structure
>pdb|1R4M|A Chain A, Appbp1-Uba3-Nedd8, An E1-Ubiquitin-Like Protein Complex Length = 529 Back     alignment and structure
>pdb|1YOV|A Chain A, Insights Into The Ubiquitin Transfer Cascade From The Refined Structure Of The Activating Enzyme For Nedd8 Length = 537 Back     alignment and structure
>pdb|1YOV|A Chain A, Insights Into The Ubiquitin Transfer Cascade From The Refined Structure Of The Activating Enzyme For Nedd8 Length = 537 Back     alignment and structure
>pdb|1TT5|A Chain A, Structure Of Appbp1-Uba3-Ubc12n26: A Unique E1-E2 Interaction Required For Optimal Conjugation Of The Ubiquitin-Like Protein Nedd8 Length = 531 Back     alignment and structure
>pdb|1TT5|A Chain A, Structure Of Appbp1-Uba3-Ubc12n26: A Unique E1-E2 Interaction Required For Optimal Conjugation Of The Ubiquitin-Like Protein Nedd8 Length = 531 Back     alignment and structure
>pdb|1JWB|B Chain B, Structure Of The Covalent Acyl-Adenylate Form Of The Moeb-Moad Protein Complex Length = 249 Back     alignment and structure
>pdb|3H5N|A Chain A, Crystal Structure Of E. Coli Mccb + Atp Length = 353 Back     alignment and structure
>pdb|3H5A|A Chain A, Crystal Structure Of E. Coli Mccb Length = 358 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query1099
3cmm_A1015 Ubiquitin-activating enzyme E1 1; UBA1, protein tu 0.0
3cmm_A1015 Ubiquitin-activating enzyme E1 1; UBA1, protein tu 6e-22
1y8q_B640 Anthracycline-, ubiquitin-like 2 activating enzyme 1e-145
1y8q_B640 Anthracycline-, ubiquitin-like 2 activating enzyme 2e-12
1y8q_A346 Ubiquitin-like 1 activating enzyme E1A; SUMO, hete 1e-104
1y8q_A346 Ubiquitin-like 1 activating enzyme E1A; SUMO, hete 1e-33
1z7l_A276 Ubiquitin-activating enzyme E1 1; SCCH, second cat 2e-90
2nvu_B805 Maltose binding protein/NEDD8-activating enzyme E1 6e-84
2nvu_B805 Maltose binding protein/NEDD8-activating enzyme E1 2e-29
2nvu_B805 Maltose binding protein/NEDD8-activating enzyme E1 5e-07
1tt5_B434 Ubiquitin-activating enzyme E1C isoform 1; cell cy 2e-79
1tt5_B434 Ubiquitin-activating enzyme E1C isoform 1; cell cy 8e-27
1tt5_B434 Ubiquitin-activating enzyme E1C isoform 1; cell cy 6e-12
1tt5_A531 APPBP1, amyloid protein-binding protein 1; cell cy 3e-61
1tt5_A531 APPBP1, amyloid protein-binding protein 1; cell cy 1e-56
1tt5_A531 APPBP1, amyloid protein-binding protein 1; cell cy 2e-35
2v31_A112 Ubiquitin-activating enzyme E1 X; ligase, phosphor 1e-46
3h5n_A353 MCCB protein; ubiquitin-activating enzyme, microci 8e-26
3h5n_A353 MCCB protein; ubiquitin-activating enzyme, microci 9e-11
3h8v_A292 Ubiquitin-like modifier-activating enzyme 5; rossm 1e-24
3h8v_A292 Ubiquitin-like modifier-activating enzyme 5; rossm 4e-09
1jw9_B249 Molybdopterin biosynthesis MOEB protein; MOEB: mod 1e-24
1jw9_B249 Molybdopterin biosynthesis MOEB protein; MOEB: mod 3e-09
1zud_1251 Adenylyltransferase THIF; thiamin, thiazole, prote 2e-24
1zud_1251 Adenylyltransferase THIF; thiamin, thiazole, prote 8e-10
3rui_A340 Ubiquitin-like modifier-activating enzyme ATG7; au 2e-19
3rui_A340 Ubiquitin-like modifier-activating enzyme ATG7; au 9e-09
3vh1_A598 Ubiquitin-like modifier-activating enzyme ATG7; au 3e-18
3vh1_A598 Ubiquitin-like modifier-activating enzyme ATG7; au 4e-09
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 5e-17
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-09
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 5e-06
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-04
>3cmm_A Ubiquitin-activating enzyme E1 1; UBA1, protein turnover, ligase, conformationa thioester, adenylation, transthioesterification, ATP-bindin nucleotide-binding; 2.70A {Saccharomyces cerevisiae} Length = 1015 Back     alignment and structure
 Score = 1017 bits (2630), Expect = 0.0
 Identities = 457/1024 (44%), Positives = 661/1024 (64%), Gaps = 26/1024 (2%)

Query: 90   TDIDEDLHSRQLAVYGRETMRRLFASNILVSGMQGLGAEIAKNLILAGVKSVTLHDEGTV 149
             +IDE L+SRQL V G+E M ++  SN+L+ G++GLG EIAKN++LAGVKS+T+ D   V
Sbjct: 3    GEIDESLYSRQLYVLGKEAMLKMQTSNVLILGLKGLGVEIAKNVVLAGVKSMTVFDPEPV 62

Query: 150  ELWDLSSNFVFSDNDIGKNRALASVQKLQELNNAVVLSTLTSKLTKEQLSDFQAVVFTD- 208
            +L DLS+ F  ++ DIG+ R   +  KL ELN  V ++ L S     QLS FQ VV TD 
Sbjct: 63   QLADLSTQFFLTEKDIGQKRGDVTRAKLAELNAYVPVNVLDSLDDVTQLSQFQVVVATDT 122

Query: 209  ISLDKAIEFDDFCHNHQPAISFIKAEVRGLFGSVFCDFGPEFTVVDVDGEDPHTGIIASI 268
            +SL+  ++ ++FCH+    I FI +E RGLFG+ F D G EFTV+D  GE+P TG+++ I
Sbjct: 123  VSLEDKVKINEFCHSSG--IRFISSETRGLFGNTFVDLGDEFTVLDPTGEEPRTGMVSDI 180

Query: 269  SNDNPALVSCVDDERLEFQDGDLVVFSEVHGMTELNDGKPRKIKSARPYSFTLEEDTTNY 328
              D    V+ +DD R   +DG+ V FSEV G+ +LNDG   K++   P++F +      Y
Sbjct: 181  EPDGT--VTMLDDNRHGLEDGNFVRFSEVEGLDKLNDGTLFKVEVLGPFAFRI-GSVKEY 237

Query: 329  GTYVKGGIVTQVKQPKVLNFKPLREALEDPGDFLLSDFSKFDRPPPLHLAFQALDKFVSE 388
            G Y KGGI T+VK P+ ++FK L++ L +P +F+ SDF+KFDR   LHL FQAL +F   
Sbjct: 238  GEYKKGGIFTEVKVPRKISFKSLKQQLSNP-EFVFSDFAKFDRAAQLHLGFQALHQFAVR 296

Query: 389  -LGRFPVAGSEEDAQKLISVATNINESLGD--GRVEDINTKLLRHFAFGARAVLNPMAAM 445
              G  P   ++EDA +LI + T+++    +  G   D+N  L++  ++ AR  +  + A 
Sbjct: 297  HNGELPRTMNDEDANELIKLVTDLSVQQPEVLGEGVDVNEDLIKELSYQARGDIPGVVAF 356

Query: 446  FGGIVGQEVVKACSGKFHPLYQFFYFDSVESLPTE---PLDSTEFKPINSRYDAQISVFG 502
            FGG+V QEV+KACSGKF PL QF YFDS+ESLP     P +    +P+NSRYD QI+VFG
Sbjct: 357  FGGLVAQEVLKACSGKFTPLKQFMYFDSLESLPDPKNFPRNEKTTQPVNSRYDNQIAVFG 416

Query: 503  AKLQKKLEDAKVFIVGSGALGCEFLKNVALMGVSCGNQGKLTITDDDVIEKSNLSRQFLF 562
               QKK+ ++KVF+VGSGA+GCE LKN AL+G+  G+ G + +TD+D IEKSNL+RQFLF
Sbjct: 417  LDFQKKIANSKVFLVGSGAIGCEMLKNWALLGLGSGSDGYIVVTDNDSIEKSNLNRQFLF 476

Query: 563  RDWNIGQAKSTVAASAATSINPRLNIE--ALQNRVGPETENVFDDTFWENITCVINALDN 620
            R  ++G+ KS VAA A  ++NP L  +  A  ++VGPETE +F+D+FWE++  V NALDN
Sbjct: 477  RPKDVGKNKSEVAAEAVCAMNPDLKGKINAKIDKVGPETEEIFNDSFWESLDFVTNALDN 536

Query: 621  VNARLYVDQRCLYFQKPLLESGTLGAKCNTQMVIPHLTENYGASRDPPEKQAPMCTVHSF 680
            V+AR YVD+RC++++KPLLESGTLG K NTQ++IP LTE+Y +SRDPPEK  P+CT+ SF
Sbjct: 537  VDARTYVDRRCVFYRKPLLESGTLGTKGNTQVIIPRLTESYSSSRDPPEKSIPLCTLRSF 596

Query: 681  PHNIDHCLTWARSEFEGLLEKTPAEVNAYLSNPVEYTTSMANAGDAQARDNLERVLECLD 740
            P+ IDH + WA+S F+G    +   VN YL+ P     ++  +GD   +  LE + + L 
Sbjct: 597  PNKIDHTIAWAKSLFQGYFTDSAENVNMYLTQPNFVEQTLKQSGD--VKGVLESISDSLS 654

Query: 741  KEKCEIFQDCITWARLKFEDYFSNRVKQLIFTFPEDAATSTGAPFWSAPKRFPHPLQFSS 800
              K   F+DCI WARL+FE  F++ +KQL+F FP+DA TS G PFWS  KR P PL+F  
Sbjct: 655  -SKPHNFEDCIKWARLEFEKKFNHDIKQLLFNFPKDAKTSNGEPFWSGAKRAPTPLEFDI 713

Query: 801  ADPSHLHFVMAASILRAETFGIPIPDWTNNPKM--LAEAVDKVMVPDFLPKKDAKILTDE 858
             +  H HFV+A + LRA  +GI   D  + P +      +D +++P+F P  + KI  ++
Sbjct: 714  YNNDHFHFVVAGASLRAYNYGIKSDDSNSKPNVDEYKSVIDHMIIPEFTPNANLKIQVND 773

Query: 859  KATTLSTASVDDAAVINDLIIKLEQCRKNLPSGFRLKPIQFEKDDDTNYHMDMIAGLANM 918
                 +  + + +  I+ L+  L        +GF+L+P+ FEKDDDTN+H++ I   +N 
Sbjct: 774  DDPDPNANAANGSDEIDQLVSSLPDPSTL--AGFKLEPVDFEKDDDTNHHIEFITACSNC 831

Query: 919  RARNYSIPEVDKLKAKFIAGRIIPAIATSTAMATGLVCLELYKVLDGGHKLEDYRNTFAN 978
            RA+NY I   D+ K KFIAGRIIPAIAT+T++ TGLV LELYK++D    +E Y+N F N
Sbjct: 832  RAQNYFIETADRQKTKFIAGRIIPAIATTTSLVTGLVNLELYKLIDNKTDIEQYKNGFVN 891

Query: 979  LALPLFSMAEPVPPKVIKHRDMSW-TVWDRWILKDNPTLRELIQWLKDK-GLNAYSISCG 1036
            LALP F  +EP+     ++ +  +  +WDR+ +K +  L +LI+  +   GL    +S G
Sbjct: 892  LALPFFGFSEPIASPKGEYNNKKYDKIWDRFDIKGDIKLSDLIEHFEKDEGLEITMLSYG 951

Query: 1037 SCLLFNSMFPRHK--ERMDKKVVDLAREVAKVELPPYRRHLDVVVACEDDEDNDIDIPLI 1094
              LL+ S FP  K  ER++  +  L + V K ++P +   + + +  +D E  D+++P I
Sbjct: 952  VSLLYASFFPPKKLKERLNLPITQLVKLVTKKDIPAHVSTMILEICADDKEGEDVEVPFI 1011

Query: 1095 SIYF 1098
            +I+ 
Sbjct: 1012 TIHL 1015
>3cmm_A Ubiquitin-activating enzyme E1 1; UBA1, protein turnover, ligase, conformationa thioester, adenylation, transthioesterification, ATP-bindin nucleotide-binding; 2.70A {Saccharomyces cerevisiae} Length = 1015 Back     alignment and structure
>1y8q_B Anthracycline-, ubiquitin-like 2 activating enzyme E1B; SUMO, heterodimer, UBL, ligase; HET: ATP; 2.25A {Homo sapiens} PDB: 1y8r_B* 3kyc_B* 3kyd_B* 2px9_A Length = 640 Back     alignment and structure
>1y8q_B Anthracycline-, ubiquitin-like 2 activating enzyme E1B; SUMO, heterodimer, UBL, ligase; HET: ATP; 2.25A {Homo sapiens} PDB: 1y8r_B* 3kyc_B* 3kyd_B* 2px9_A Length = 640 Back     alignment and structure
>1y8q_A Ubiquitin-like 1 activating enzyme E1A; SUMO, heterodimer, UBL, ligase; HET: ATP; 2.25A {Homo sapiens} PDB: 1y8r_A* 3kyc_A* 3kyd_A* Length = 346 Back     alignment and structure
>1y8q_A Ubiquitin-like 1 activating enzyme E1A; SUMO, heterodimer, UBL, ligase; HET: ATP; 2.25A {Homo sapiens} PDB: 1y8r_A* 3kyc_A* 3kyd_A* Length = 346 Back     alignment and structure
>1z7l_A Ubiquitin-activating enzyme E1 1; SCCH, second catalytic cysteine half-domain, ligase; HET: TBR; 2.80A {Mus musculus} Length = 276 Back     alignment and structure
>2nvu_B Maltose binding protein/NEDD8-activating enzyme E1 catalytic subunit chimera; multifunction macromolecular complex, ubiquitin, ATP, conformational change, thioester, switch, adenylation, protein turnover, ligase; HET: ATP; 2.80A {Homo sapiens} SCOP: c.111.1.2 c.94.1.1 Length = 805 Back     alignment and structure
>2nvu_B Maltose binding protein/NEDD8-activating enzyme E1 catalytic subunit chimera; multifunction macromolecular complex, ubiquitin, ATP, conformational change, thioester, switch, adenylation, protein turnover, ligase; HET: ATP; 2.80A {Homo sapiens} SCOP: c.111.1.2 c.94.1.1 Length = 805 Back     alignment and structure
>2nvu_B Maltose binding protein/NEDD8-activating enzyme E1 catalytic subunit chimera; multifunction macromolecular complex, ubiquitin, ATP, conformational change, thioester, switch, adenylation, protein turnover, ligase; HET: ATP; 2.80A {Homo sapiens} SCOP: c.111.1.2 c.94.1.1 Length = 805 Back     alignment and structure
>1tt5_B Ubiquitin-activating enzyme E1C isoform 1; cell cycle, ligase; 2.60A {Homo sapiens} SCOP: c.111.1.2 PDB: 3dbl_B 3dbr_B 3dbh_B 3gzn_B* 1yov_B 1r4m_B 1r4n_B* Length = 434 Back     alignment and structure
>1tt5_B Ubiquitin-activating enzyme E1C isoform 1; cell cycle, ligase; 2.60A {Homo sapiens} SCOP: c.111.1.2 PDB: 3dbl_B 3dbr_B 3dbh_B 3gzn_B* 1yov_B 1r4m_B 1r4n_B* Length = 434 Back     alignment and structure
>1tt5_B Ubiquitin-activating enzyme E1C isoform 1; cell cycle, ligase; 2.60A {Homo sapiens} SCOP: c.111.1.2 PDB: 3dbl_B 3dbr_B 3dbh_B 3gzn_B* 1yov_B 1r4m_B 1r4n_B* Length = 434 Back     alignment and structure
>1tt5_A APPBP1, amyloid protein-binding protein 1; cell cycle, ligase; 2.60A {Homo sapiens} SCOP: c.111.1.2 PDB: 3dbh_A 3dbl_A 3dbr_A 1r4m_A 1r4n_A* 2nvu_A* 1yov_A 3gzn_A* Length = 531 Back     alignment and structure
>1tt5_A APPBP1, amyloid protein-binding protein 1; cell cycle, ligase; 2.60A {Homo sapiens} SCOP: c.111.1.2 PDB: 3dbh_A 3dbl_A 3dbr_A 1r4m_A 1r4n_A* 2nvu_A* 1yov_A 3gzn_A* Length = 531 Back     alignment and structure
>1tt5_A APPBP1, amyloid protein-binding protein 1; cell cycle, ligase; 2.60A {Homo sapiens} SCOP: c.111.1.2 PDB: 3dbh_A 3dbl_A 3dbr_A 1r4m_A 1r4n_A* 2nvu_A* 1yov_A 3gzn_A* Length = 531 Back     alignment and structure
>2v31_A Ubiquitin-activating enzyme E1 X; ligase, phosphorylation, catalytic domain, heteronuclear first catalytic cysteine half-domain, E1 protein; NMR {Mus musculus} Length = 112 Back     alignment and structure
>3h5n_A MCCB protein; ubiquitin-activating enzyme, microcin, protein structure, MCCC7, peptide antibiotics, N-P bond formation, transferase; HET: ATP; 1.90A {Escherichia coli} PDB: 3h5r_A 3h9g_A 3h9j_A* 3h9q_A 3h5a_A Length = 353 Back     alignment and structure
>3h5n_A MCCB protein; ubiquitin-activating enzyme, microcin, protein structure, MCCC7, peptide antibiotics, N-P bond formation, transferase; HET: ATP; 1.90A {Escherichia coli} PDB: 3h5r_A 3h9g_A 3h9j_A* 3h9q_A 3h5a_A Length = 353 Back     alignment and structure
>3h8v_A Ubiquitin-like modifier-activating enzyme 5; rossman fold, ATP-binding, UBL conjugation pathway, transfer structural genomics consortium, SGC; HET: ATP; 2.00A {Homo sapiens} PDB: 3guc_A* Length = 292 Back     alignment and structure
>3h8v_A Ubiquitin-like modifier-activating enzyme 5; rossman fold, ATP-binding, UBL conjugation pathway, transfer structural genomics consortium, SGC; HET: ATP; 2.00A {Homo sapiens} PDB: 3guc_A* Length = 292 Back     alignment and structure
>1jw9_B Molybdopterin biosynthesis MOEB protein; MOEB: modified rossmann fold, (2) Cys-X-X-Cys zinc-binding M MOAD: ubiquitin-like fold; 1.70A {Escherichia coli} SCOP: c.111.1.1 PDB: 1jwa_B* 1jwb_B* Length = 249 Back     alignment and structure
>1jw9_B Molybdopterin biosynthesis MOEB protein; MOEB: modified rossmann fold, (2) Cys-X-X-Cys zinc-binding M MOAD: ubiquitin-like fold; 1.70A {Escherichia coli} SCOP: c.111.1.1 PDB: 1jwa_B* 1jwb_B* Length = 249 Back     alignment and structure
>1zud_1 Adenylyltransferase THIF; thiamin, thiazole, protein-protein complex, THIF, TRAN biosynthetic protein complex; 1.98A {Escherichia coli} PDB: 1zfn_A* 1zkm_A Length = 251 Back     alignment and structure
>1zud_1 Adenylyltransferase THIF; thiamin, thiazole, protein-protein complex, THIF, TRAN biosynthetic protein complex; 1.98A {Escherichia coli} PDB: 1zfn_A* 1zkm_A Length = 251 Back     alignment and structure
>3rui_A Ubiquitin-like modifier-activating enzyme ATG7; autophagosome formation, non-canonical E1, ATP BI UBL, ATG8, ATG12, ATG10, ATG3, UBL activation, thiolation; 1.91A {Saccharomyces cerevisiae} PDB: 3t7e_A 3vh3_A 3vh4_A* Length = 340 Back     alignment and structure
>3rui_A Ubiquitin-like modifier-activating enzyme ATG7; autophagosome formation, non-canonical E1, ATP BI UBL, ATG8, ATG12, ATG10, ATG3, UBL activation, thiolation; 1.91A {Saccharomyces cerevisiae} PDB: 3t7e_A 3vh3_A 3vh4_A* Length = 340 Back     alignment and structure
>3vh1_A Ubiquitin-like modifier-activating enzyme ATG7; autophagy, zinc binding, metal binding protein; 3.00A {Saccharomyces cerevisiae} PDB: 3vh2_A Length = 598 Back     alignment and structure
>3vh1_A Ubiquitin-like modifier-activating enzyme ATG7; autophagy, zinc binding, metal binding protein; 3.00A {Saccharomyces cerevisiae} PDB: 3vh2_A Length = 598 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query1099
3cmm_A1015 Ubiquitin-activating enzyme E1 1; UBA1, protein tu 100.0
1y8q_B640 Anthracycline-, ubiquitin-like 2 activating enzyme 100.0
1z7l_A276 Ubiquitin-activating enzyme E1 1; SCCH, second cat 100.0
1tt5_A531 APPBP1, amyloid protein-binding protein 1; cell cy 100.0
1y8q_A346 Ubiquitin-like 1 activating enzyme E1A; SUMO, hete 100.0
1tt5_B434 Ubiquitin-activating enzyme E1C isoform 1; cell cy 100.0
2nvu_B805 Maltose binding protein/NEDD8-activating enzyme E1 100.0
1y8q_A346 Ubiquitin-like 1 activating enzyme E1A; SUMO, hete 100.0
1tt5_A531 APPBP1, amyloid protein-binding protein 1; cell cy 100.0
3h8v_A292 Ubiquitin-like modifier-activating enzyme 5; rossm 100.0
1tt5_B434 Ubiquitin-activating enzyme E1C isoform 1; cell cy 100.0
1zud_1251 Adenylyltransferase THIF; thiamin, thiazole, prote 99.97
2nvu_B805 Maltose binding protein/NEDD8-activating enzyme E1 99.97
1jw9_B249 Molybdopterin biosynthesis MOEB protein; MOEB: mod 99.97
3h5n_A353 MCCB protein; ubiquitin-activating enzyme, microci 99.97
1zud_1251 Adenylyltransferase THIF; thiamin, thiazole, prote 99.96
1y8q_B640 Anthracycline-, ubiquitin-like 2 activating enzyme 99.96
3rui_A340 Ubiquitin-like modifier-activating enzyme ATG7; au 99.96
3cmm_A 1015 Ubiquitin-activating enzyme E1 1; UBA1, protein tu 99.96
1jw9_B249 Molybdopterin biosynthesis MOEB protein; MOEB: mod 99.95
3vh1_A598 Ubiquitin-like modifier-activating enzyme ATG7; au 99.95
3h8v_A292 Ubiquitin-like modifier-activating enzyme 5; rossm 99.95
4gsl_A615 Ubiquitin-like modifier-activating enzyme ATG7; ub 99.95
3h5n_A353 MCCB protein; ubiquitin-activating enzyme, microci 99.94
3rui_A340 Ubiquitin-like modifier-activating enzyme ATG7; au 99.91
3vh1_A598 Ubiquitin-like modifier-activating enzyme ATG7; au 99.91
2v31_A112 Ubiquitin-activating enzyme E1 X; ligase, phosphor 99.9
4gsl_A615 Ubiquitin-like modifier-activating enzyme ATG7; ub 99.9
1z7l_A276 Ubiquitin-activating enzyme E1 1; SCCH, second cat 98.32
3dfz_A223 SIRC, precorrin-2 dehydrogenase; NAD dehydrogenase 97.2
1y8x_B98 Ubiquitin-activating enzyme E1C; ubiquitin-conjuga 97.03
3jyo_A283 Quinate/shikimate dehydrogenase; enzyme-cofactor c 96.88
3jyo_A283 Quinate/shikimate dehydrogenase; enzyme-cofactor c 96.81
3dfz_A223 SIRC, precorrin-2 dehydrogenase; NAD dehydrogenase 96.78
3ic5_A118 Putative saccharopine dehydrogenase; structural ge 96.76
1kyq_A274 Met8P, siroheme biosynthesis protein Met8; homodim 96.69
1pjq_A457 CYSG, siroheme synthase; rossman fold, nucleotide 96.55
3llv_A141 Exopolyphosphatase-related protein; NAD(P)-binding 96.19
3ic5_A118 Putative saccharopine dehydrogenase; structural ge 96.13
2g1u_A155 Hypothetical protein TM1088A; structural genomics, 95.92
3llv_A141 Exopolyphosphatase-related protein; NAD(P)-binding 95.86
2hmt_A144 YUAA protein; RCK, KTN, KTR, KTRA, ktrab, membrane 95.82
2g1u_A155 Hypothetical protein TM1088A; structural genomics, 95.69
3t4e_A312 Quinate/shikimate dehydrogenase; structural genomi 95.66
3tnl_A315 Shikimate dehydrogenase; structural genomics, cent 95.6
3tum_A269 Shikimate dehydrogenase family protein; rossmann-f 95.52
2hmt_A144 YUAA protein; RCK, KTN, KTR, KTRA, ktrab, membrane 95.41
1kyq_A274 Met8P, siroheme biosynthesis protein Met8; homodim 95.35
3e8x_A236 Putative NAD-dependent epimerase/dehydratase; stru 95.24
1id1_A153 Putative potassium channel protein; RCK domain, E. 95.24
3tnl_A315 Shikimate dehydrogenase; structural genomics, cent 95.17
4ina_A405 Saccharopine dehydrogenase; structural genomics, P 95.14
2ph5_A480 Homospermidine synthase; alpha-beta protein, struc 95.01
3tum_A269 Shikimate dehydrogenase family protein; rossmann-f 94.97
1pjq_A457 CYSG, siroheme synthase; rossman fold, nucleotide 94.92
3abi_A365 Putative uncharacterized protein PH1688; L-lysine 94.89
1lss_A140 TRK system potassium uptake protein TRKA homolog; 94.83
1id1_A153 Putative potassium channel protein; RCK domain, E. 94.8
3fwz_A140 Inner membrane protein YBAL; TRKA-N domain, E.coli 94.8
1lss_A140 TRK system potassium uptake protein TRKA homolog; 94.75
3pwz_A272 Shikimate dehydrogenase 3; alpha-beta, oxidoreduct 94.63
3c85_A183 Putative glutathione-regulated potassium-efflux S 94.63
3t4e_A312 Quinate/shikimate dehydrogenase; structural genomi 94.51
3o8q_A281 Shikimate 5-dehydrogenase I alpha; structural geno 94.49
3oj0_A144 Glutr, glutamyl-tRNA reductase; structural genomic 94.44
3abi_A365 Putative uncharacterized protein PH1688; L-lysine 94.32
3qsg_A312 NAD-binding phosphogluconate dehydrogenase-like P; 94.21
3gvi_A324 Malate dehydrogenase; NAD, oxidoreductase, tricarb 94.11
3oj0_A144 Glutr, glutamyl-tRNA reductase; structural genomic 94.01
3l4b_C218 TRKA K+ channel protien TM1088B; potassium channel 93.88
4ina_A405 Saccharopine dehydrogenase; structural genomics, P 93.87
3pwz_A272 Shikimate dehydrogenase 3; alpha-beta, oxidoreduct 93.86
3o8q_A281 Shikimate 5-dehydrogenase I alpha; structural geno 93.72
3l4b_C218 TRKA K+ channel protien TM1088B; potassium channel 93.66
3h2s_A224 Putative NADH-flavin reductase; Q03B84, NESG, LCR1 93.57
2egg_A297 AROE, shikimate 5-dehydrogenase; dimer, X-RAY diff 93.49
3dqp_A219 Oxidoreductase YLBE; alpha-beta protein., structur 93.47
1hyh_A309 L-hicdh, L-2-hydroxyisocaproate dehydrogenase; L-2 93.4
3gpi_A286 NAD-dependent epimerase/dehydratase; structural ge 93.37
3p7m_A321 Malate dehydrogenase; putative dehydrogenase, enzy 93.36
2z2v_A365 Hypothetical protein PH1688; L-lysine dehydrogenas 93.25
3e8x_A236 Putative NAD-dependent epimerase/dehydratase; stru 93.22
1p9l_A245 Dihydrodipicolinate reductase; oxidoreductase, lys 93.22
3don_A277 Shikimate dehydrogenase; alpha-beta structure, ros 93.11
3dhn_A227 NAD-dependent epimerase/dehydratase; reductase, PF 93.11
2d4a_B308 Malate dehydrogenase; archaea, hyperthermophIle, o 93.02
1hdo_A206 Biliverdin IX beta reductase; foetal metabolism, H 93.01
2raf_A209 Putative dinucleotide-binding oxidoreductase; NP_7 93.0
3ruf_A351 WBGU; rossmann fold, UDP-hexose 4-epimerase, isome 92.91
2z2v_A365 Hypothetical protein PH1688; L-lysine dehydrogenas 92.78
1hdo_A206 Biliverdin IX beta reductase; foetal metabolism, H 92.72
3rku_A287 Oxidoreductase YMR226C; substrate fingerprint, sho 92.72
3slg_A372 PBGP3 protein; structural genomics, seattle struct 92.7
1npy_A271 Hypothetical shikimate 5-dehydrogenase-like protei 92.59
3doj_A310 AT3G25530, dehydrogenase-like protein; gamma-hydro 92.47
3d0o_A317 L-LDH 1, L-lactate dehydrogenase 1; cytoplasm, gly 92.36
1ldn_A316 L-lactate dehydrogenase; oxidoreductase(CHOH(D)-NA 92.33
3l9w_A413 Glutathione-regulated potassium-efflux system Pro 92.29
3don_A277 Shikimate dehydrogenase; alpha-beta structure, ros 92.26
2hk9_A275 Shikimate dehydrogenase; shikimate pathway, drug d 92.09
4id9_A347 Short-chain dehydrogenase/reductase; putative dehy 92.09
2aef_A234 Calcium-gated potassium channel MTHK; rossmann fol 92.03
4ezb_A317 Uncharacterized conserved protein; structural geno 92.0
3t4x_A267 Oxidoreductase, short chain dehydrogenase/reducta; 91.99
2h78_A302 Hibadh, 3-hydroxyisobutyrate dehydrogenase; APC601 91.99
3dhn_A227 NAD-dependent epimerase/dehydratase; reductase, PF 91.93
4e12_A283 Diketoreductase; oxidoreductase, NADH; HET: 1PE; 1 91.93
2ewd_A317 Lactate dehydrogenase,; protein-substrate_cofactor 91.89
3o38_A266 Short chain dehydrogenase; tuberculosis, ortholog 91.87
2axq_A467 Saccharopine dehydrogenase; rossmann fold variant, 91.81
3vku_A326 L-LDH, L-lactate dehydrogenase; rossmann fold, NAD 91.76
4egb_A346 DTDP-glucose 4,6-dehydratase; rhamnose pathway, ce 91.7
3m2p_A311 UDP-N-acetylglucosamine 4-epimerase; SGXNY, 11155J 91.56
1oju_A294 MDH, malate dehydrogenase; hyperthermophilic, oxid 91.54
2b69_A343 UDP-glucuronate decarboxylase 1; UDP-glucoronic ac 91.54
4e21_A358 6-phosphogluconate dehydrogenase (decarboxylating; 91.51
3qsg_A312 NAD-binding phosphogluconate dehydrogenase-like P; 91.49
4aj2_A331 L-lactate dehydrogenase A chain; oxidoreductase-in 91.49
3rku_A287 Oxidoreductase YMR226C; substrate fingerprint, sho 91.45
3gpi_A286 NAD-dependent epimerase/dehydratase; structural ge 91.4
2raf_A209 Putative dinucleotide-binding oxidoreductase; NP_7 91.35
4g65_A461 TRK system potassium uptake protein TRKA; structur 91.34
2pzm_A330 Putative nucleotide sugar epimerase/ dehydratase; 91.29
1y1p_A342 ARII, aldehyde reductase II; rossmann fold, short 91.25
3ew7_A221 LMO0794 protein; Q8Y8U8_lismo, putative NAD-depend 91.04
4id9_A347 Short-chain dehydrogenase/reductase; putative dehy 90.99
4ezb_A317 Uncharacterized conserved protein; structural geno 90.99
3pqe_A326 L-LDH, L-lactate dehydrogenase; FBP, oxidoreductas 90.97
2x0j_A294 Malate dehydrogenase; oxidoreductase, hyperthermop 90.96
3ruf_A351 WBGU; rossmann fold, UDP-hexose 4-epimerase, isome 90.92
3tl2_A315 Malate dehydrogenase; center for structural genomi 90.89
3lf2_A265 Short chain oxidoreductase Q9HYA2; SDR, SCOR, ross 90.87
2bka_A242 CC3, TAT-interacting protein TIP30; NADPH, PEG600, 90.85
4e12_A283 Diketoreductase; oxidoreductase, NADH; HET: 1PE; 1 90.83
2egg_A297 AROE, shikimate 5-dehydrogenase; dimer, X-RAY diff 90.72
3d1l_A266 Putative NADP oxidoreductase BF3122; structural ge 90.7
4egb_A346 DTDP-glucose 4,6-dehydratase; rhamnose pathway, ce 90.7
2hjr_A328 Malate dehydrogenase; malaria, structural genomics 90.69
3slg_A372 PBGP3 protein; structural genomics, seattle struct 90.68
3ldh_A330 Lactate dehydrogenase; oxidoreductase, CHOH donor, 90.58
1xg5_A279 ARPG836; short chain dehydrogenase, human, SGC, st 90.57
1lu9_A287 Methylene tetrahydromethanopterin dehydrogenase; a 90.52
3ko8_A312 NAD-dependent epimerase/dehydratase; isomerase, UD 90.49
3ius_A286 Uncharacterized conserved protein; APC63810, silic 90.49
2v6b_A304 L-LDH, L-lactate dehydrogenase; oxidoreductase, ra 90.46
3d1l_A266 Putative NADP oxidoreductase BF3122; structural ge 90.36
3o26_A311 Salutaridine reductase; short chain dehydrogenase/ 90.31
3gvi_A324 Malate dehydrogenase; NAD, oxidoreductase, tricarb 90.28
3vps_A321 TUNA, NAD-dependent epimerase/dehydratase; tunicam 90.14
1sb8_A352 WBPP; epimerase, 4-epimerase, UDP-galnac, UDP-GLCN 90.14
3tri_A280 Pyrroline-5-carboxylate reductase; amino acid bios 90.13
4gbj_A297 6-phosphogluconate dehydrogenase NAD-binding; stru 90.06
3fwz_A140 Inner membrane protein YBAL; TRKA-N domain, E.coli 90.01
1ur5_A309 Malate dehydrogenase; oxidoreductase, tricarboxyli 90.01
3nyw_A250 Putative oxidoreductase; fatty acid synthesis,3-ox 89.97
3hg7_A324 D-isomer specific 2-hydroxyacid dehydrogenase FAM 89.95
4g65_A461 TRK system potassium uptake protein TRKA; structur 89.85
3qiv_A253 Short-chain dehydrogenase or 3-oxoacyl-[acyl-CARR 89.79
1p77_A272 Shikimate 5-dehydrogenase; NADPH, oxidoreductase; 89.78
3ius_A286 Uncharacterized conserved protein; APC63810, silic 89.77
3dqp_A219 Oxidoreductase YLBE; alpha-beta protein., structur 89.7
3dtt_A245 NADP oxidoreductase; structural genomics, joint ce 89.69
3phh_A269 Shikimate dehydrogenase; shikimate pathway, helico 89.68
2ph5_A480 Homospermidine synthase; alpha-beta protein, struc 89.62
3tri_A280 Pyrroline-5-carboxylate reductase; amino acid bios 89.61
3pp8_A315 Glyoxylate/hydroxypyruvate reductase A; structural 89.57
3l9w_A413 Glutathione-regulated potassium-efflux system Pro 89.53
3qvo_A236 NMRA family protein; structural genomics, PSI-biol 89.53
3r6d_A221 NAD-dependent epimerase/dehydratase; structural ge 89.52
2b69_A343 UDP-glucuronate decarboxylase 1; UDP-glucoronic ac 89.52
2bll_A345 Protein YFBG; decarboxylase, short chain dehydroge 89.51
1lld_A319 L-lactate dehydrogenase; oxidoreductase(CHOH (D)-N 89.42
3pef_A287 6-phosphogluconate dehydrogenase, NAD-binding; gam 89.39
3m2p_A311 UDP-N-acetylglucosamine 4-epimerase; SGXNY, 11155J 89.33
1a5z_A319 L-lactate dehydrogenase; oxidoreductase, glycolysi 89.3
1nvt_A287 Shikimate 5'-dehydrogenase; structural genomics, P 89.29
3g0o_A303 3-hydroxyisobutyrate dehydrogenase; NAD(P), valine 89.29
3obb_A300 Probable 3-hydroxyisobutyrate dehydrogenase; struc 89.25
3qvo_A236 NMRA family protein; structural genomics, PSI-biol 89.24
1y1p_A342 ARII, aldehyde reductase II; rossmann fold, short 89.13
3evt_A324 Phosphoglycerate dehydrogenase; structural genomic 89.03
2pzm_A330 Putative nucleotide sugar epimerase/ dehydratase; 88.98
3sxp_A362 ADP-L-glycero-D-mannoheptose-6-epimerase; rossman 88.97
2cvz_A289 Dehydrogenase, 3-hydroxyisobutyrate dehydrogenase; 88.96
1iy8_A267 Levodione reductase; oxidoreductase; HET: NAD; 1.6 88.86
3ggo_A314 Prephenate dehydrogenase; TYRA, HPP, NADH, alpha-b 88.81
3c85_A183 Putative glutathione-regulated potassium-efflux S 88.8
2gf2_A296 Hibadh, 3-hydroxyisobutyrate dehydrogenase; struct 88.77
3sxp_A362 ADP-L-glycero-D-mannoheptose-6-epimerase; rossman 88.76
2gn4_A344 FLAA1 protein, UDP-GLCNAC C6 dehydratase; rossmann 88.72
1ks9_A291 KPA reductase;, 2-dehydropantoate 2-reductase; PAN 88.7
3i6i_A346 Putative leucoanthocyanidin reductase 1; rossmann 88.69
3pqe_A326 L-LDH, L-lactate dehydrogenase; FBP, oxidoreductas 88.63
1ff9_A450 Saccharopine reductase; lysine biosynthesis, alpha 88.59
3onh_A127 Ubiquitin-activating enzyme E1-like; ligase, SUMO 88.55
3pdu_A287 3-hydroxyisobutyrate dehydrogenase family protein; 88.54
1t2d_A322 LDH-P, L-lactate dehydrogenase; ternary complex, o 88.53
2hjr_A328 Malate dehydrogenase; malaria, structural genomics 88.53
1sby_A254 Alcohol dehydrogenase; ternary complex, NAD, trifl 88.52
3rft_A267 Uronate dehydrogenase; apoenzyme, rossmann fold, N 88.51
2gn4_A344 FLAA1 protein, UDP-GLCNAC C6 dehydratase; rossmann 88.5
1ez4_A318 Lactate dehydrogenase; rossmann fold, oxidoreducta 88.5
3kkj_A336 Amine oxidase, flavin-containing; oxidoreductase, 88.43
3vku_A326 L-LDH, L-lactate dehydrogenase; rossmann fold, NAD 88.36
2x4g_A342 Nucleoside-diphosphate-sugar epimerase; isomerase; 88.34
1lnq_A336 MTHK channels, potassium channel related protein; 88.33
2pv7_A298 T-protein [includes: chorismate mutase (EC 5.4.99 88.31
4dqv_A478 Probable peptide synthetase NRP (peptide synthase; 88.07
3fi9_A343 Malate dehydrogenase; structural genomics, oxidore 88.04
3rkr_A262 Short chain oxidoreductase; rossmann fold; HET: NA 87.99
3ioy_A319 Short-chain dehydrogenase/reductase SDR; structura 87.92
3p7m_A321 Malate dehydrogenase; putative dehydrogenase, enzy 87.88
3vps_A321 TUNA, NAD-dependent epimerase/dehydratase; tunicam 87.81
4e21_A358 6-phosphogluconate dehydrogenase (decarboxylating; 87.81
2f1k_A279 Prephenate dehydrogenase; tyrosine synthesis, X-RA 87.79
2g5c_A281 Prephenate dehydrogenase; TYRA, oxidoreductase; HE 87.68
3gt0_A247 Pyrroline-5-carboxylate reductase; structural geno 87.68
2d5c_A263 AROE, shikimate 5-dehydrogenase; substrate, dimer, 87.66
1vl6_A388 Malate oxidoreductase; TM0542, NAD-dependent malic 87.63
2z1n_A260 Dehydrogenase; reductase, SDR, oxidoreductase; 1.8 87.62
1sb8_A352 WBPP; epimerase, 4-epimerase, UDP-galnac, UDP-GLCN 87.61
1xu9_A286 Corticosteroid 11-beta-dehydrogenase, isozyme 1; h 87.58
3lk7_A451 UDP-N-acetylmuramoylalanine--D-glutamate ligase; a 87.56
3sju_A279 Keto reductase; short-chain dehydrogenase, oxidore 87.56
1yb4_A295 Tartronic semialdehyde reductase; structural genom 87.53
2bka_A242 CC3, TAT-interacting protein TIP30; NADPH, PEG600, 87.49
1x7d_A350 Ornithine cyclodeaminase; binds NAD+, binds L-orni 87.48
2z1m_A345 GDP-D-mannose dehydratase; short-chain dehydrogena 87.47
1lu9_A287 Methylene tetrahydromethanopterin dehydrogenase; a 87.45
3i1j_A247 Oxidoreductase, short chain dehydrogenase/reducta; 87.4
3svt_A281 Short-chain type dehydrogenase/reductase; ssgcid, 87.36
3nep_X314 Malate dehydrogenase; halophIle, molecular adpatat 87.34
3gaf_A256 7-alpha-hydroxysteroid dehydrogenase; seattle stru 87.27
2ew2_A316 2-dehydropantoate 2-reductase, putative; alpha-str 87.25
3enk_A341 UDP-glucose 4-epimerase; seattle structural genomi 87.24
3fbt_A282 Chorismate mutase and shikimate 5-dehydrogenase fu 87.23
2dc1_A236 L-aspartate dehydrogenase; NAD, oxidoreductase; HE 87.21
2q1s_A377 Putative nucleotide sugar epimerase/ dehydratase; 87.19
1bg6_A359 N-(1-D-carboxylethyl)-L-norvaline dehydrogenase; L 87.14
2zqz_A326 L-LDH, L-lactate dehydrogenase; oxidoreductase, ro 87.06
2q1s_A377 Putative nucleotide sugar epimerase/ dehydratase; 87.04
2cvz_A289 Dehydrogenase, 3-hydroxyisobutyrate dehydrogenase; 87.04
2x6t_A357 ADP-L-glycero-D-manno-heptose-6-epimerase; isomera 87.01
3ucx_A264 Short chain dehydrogenase; ssgcid, seattle structu 87.0
4dll_A320 2-hydroxy-3-oxopropionate reductase; structural ge 86.96
3lyl_A247 3-oxoacyl-(acyl-carrier-protein) reductase; alpha 86.95
2xxj_A310 L-LDH, L-lactate dehydrogenase; oxidoreductase, hy 86.85
1ldn_A316 L-lactate dehydrogenase; oxidoreductase(CHOH(D)-NA 86.85
3tjr_A301 Short chain dehydrogenase; structural genomics, se 86.82
2dpo_A319 L-gulonate 3-dehydrogenase; structural genomics, N 86.76
4da9_A280 Short-chain dehydrogenase/reductase; structural ge 86.72
2d4a_B308 Malate dehydrogenase; archaea, hyperthermophIle, o 86.69
2x0j_A294 Malate dehydrogenase; oxidoreductase, hyperthermop 86.66
3r6d_A221 NAD-dependent epimerase/dehydratase; structural ge 86.64
2pv7_A298 T-protein [includes: chorismate mutase (EC 5.4.99 86.63
3pk0_A262 Short-chain dehydrogenase/reductase SDR; ssgcid, s 86.61
2rcy_A262 Pyrroline carboxylate reductase; malaria, structur 86.6
3ehe_A313 UDP-glucose 4-epimerase (GALE-1); PSI-II, NYSGXRC, 86.59
3nzo_A399 UDP-N-acetylglucosamine 4,6-dehydratase; structura 86.58
3c24_A286 Putative oxidoreductase; YP_511008.1, structural g 86.52
3u62_A253 Shikimate dehydrogenase; shikimate pathway, oxidor 86.47
1pjc_A361 Protein (L-alanine dehydrogenase); oxidoreductase, 86.46
3gvx_A290 Glycerate dehydrogenase related protein; NYSGXRC, 86.33
3e48_A289 Putative nucleoside-diphosphate-sugar epimerase; a 86.31
3t4x_A267 Oxidoreductase, short chain dehydrogenase/reducta; 86.28
1zcj_A463 Peroxisomal bifunctional enzyme; peroxisomal multi 86.24
4ibo_A271 Gluconate dehydrogenase; enzyme function initiativ 86.2
1oju_A294 MDH, malate dehydrogenase; hyperthermophilic, oxid 86.15
3ngx_A276 Bifunctional protein fold; methylenetetrahydrofola 86.15
1guz_A310 Malate dehydrogenase; oxidoreductase, tricarboxyli 86.13
3st7_A369 Capsular polysaccharide synthesis enzyme CAP5F; ro 86.12
1t2d_A322 LDH-P, L-lactate dehydrogenase; ternary complex, o 86.09
2a9f_A398 Putative malic enzyme ((S)-malate:NAD+ oxidoreduct 86.08
3fbt_A282 Chorismate mutase and shikimate 5-dehydrogenase fu 86.07
1x7d_A350 Ornithine cyclodeaminase; binds NAD+, binds L-orni 86.07
2z1m_A345 GDP-D-mannose dehydratase; short-chain dehydrogena 86.06
2x4g_A342 Nucleoside-diphosphate-sugar epimerase; isomerase; 86.03
4gx0_A565 TRKA domain protein; membrane protein, ION channel 86.01
1p9l_A245 Dihydrodipicolinate reductase; oxidoreductase, lys 85.96
2h78_A302 Hibadh, 3-hydroxyisobutyrate dehydrogenase; APC601 85.93
2vhw_A377 Alanine dehydrogenase; NAD, secreted, oxidoreducta 85.89
3qlj_A322 Short chain dehydrogenase; structural genomics, se 85.88
1a4i_A301 Methylenetetrahydrofolate dehydrogenase / methenyl 85.88
1dih_A273 Dihydrodipicolinate reductase; oxidoreductase; HET 85.87
3tfo_A264 Putative 3-oxoacyl-(acyl-carrier-protein) reducta; 85.85
4huj_A220 Uncharacterized protein; PSI-biology, nysgrc, stru 85.85
2zyd_A480 6-phosphogluconate dehydrogenase, decarboxylating; 85.85
2c5a_A379 GDP-mannose-3', 5'-epimerase; short chain dehydrat 85.82
3uve_A286 Carveol dehydrogenase ((+)-trans-carveol dehydrog; 85.55
3nzo_A399 UDP-N-acetylglucosamine 4,6-dehydratase; structura 85.55
2axq_A467 Saccharopine dehydrogenase; rossmann fold variant, 85.51
3tox_A280 Short chain dehydrogenase; structural genomics, PS 85.49
1ez4_A318 Lactate dehydrogenase; rossmann fold, oxidoreducta 85.46
3qha_A296 Putative oxidoreductase; seattle structural genomi 85.45
3pgx_A280 Carveol dehydrogenase; structural genomics, seattl 85.43
1rkx_A357 CDP-glucose-4,6-dehydratase; SDR, lyase; HET: NAD; 85.42
3tsc_A277 Putative oxidoreductase; structural genomics, seat 85.4
2q1w_A333 Putative nucleotide sugar epimerase/ dehydratase; 85.4
3i6i_A346 Putative leucoanthocyanidin reductase 1; rossmann 85.36
3v2h_A281 D-beta-hydroxybutyrate dehydrogenase; structural g 85.29
3r1i_A276 Short-chain type dehydrogenase/reductase; structur 85.2
2ywl_A180 Thioredoxin reductase related protein; uncharacter 85.19
4imr_A275 3-oxoacyl-(acyl-carrier-protein) reductase; oxidor 85.19
3nyw_A250 Putative oxidoreductase; fatty acid synthesis,3-ox 85.18
2zat_A260 Dehydrogenase/reductase SDR family member 4; alpha 85.18
2ae2_A260 Protein (tropinone reductase-II); oxidoreductase, 85.14
4fgs_A273 Probable dehydrogenase protein; PSI-biology, nysgr 85.11
3g0o_A303 3-hydroxyisobutyrate dehydrogenase; NAD(P), valine 85.1
4hb9_A412 Similarities with probable monooxygenase; flavin, 85.07
4fn4_A254 Short chain dehydrogenase; NADH-binding, rossmann 85.06
4a26_A300 Putative C-1-tetrahydrofolate synthase, cytoplasm; 85.06
4fs3_A256 Enoyl-[acyl-carrier-protein] reductase [NADPH] FA; 85.02
3enk_A341 UDP-glucose 4-epimerase; seattle structural genomi 85.01
3ko8_A312 NAD-dependent epimerase/dehydratase; isomerase, UD 84.98
2zyd_A480 6-phosphogluconate dehydrogenase, decarboxylating; 84.98
3qy9_A243 DHPR, dihydrodipicolinate reductase; rossmann fold 84.94
3v2g_A271 3-oxoacyl-[acyl-carrier-protein] reductase; struct 84.93
4gx0_A565 TRKA domain protein; membrane protein, ION channel 84.9
2yq5_A343 D-isomer specific 2-hydroxyacid dehydrogenase; oxi 84.89
1ur5_A309 Malate dehydrogenase; oxidoreductase, tricarboxyli 84.78
1vkn_A351 N-acetyl-gamma-glutamyl-phosphate reductase; TM178 84.76
3o38_A266 Short chain dehydrogenase; tuberculosis, ortholog 84.75
1vl6_A388 Malate oxidoreductase; TM0542, NAD-dependent malic 84.75
1rkx_A357 CDP-glucose-4,6-dehydratase; SDR, lyase; HET: NAD; 84.75
3p2o_A285 Bifunctional protein fold; structural genomics, ce 84.74
4egf_A266 L-xylulose reductase; structural genomics, ssgcid, 84.71
3ksu_A262 3-oxoacyl-acyl carrier protein reductase; structur 84.71
2c5a_A379 GDP-mannose-3', 5'-epimerase; short chain dehydrat 84.59
4iin_A271 3-ketoacyl-acyl carrier protein reductase (FABG); 84.57
4f6c_A427 AUSA reductase domain protein; thioester reductase 84.56
1gee_A261 Glucose 1-dehydrogenase; short-chain dehydrogenase 84.51
1i36_A264 Conserved hypothetical protein MTH1747; NADP bindi 84.51
1xg5_A279 ARPG836; short chain dehydrogenase, human, SGC, st 84.48
3i83_A320 2-dehydropantoate 2-reductase; structural genomics 84.48
3d0o_A317 L-LDH 1, L-lactate dehydrogenase 1; cytoplasm, gly 84.46
2jah_A247 Clavulanic acid dehydrogenase; short-chain dehydro 84.45
1orr_A347 CDP-tyvelose-2-epimerase; rossmann fold, short-cha 84.4
3hn2_A312 2-dehydropantoate 2-reductase; PSI-2, NYSGXRC, str 84.4
1fmc_A255 7 alpha-hydroxysteroid dehydrogenase; short-chain 84.37
1b0a_A288 Protein (fold bifunctional protein); folate, dehyd 84.37
2i99_A312 MU-crystallin homolog; thyroid hormine binding pro 84.35
4fc7_A277 Peroxisomal 2,4-dienoyl-COA reductase; SDR/rossman 84.34
1y6j_A318 L-lactate dehydrogenase; southeast collaboratory f 84.33
4gwg_A484 6-phosphogluconate dehydrogenase, decarboxylating; 84.32
1pzg_A331 LDH, lactate dehydrogenase; apicomplexa, APAD, tet 84.31
3lf2_A265 Short chain oxidoreductase Q9HYA2; SDR, SCOR, ross 84.28
3ftp_A270 3-oxoacyl-[acyl-carrier protein] reductase; ssgcid 84.28
1oaa_A259 Sepiapterin reductase; tetrahydrobiopterin, oxidor 84.25
2izz_A322 Pyrroline-5-carboxylate reductase 1; amino-acid bi 84.19
3ego_A307 Probable 2-dehydropantoate 2-reductase; structural 84.18
3ew7_A221 LMO0794 protein; Q8Y8U8_lismo, putative NAD-depend 84.17
1omo_A322 Alanine dehydrogenase; two-domain, beta-sandwich-d 84.1
3v8b_A283 Putative dehydrogenase, possibly 3-oxoacyl-[acyl- 84.08
3phh_A269 Shikimate dehydrogenase; shikimate pathway, helico 84.06
2ydy_A315 Methionine adenosyltransferase 2 subunit beta; oxi 84.05
3l77_A235 Short-chain alcohol dehydrogenase; oxidoreductase; 84.04
2eez_A369 Alanine dehydrogenase; TTHA0216, structural genomi 83.92
3doj_A310 AT3G25530, dehydrogenase-like protein; gamma-hydro 83.88
3kkj_A336 Amine oxidase, flavin-containing; oxidoreductase, 83.86
3hn2_A312 2-dehydropantoate 2-reductase; PSI-2, NYSGXRC, str 83.82
3afn_B258 Carbonyl reductase; alpha/beta/alpha, rossmann-fol 83.77
2rcy_A262 Pyrroline carboxylate reductase; malaria, structur 83.72
1jay_A212 Coenzyme F420H2:NADP+ oxidoreductase (FNO); rossma 83.69
3l07_A285 Bifunctional protein fold; structural genomics, ID 83.69
1yxm_A303 Pecra, peroxisomal trans 2-enoyl COA reductase; pe 83.68
4f3y_A272 DHPR, dihydrodipicolinate reductase; structural ge 83.67
3hwr_A318 2-dehydropantoate 2-reductase; YP_299159.1, PANE/A 83.66
2zqz_A326 L-LDH, L-lactate dehydrogenase; oxidoreductase, ro 83.64
2xxj_A310 L-LDH, L-lactate dehydrogenase; oxidoreductase, hy 83.58
2iz1_A474 6-phosphogluconate dehydrogenase, decarboxylating; 83.51
3b1f_A290 Putative prephenate dehydrogenase; enzyme, 4-hydro 83.5
3eag_A326 UDP-N-acetylmuramate:L-alanyl-gamma-D-glutamyl-ME 83.46
1iy8_A267 Levodione reductase; oxidoreductase; HET: NAD; 1.6 83.39
4iiu_A267 3-oxoacyl-[acyl-carrier protein] reductase; struct 83.39
2a9f_A398 Putative malic enzyme ((S)-malate:NAD+ oxidoreduct 83.33
1sby_A254 Alcohol dehydrogenase; ternary complex, NAD, trifl 83.32
3imf_A257 Short chain dehydrogenase; structural genomics, in 83.29
2ydy_A315 Methionine adenosyltransferase 2 subunit beta; oxi 83.26
2qyt_A317 2-dehydropantoate 2-reductase; APC81190, porphyrom 83.2
3u62_A253 Shikimate dehydrogenase; shikimate pathway, oxidor 83.19
2dvm_A439 Malic enzyme, 439AA long hypothetical malate oxido 83.16
3gvx_A290 Glycerate dehydrogenase related protein; NYSGXRC, 83.15
3dtt_A245 NADP oxidoreductase; structural genomics, joint ce 83.1
3e48_A289 Putative nucleoside-diphosphate-sugar epimerase; a 83.09
3u9l_A324 3-oxoacyl-[acyl-carrier-protein] reductase; struct 83.08
2gdz_A267 NAD+-dependent 15-hydroxyprostaglandin dehydrogen; 82.95
2iz1_A474 6-phosphogluconate dehydrogenase, decarboxylating; 82.95
3fef_A450 Putative glucosidase LPLD; gulosidase, structural 82.93
1omo_A322 Alanine dehydrogenase; two-domain, beta-sandwich-d 82.93
1nyt_A271 Shikimate 5-dehydrogenase; alpha/beta domains, WID 82.92
3k6j_A460 Protein F01G10.3, confirmed by transcript evidenc; 82.89
3sc6_A287 DTDP-4-dehydrorhamnose reductase; RFBD, structural 82.87
2hrz_A342 AGR_C_4963P, nucleoside-diphosphate-sugar epimeras 82.8
2jl1_A287 Triphenylmethane reductase; oxidoreductase, biorem 82.8
4aj2_A331 L-lactate dehydrogenase A chain; oxidoreductase-in 82.77
1z7e_A660 Protein aRNA; rossmann fold, OB-like fold, hydrola 82.77
1zem_A262 Xylitol dehydrogenase; rossmann fold, dinucleotide 82.72
1npy_A271 Hypothetical shikimate 5-dehydrogenase-like protei 82.68
1o0s_A605 NAD-ME, NAD-dependent malic enzyme; oxidoreductase 82.66
3i83_A320 2-dehydropantoate 2-reductase; structural genomics 82.63
2q1w_A333 Putative nucleotide sugar epimerase/ dehydratase; 82.59
3cky_A301 2-hydroxymethyl glutarate dehydrogenase; rossmann 82.51
3pef_A287 6-phosphogluconate dehydrogenase, NAD-binding; gam 82.45
1o6z_A303 MDH, malate dehydrogenase; halophilic, ION-binding 82.44
2hun_A336 336AA long hypothetical DTDP-glucose 4,6-dehydrat; 82.44
3h2s_A224 Putative NADH-flavin reductase; Q03B84, NESG, LCR1 82.4
2qq5_A260 DHRS1, dehydrogenase/reductase SDR family member 1 82.38
1ek6_A348 UDP-galactose 4-epimerase; short-chain dehydrogena 82.38
4gbj_A297 6-phosphogluconate dehydrogenase NAD-binding; stru 82.32
1ff9_A450 Saccharopine reductase; lysine biosynthesis, alpha 82.28
3un1_A260 Probable oxidoreductase; structural genomics, PSI- 82.22
4dqv_A478 Probable peptide synthetase NRP (peptide synthase; 82.19
3ehe_A313 UDP-glucose 4-epimerase (GALE-1); PSI-II, NYSGXRC, 82.16
1eq2_A310 ADP-L-glycero-D-mannoheptose 6-epimerase; N-termin 82.04
3gt0_A247 Pyrroline-5-carboxylate reductase; structural geno 82.02
1wma_A276 Carbonyl reductase [NADPH] 1; oxidoreductase; HET: 81.97
3ijp_A288 DHPR, dihydrodipicolinate reductase; ssgcid, SBRI, 81.96
1lld_A319 L-lactate dehydrogenase; oxidoreductase(CHOH (D)-N 81.89
3rkr_A262 Short chain oxidoreductase; rossmann fold; HET: NA 81.89
1qyd_A313 Pinoresinol-lariciresinol reductase; NADPH-depende 81.89
1gpj_A404 Glutamyl-tRNA reductase; tRNA-dependent tetrapyrro 81.88
1vl0_A292 DTDP-4-dehydrorhamnose reductase, RFBD ortholog; s 81.83
2hun_A336 336AA long hypothetical DTDP-glucose 4,6-dehydrat; 81.83
3hhp_A312 Malate dehydrogenase; MDH, citric acid cycle, TCA 81.83
1txg_A335 Glycerol-3-phosphate dehydrogenase [NAD(P)+]; oxid 81.81
1ja9_A274 4HNR, 1,3,6,8-tetrahydroxynaphthalene reductase; p 81.79
4dyv_A272 Short-chain dehydrogenase/reductase SDR; structura 81.77
3svt_A281 Short-chain type dehydrogenase/reductase; ssgcid, 81.74
1gpj_A404 Glutamyl-tRNA reductase; tRNA-dependent tetrapyrro 81.73
2hk9_A275 Shikimate dehydrogenase; shikimate pathway, drug d 81.72
3kb6_A334 D-lactate dehydrogenase; oxidoreductase, D-LDH, NA 81.7
2i6t_A303 Ubiquitin-conjugating enzyme E2-like isoform A; L- 81.64
1qyc_A308 Phenylcoumaran benzylic ether reductase PT1; NADPH 81.64
3k96_A356 Glycerol-3-phosphate dehydrogenase [NAD(P)+]; GPSA 81.63
3ado_A319 Lambda-crystallin; L-gulonate 3-dehydrogenase, str 81.54
1oc2_A348 DTDP-glucose 4,6-dehydratase; lyase, NADH, rhamnos 81.52
3rft_A267 Uronate dehydrogenase; apoenzyme, rossmann fold, N 81.51
3osu_A246 3-oxoacyl-[acyl-carrier-protein] reductase; struct 81.49
2hq1_A247 Glucose/ribitol dehydrogenase; CTH-1438, structura 81.45
3ghy_A335 Ketopantoate reductase protein; oxidoreductase, NA 81.44
3mog_A483 Probable 3-hydroxybutyryl-COA dehydrogenase; struc 81.43
1xq1_A266 Putative tropinone reducatse; structural genomics, 81.41
1e6u_A321 GDP-fucose synthetase; epimerase/reductase, SDR, R 81.4
3nep_X314 Malate dehydrogenase; halophIle, molecular adpatat 81.38
2dc1_A236 L-aspartate dehydrogenase; NAD, oxidoreductase; HE 81.38
1spx_A278 Short-chain reductase family member (5L265); paral 81.35
3g17_A294 Similar to 2-dehydropantoate 2-reductase; structur 81.31
3hdj_A313 Probable ornithine cyclodeaminase; APC62486, borde 81.28
3jtm_A351 Formate dehydrogenase, mitochondrial; mitochondrio 81.24
2gas_A307 Isoflavone reductase; NADPH-dependent reductase, o 81.22
3e03_A274 Short chain dehydrogenase; structural genomics, PS 81.14
2aef_A234 Calcium-gated potassium channel MTHK; rossmann fol 81.06
3c1o_A321 Eugenol synthase; phenylpropene, PIP reductase, sh 81.01
1nyt_A271 Shikimate 5-dehydrogenase; alpha/beta domains, WID 81.0
3s55_A281 Putative short-chain dehydrogenase/reductase; stru 80.97
1pj3_A564 NAD-dependent malic enzyme, mitochondrial; oxidati 80.95
2i99_A312 MU-crystallin homolog; thyroid hormine binding pro 80.95
3s55_A281 Putative short-chain dehydrogenase/reductase; stru 80.93
1ek6_A348 UDP-galactose 4-epimerase; short-chain dehydrogena 80.91
3pxx_A287 Carveol dehydrogenase; structural genomics, seattl 80.9
3qlj_A322 Short chain dehydrogenase; structural genomics, se 80.83
3i1j_A247 Oxidoreductase, short chain dehydrogenase/reducta; 80.82
2nwq_A272 Probable short-chain dehydrogenase; oxidoreductase 80.81
2x9g_A288 PTR1, pteridine reductase; short chain dehydrogena 80.8
4ej6_A370 Putative zinc-binding dehydrogenase; structural ge 80.79
4a5o_A286 Bifunctional protein fold; oxidoreductase, hydrola 80.74
1gq2_A555 Malic enzyme; oxidoreductase, pigeon liver, NADP-d 80.73
3pxx_A287 Carveol dehydrogenase; structural genomics, seattl 80.69
1z82_A335 Glycerol-3-phosphate dehydrogenase; TM0378, struct 80.69
3l6d_A306 Putative oxidoreductase; structural genomics, prot 80.65
2j6i_A364 Formate dehydrogenase; oxidoreductase, D-specific- 80.54
3qiv_A253 Short-chain dehydrogenase or 3-oxoacyl-[acyl-CARR 80.51
3oh8_A516 Nucleoside-diphosphate sugar epimerase (SULA FAMI; 80.47
2c2x_A281 Methylenetetrahydrofolate dehydrogenase- methenylt 80.44
3is3_A270 17BETA-hydroxysteroid dehydrogenase; short chain d 80.38
1vpd_A299 Tartronate semialdehyde reductase; structural geno 80.37
1f0y_A302 HCDH, L-3-hydroxyacyl-COA dehydrogenase; abortive 80.34
3hg7_A324 D-isomer specific 2-hydroxyacid dehydrogenase FAM 80.17
4dmm_A269 3-oxoacyl-[acyl-carrier-protein] reductase; rossma 80.14
3k5p_A416 D-3-phosphoglycerate dehydrogenase; niaid, ssgcid, 80.1
1orr_A347 CDP-tyvelose-2-epimerase; rossmann fold, short-cha 80.08
2cul_A232 Glucose-inhibited division protein A-related PROT 80.07
2ejw_A332 HDH, homoserine dehydrogenase; NAD-dependent, oxid 80.05
3obb_A300 Probable 3-hydroxyisobutyrate dehydrogenase; struc 80.04
3sc6_A287 DTDP-4-dehydrorhamnose reductase; RFBD, structural 80.04
1n2s_A299 DTDP-4-, DTDP-glucose oxidoreductase; rossman-fold 80.03
1hye_A313 L-lactate/malate dehydrogenase; nucleotide binding 80.01
>3cmm_A Ubiquitin-activating enzyme E1 1; UBA1, protein turnover, ligase, conformationa thioester, adenylation, transthioesterification, ATP-bindin nucleotide-binding; 2.70A {Saccharomyces cerevisiae} Back     alignment and structure
Probab=100.00  E-value=6.8e-215  Score=2011.09  Aligned_cols=998  Identities=45%  Similarity=0.815  Sum_probs=938.9

Q ss_pred             CchhHhHhhhhhhccCHHHHHHhhcCeEEEEcCChHHHHHHHHHHHhCCCeEEEEeCCccCcccCCcccccCCCcccchH
Q 001331           90 TDIDEDLHSRQLAVYGRETMRRLFASNILVSGMQGLGAEIAKNLILAGVKSVTLHDEGTVELWDLSSNFVFSDNDIGKNR  169 (1099)
Q Consensus        90 ~~~~~~~YsRQi~l~G~e~q~kL~~s~VlIiG~gglG~EiaKnLvlaGVg~itlvD~d~V~~~dL~~qf~~~~~diGk~K  169 (1099)
                      .+++++|||||+++||.++|+||++++|+|+|+||+|+++||||+++|||+|+|+|+|.|+.+||+||||++++|||++|
T Consensus         3 ~~id~~rY~Rqi~l~G~~~q~rL~~s~VlIvG~GGlGseiak~La~aGVg~itlvD~D~V~~sNL~RQ~l~~~~dvG~~K   82 (1015)
T 3cmm_A            3 GEIDESLYSRQLYVLGKEAMLKMQTSNVLILGLKGLGVEIAKNVVLAGVKSMTVFDPEPVQLADLSTQFFLTEKDIGQKR   82 (1015)
T ss_dssp             CCCCHHHHHHHHHHSCHHHHHHHTTCEEEEECCSHHHHHHHHHHHHHCCSEEEEECCSBCCGGGGGTCTTCCGGGTTSBH
T ss_pred             hhhhhHhccchHhhcCHHHHHHHhcCEEEEECCChHHHHHHHHHHHcCCCeEEEecCCEechhhhccccccChhhcChHH
Confidence            47899999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHHHHHhCCCcEEEEEecCCChhhccCCcEEEEecC-CHHHHHHHHHHHHhcCCCceeEEEeecceeEEEEEEcCC
Q 001331          170 ALASVQKLQELNNAVVLSTLTSKLTKEQLSDFQAVVFTDI-SLDKAIEFDDFCHNHQPAISFIKAEVRGLFGSVFCDFGP  248 (1099)
Q Consensus       170 aea~~~~L~eLNp~V~v~~~~~~l~~~~l~~~dvVV~~~~-~~~~~~~ln~~c~~~~~~ipfI~~~~~G~~G~vf~d~g~  248 (1099)
                      |++++++|+++||+|+|+++...++++++.+||+||+|.+ +.+.+..|+++|++++  +|||++++.|++|++|+|+|+
T Consensus        83 a~a~~~~L~~lNP~v~v~~~~~~l~~~~l~~~DvVv~~~d~~~~~r~~ln~~c~~~~--iplI~~~~~G~~G~v~~d~~~  160 (1015)
T 3cmm_A           83 GDVTRAKLAELNAYVPVNVLDSLDDVTQLSQFQVVVATDTVSLEDKVKINEFCHSSG--IRFISSETRGLFGNTFVDLGD  160 (1015)
T ss_dssp             HHHHHHHHTTSCTTSCEEECCCCCCSTTGGGCSEEEECTTSCHHHHHHHHHHHHHHT--CEEEEEEEETTEEEEEEECCS
T ss_pred             HHHHHHHHHHHCCCCeEEEecCCCCHHHHhcCCEEEEcCCCCHHHHHHHHHHHHHcC--CCEEEEEecccEEEEEecCCC
Confidence            9999999999999999999999999899999999999999 9999999999999999  999999999999999999999


Q ss_pred             ceEEEcCCCCCCcceeecccccCCCceeeeccccccccccCCeeEEEEeecccccCCCCCccccccCCceeeeccccccc
Q 001331          249 EFTVVDVDGEDPHTGIIASISNDNPALVSCVDDERLEFQDGDLVVFSEVHGMTELNDGKPRKIKSARPYSFTLEEDTTNY  328 (1099)
Q Consensus       249 ~~~v~d~~ge~p~~~~i~~I~~~~~~lv~~~~~~~~~~~dgd~v~f~ev~gm~eln~~~~~~i~~~~~~~f~i~~Dt~~f  328 (1099)
                      .|.|.+.+|+.|.++.|.+|  +.|++++++++.+|++++||++.|++++||.++|+++++++++.+||+|.| .|++.|
T Consensus       161 ~~~c~~~~~~~p~~~~i~~i--~~p~~v~~l~~~~h~~~~gd~v~F~ev~gm~elN~~e~~~i~~~~p~~f~I-~Dts~~  237 (1015)
T 3cmm_A          161 EFTVLDPTGEEPRTGMVSDI--EPDGTVTMLDDNRHGLEDGNFVRFSEVEGLDKLNDGTLFKVEVLGPFAFRI-GSVKEY  237 (1015)
T ss_dssp             CEEESBSSCCCCCEEEEEEE--CTTCEEEESTTCCCCCCTTCEEEEECCBTSGGGGSSCCEECEEEETTEEEC-SCCTTT
T ss_pred             ceEEeeCCCCCCccccccCC--CCCceeEeeecccccCCCCCeEEEEeeccchhhcCccceeeEEcCCceeEe-cccchh
Confidence            99999999999999999999  567899999999999999999999999999999999999999999999999 699999


Q ss_pred             cceeecceEEEeeCCeeecccchHHhhcCCCCcccccCccCCCCChHHHHHHHHHHHHHHh-CCCCCCCCHHHHHHHHHH
Q 001331          329 GTYVKGGIVTQVKQPKVLNFKPLREALEDPGDFLLSDFSKFDRPPPLHLAFQALDKFVSEL-GRFPVAGSEEDAQKLISV  407 (1099)
Q Consensus       329 ~~y~~gg~~~qvk~p~~i~f~sL~e~l~~p~~~l~~d~~k~~~~~~l~~~~~al~~F~~~~-gr~P~~~~~~D~~~l~~~  407 (1099)
                      ..|++||+++|+|+|++++|++|++.+++| .++.+|+.+++++..+|++||||++|.++| ||+|++++++|+++|+++
T Consensus       238 ~~yv~~g~~~qvk~p~~i~f~~l~~~l~~p-~~l~~d~~k~~~~~~l~~~~~Al~~F~~~~~gr~P~~~~~~D~~~l~~~  316 (1015)
T 3cmm_A          238 GEYKKGGIFTEVKVPRKISFKSLKQQLSNP-EFVFSDFAKFDRAAQLHLGFQALHQFAVRHNGELPRTMNDEDANELIKL  316 (1015)
T ss_dssp             CCCCBCCEEEECCCCEEECCCCHHHHHHSC-CBCCSCGGGTHHHHHHHHHHHHHHHHHHHTTTCCCCTTCHHHHHHHHHH
T ss_pred             hhhhcCceeEEecCCcccCHHHHHHHHcCh-HHHHHHHhccCcchHHHHHHHHHHHHHHhcCCCCCCCCCHHHHHHHHHH
Confidence            999999999999999999999999999999 477889998888999999999999999999 999999999999999999


Q ss_pred             HHHHHHhcCCC--CCCCCCHHHHHHHHhhcccccCchhhhhhhhhhHHHHHhhcCCccccceeeeeccCCCCCC---CCC
Q 001331          408 ATNINESLGDG--RVEDINTKLLRHFAFGARAVLNPMAAMFGGIVGQEVVKACSGKFHPLYQFFYFDSVESLPT---EPL  482 (1099)
Q Consensus       408 a~~i~~~~~~~--~~~~i~~~~i~~~a~~~~~el~pvaA~iGGiaAQEVIKaiTgkf~PI~q~~~fD~~e~l~~---~~~  482 (1099)
                      +++++.+.+..  ...+++++++++|+++++++|||||||+||+|||||||+|||||+||+||||||+++++|.   .++
T Consensus       317 a~~~~~~~~~~~~~~~~~~~~~~~e~~~~~~~el~pvaA~iGGivAQEVIKaiT~kf~Pi~~~~~~d~~~~~~~~~~~~~  396 (1015)
T 3cmm_A          317 VTDLSVQQPEVLGEGVDVNEDLIKELSYQARGDIPGVVAFFGGLVAQEVLKACSGKFTPLKQFMYFDSLESLPDPKNFPR  396 (1015)
T ss_dssp             HHHHHHHCHHHHCTTCCCCHHHHHHHHHTTTCCCHHHHHHHHHHHHHHHHHHHHCBSCCCCSEEEEECGGGSCCTTTSCC
T ss_pred             HHHHHHhcCCCccccccCcHHHHHHHHHhcCcccCcHHHHhcchHHHHHHHHhccCCCcccceEEecchhhccccccCCC
Confidence            99998764311  0036889999999999999999999999999999999999999999999999999999994   567


Q ss_pred             CCCCCCCccCchhhhhhhcCHHHHHHHhcCcEEEEcCCcchHHHHHHHHHcCCCCCCCccEEEecCCccccccCCccccc
Q 001331          483 DSTEFKPINSRYDAQISVFGAKLQKKLEDAKVFIVGSGALGCEFLKNVALMGVSCGNQGKLTITDDDVIEKSNLSRQFLF  562 (1099)
Q Consensus       483 ~~~~~~~~~~Rydrqi~l~G~~~q~~L~~~~v~vvG~GglG~evlk~La~~Gv~~~~~g~i~ivD~D~Ie~sNLnRQflf  562 (1099)
                      +++++++.++||+||+++||.++|++|+++||+||||||+||++|++||++||+||++|+|+|+|+|+|+.|||||||||
T Consensus       397 ~~~~~~~~~~Ry~rq~~l~G~~~q~kL~~~~VlvVGaGGlGsevlk~La~~Gv~~g~~G~i~lvD~D~Ve~SNLnRQ~lf  476 (1015)
T 3cmm_A          397 NEKTTQPVNSRYDNQIAVFGLDFQKKIANSKVFLVGSGAIGCEMLKNWALLGLGSGSDGYIVVTDNDSIEKSNLNRQFLF  476 (1015)
T ss_dssp             STTTTSCCSSTTHHHHHHHCHHHHHHHHTCEEEEECCSHHHHHHHHHHHHHTTTCSTTCEEEEECCCBCCGGGTTTCTTC
T ss_pred             ChhhccchhhhhhhHHHhcCHHHHHHHhcCeEEEEecCHHHHHHHHHHHHcCcCcCCCCeEEEEeCCEeccccccccccC
Confidence            88888888999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             ccCcccchHHHHHHHHHHhhCCCC--eEEEEecccCcccccccchhhhcCCCEEEEccCchHHHHHHHhhcccccccEEE
Q 001331          563 RDWNIGQAKSTVAASAATSINPRL--NIEALQNRVGPETENVFDDTFWENITCVINALDNVNARLYVDQRCLYFQKPLLE  640 (1099)
Q Consensus       563 ~~~diG~~Ka~vaa~~l~~~np~~--~i~~~~~~v~~~~e~~~~~~~~~~~DvVi~alDn~~ar~~i~~~c~~~~~Pli~  640 (1099)
                      +.+|||++||++|+++++++||++  +|+++..+++++++.+|+++||+++|+||+|+||+++|++++++|+.+++|+|+
T Consensus       477 ~~~dvG~~Ka~~aa~~l~~iNP~v~~~v~~~~~~i~~~~~~~~~~~~~~~~D~Vi~a~Dn~~aR~~ln~~c~~~~~Pli~  556 (1015)
T 3cmm_A          477 RPKDVGKNKSEVAAEAVCAMNPDLKGKINAKIDKVGPETEEIFNDSFWESLDFVTNALDNVDARTYVDRRCVFYRKPLLE  556 (1015)
T ss_dssp             CGGGTTSBHHHHHHHHHHHHCGGGTTTEEEECCCCSGGGTTTSCHHHHHHCSEEEECCSSHHHHHHHHHHHHHHTCCEEE
T ss_pred             ChhhCCCHHHHHHHHHHHHHCCCCcceEEEEecccCchhhhhccHhhhccCCEEEECCCCHHHHHHHHHHHHHcCCcEEE
Confidence            999999999999999999999999  999999999988877888999999999999999999999999999999999999


Q ss_pred             cCcCcccceeEEEeCcccccCCCCCCCCCCCCCcccccCCCCCcchhHHHHHHHhhhhccCChhhhhhhcCCChhhhhhh
Q 001331          641 SGTLGAKCNTQMVIPHLTENYGASRDPPEKQAPMCTVHSFPHNIDHCLTWARSEFEGLLEKTPAEVNAYLSNPVEYTTSM  720 (1099)
Q Consensus       641 sgt~G~~G~~~v~ip~~t~cy~c~~~p~~~~~p~Ct~~~~P~~~~Hci~wAr~~F~~lF~~~~~~~~~~l~~~~~~~~~~  720 (1099)
                      +|+.|++|++++++|+.|+||.|..+|+++++|+||+++||+.++|||+|||++|+++|+..++++|+||+|| .|++.+
T Consensus       557 ~g~~G~~G~v~v~~p~~t~cy~c~~dp~~~~~P~Ctl~~~P~~~~h~i~wa~~~f~~lf~~~~~~~~~~l~~~-~~~~~~  635 (1015)
T 3cmm_A          557 SGTLGTKGNTQVIIPRLTESYSSSRDPPEKSIPLCTLRSFPNKIDHTIAWAKSLFQGYFTDSAENVNMYLTQP-NFVEQT  635 (1015)
T ss_dssp             EEEETTEEEEEEECTTTBCCGGGSCCCCCCCCCHHHHHTCCCSHHHHHHHHHHHHHHHHTHHHHHHHHHHHCT-THHHHH
T ss_pred             eCCCccccceEEEeCCCCCccCCCCCCCCCCCCcccccCCCCCcHHHHHHHHHHHHHHHhhhhhhhhhhccCc-hhHHHH
Confidence            9999999999999999999999999999999999999999999999999999999999999999999999999 687777


Q ss_pred             hhcCchhHHHHHHHHHHHhhhhcccchHHHHHHHHHHHHHHHHHHHHHHhhhCCccccccCCCCCccCCCCCCCccccCC
Q 001331          721 ANAGDAQARDNLERVLECLDKEKCEIFQDCITWARLKFEDYFSNRVKQLIFTFPEDAATSTGAPFWSAPKRFPHPLQFSS  800 (1099)
Q Consensus       721 ~~~~~~~~~~~l~~~~~~l~~~~~~~~~~c~~~a~~~f~~~F~~~i~~ll~~~p~d~~~~~g~~fWs~~kr~P~pl~fd~  800 (1099)
                      .+....+. +.|+.+++.| ..+|.+|++|++||+.+|+++|+++|+|||++||+|++|++|+|||+|+||+|+||+||+
T Consensus       636 ~~~~~~~~-~~l~~~~~~l-~~~~~~~~~c~~~a~~~f~~~F~~~I~~Ll~~~p~d~~~~~g~~fW~~~kr~P~pl~fd~  713 (1015)
T 3cmm_A          636 LKQSGDVK-GVLESISDSL-SSKPHNFEDCIKWARLEFEKKFNHDIKQLLFNFPKDAKTSNGEPFWSGAKRAPTPLEFDI  713 (1015)
T ss_dssp             HC---CCH-HHHHHHHHHH-HSCCSSHHHHHHHHHHHHHHHHTHHHHHHHHHSCTTCBCSTTCBSSCTTCCCCCCCCCCT
T ss_pred             HhccchhH-HHHHHHHHHh-hcCCCcHHHHHHHHHHHHHHHHHHHHHHHHHhCCcccccccCcccccCCCCCCCCcccCC
Confidence            66544333 7788888888 778999999999999999999999999999999999999999999999999999999999


Q ss_pred             CCCchhHHHHHHHHHHHHHcCCCCC--CCCCChHHHHHHhhhcCCCCCCCCCCcceecccccccccccCcCcHHHHHHHH
Q 001331          801 ADPSHLHFVMAASILRAETFGIPIP--DWTNNPKMLAEAVDKVMVPDFLPKKDAKILTDEKATTLSTASVDDAAVINDLI  878 (1099)
Q Consensus       801 ~~~~h~~fi~~~a~l~a~~~~i~~~--~~~~~~~~~~~~~~~~~~~~f~~~~~~~~~~~e~~~~~~~~~~~~~~~~~~l~  878 (1099)
                      +|++|++||+++|+|+|++|||+.+  .|..+.+.+.++++++.+|+|.|+++++|.+++++...+..+.++.+.++.|.
T Consensus       714 ~~~~h~~fi~~~a~l~a~~~~i~~~~~~~~~~~~~~~~~~~~~~v~~f~~~~~~ki~~~~~~~~~~~~~~~~~~~~~~l~  793 (1015)
T 3cmm_A          714 YNNDHFHFVVAGASLRAYNYGIKSDDSNSKPNVDEYKSVIDHMIIPEFTPNANLKIQVNDDDPDPNANAANGSDEIDQLV  793 (1015)
T ss_dssp             TSHHHHHHHHHHHHHHHHHHTCCCSSTTSSCCHHHHHHHHTTCCCCCCCCCSSCCCCSSTTSSCC---------CCHHHH
T ss_pred             CCHHHHHHHHHHHHhHHHhcCCCCccccccCCHHHHHHHHhhCcCCCcCCccCceeccchhhhcccccccccHHHHHHHH
Confidence            9999999999999999999999985  47788999999999999999999999999988876544333333455667777


Q ss_pred             HHHHHhhhcCCCCCCcCCceeeccCCCCchhHHHHHHhhhhhhccCCCCccHHHHHHHhccccchhhhhHHHHHHHHHHH
Q 001331          879 IKLEQCRKNLPSGFRLKPIQFEKDDDTNYHMDMIAGLANMRARNYSIPEVDKLKAKFIAGRIIPAIATSTAMATGLVCLE  958 (1099)
Q Consensus       879 ~~l~~~~~~~~~~~~~~p~~FeKDDd~n~hidFI~aasNLRA~ny~I~~~d~~~~K~iAG~IIPAIATTtA~VaGl~~lE  958 (1099)
                      ++|++...  ..++++.|++||||||+|+|||||+|||||||+||+||++|||++|+|||||||||||||||||||+|+|
T Consensus       794 ~~l~~~~~--~~~~~~~~~~FeKDDd~n~h~dFi~aasNlRa~ny~I~~~~~~~~k~iaG~IIPAIaTT~AivaGl~~lE  871 (1015)
T 3cmm_A          794 SSLPDPST--LAGFKLEPVDFEKDDDTNHHIEFITACSNCRAQNYFIETADRQKTKFIAGRIIPAIATTTSLVTGLVNLE  871 (1015)
T ss_dssp             TTSCCGGG--GTTCCCCCCCCCTTCTTSSHHHHHHHHHHHHHHHTTCCCCCHHHHHHHHTTCCCCCHHHHHHHHHHHHHH
T ss_pred             HHhccchh--cccCCCCceeeecCCCchhHHHHHHHHHHHHHHHcCCCccCHHHHHHHhCCcCccchhHHHHHHHHHHHH
Confidence            66655433  2567899999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHhcCCCCcccccccccccccCcccccCCCCCcccccCCcce-eEEeEEEcCCCCcHHHHHHHHHHc-CCceeeeecC
Q 001331          959 LYKVLDGGHKLEDYRNTFANLALPLFSMAEPVPPKVIKHRDMSW-TVWDRWILKDNPTLRELIQWLKDK-GLNAYSISCG 1036 (1099)
Q Consensus       959 l~K~l~~~~~~~~~rn~f~nla~p~~~~~eP~~~~~~~~~~~~~-t~Wd~~~v~~~~TL~~li~~~~~~-~l~~~~i~~g 1036 (1099)
                      +||+++|.+++++|||+|+|||+|+|.|+||.+|++.++...+| |+||||++.+++||++|+++|+++ |++++||++|
T Consensus       872 ~~K~~~~~~~~~~~kn~f~nla~~~~~~~~p~~~~~~~~~~~~~~t~wd~~~v~~~~Tl~~li~~~~~~~~~~~~~i~~~  951 (1015)
T 3cmm_A          872 LYKLIDNKTDIEQYKNGFVNLALPFFGFSEPIASPKGEYNNKKYDKIWDRFDIKGDIKLSDLIEHFEKDEGLEITMLSYG  951 (1015)
T ss_dssp             HHHHHTTCCCGGGCCEEEEETTTTEEEEECCCBCCEEEETTEEEETTTCEEEEESCCBHHHHHHHHHHTTCCEEEEEEET
T ss_pred             HHHHHhcccchhhhhhHHHhccCCceeecCCCCCCCCCCCCCCCCeEEEEEEECCCCcHHHHHHHHHHHhCCcceeeccC
Confidence            99999987789999999999999999999999999998888999 999999999999999999999999 9999999999


Q ss_pred             CceeecCCCc--chhccccCcHHHHHHHhhccCCCCceeEEEEEEEeecCCCCccccCeEEEEe
Q 001331         1037 SCLLFNSMFP--RHKERMDKKVVDLAREVAKVELPPYRRHLDVVVACEDDEDNDIDIPLISIYF 1098 (1099)
Q Consensus      1037 ~~~LY~~~~~--~~~~~l~~~l~~l~~~~~~~~~~~~~~~~~l~~~~~d~~~~~v~~P~v~~~~ 1098 (1099)
                      +++||++++|  ++++||+++|+||++.++++++|++++||+|+|+|+|++++||++|+|+|+|
T Consensus       952 ~~~ly~~~~~~~~~~~~l~~~l~~l~~~~~~~~~~~~~~~~~~~~~~~d~~~~d~~~p~v~~~~ 1015 (1015)
T 3cmm_A          952 VSLLYASFFPPKKLKERLNLPITQLVKLVTKKDIPAHVSTMILEICADDKEGEDVEVPFITIHL 1015 (1015)
T ss_dssp             TEEEEETTCCHHHHHHHTTSBHHHHHHHHSSSCCCSSCCEEEEEEEEECTTSCEECCCEEEEEC
T ss_pred             CcEEEecCCCchhhHHhccCCHHHHHHhhccCcCCCCceEEEEEEEecCCCCCcCCCCcEEEeC
Confidence            9999999987  6789999999999999999999999999999999999989999999999986
>1y8q_B Anthracycline-, ubiquitin-like 2 activating enzyme E1B; SUMO, heterodimer, UBL, ligase; HET: ATP; 2.25A {Homo sapiens} PDB: 1y8r_B* 3kyc_B* 3kyd_B* 2px9_A Back     alignment and structure
>1z7l_A Ubiquitin-activating enzyme E1 1; SCCH, second catalytic cysteine half-domain, ligase; HET: TBR; 2.80A {Mus musculus} Back     alignment and structure
>1tt5_A APPBP1, amyloid protein-binding protein 1; cell cycle, ligase; 2.60A {Homo sapiens} SCOP: c.111.1.2 PDB: 3dbh_A 3dbl_A 3dbr_A 1r4m_A 1r4n_A* 2nvu_A* 1yov_A 3gzn_A* Back     alignment and structure
>1y8q_A Ubiquitin-like 1 activating enzyme E1A; SUMO, heterodimer, UBL, ligase; HET: ATP; 2.25A {Homo sapiens} PDB: 1y8r_A* 3kyc_A* 3kyd_A* Back     alignment and structure
>1tt5_B Ubiquitin-activating enzyme E1C isoform 1; cell cycle, ligase; 2.60A {Homo sapiens} SCOP: c.111.1.2 PDB: 3dbl_B 3dbr_B 3dbh_B 3gzn_B* 1yov_B 1r4m_B 1r4n_B* Back     alignment and structure
>2nvu_B Maltose binding protein/NEDD8-activating enzyme E1 catalytic subunit chimera; multifunction macromolecular complex, ubiquitin, ATP, conformational change, thioester, switch, adenylation, protein turnover, ligase; HET: ATP; 2.80A {Homo sapiens} SCOP: c.111.1.2 c.94.1.1 Back     alignment and structure
>1y8q_A Ubiquitin-like 1 activating enzyme E1A; SUMO, heterodimer, UBL, ligase; HET: ATP; 2.25A {Homo sapiens} PDB: 1y8r_A* 3kyc_A* 3kyd_A* Back     alignment and structure
>1tt5_A APPBP1, amyloid protein-binding protein 1; cell cycle, ligase; 2.60A {Homo sapiens} SCOP: c.111.1.2 PDB: 3dbh_A 3dbl_A 3dbr_A 1r4m_A 1r4n_A* 2nvu_A* 1yov_A 3gzn_A* Back     alignment and structure
>3h8v_A Ubiquitin-like modifier-activating enzyme 5; rossman fold, ATP-binding, UBL conjugation pathway, transfer structural genomics consortium, SGC; HET: ATP; 2.00A {Homo sapiens} PDB: 3guc_A* Back     alignment and structure
>1tt5_B Ubiquitin-activating enzyme E1C isoform 1; cell cycle, ligase; 2.60A {Homo sapiens} SCOP: c.111.1.2 PDB: 3dbl_B 3dbr_B 3dbh_B 3gzn_B* 1yov_B 1r4m_B 1r4n_B* Back     alignment and structure
>1zud_1 Adenylyltransferase THIF; thiamin, thiazole, protein-protein complex, THIF, TRAN biosynthetic protein complex; 1.98A {Escherichia coli} PDB: 1zfn_A* 1zkm_A Back     alignment and structure
>2nvu_B Maltose binding protein/NEDD8-activating enzyme E1 catalytic subunit chimera; multifunction macromolecular complex, ubiquitin, ATP, conformational change, thioester, switch, adenylation, protein turnover, ligase; HET: ATP; 2.80A {Homo sapiens} SCOP: c.111.1.2 c.94.1.1 Back     alignment and structure
>1jw9_B Molybdopterin biosynthesis MOEB protein; MOEB: modified rossmann fold, (2) Cys-X-X-Cys zinc-binding M MOAD: ubiquitin-like fold; 1.70A {Escherichia coli} SCOP: c.111.1.1 PDB: 1jwa_B* 1jwb_B* Back     alignment and structure
>3h5n_A MCCB protein; ubiquitin-activating enzyme, microcin, protein structure, MCCC7, peptide antibiotics, N-P bond formation, transferase; HET: ATP; 1.90A {Escherichia coli} PDB: 3h5r_A 3h9g_A 3h9j_A* 3h9q_A 3h5a_A Back     alignment and structure
>1zud_1 Adenylyltransferase THIF; thiamin, thiazole, protein-protein complex, THIF, TRAN biosynthetic protein complex; 1.98A {Escherichia coli} PDB: 1zfn_A* 1zkm_A Back     alignment and structure
>1y8q_B Anthracycline-, ubiquitin-like 2 activating enzyme E1B; SUMO, heterodimer, UBL, ligase; HET: ATP; 2.25A {Homo sapiens} PDB: 1y8r_B* 3kyc_B* 3kyd_B* 2px9_A Back     alignment and structure
>3rui_A Ubiquitin-like modifier-activating enzyme ATG7; autophagosome formation, non-canonical E1, ATP BI UBL, ATG8, ATG12, ATG10, ATG3, UBL activation, thiolation; 1.91A {Saccharomyces cerevisiae} PDB: 3t7e_A 3vh3_A 3vh4_A* Back     alignment and structure
>3cmm_A Ubiquitin-activating enzyme E1 1; UBA1, protein turnover, ligase, conformationa thioester, adenylation, transthioesterification, ATP-bindin nucleotide-binding; 2.70A {Saccharomyces cerevisiae} Back     alignment and structure
>1jw9_B Molybdopterin biosynthesis MOEB protein; MOEB: modified rossmann fold, (2) Cys-X-X-Cys zinc-binding M MOAD: ubiquitin-like fold; 1.70A {Escherichia coli} SCOP: c.111.1.1 PDB: 1jwa_B* 1jwb_B* Back     alignment and structure
>3vh1_A Ubiquitin-like modifier-activating enzyme ATG7; autophagy, zinc binding, metal binding protein; 3.00A {Saccharomyces cerevisiae} PDB: 3vh2_A Back     alignment and structure
>3h8v_A Ubiquitin-like modifier-activating enzyme 5; rossman fold, ATP-binding, UBL conjugation pathway, transfer structural genomics consortium, SGC; HET: ATP; 2.00A {Homo sapiens} PDB: 3guc_A* Back     alignment and structure
>4gsl_A Ubiquitin-like modifier-activating enzyme ATG7; ubiquitin-like protein activation enzyme, ubiquitin-like Pro transfer enzyme, protein transport; 2.70A {Saccharomyces cerevisiae} PDB: 3vh2_A 4gsk_A 3vh1_A Back     alignment and structure
>3h5n_A MCCB protein; ubiquitin-activating enzyme, microcin, protein structure, MCCC7, peptide antibiotics, N-P bond formation, transferase; HET: ATP; 1.90A {Escherichia coli} PDB: 3h5r_A 3h9g_A 3h9j_A* 3h9q_A 3h5a_A Back     alignment and structure
>3rui_A Ubiquitin-like modifier-activating enzyme ATG7; autophagosome formation, non-canonical E1, ATP BI UBL, ATG8, ATG12, ATG10, ATG3, UBL activation, thiolation; 1.91A {Saccharomyces cerevisiae} PDB: 3t7e_A 3vh3_A 3vh4_A* Back     alignment and structure
>3vh1_A Ubiquitin-like modifier-activating enzyme ATG7; autophagy, zinc binding, metal binding protein; 3.00A {Saccharomyces cerevisiae} PDB: 3vh2_A Back     alignment and structure
>2v31_A Ubiquitin-activating enzyme E1 X; ligase, phosphorylation, catalytic domain, heteronuclear first catalytic cysteine half-domain, E1 protein; NMR {Mus musculus} Back     alignment and structure
>4gsl_A Ubiquitin-like modifier-activating enzyme ATG7; ubiquitin-like protein activation enzyme, ubiquitin-like Pro transfer enzyme, protein transport; 2.70A {Saccharomyces cerevisiae} PDB: 3vh2_A 4gsk_A 3vh1_A Back     alignment and structure
>1z7l_A Ubiquitin-activating enzyme E1 1; SCCH, second catalytic cysteine half-domain, ligase; HET: TBR; 2.80A {Mus musculus} Back     alignment and structure
>3dfz_A SIRC, precorrin-2 dehydrogenase; NAD dehydrogenase, cobalamin biosynthesis, NAD, oxidoreducta porphyrin biosynthesis; 2.30A {Bacillus megaterium} Back     alignment and structure
>1y8x_B Ubiquitin-activating enzyme E1C; ubiquitin-conjugating enzyme E2 M, ligase; 2.40A {Homo sapiens} SCOP: c.111.1.2 PDB: 3fn1_A Back     alignment and structure
>3jyo_A Quinate/shikimate dehydrogenase; enzyme-cofactor complex, amino-acid biosynthesis, aromatic A biosynthesis, NAD, oxidoreductase; HET: NAD; 1.00A {Corynebacterium glutamicum} PDB: 3jyp_A* 3jyq_A* 2nlo_A Back     alignment and structure
>3jyo_A Quinate/shikimate dehydrogenase; enzyme-cofactor complex, amino-acid biosynthesis, aromatic A biosynthesis, NAD, oxidoreductase; HET: NAD; 1.00A {Corynebacterium glutamicum} PDB: 3jyp_A* 3jyq_A* 2nlo_A Back     alignment and structure
>3dfz_A SIRC, precorrin-2 dehydrogenase; NAD dehydrogenase, cobalamin biosynthesis, NAD, oxidoreducta porphyrin biosynthesis; 2.30A {Bacillus megaterium} Back     alignment and structure
>3ic5_A Putative saccharopine dehydrogenase; structural genomics, APC63807.2, N-terminal domain, saccharo dehydrogenase, PSI-2; HET: MSE; 2.08A {Ruegeria pomeroyi} Back     alignment and structure
>1kyq_A Met8P, siroheme biosynthesis protein Met8; homodimer, oxidoreductase, lyase; HET: NAD; 2.20A {Saccharomyces cerevisiae} SCOP: c.2.1.11 e.37.1.1 Back     alignment and structure
>1pjq_A CYSG, siroheme synthase; rossman fold, nucleotide binding motif, SAM, NAD, phosphoserine, transferase/oxidoreductase/lyase complex; HET: SEP PGE SAH; 2.21A {Salmonella typhimurium} SCOP: c.2.1.11 c.90.1.1 e.37.1.1 PDB: 1pjs_A* 1pjt_A* Back     alignment and structure
>3llv_A Exopolyphosphatase-related protein; NAD(P)-binding, rossmann, PSI, M structural genomics; 1.70A {Archaeoglobus fulgidus} Back     alignment and structure
>3ic5_A Putative saccharopine dehydrogenase; structural genomics, APC63807.2, N-terminal domain, saccharo dehydrogenase, PSI-2; HET: MSE; 2.08A {Ruegeria pomeroyi} Back     alignment and structure
>2g1u_A Hypothetical protein TM1088A; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: AMP; 1.50A {Thermotoga maritima} PDB: 3l4b_A* Back     alignment and structure
>3llv_A Exopolyphosphatase-related protein; NAD(P)-binding, rossmann, PSI, M structural genomics; 1.70A {Archaeoglobus fulgidus} Back     alignment and structure
>2hmt_A YUAA protein; RCK, KTN, KTR, KTRA, ktrab, membrane protein, ION transporter, symporter, transport protein; HET: NAI; 2.20A {Bacillus subtilis} SCOP: c.2.1.9 PDB: 2hms_A* 2hmu_A* 2hmv_A* 2hmw_A* 1lsu_A* Back     alignment and structure
>2g1u_A Hypothetical protein TM1088A; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: AMP; 1.50A {Thermotoga maritima} PDB: 3l4b_A* Back     alignment and structure
>3t4e_A Quinate/shikimate dehydrogenase; structural genomics, center for structural genomics of infec diseases, csgid; HET: NAD; 1.95A {Salmonella enterica subsp} PDB: 1npd_A* 1o9b_A* 1vi2_A* Back     alignment and structure
>3tnl_A Shikimate dehydrogenase; structural genomics, center for structural genomics of infec diseases, csgid; HET: NAD SKM; 1.45A {Listeria monocytogenes} PDB: 3toz_A* Back     alignment and structure
>2hmt_A YUAA protein; RCK, KTN, KTR, KTRA, ktrab, membrane protein, ION transporter, symporter, transport protein; HET: NAI; 2.20A {Bacillus subtilis} SCOP: c.2.1.9 PDB: 2hms_A* 2hmu_A* 2hmv_A* 2hmw_A* 1lsu_A* Back     alignment and structure
>1kyq_A Met8P, siroheme biosynthesis protein Met8; homodimer, oxidoreductase, lyase; HET: NAD; 2.20A {Saccharomyces cerevisiae} SCOP: c.2.1.11 e.37.1.1 Back     alignment and structure
>3e8x_A Putative NAD-dependent epimerase/dehydratase; structural genomics, APC7755, NADP, P protein structure initiative; HET: MSE NAP; 2.10A {Bacillus halodurans} Back     alignment and structure
>1id1_A Putative potassium channel protein; RCK domain, E.coli potassium channel, BK channel, rossmann fold, membrane protein; 2.40A {Escherichia coli} SCOP: c.2.1.9 Back     alignment and structure
>3tnl_A Shikimate dehydrogenase; structural genomics, center for structural genomics of infec diseases, csgid; HET: NAD SKM; 1.45A {Listeria monocytogenes} PDB: 3toz_A* Back     alignment and structure
>4ina_A Saccharopine dehydrogenase; structural genomics, PSI-biology, northeast structural genom consortium, NESG, oxidoreductas; 2.49A {Wolinella succinogenes} Back     alignment and structure
>2ph5_A Homospermidine synthase; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative; HET: NAD; 2.50A {Legionella pneumophila subsp} Back     alignment and structure
>1pjq_A CYSG, siroheme synthase; rossman fold, nucleotide binding motif, SAM, NAD, phosphoserine, transferase/oxidoreductase/lyase complex; HET: SEP PGE SAH; 2.21A {Salmonella typhimurium} SCOP: c.2.1.11 c.90.1.1 e.37.1.1 PDB: 1pjs_A* 1pjt_A* Back     alignment and structure
>3abi_A Putative uncharacterized protein PH1688; L-lysine dehydrogenase, oxidoreductase; HET: NAD; 2.44A {Pyrococcus horikoshii} Back     alignment and structure
>1lss_A TRK system potassium uptake protein TRKA homolog; KTN domain, NAD, RCK domain, potassium transport, potassium channel, KTRA; HET: NAD; 2.30A {Methanocaldococcus jannaschii} SCOP: c.2.1.9 Back     alignment and structure
>1id1_A Putative potassium channel protein; RCK domain, E.coli potassium channel, BK channel, rossmann fold, membrane protein; 2.40A {Escherichia coli} SCOP: c.2.1.9 Back     alignment and structure
>3fwz_A Inner membrane protein YBAL; TRKA-N domain, E.coli, structural genomics, PSI-2, Pro structure initiative; HET: MSE AMP; 1.79A {Escherichia coli k-12} Back     alignment and structure
>1lss_A TRK system potassium uptake protein TRKA homolog; KTN domain, NAD, RCK domain, potassium transport, potassium channel, KTRA; HET: NAD; 2.30A {Methanocaldococcus jannaschii} SCOP: c.2.1.9 Back     alignment and structure
>3pwz_A Shikimate dehydrogenase 3; alpha-beta, oxidoreductase; 1.71A {Pseudomonas putida} Back     alignment and structure
>3c85_A Putative glutathione-regulated potassium-efflux S protein KEFB; TRKA domain; HET: AMP; 1.90A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>3t4e_A Quinate/shikimate dehydrogenase; structural genomics, center for structural genomics of infec diseases, csgid; HET: NAD; 1.95A {Salmonella enterica subsp} PDB: 1npd_A* 1o9b_A* 1vi2_A* Back     alignment and structure
>3o8q_A Shikimate 5-dehydrogenase I alpha; structural genomics, center for structural genomics of infec diseases, csgid; HET: EPE; 1.45A {Vibrio cholerae biovar el tor} PDB: 3sef_A* 3pgj_A* 3o8q_B* Back     alignment and structure
>3oj0_A Glutr, glutamyl-tRNA reductase; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: MSE SO4; 1.65A {Thermoplasma volcanium} Back     alignment and structure
>3abi_A Putative uncharacterized protein PH1688; L-lysine dehydrogenase, oxidoreductase; HET: NAD; 2.44A {Pyrococcus horikoshii} Back     alignment and structure
>3qsg_A NAD-binding phosphogluconate dehydrogenase-like P; structural genomics, PSI-biology, midwest center for structu genomics; 1.90A {Alicyclobacillus acidocaldarius subsp} Back     alignment and structure
>3gvi_A Malate dehydrogenase; NAD, oxidoreductase, tricarboxylic acid cycle, structural genomics; HET: ADP; 2.25A {Brucella melitensis biovar ABORTUS2308} PDB: 3gvh_A* Back     alignment and structure
>3oj0_A Glutr, glutamyl-tRNA reductase; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: MSE SO4; 1.65A {Thermoplasma volcanium} Back     alignment and structure
>3l4b_C TRKA K+ channel protien TM1088B; potassium channel, ring-gating complex, structural GEN PSI-2-2, protein structure initiative; HET: AMP; 3.45A {Thermotoga maritima} Back     alignment and structure
>4ina_A Saccharopine dehydrogenase; structural genomics, PSI-biology, northeast structural genom consortium, NESG, oxidoreductas; 2.49A {Wolinella succinogenes} Back     alignment and structure
>3pwz_A Shikimate dehydrogenase 3; alpha-beta, oxidoreductase; 1.71A {Pseudomonas putida} Back     alignment and structure
>3o8q_A Shikimate 5-dehydrogenase I alpha; structural genomics, center for structural genomics of infec diseases, csgid; HET: EPE; 1.45A {Vibrio cholerae biovar el tor} PDB: 3sef_A* 3pgj_A* 3o8q_B* Back     alignment and structure
>3l4b_C TRKA K+ channel protien TM1088B; potassium channel, ring-gating complex, structural GEN PSI-2-2, protein structure initiative; HET: AMP; 3.45A {Thermotoga maritima} Back     alignment and structure
>3h2s_A Putative NADH-flavin reductase; Q03B84, NESG, LCR19, structural genomics, PSI-2, protein structure initiative; HET: NDP; 1.78A {Lactobacillus casei atcc 334} Back     alignment and structure
>2egg_A AROE, shikimate 5-dehydrogenase; dimer, X-RAY diffraction, structural genomics, NPPSFA; 2.25A {Geobacillus kaustophilus} Back     alignment and structure
>3dqp_A Oxidoreductase YLBE; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; 1.40A {Lactococcus lactis subsp} Back     alignment and structure
>1hyh_A L-hicdh, L-2-hydroxyisocaproate dehydrogenase; L-2-hydroxycarboxylate dehydrogenase, L-lactate dehydrogenas oxidoreductase (CHOH(D)-NAD+(A)); HET: NAD; 2.20A {Weissella confusa} SCOP: c.2.1.5 d.162.1.1 Back     alignment and structure
>3gpi_A NAD-dependent epimerase/dehydratase; structural genomics, unknown function, PSI-2, protein structure initiative; 1.44A {Methylobacillus flagellatus KT} Back     alignment and structure
>3p7m_A Malate dehydrogenase; putative dehydrogenase, enzyme, structural genomics, center structural genomics of infectious diseases, csgid; 2.20A {Francisella tularensis} Back     alignment and structure
>3e8x_A Putative NAD-dependent epimerase/dehydratase; structural genomics, APC7755, NADP, P protein structure initiative; HET: MSE NAP; 2.10A {Bacillus halodurans} Back     alignment and structure
>1p9l_A Dihydrodipicolinate reductase; oxidoreductase, lysine biosynthesis, NADH binding specificity, TB structural genomics consortium; HET: NAD PDC PG4; 2.30A {Mycobacterium tuberculosis} SCOP: c.2.1.3 d.81.1.3 PDB: 1c3v_A* 1yl5_A 1yl7_A* 1yl6_A* Back     alignment and structure
>3don_A Shikimate dehydrogenase; alpha-beta structure, rossman fold, amino-acid biosynthesis, amino acid biosynthesis, NADP, oxidoreductase; 2.10A {Staphylococcus epidermidis} PDB: 3doo_A* Back     alignment and structure
>3dhn_A NAD-dependent epimerase/dehydratase; reductase, PF01370, Q89Z24_bactn, NESG, BTR310, structural genomics, PSI-2; 2.00A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2d4a_B Malate dehydrogenase; archaea, hyperthermophIle, oxidoreductase; 2.87A {Aeropyrum pernix} Back     alignment and structure
>1hdo_A Biliverdin IX beta reductase; foetal metabolism, HAEM degradation, flavin reductase, diaphorase, green HAEM binding protein; HET: NAP; 1.15A {Homo sapiens} SCOP: c.2.1.2 PDB: 1he2_A* 1he3_A* 1he4_A* 1he5_A* Back     alignment and structure
>2raf_A Putative dinucleotide-binding oxidoreductase; NP_786167.1, NADP oxidoreductase coenzyme F420-dependent, structural genomics; HET: MSE NAP; 1.60A {Lactobacillus plantarum WCFS1} Back     alignment and structure
>3ruf_A WBGU; rossmann fold, UDP-hexose 4-epimerase, isomerase; HET: NAD UDP; 2.00A {Plesiomonas shigelloides} SCOP: c.2.1.2 PDB: 3ru9_A* 3rud_A* 3rue_A* 3rua_A* 3ruh_A* 3ruc_A* 3ru7_A* 3lu1_A* Back     alignment and structure
>1hdo_A Biliverdin IX beta reductase; foetal metabolism, HAEM degradation, flavin reductase, diaphorase, green HAEM binding protein; HET: NAP; 1.15A {Homo sapiens} SCOP: c.2.1.2 PDB: 1he2_A* 1he3_A* 1he4_A* 1he5_A* Back     alignment and structure
>3rku_A Oxidoreductase YMR226C; substrate fingerprint, short chain oxidoreductase, rossmann oxidoreductase; HET: NAP; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3slg_A PBGP3 protein; structural genomics, seattle structural genomics center for infectious disease, ssgcid, melioidosis, glanders; 2.10A {Burkholderia pseudomallei} Back     alignment and structure
>1npy_A Hypothetical shikimate 5-dehydrogenase-like protein HI0607; structural genomics, PSI, protein structure initiative; 1.75A {Haemophilus influenzae} SCOP: c.2.1.7 c.58.1.5 Back     alignment and structure
>3doj_A AT3G25530, dehydrogenase-like protein; gamma-hydroxybutyrate dehydrogenase, 4-hydroxybutyrate dehydrogenase; 2.10A {Arabidopsis thaliana} Back     alignment and structure
>3d0o_A L-LDH 1, L-lactate dehydrogenase 1; cytoplasm, glycolysis, NAD, oxidoreductase, phosphoprotein; 1.80A {Staphylococcus aureus} PDB: 3d4p_A* 3h3j_A* Back     alignment and structure
>1ldn_A L-lactate dehydrogenase; oxidoreductase(CHOH(D)-NAD(A)); HET: FBP NAD; 2.50A {Geobacillus stearothermophilus} SCOP: c.2.1.5 d.162.1.1 PDB: 1ldb_A 2ldb_A* Back     alignment and structure
>3l9w_A Glutathione-regulated potassium-efflux system Pro linker, ancillary protein KEFF; potassium channel regulation, domains, antiport; HET: FMN AMP GSH; 1.75A {Escherichia coli} PDB: 3eyw_A* 3l9x_A* Back     alignment and structure
>3don_A Shikimate dehydrogenase; alpha-beta structure, rossman fold, amino-acid biosynthesis, amino acid biosynthesis, NADP, oxidoreductase; 2.10A {Staphylococcus epidermidis} PDB: 3doo_A* Back     alignment and structure
>2hk9_A Shikimate dehydrogenase; shikimate pathway, drug design, oxidoreductase; HET: ATR SKM NAP; 2.20A {Aquifex aeolicus} PDB: 2hk8_A 2hk7_A Back     alignment and structure
>4id9_A Short-chain dehydrogenase/reductase; putative dehydrogenase, enzyme function initiative, EFI, STR genomics, oxidoreductase; HET: NAD; 1.60A {Agrobacterium fabrum} PDB: 4idg_A* Back     alignment and structure
>2aef_A Calcium-gated potassium channel MTHK; rossmann fold, helix-turn-helix, Ca2+ binding, flexible interface; 1.70A {Methanothermobacterthermautotrophicus} PDB: 2aej_A 2aem_A 3rbx_A 2ogu_A 2fy8_A 3kxd_A Back     alignment and structure
>4ezb_A Uncharacterized conserved protein; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium; 2.10A {Sinorhizobium meliloti} Back     alignment and structure
>3t4x_A Oxidoreductase, short chain dehydrogenase/reducta; structural genomics, center for structural genomics of infec diseases, csgid; 2.80A {Bacillus anthracis} Back     alignment and structure
>3dhn_A NAD-dependent epimerase/dehydratase; reductase, PF01370, Q89Z24_bactn, NESG, BTR310, structural genomics, PSI-2; 2.00A {Bacteroides thetaiotaomicron} Back     alignment and structure
>4e12_A Diketoreductase; oxidoreductase, NADH; HET: 1PE; 1.93A {Acinetobacter baylyi} PDB: 4dyd_A* 4e13_A* Back     alignment and structure
>2ewd_A Lactate dehydrogenase,; protein-substrate_cofactor analog complex, oxidoreductase; HET: A3D; 2.00A {Cryptosporidium parvum} PDB: 2frm_A 2fn7_A* 2fnz_A* 2fm3_A Back     alignment and structure
>3o38_A Short chain dehydrogenase; tuberculosis, ortholog from A non-pathogenic dehydrogenase, structural genomics; 1.95A {Mycobacterium smegmatis} Back     alignment and structure
>2axq_A Saccharopine dehydrogenase; rossmann fold variant, saccharopine reductase fold (domain II), alpha/beta protein; 1.70A {Saccharomyces cerevisiae} Back     alignment and structure
>3vku_A L-LDH, L-lactate dehydrogenase; rossmann fold, NADH binding, oxidoreductase; 1.96A {Lactobacillus casei} PDB: 2zqz_A 2zqy_A 3vkv_A* 1llc_A* Back     alignment and structure
>4egb_A DTDP-glucose 4,6-dehydratase; rhamnose pathway, center for structural genomics of infectio diseases, csgid, niaid; HET: NAD SUC; 3.00A {Bacillus anthracis} Back     alignment and structure
>3m2p_A UDP-N-acetylglucosamine 4-epimerase; SGXNY, 11155J, isomerase, structural genomics, PSI-2, protein structure initiative; HET: UDP; 2.95A {Bacillus cereus} Back     alignment and structure
>1oju_A MDH, malate dehydrogenase; hyperthermophilic, oxidoreductase; HET: ENA; 2.79A {Archaeoglobus fulgidus} PDB: 1ojs_A* 2x0i_A* 2x0j_A* Back     alignment and structure
>2b69_A UDP-glucuronate decarboxylase 1; UDP-glucoronic acid decarboxylase, structural genomics, STRU genomics consortium, SGC, lyase; HET: MSE NAD UDP; 1.21A {Homo sapiens} SCOP: c.2.1.2 PDB: 4ef7_A* Back     alignment and structure
>4e21_A 6-phosphogluconate dehydrogenase (decarboxylating; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.30A {Geobacter metallireducens} Back     alignment and structure
>3qsg_A NAD-binding phosphogluconate dehydrogenase-like P; structural genomics, PSI-biology, midwest center for structu genomics; 1.90A {Alicyclobacillus acidocaldarius subsp} Back     alignment and structure
>4aj2_A L-lactate dehydrogenase A chain; oxidoreductase-inhibitor complex, fragment-based LEAD genera inhibitors; HET: 52C; 1.75A {Rattus norvegicus} PDB: 4aj1_A* 4aje_A* 4ajh_A* 4aji_A* 4ajj_A* 4ajk_A* 4ajl_A* 4ajn_A* 4ajo_A* 4al4_A* 4aj4_A* 4ajp_A* 1i10_A* 3h3f_A* 9ldt_A* 9ldb_A* 1t2f_A* 1i0z_A* 5ldh_A* 1ldm_A* ... Back     alignment and structure
>3rku_A Oxidoreductase YMR226C; substrate fingerprint, short chain oxidoreductase, rossmann oxidoreductase; HET: NAP; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3gpi_A NAD-dependent epimerase/dehydratase; structural genomics, unknown function, PSI-2, protein structure initiative; 1.44A {Methylobacillus flagellatus KT} Back     alignment and structure
>2raf_A Putative dinucleotide-binding oxidoreductase; NP_786167.1, NADP oxidoreductase coenzyme F420-dependent, structural genomics; HET: MSE NAP; 1.60A {Lactobacillus plantarum WCFS1} Back     alignment and structure
>4g65_A TRK system potassium uptake protein TRKA; structural genomics, center for structural genomics of infec diseases, csgid, niaid; HET: MSE; 2.09A {Vibrio vulnificus} Back     alignment and structure
>2pzm_A Putative nucleotide sugar epimerase/ dehydratase; rossman fold, protein-NAD complex, protein-nucleotide comple binding protein; HET: NAD UDP; 2.00A {Bordetella bronchiseptica} PDB: 2pzl_A* 2pzk_A* Back     alignment and structure
>1y1p_A ARII, aldehyde reductase II; rossmann fold, short chain dehydrogenase reductase, oxidoreductase; HET: NMN AMP; 1.60A {Sporidiobolus salmonicolor} SCOP: c.2.1.2 PDB: 1ujm_A* 1zze_A Back     alignment and structure
>3ew7_A LMO0794 protein; Q8Y8U8_lismo, putative NAD-dependent epimerase/dehydratase, LMR162, NESG, structural genomics, PSI-2; 2.73A {Listeria monocytogenes} Back     alignment and structure
>4id9_A Short-chain dehydrogenase/reductase; putative dehydrogenase, enzyme function initiative, EFI, STR genomics, oxidoreductase; HET: NAD; 1.60A {Agrobacterium fabrum} PDB: 4idg_A* Back     alignment and structure
>4ezb_A Uncharacterized conserved protein; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium; 2.10A {Sinorhizobium meliloti} Back     alignment and structure
>3pqe_A L-LDH, L-lactate dehydrogenase; FBP, oxidoreductase; 2.20A {Bacillus subtilis} PDB: 3pqf_A* 3pqd_A* Back     alignment and structure
>2x0j_A Malate dehydrogenase; oxidoreductase, hyperthermophilic, tricarboxylic acid cycle; HET: ENA; 2.79A {Archaeoglobus fulgidus dsm 4304} PDB: 2x0i_A* Back     alignment and structure
>3ruf_A WBGU; rossmann fold, UDP-hexose 4-epimerase, isomerase; HET: NAD UDP; 2.00A {Plesiomonas shigelloides} SCOP: c.2.1.2 PDB: 3ru9_A* 3rud_A* 3rue_A* 3rua_A* 3ruh_A* 3ruc_A* 3ru7_A* 3lu1_A* Back     alignment and structure
>3tl2_A Malate dehydrogenase; center for structural genomics of infectious diseases, csgid dehydrogenase, oxidoreductase, citric acid cycle; 1.70A {Bacillus anthracis} Back     alignment and structure
>3lf2_A Short chain oxidoreductase Q9HYA2; SDR, SCOR, rossmann fold; HET: NAP; 2.30A {Pseudomonas aeruginosa} PDB: 3lf1_A* Back     alignment and structure
>2bka_A CC3, TAT-interacting protein TIP30; NADPH, PEG600, transcription; HET: NDP PE8; 1.7A {Homo sapiens} SCOP: c.2.1.2 PDB: 2fmu_A Back     alignment and structure
>4e12_A Diketoreductase; oxidoreductase, NADH; HET: 1PE; 1.93A {Acinetobacter baylyi} PDB: 4dyd_A* 4e13_A* Back     alignment and structure
>2egg_A AROE, shikimate 5-dehydrogenase; dimer, X-RAY diffraction, structural genomics, NPPSFA; 2.25A {Geobacillus kaustophilus} Back     alignment and structure
>3d1l_A Putative NADP oxidoreductase BF3122; structural genomics, PSI-2, protein structure initiative, M center for structural genomics, MCSG; 2.19A {Bacteroides fragilis} Back     alignment and structure
>4egb_A DTDP-glucose 4,6-dehydratase; rhamnose pathway, center for structural genomics of infectio diseases, csgid, niaid; HET: NAD SUC; 3.00A {Bacillus anthracis} Back     alignment and structure
>2hjr_A Malate dehydrogenase; malaria, structural genomics, structural genomics consortium, SGC, oxidoreductase; HET: CIT APR; 2.20A {Cryptosporidium parvum} Back     alignment and structure
>3slg_A PBGP3 protein; structural genomics, seattle structural genomics center for infectious disease, ssgcid, melioidosis, glanders; 2.10A {Burkholderia pseudomallei} Back     alignment and structure
>3ldh_A Lactate dehydrogenase; oxidoreductase, CHOH donor, NAD acceptor; HET: NAD; 3.00A {Squalus acanthias} SCOP: i.12.1.1 Back     alignment and structure
>1xg5_A ARPG836; short chain dehydrogenase, human, SGC, structural genomics, structural genomics consortium, oxidoreductase; HET: NAP; 1.53A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>1lu9_A Methylene tetrahydromethanopterin dehydrogenase; alpha/beta twisted open sheet structure, oxidoreductase; 1.90A {Methylobacterium extorquens} SCOP: c.2.1.7 c.58.1.4 PDB: 1lua_A* Back     alignment and structure
>3ko8_A NAD-dependent epimerase/dehydratase; isomerase, UDP-galactose 4-epimerase; HET: NAD; 1.80A {Pyrobaculum calidifontis} SCOP: c.2.1.0 PDB: 3icp_A* 3aw9_A* Back     alignment and structure
>3ius_A Uncharacterized conserved protein; APC63810, silicibacter pomeroyi DSS, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.66A {Ruegeria pomeroyi dss-3} Back     alignment and structure
>2v6b_A L-LDH, L-lactate dehydrogenase; oxidoreductase, radioresistance, NAD, cytoplasm, mesophilic, glycolysis; 2.50A {Deinococcus radiodurans} Back     alignment and structure
>3d1l_A Putative NADP oxidoreductase BF3122; structural genomics, PSI-2, protein structure initiative, M center for structural genomics, MCSG; 2.19A {Bacteroides fragilis} Back     alignment and structure
>3o26_A Salutaridine reductase; short chain dehydrogenase/reductases, oxidoreductase; HET: NDP; 1.91A {Papaver somniferum} SCOP: c.2.1.0 Back     alignment and structure
>3gvi_A Malate dehydrogenase; NAD, oxidoreductase, tricarboxylic acid cycle, structural genomics; HET: ADP; 2.25A {Brucella melitensis biovar ABORTUS2308} PDB: 3gvh_A* Back     alignment and structure
>3vps_A TUNA, NAD-dependent epimerase/dehydratase; tunicamycins, biosynthesis, EXO-glycal, rossman transferase; HET: UD1 NAD; 1.90A {Streptomyces chartreusis} Back     alignment and structure
>1sb8_A WBPP; epimerase, 4-epimerase, UDP-galnac, UDP-GLCNAC, SDR, G SYK, UDP, N-acetylglucosamine, N- acetylgalactosamine, UDP-GLC, isomerase; HET: NAD UD2; 2.10A {Pseudomonas aeruginosa} SCOP: c.2.1.2 PDB: 1sb9_A* Back     alignment and structure
>3tri_A Pyrroline-5-carboxylate reductase; amino acid biosynthesis, oxidoreductase; HET: NAP; 2.50A {Coxiella burnetii} Back     alignment and structure
>4gbj_A 6-phosphogluconate dehydrogenase NAD-binding; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; 2.05A {Dyadobacter fermentans} Back     alignment and structure
>3fwz_A Inner membrane protein YBAL; TRKA-N domain, E.coli, structural genomics, PSI-2, Pro structure initiative; HET: MSE AMP; 1.79A {Escherichia coli k-12} Back     alignment and structure
>1ur5_A Malate dehydrogenase; oxidoreductase, tricarboxylic acid cycle; HET: NAD; 1.75A {Chloroflexus aurantiacus} SCOP: c.2.1.5 d.162.1.1 PDB: 1uxg_A* 1guy_A* 1uxk_A* 1uxh_A* 1uxj_A* 1uxi_A* Back     alignment and structure
>3nyw_A Putative oxidoreductase; fatty acid synthesis,3-oxoacyl-[ACP] reductase, NADP+ bindin rossman fold, PSI-II, nysgxrc; 2.16A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3hg7_A D-isomer specific 2-hydroxyacid dehydrogenase FAM protein; structural genomics; 1.80A {Aeromonas salmonicida subsp} Back     alignment and structure
>4g65_A TRK system potassium uptake protein TRKA; structural genomics, center for structural genomics of infec diseases, csgid, niaid; HET: MSE; 2.09A {Vibrio vulnificus} Back     alignment and structure
>3qiv_A Short-chain dehydrogenase or 3-oxoacyl-[acyl-CARR protein] reductase; structural genomics; 2.25A {Mycobacterium avium subsp} Back     alignment and structure
>1p77_A Shikimate 5-dehydrogenase; NADPH, oxidoreductase; HET: ATR; 1.95A {Haemophilus influenzae} SCOP: c.2.1.7 c.58.1.5 PDB: 1p74_A* Back     alignment and structure
>3ius_A Uncharacterized conserved protein; APC63810, silicibacter pomeroyi DSS, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.66A {Ruegeria pomeroyi dss-3} Back     alignment and structure
>3dqp_A Oxidoreductase YLBE; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; 1.40A {Lactococcus lactis subsp} Back     alignment and structure
>3dtt_A NADP oxidoreductase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: NAP; 1.70A {Arthrobacter SP} Back     alignment and structure
>3phh_A Shikimate dehydrogenase; shikimate pathway, helicobacter PYL oxidoreductase, alpha/beta domain, rossmann fold; HET: SKM; 1.42A {Helicobacter pylori} PDB: 3phg_A* 3phi_A* 3phj_A* 4foo_A 4fpx_A 4fos_A* 4fr5_A* 4fq8_A* Back     alignment and structure
>2ph5_A Homospermidine synthase; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative; HET: NAD; 2.50A {Legionella pneumophila subsp} Back     alignment and structure
>3tri_A Pyrroline-5-carboxylate reductase; amino acid biosynthesis, oxidoreductase; HET: NAP; 2.50A {Coxiella burnetii} Back     alignment and structure
>3pp8_A Glyoxylate/hydroxypyruvate reductase A; structural genomics, center for structural genomics of infec diseases, csgid; 2.10A {Salmonella enterica subsp} PDB: 3kbo_A Back     alignment and structure
>3l9w_A Glutathione-regulated potassium-efflux system Pro linker, ancillary protein KEFF; potassium channel regulation, domains, antiport; HET: FMN AMP GSH; 1.75A {Escherichia coli} PDB: 3eyw_A* 3l9x_A* Back     alignment and structure
>3qvo_A NMRA family protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, unknown function; HET: MNB; 2.30A {Shigella flexneri 2A} Back     alignment and structure
>3r6d_A NAD-dependent epimerase/dehydratase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, veillo parvula; HET: MLZ; 1.25A {Veillonella parvula dsm 2008} PDB: 4hng_A 4hnh_A* 3r14_A* Back     alignment and structure
>2b69_A UDP-glucuronate decarboxylase 1; UDP-glucoronic acid decarboxylase, structural genomics, STRU genomics consortium, SGC, lyase; HET: MSE NAD UDP; 1.21A {Homo sapiens} SCOP: c.2.1.2 PDB: 4ef7_A* Back     alignment and structure
>2bll_A Protein YFBG; decarboxylase, short chain dehydrogenase, L-ARA4N biosynthes methyltransferase, transferase; 2.3A {Escherichia coli} SCOP: c.2.1.2 PDB: 1u9j_A 1z73_A 1z75_A 1z7b_A 1z74_A Back     alignment and structure
>1lld_A L-lactate dehydrogenase; oxidoreductase(CHOH (D)-NAD (A)); HET: NAD; 2.00A {Bifidobacterium longum subsp} SCOP: c.2.1.5 d.162.1.1 PDB: 1lth_T* Back     alignment and structure
>3pef_A 6-phosphogluconate dehydrogenase, NAD-binding; gamma-hydroxybutyrate dehydrogenase, succinic semialdehyde R geobacter metallireducens; HET: NAP; 2.07A {Geobacter metallireducens} Back     alignment and structure
>3m2p_A UDP-N-acetylglucosamine 4-epimerase; SGXNY, 11155J, isomerase, structural genomics, PSI-2, protein structure initiative; HET: UDP; 2.95A {Bacillus cereus} Back     alignment and structure
>1a5z_A L-lactate dehydrogenase; oxidoreductase, glycolysis, hyperthermophiles, thermotoga MA protein stability; HET: FBP NAD; 2.10A {Thermotoga maritima} SCOP: c.2.1.5 d.162.1.1 Back     alignment and structure
>1nvt_A Shikimate 5'-dehydrogenase; structural genomics, PSI, protein structure initiative; HET: NAP; 2.35A {Methanocaldococcus jannaschii} SCOP: c.2.1.7 c.58.1.5 Back     alignment and structure
>3g0o_A 3-hydroxyisobutyrate dehydrogenase; NAD(P), valine catabolism, tartaric acid, target 11128H, NYSGXRC, PSI-2, structural genomics; HET: TLA; 1.80A {Salmonella typhimurium} Back     alignment and structure
>3obb_A Probable 3-hydroxyisobutyrate dehydrogenase; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics; HET: EPE; 2.20A {Pseudomonas aeruginosa} PDB: 3q3c_A* Back     alignment and structure
>3qvo_A NMRA family protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, unknown function; HET: MNB; 2.30A {Shigella flexneri 2A} Back     alignment and structure
>1y1p_A ARII, aldehyde reductase II; rossmann fold, short chain dehydrogenase reductase, oxidoreductase; HET: NMN AMP; 1.60A {Sporidiobolus salmonicolor} SCOP: c.2.1.2 PDB: 1ujm_A* 1zze_A Back     alignment and structure
>3evt_A Phosphoglycerate dehydrogenase; structural genomics, PSI-2, protein structure initiative; 2.20A {Lactobacillus plantarum} Back     alignment and structure
>2pzm_A Putative nucleotide sugar epimerase/ dehydratase; rossman fold, protein-NAD complex, protein-nucleotide comple binding protein; HET: NAD UDP; 2.00A {Bordetella bronchiseptica} PDB: 2pzl_A* 2pzk_A* Back     alignment and structure
>3sxp_A ADP-L-glycero-D-mannoheptose-6-epimerase; rossman fold, NAD binding, isomerase; HET: NAD; 2.55A {Helicobacter pylori} Back     alignment and structure
>2cvz_A Dehydrogenase, 3-hydroxyisobutyrate dehydrogenase; valine catabolism, NADP+, structural GEN riken structural genomics/proteomics initiative; HET: NDP; 1.80A {Thermus thermophilus} SCOP: a.100.1.1 c.2.1.6 PDB: 1wp4_A* Back     alignment and structure
>1iy8_A Levodione reductase; oxidoreductase; HET: NAD; 1.60A {Leifsonia aquatica} SCOP: c.2.1.2 Back     alignment and structure
>3ggo_A Prephenate dehydrogenase; TYRA, HPP, NADH, alpha-beta, oxidoreductase; HET: NAI ENO; 2.15A {Aquifex aeolicus} PDB: 3ggg_D* 3ggp_A* Back     alignment and structure
>3c85_A Putative glutathione-regulated potassium-efflux S protein KEFB; TRKA domain; HET: AMP; 1.90A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>2gf2_A Hibadh, 3-hydroxyisobutyrate dehydrogenase; structural genomics, structural genomics consortium, SGC, oxidoreductase; 2.38A {Homo sapiens} PDB: 2i9p_A* Back     alignment and structure
>3sxp_A ADP-L-glycero-D-mannoheptose-6-epimerase; rossman fold, NAD binding, isomerase; HET: NAD; 2.55A {Helicobacter pylori} Back     alignment and structure
>2gn4_A FLAA1 protein, UDP-GLCNAC C6 dehydratase; rossmann fold, TYK triad, SDR, enzyme, NADP, NADPH, lyase; HET: NDP UD1 MES; 1.90A {Helicobacter pylori} PDB: 2gn6_A* 2gn8_A* 2gn9_A* 2gna_A* Back     alignment and structure
>1ks9_A KPA reductase;, 2-dehydropantoate 2-reductase; PANE, APBA, ketopantoate reductase, rossman fold, monomer, APO, oxidoreductase; 1.70A {Escherichia coli} SCOP: a.100.1.7 c.2.1.6 PDB: 1yon_A* 1yjq_A* 2ofp_A* Back     alignment and structure
>3i6i_A Putative leucoanthocyanidin reductase 1; rossmann fold, short chain dehydrogenase reductase, flavonoi oxidoreductase; HET: NDP; 1.75A {Vitis vinifera} PDB: 3i5m_A 3i52_A* 3i6q_A* Back     alignment and structure
>3pqe_A L-LDH, L-lactate dehydrogenase; FBP, oxidoreductase; 2.20A {Bacillus subtilis} PDB: 3pqf_A* 3pqd_A* Back     alignment and structure
>1ff9_A Saccharopine reductase; lysine biosynthesis, alpha-aminoadipate pathway, dehydrogenase, oxidoreductase; 2.00A {Magnaporthe grisea} SCOP: c.2.1.3 d.81.1.2 PDB: 1e5l_A* 1e5q_A Back     alignment and structure
>3onh_A Ubiquitin-activating enzyme E1-like; ligase, SUMO conjugation, UBC9; 1.60A {Saccharomyces cerevisiae} PDB: 3ong_A Back     alignment and structure
>3pdu_A 3-hydroxyisobutyrate dehydrogenase family protein; gamma-hydroxybutyrate dehydrogenase, succinic semialdehyde R glyoxylate metabolism; HET: NAP; 1.89A {Geobacter sulfurreducens} Back     alignment and structure
>1t2d_A LDH-P, L-lactate dehydrogenase; ternary complex, oxidoreductase; HET: NAD; 1.10A {Plasmodium falciparum} SCOP: c.2.1.5 d.162.1.1 PDB: 1t25_A* 1t26_A* 1t2c_A* 1t24_A* 2x8l_A 2ydn_A* 2a94_A* 1u4s_A* 1u5a_A* 1u5c_A* 1u4o_A* 1t2e_A* 1xiv_A* 1ceq_A 1ldg_A* 1cet_A* 1oc4_A* 2a92_A* 2aa3_A* Back     alignment and structure
>2hjr_A Malate dehydrogenase; malaria, structural genomics, structural genomics consortium, SGC, oxidoreductase; HET: CIT APR; 2.20A {Cryptosporidium parvum} Back     alignment and structure
>1sby_A Alcohol dehydrogenase; ternary complex, NAD, trifluoroethanol, oxidoreductase; HET: NAD; 1.10A {Scaptodrosophila lebanonensis} SCOP: c.2.1.2 PDB: 1b14_A* 1b15_A* 1a4u_A* 1b2l_A* 1b16_A* 3rj5_A* 3rj9_A* 1mg5_A* Back     alignment and structure
>3rft_A Uronate dehydrogenase; apoenzyme, rossmann fold, NAD binding, oxidoreductase; 1.90A {Agrobacterium tumefaciens} PDB: 3rfv_A* 3rfx_A* Back     alignment and structure
>2gn4_A FLAA1 protein, UDP-GLCNAC C6 dehydratase; rossmann fold, TYK triad, SDR, enzyme, NADP, NADPH, lyase; HET: NDP UD1 MES; 1.90A {Helicobacter pylori} PDB: 2gn6_A* 2gn8_A* 2gn9_A* 2gna_A* Back     alignment and structure
>1ez4_A Lactate dehydrogenase; rossmann fold, oxidoreductase; HET: NAD; 2.30A {Lactobacillus pentosus} SCOP: c.2.1.5 d.162.1.1 Back     alignment and structure
>3kkj_A Amine oxidase, flavin-containing; oxidoreductase, PSR10, Q888A4, X-RAY, structure, PSI, protein structure initiative; HET: FAD; 2.50A {Pseudomonas syringae PV} Back     alignment and structure
>3vku_A L-LDH, L-lactate dehydrogenase; rossmann fold, NADH binding, oxidoreductase; 1.96A {Lactobacillus casei} PDB: 2zqz_A 2zqy_A 3vkv_A* 1llc_A* Back     alignment and structure
>2x4g_A Nucleoside-diphosphate-sugar epimerase; isomerase; 2.65A {Pseudomonas aeruginosa} Back     alignment and structure
>1lnq_A MTHK channels, potassium channel related protein; rossman fold, helix bundle, membrane protein; 3.30A {Methanothermobacter thermautotrophicusorganism_taxid} SCOP: c.2.1.9 d.286.1.1 f.14.1.1 PDB: 3rbz_A Back     alignment and structure
>2pv7_A T-protein [includes: chorismate mutase (EC 5.4.99 and prephenate dehydrogenase (EC...; 1574749, chorismate mutase type II; HET: MSE TYR NAD; 2.00A {Haemophilus influenzae} SCOP: a.100.1.12 c.2.1.6 Back     alignment and structure
>4dqv_A Probable peptide synthetase NRP (peptide synthase; GXXGXXG motif, rossmann fold, short chain dehydrogenase/REDU family, reductase; 2.30A {Mycobacterium tuberculosis} Back     alignment and structure
>3fi9_A Malate dehydrogenase; structural genomics, oxidoreductase, PSI-2, protein structur initiative; 1.90A {Porphyromonas gingivalis} Back     alignment and structure
>3rkr_A Short chain oxidoreductase; rossmann fold; HET: NAP; 2.42A {Uncultured bacterium BIO5} Back     alignment and structure
>3ioy_A Short-chain dehydrogenase/reductase SDR; structural genomics, oxidoreductase, PSI-2, protein structure initiative; 1.90A {Novosphingobium aromaticivorans DSM12444} Back     alignment and structure
>3p7m_A Malate dehydrogenase; putative dehydrogenase, enzyme, structural genomics, center structural genomics of infectious diseases, csgid; 2.20A {Francisella tularensis} Back     alignment and structure
>3vps_A TUNA, NAD-dependent epimerase/dehydratase; tunicamycins, biosynthesis, EXO-glycal, rossman transferase; HET: UD1 NAD; 1.90A {Streptomyces chartreusis} Back     alignment and structure
>4e21_A 6-phosphogluconate dehydrogenase (decarboxylating; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.30A {Geobacter metallireducens} Back     alignment and structure
>2f1k_A Prephenate dehydrogenase; tyrosine synthesis, X-RA crystallography structure, oxidoreductase; HET: OMT NAP; 1.55A {Synechocystis SP} SCOP: a.100.1.12 c.2.1.6 Back     alignment and structure
>2g5c_A Prephenate dehydrogenase; TYRA, oxidoreductase; HET: NAD; 1.90A {Aquifex aeolicus} SCOP: a.100.1.12 c.2.1.6 Back     alignment and structure
>3gt0_A Pyrroline-5-carboxylate reductase; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG; 2.00A {Bacillus cereus atcc 14579} Back     alignment and structure
>2d5c_A AROE, shikimate 5-dehydrogenase; substrate, dimer, structural genomics, NPPSFA, Na project on protein structural and functional analyses; HET: SKM; 1.65A {Thermus thermophilus} PDB: 1wxd_A* 2cy0_A* 2ev9_A* Back     alignment and structure
>1vl6_A Malate oxidoreductase; TM0542, NAD-dependent malic enzyme, structural genomics, JCS protein structure initiative, PSI; 2.61A {Thermotoga maritima} SCOP: c.2.1.7 c.58.1.3 PDB: 2hae_A* Back     alignment and structure
>2z1n_A Dehydrogenase; reductase, SDR, oxidoreductase; 1.80A {Aeropyrum pernix} Back     alignment and structure
>1sb8_A WBPP; epimerase, 4-epimerase, UDP-galnac, UDP-GLCNAC, SDR, G SYK, UDP, N-acetylglucosamine, N- acetylgalactosamine, UDP-GLC, isomerase; HET: NAD UD2; 2.10A {Pseudomonas aeruginosa} SCOP: c.2.1.2 PDB: 1sb9_A* Back     alignment and structure
>1xu9_A Corticosteroid 11-beta-dehydrogenase, isozyme 1; hydroxysteroid, SDR, oxidoreductase; HET: NDP CPS MES; 1.55A {Homo sapiens} SCOP: c.2.1.2 PDB: 1xu7_A* 3bzu_A* 3czr_A* 3d3e_A* 3d4n_A* 3fco_A* 3frj_A* 3h6k_A* 3hfg_A* 3oq1_A* 3qqp_A* 3pdj_A* 3d5q_A* 2rbe_A* 3byz_A* 3ey4_A* 3tfq_A* 3ch6_A* 2irw_A* 2ilt_A* ... Back     alignment and structure
>3lk7_A UDP-N-acetylmuramoylalanine--D-glutamate ligase; agalacitae, PSI, MCSG, structural genomics, midwest center for structural genomics; HET: MSE; 1.50A {Streptococcus agalactiae} Back     alignment and structure
>3sju_A Keto reductase; short-chain dehydrogenase, oxidoreductase; HET: NDP; 2.40A {Streptomyces griseoruber} Back     alignment and structure
>1yb4_A Tartronic semialdehyde reductase; structural genomics, oxidoreductase, salmonella typhimurium LT2, PSI, protein ST initiative; 2.40A {Salmonella typhimurium} Back     alignment and structure
>2bka_A CC3, TAT-interacting protein TIP30; NADPH, PEG600, transcription; HET: NDP PE8; 1.7A {Homo sapiens} SCOP: c.2.1.2 PDB: 2fmu_A Back     alignment and structure
>1x7d_A Ornithine cyclodeaminase; binds NAD+, binds L-ornithine, binds L-proline, 2 bundle, beta barrel, rossmann fold, lyase; HET: NAD ORN MES; 1.60A {Pseudomonas putida} SCOP: c.2.1.13 PDB: 1u7h_A* Back     alignment and structure
>2z1m_A GDP-D-mannose dehydratase; short-chain dehydrogenase/reductase, lyase, structural genom NPPSFA; HET: NDP GDP; 2.00A {Aquifex aeolicus} PDB: 2z95_A* Back     alignment and structure
>1lu9_A Methylene tetrahydromethanopterin dehydrogenase; alpha/beta twisted open sheet structure, oxidoreductase; 1.90A {Methylobacterium extorquens} SCOP: c.2.1.7 c.58.1.4 PDB: 1lua_A* Back     alignment and structure
>3i1j_A Oxidoreductase, short chain dehydrogenase/reducta; dimer, MIXE beta, structural genomics, PSI-2; 1.90A {Pseudomonas syringae PV} SCOP: c.2.1.0 Back     alignment and structure
>3svt_A Short-chain type dehydrogenase/reductase; ssgcid, seattle structural genomics center for infectious DI oxidoreductase; 2.00A {Mycobacterium ulcerans} Back     alignment and structure
>3nep_X Malate dehydrogenase; halophIle, molecular adpatation, NAD, oxidoreductase, tricarboxylic acid cycle; 1.55A {Salinibacter ruber} Back     alignment and structure
>3gaf_A 7-alpha-hydroxysteroid dehydrogenase; seattle structural genomics center for infectious disease, ssgcid, oxidoreductase, structural genomics; 2.20A {Brucella melitensis} Back     alignment and structure
>2ew2_A 2-dehydropantoate 2-reductase, putative; alpha-structure, alpha-beta structure, structural genomics, protein structure initiative; HET: MSE; 2.00A {Enterococcus faecalis} Back     alignment and structure
>3enk_A UDP-glucose 4-epimerase; seattle structural genomics center for infectious disease, ssgcid, isomerase, NAD; HET: NAD GUD; 1.90A {Burkholderia pseudomallei 1710B} SCOP: c.2.1.0 Back     alignment and structure
>3fbt_A Chorismate mutase and shikimate 5-dehydrogenase fusion protein; structural genomics, oxidoreductase, amino-acid biosynthesis; 2.10A {Clostridium acetobutylicum} Back     alignment and structure
>2dc1_A L-aspartate dehydrogenase; NAD, oxidoreductase; HET: CIT NAD; 1.90A {Archaeoglobus fulgidus} Back     alignment and structure
>2q1s_A Putative nucleotide sugar epimerase/ dehydratase; rossman fold, protein-NADH complex, sugar binding protein; HET: NAI; 1.50A {Bordetella bronchiseptica} PDB: 2pzj_A* 2q1t_A* 2q1u_A* Back     alignment and structure
>1bg6_A N-(1-D-carboxylethyl)-L-norvaline dehydrogenase; L) stereospecific opine dehydrogenase, oxidoreductase; 1.80A {Arthrobacter SP} SCOP: a.100.1.5 c.2.1.6 Back     alignment and structure
>2zqz_A L-LDH, L-lactate dehydrogenase; oxidoreductase, rossmann fold, cytoplasm, glycolysis, NAD, phosphoprotein; 2.50A {Lactobacillus casei} PDB: 2zqy_A 3vkv_A* 1llc_A* Back     alignment and structure
>2q1s_A Putative nucleotide sugar epimerase/ dehydratase; rossman fold, protein-NADH complex, sugar binding protein; HET: NAI; 1.50A {Bordetella bronchiseptica} PDB: 2pzj_A* 2q1t_A* 2q1u_A* Back     alignment and structure
>2cvz_A Dehydrogenase, 3-hydroxyisobutyrate dehydrogenase; valine catabolism, NADP+, structural GEN riken structural genomics/proteomics initiative; HET: NDP; 1.80A {Thermus thermophilus} SCOP: a.100.1.1 c.2.1.6 PDB: 1wp4_A* Back     alignment and structure
>2x6t_A ADP-L-glycero-D-manno-heptose-6-epimerase; isomerase, carbohydrate metabolism, stress response; HET: NAP ADP BMA; 2.36A {Escherichia coli} PDB: 2x86_A* Back     alignment and structure
>3ucx_A Short chain dehydrogenase; ssgcid, seattle structural genomics center for infectious DI dehydrogenase, oxidoreductase; HET: 1PE; 1.85A {Mycobacterium smegmatis} SCOP: c.2.1.0 Back     alignment and structure
>4dll_A 2-hydroxy-3-oxopropionate reductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, oxidoreductase; 2.11A {Polaromonas SP} Back     alignment and structure
>3lyl_A 3-oxoacyl-(acyl-carrier-protein) reductase; alpha and beta protein, NAD(P)-binding rossmann fold, csgid, oxidoreductase; 1.95A {Francisella tularensis subsp} SCOP: c.2.1.2 Back     alignment and structure
>2xxj_A L-LDH, L-lactate dehydrogenase; oxidoreductase, hyperthermophIle; HET: NAD; 1.964A {Thermus thermophilus} PDB: 2xxb_A* 3zzn_A* 2v7p_A* 2e37_A* 2v6m_A* 2xxe_A 4a73_A Back     alignment and structure
>1ldn_A L-lactate dehydrogenase; oxidoreductase(CHOH(D)-NAD(A)); HET: FBP NAD; 2.50A {Geobacillus stearothermophilus} SCOP: c.2.1.5 d.162.1.1 PDB: 1ldb_A 2ldb_A* Back     alignment and structure
>3tjr_A Short chain dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, SCD, NAD; HET: UNL; 1.60A {Mycobacterium avium subsp} Back     alignment and structure
>4da9_A Short-chain dehydrogenase/reductase; structural genomics, protein structure initiative, PSI-biology; 2.50A {Sinorhizobium meliloti} Back     alignment and structure
>2d4a_B Malate dehydrogenase; archaea, hyperthermophIle, oxidoreductase; 2.87A {Aeropyrum pernix} Back     alignment and structure
>2x0j_A Malate dehydrogenase; oxidoreductase, hyperthermophilic, tricarboxylic acid cycle; HET: ENA; 2.79A {Archaeoglobus fulgidus dsm 4304} PDB: 2x0i_A* Back     alignment and structure
>3r6d_A NAD-dependent epimerase/dehydratase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, veillo parvula; HET: MLZ; 1.25A {Veillonella parvula dsm 2008} PDB: 4hng_A 4hnh_A* 3r14_A* Back     alignment and structure
>2pv7_A T-protein [includes: chorismate mutase (EC 5.4.99 and prephenate dehydrogenase (EC...; 1574749, chorismate mutase type II; HET: MSE TYR NAD; 2.00A {Haemophilus influenzae} SCOP: a.100.1.12 c.2.1.6 Back     alignment and structure
>3pk0_A Short-chain dehydrogenase/reductase SDR; ssgcid, structural genomics, seattle structural genomics CEN infectious disease; 1.75A {Mycobacterium smegmatis} SCOP: c.2.1.0 Back     alignment and structure
>2rcy_A Pyrroline carboxylate reductase; malaria, structural genomics, pyrroline reductase, oxidoredu structural genomics consortium, SGC; HET: NAP; 2.30A {Plasmodium falciparum} Back     alignment and structure
>3ehe_A UDP-glucose 4-epimerase (GALE-1); PSI-II, NYSGXRC, ST genomics, protein structure initiative, NEW YORK SGX resear for structural genomics; HET: NAD; 1.87A {Archaeoglobus fulgidus} SCOP: c.2.1.0 Back     alignment and structure
>3c24_A Putative oxidoreductase; YP_511008.1, structural genomics, center for structural genomics, JCSG, protein structure INI PSI-2; HET: MSE; 1.62A {Jannaschia SP} Back     alignment and structure
>3u62_A Shikimate dehydrogenase; shikimate pathway, oxidoreductase; 1.45A {Thermotoga maritima} Back     alignment and structure
>1pjc_A Protein (L-alanine dehydrogenase); oxidoreductase, NAD; HET: NAD; 2.00A {Phormidium lapideum} SCOP: c.2.1.4 c.23.12.2 PDB: 1pjb_A* 1say_A Back     alignment and structure
>3gvx_A Glycerate dehydrogenase related protein; NYSGXRC, PSI-II, 11143J, structural genomics, protein structure initiative; 2.20A {Thermoplasma acidophilum} Back     alignment and structure
>3e48_A Putative nucleoside-diphosphate-sugar epimerase; alpha-beta protein., structural genomics, PSI-2, protein STR initiative; 1.60A {Staphylococcus aureus subsp} Back     alignment and structure
>3t4x_A Oxidoreductase, short chain dehydrogenase/reducta; structural genomics, center for structural genomics of infec diseases, csgid; 2.80A {Bacillus anthracis} Back     alignment and structure
>1zcj_A Peroxisomal bifunctional enzyme; peroxisomal multifunctional enzyme type 1, L-bifunction enzyme, MFE-1, fatty acid beta oxidation; 1.90A {Rattus norvegicus} Back     alignment and structure
>4ibo_A Gluconate dehydrogenase; enzyme function initiative structural genomics, oxidoreductase; 2.10A {Agrobacterium fabrum} Back     alignment and structure
>1oju_A MDH, malate dehydrogenase; hyperthermophilic, oxidoreductase; HET: ENA; 2.79A {Archaeoglobus fulgidus} PDB: 1ojs_A* 2x0i_A* 2x0j_A* Back     alignment and structure
>3ngx_A Bifunctional protein fold; methylenetetrahydrofolate dehydrogenase/cyclohydrolase; 2.30A {Thermoplasma acidophilum} PDB: 3ngl_A Back     alignment and structure
>1guz_A Malate dehydrogenase; oxidoreductase, tricarboxylic acid cycle, NAD; HET: NAD; 2.0A {Chlorobium vibrioforme} SCOP: c.2.1.5 d.162.1.1 PDB: 1gv1_A 1gv0_A* Back     alignment and structure
>3st7_A Capsular polysaccharide synthesis enzyme CAP5F; rossmann fold, cupid domain, short-chain dehydrogenase/reduc NADPH; 2.45A {Staphylococcus aureus} PDB: 2zkl_A 3vhr_A Back     alignment and structure
>1t2d_A LDH-P, L-lactate dehydrogenase; ternary complex, oxidoreductase; HET: NAD; 1.10A {Plasmodium falciparum} SCOP: c.2.1.5 d.162.1.1 PDB: 1t25_A* 1t26_A* 1t2c_A* 1t24_A* 2x8l_A 2ydn_A* 2a94_A* 1u4s_A* 1u5a_A* 1u5c_A* 1u4o_A* 1t2e_A* 1xiv_A* 1ceq_A 1ldg_A* 1cet_A* 1oc4_A* 2a92_A* 2aa3_A* Back     alignment and structure
>2a9f_A Putative malic enzyme ((S)-malate:NAD+ oxidoreductase (decarboxylating)); hypothetical protein, structural genomics, PSI; 2.50A {Streptococcus pyogenes} Back     alignment and structure
>3fbt_A Chorismate mutase and shikimate 5-dehydrogenase fusion protein; structural genomics, oxidoreductase, amino-acid biosynthesis; 2.10A {Clostridium acetobutylicum} Back     alignment and structure
>1x7d_A Ornithine cyclodeaminase; binds NAD+, binds L-ornithine, binds L-proline, 2 bundle, beta barrel, rossmann fold, lyase; HET: NAD ORN MES; 1.60A {Pseudomonas putida} SCOP: c.2.1.13 PDB: 1u7h_A* Back     alignment and structure
>2z1m_A GDP-D-mannose dehydratase; short-chain dehydrogenase/reductase, lyase, structural genom NPPSFA; HET: NDP GDP; 2.00A {Aquifex aeolicus} PDB: 2z95_A* Back     alignment and structure
>2x4g_A Nucleoside-diphosphate-sugar epimerase; isomerase; 2.65A {Pseudomonas aeruginosa} Back     alignment and structure
>4gx0_A TRKA domain protein; membrane protein, ION channel, ADP binding, NAD binding, MEM transport protein; HET: MAL GLC; 2.60A {Geobacter sulfurreducens} PDB: 4gx1_A* 4gx2_A* 4gx5_A 4gvl_A* Back     alignment and structure
>1p9l_A Dihydrodipicolinate reductase; oxidoreductase, lysine biosynthesis, NADH binding specificity, TB structural genomics consortium; HET: NAD PDC PG4; 2.30A {Mycobacterium tuberculosis} SCOP: c.2.1.3 d.81.1.3 PDB: 1c3v_A* 1yl5_A 1yl7_A* 1yl6_A* Back     alignment and structure
>2vhw_A Alanine dehydrogenase; NAD, secreted, oxidoreductase; HET: NAI; 2.0A {Mycobacterium tuberculosis} PDB: 2vhx_A* 2vhy_A 2vhz_A* 2vhv_A* 2voe_A 2voj_A* Back     alignment and structure
>3qlj_A Short chain dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, tuberculosis; 1.80A {Mycobacterium avium} Back     alignment and structure
>1a4i_A Methylenetetrahydrofolate dehydrogenase / methenyltetrahydrofolate cyclohydrolase...; THF, bifunctional, oxidoreductase; HET: NDP; 1.50A {Homo sapiens} SCOP: c.2.1.7 c.58.1.2 PDB: 1dia_A* 1dib_A* 1dig_A* Back     alignment and structure
>1dih_A Dihydrodipicolinate reductase; oxidoreductase; HET: NDP; 2.20A {Escherichia coli} SCOP: c.2.1.3 d.81.1.3 PDB: 1arz_A* 1dru_A* 1drv_A* 1drw_A* Back     alignment and structure
>3tfo_A Putative 3-oxoacyl-(acyl-carrier-protein) reducta; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.08A {Sinorhizobium meliloti} Back     alignment and structure
>4huj_A Uncharacterized protein; PSI-biology, nysgrc, structural genomics, NEW YORK structura genomics research consortium, dinucleotide-binding; 1.77A {Sinorhizobium meliloti} Back     alignment and structure
>2zyd_A 6-phosphogluconate dehydrogenase, decarboxylating; NADP, pentose phosphate pathway, oxidoreductase, 6-phosphogl dehydrogenase; HET: GLO; 1.50A {Escherichia coli} PDB: 2zya_A* 3fwn_A* 2zyg_A 2w8z_A* 2w90_A* Back     alignment and structure
>2c5a_A GDP-mannose-3', 5'-epimerase; short chain dehydratase/reductase, GDP-gulose, GDP-galactose, keto intermediate, vitamin C, SDR; HET: GDC NAD BTB; 1.4A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 2c59_A* 2c54_A* 2c5e_A* Back     alignment and structure
>3uve_A Carveol dehydrogenase ((+)-trans-carveol dehydrog; ssgcid, structural genomics, seattle structural genomics CEN infectious disease; HET: NAD PG4; 1.55A {Mycobacterium avium} SCOP: c.2.1.0 PDB: 3uwr_A* Back     alignment and structure
>2axq_A Saccharopine dehydrogenase; rossmann fold variant, saccharopine reductase fold (domain II), alpha/beta protein; 1.70A {Saccharomyces cerevisiae} Back     alignment and structure
>3tox_A Short chain dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, oxidoreductase; HET: NAP; 1.93A {Sinorhizobium meliloti} Back     alignment and structure
>1ez4_A Lactate dehydrogenase; rossmann fold, oxidoreductase; HET: NAD; 2.30A {Lactobacillus pentosus} SCOP: c.2.1.5 d.162.1.1 Back     alignment and structure
>3qha_A Putative oxidoreductase; seattle structural genomics center for infectious disease, S mycobacterium avium 104, rossmann fold; 2.25A {Mycobacterium avium} Back     alignment and structure
>3pgx_A Carveol dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: NAD; 1.85A {Mycobacterium avium} SCOP: c.2.1.0 Back     alignment and structure
>1rkx_A CDP-glucose-4,6-dehydratase; SDR, lyase; HET: NAD; 1.80A {Yersinia pseudotuberculosis} SCOP: c.2.1.2 PDB: 1wvg_A* Back     alignment and structure
>3tsc_A Putative oxidoreductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, nucleotide; HET: NAD; 2.05A {Mycobacterium avium subsp} SCOP: c.2.1.0 Back     alignment and structure
>2q1w_A Putative nucleotide sugar epimerase/ dehydratase; rossman fold, protein-NAD complex, sugar binding protein; HET: NAD; 2.19A {Bordetella bronchiseptica} Back     alignment and structure
>3i6i_A Putative leucoanthocyanidin reductase 1; rossmann fold, short chain dehydrogenase reductase, flavonoi oxidoreductase; HET: NDP; 1.75A {Vitis vinifera} PDB: 3i5m_A 3i52_A* 3i6q_A* Back     alignment and structure
>3v2h_A D-beta-hydroxybutyrate dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 3.00A {Sinorhizobium meliloti} Back     alignment and structure
>3r1i_A Short-chain type dehydrogenase/reductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; 1.95A {Mycobacterium marinum} Back     alignment and structure
>2ywl_A Thioredoxin reductase related protein; uncharacterized conserved protein, rossmann fold, structural genomics, NPPSFA; HET: FAD; 1.60A {Thermus thermophilus} PDB: 2cvj_A* Back     alignment and structure
>4imr_A 3-oxoacyl-(acyl-carrier-protein) reductase; oxidoreductase, nicotinamide adenine dinucleotide phosphate, structural genomics; HET: NAP; 1.96A {Agrobacterium fabrum} Back     alignment and structure
>3nyw_A Putative oxidoreductase; fatty acid synthesis,3-oxoacyl-[ACP] reductase, NADP+ bindin rossman fold, PSI-II, nysgxrc; 2.16A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2zat_A Dehydrogenase/reductase SDR family member 4; alpha/beta, oxidoreductase; HET: NAP; 1.50A {Sus scrofa} PDB: 3o4r_A* Back     alignment and structure
>2ae2_A Protein (tropinone reductase-II); oxidoreductase, tropane alkaloid biosynthesis, reduction of tropinone to pseudotropine; HET: NAP PTO; 1.90A {Datura stramonium} SCOP: c.2.1.2 PDB: 2ae1_A* 1ipe_A* 1ipf_A* Back     alignment and structure
>4fgs_A Probable dehydrogenase protein; PSI-biology, nysgrc, structural genomics, NEW YORK structura genomics research consortium, three layer; 1.76A {Rhizobium etli} Back     alignment and structure
>3g0o_A 3-hydroxyisobutyrate dehydrogenase; NAD(P), valine catabolism, tartaric acid, target 11128H, NYSGXRC, PSI-2, structural genomics; HET: TLA; 1.80A {Salmonella typhimurium} Back     alignment and structure
>4hb9_A Similarities with probable monooxygenase; flavin, structural genomics, NEW YORK structural genomics RE consortium, nysgrc, PSI; HET: MSE FAD; 1.93A {Photorhabdus luminescens} Back     alignment and structure
>4fn4_A Short chain dehydrogenase; NADH-binding, rossmann fold, oxidoreductase; HET: NAD; 1.75A {Sulfolobus acidocaldarius} Back     alignment and structure
>4a26_A Putative C-1-tetrahydrofolate synthase, cytoplasm; oxidoreductase, hydrolase, leishmaniasis; 2.70A {Leishmania major} Back     alignment and structure
>4fs3_A Enoyl-[acyl-carrier-protein] reductase [NADPH] FA; rossmann fold, short chain dehydrogenase, NADPH binding, oxidoreductase; HET: 0WD 0WE; 1.80A {Staphylococcus aureus subsp} PDB: 3gr6_A* 3gns_A* 4all_A* 3gnt_A 4alk_A* 4alj_A* 4ali_A* 4alm_A 4aln_A Back     alignment and structure
>3enk_A UDP-glucose 4-epimerase; seattle structural genomics center for infectious disease, ssgcid, isomerase, NAD; HET: NAD GUD; 1.90A {Burkholderia pseudomallei 1710B} SCOP: c.2.1.0 Back     alignment and structure
>3ko8_A NAD-dependent epimerase/dehydratase; isomerase, UDP-galactose 4-epimerase; HET: NAD; 1.80A {Pyrobaculum calidifontis} SCOP: c.2.1.0 PDB: 3icp_A* 3aw9_A* Back     alignment and structure
>2zyd_A 6-phosphogluconate dehydrogenase, decarboxylating; NADP, pentose phosphate pathway, oxidoreductase, 6-phosphogl dehydrogenase; HET: GLO; 1.50A {Escherichia coli} PDB: 2zya_A* 3fwn_A* 2zyg_A 2w8z_A* 2w90_A* Back     alignment and structure
>3qy9_A DHPR, dihydrodipicolinate reductase; rossmann fold, NADH, NADPH, oxidoreductase; 1.80A {Staphylococcus aureus} Back     alignment and structure
>3v2g_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, PSI-biology, protein structure initiati nysgrc; 2.30A {Sinorhizobium meliloti} Back     alignment and structure
>4gx0_A TRKA domain protein; membrane protein, ION channel, ADP binding, NAD binding, MEM transport protein; HET: MAL GLC; 2.60A {Geobacter sulfurreducens} PDB: 4gx1_A* 4gx2_A* 4gx5_A 4gvl_A* Back     alignment and structure
>2yq5_A D-isomer specific 2-hydroxyacid dehydrogenase; oxidoreductase; HET: NAD; 2.75A {Lactobacillus delbrueckii subsp} PDB: 2yq4_A* Back     alignment and structure
>1ur5_A Malate dehydrogenase; oxidoreductase, tricarboxylic acid cycle; HET: NAD; 1.75A {Chloroflexus aurantiacus} SCOP: c.2.1.5 d.162.1.1 PDB: 1uxg_A* 1guy_A* 1uxk_A* 1uxh_A* 1uxj_A* 1uxi_A* Back     alignment and structure
>1vkn_A N-acetyl-gamma-glutamyl-phosphate reductase; TM1782, structu genomics, JCSG, PSI, protein structure initiative, joint CE structural genomics; 1.80A {Thermotoga maritima} SCOP: c.2.1.3 d.81.1.1 Back     alignment and structure
>3o38_A Short chain dehydrogenase; tuberculosis, ortholog from A non-pathogenic dehydrogenase, structural genomics; 1.95A {Mycobacterium smegmatis} Back     alignment and structure
>1vl6_A Malate oxidoreductase; TM0542, NAD-dependent malic enzyme, structural genomics, JCS protein structure initiative, PSI; 2.61A {Thermotoga maritima} SCOP: c.2.1.7 c.58.1.3 PDB: 2hae_A* Back     alignment and structure
>1rkx_A CDP-glucose-4,6-dehydratase; SDR, lyase; HET: NAD; 1.80A {Yersinia pseudotuberculosis} SCOP: c.2.1.2 PDB: 1wvg_A* Back     alignment and structure
>3p2o_A Bifunctional protein fold; structural genomics, center for structural genomics of infec diseases, csgid, alpha-beta-alpha sandwich; HET: NAD; 2.23A {Campylobacter jejuni subsp} Back     alignment and structure
>4egf_A L-xylulose reductase; structural genomics, ssgcid, seattle structural genomics CEN infectious disease, oxidoreductase; 2.30A {Mycobacterium smegmatis} Back     alignment and structure
>3ksu_A 3-oxoacyl-acyl carrier protein reductase; structural genomics, PSI-2, dehydrogenase, protein structure initiative; 2.30A {Oenococcus oeni psu-1} Back     alignment and structure
>2c5a_A GDP-mannose-3', 5'-epimerase; short chain dehydratase/reductase, GDP-gulose, GDP-galactose, keto intermediate, vitamin C, SDR; HET: GDC NAD BTB; 1.4A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 2c59_A* 2c54_A* 2c5e_A* Back     alignment and structure
>4iin_A 3-ketoacyl-acyl carrier protein reductase (FABG); structural genomics, center for structural genomics of infec diseases, csgid; HET: NAD; 2.40A {Helicobacter pylori} PDB: 4ijk_A Back     alignment and structure
>4f6c_A AUSA reductase domain protein; thioester reductase, oxidoreductase; 2.81A {Staphylococcus aureus} Back     alignment and structure
>1gee_A Glucose 1-dehydrogenase; short-chain dehydrogenase/reductase, oxidoreductase; HET: NAD; 1.60A {Bacillus megaterium} SCOP: c.2.1.2 PDB: 1rwb_A* 1gco_A* 1g6k_A* 3aus_A 3aut_A* 3auu_A* Back     alignment and structure
>1i36_A Conserved hypothetical protein MTH1747; NADP binding domain, protein NADP complex, structural genomics, PSI; HET: NAP; 2.00A {Methanothermobacterthermautotrophicus} SCOP: a.100.1.8 c.2.1.6 Back     alignment and structure
>1xg5_A ARPG836; short chain dehydrogenase, human, SGC, structural genomics, structural genomics consortium, oxidoreductase; HET: NAP; 1.53A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>3i83_A 2-dehydropantoate 2-reductase; structural genomics, oxidoreductase, NADP, pantothenate BIOS PSI-2, protein structure initiative; 1.90A {Methylococcus capsulatus} Back     alignment and structure
>3d0o_A L-LDH 1, L-lactate dehydrogenase 1; cytoplasm, glycolysis, NAD, oxidoreductase, phosphoprotein; 1.80A {Staphylococcus aureus} PDB: 3d4p_A* 3h3j_A* Back     alignment and structure
>2jah_A Clavulanic acid dehydrogenase; short-chain dehydrogenase/reductase, lactamase inhibitor, AN biosynthesis, NADPH, oxidoreductase; HET: MSE NDP; 1.80A {Streptomyces clavuligerus} PDB: 2jap_A* Back     alignment and structure
>1orr_A CDP-tyvelose-2-epimerase; rossmann fold, short-chain dehydrogenase/reductase, isomeras; HET: NAD CDP; 1.50A {Salmonella typhi} SCOP: c.2.1.2 Back     alignment and structure
>3hn2_A 2-dehydropantoate 2-reductase; PSI-2, NYSGXRC, structural GE protein structure initiative; 2.50A {Geobacter metallireducens} Back     alignment and structure
>1fmc_A 7 alpha-hydroxysteroid dehydrogenase; short-chain dehydrogenase/reductase, bIle acid catabolism, oxidoreductase; HET: CHO NAD; 1.80A {Escherichia coli} SCOP: c.2.1.2 PDB: 1ahi_A* 1ahh_A* Back     alignment and structure
>1b0a_A Protein (fold bifunctional protein); folate, dehydrogenase, cyclcohydrolase, channeling, oxidoreductase,hydrolase; 2.56A {Escherichia coli K12} SCOP: c.2.1.7 c.58.1.2 Back     alignment and structure
>2i99_A MU-crystallin homolog; thyroid hormine binding protein, oxidoreductase; HET: NDP; 2.60A {Homo sapiens} Back     alignment and structure
>4fc7_A Peroxisomal 2,4-dienoyl-COA reductase; SDR/rossmann fold, peroxisomal beta-oxidation, oxidoreductas; HET: NAP COA; 1.84A {Homo sapiens} PDB: 4fc6_A* Back     alignment and structure
>1y6j_A L-lactate dehydrogenase; southeast collaboratory for structural genomics, secsg, protein struc initiative, PSI, oxidoreductase; 3.01A {Clostridium thermocellum} SCOP: c.2.1.5 d.162.1.1 Back     alignment and structure
>4gwg_A 6-phosphogluconate dehydrogenase, decarboxylating; 6-phosphoglyconate dehydrogenase, NADP, oxido; HET: MES; 1.39A {Homo sapiens} PDB: 4gwk_A* 2jkv_A* 2pgd_A 1pgo_A* 1pgp_A* 1pgq_A* 1pgn_A Back     alignment and structure
>1pzg_A LDH, lactate dehydrogenase; apicomplexa, APAD, tetramer, rossmann fold, oxidoreductase; HET: CME A3D; 1.60A {Toxoplasma gondii} SCOP: c.2.1.5 d.162.1.1 PDB: 1pzf_A* 1pze_A* 1pzh_A* 3om9_A* 1sov_A 1sow_A* 3czm_A* Back     alignment and structure
>3lf2_A Short chain oxidoreductase Q9HYA2; SDR, SCOR, rossmann fold; HET: NAP; 2.30A {Pseudomonas aeruginosa} PDB: 3lf1_A* Back     alignment and structure
>3ftp_A 3-oxoacyl-[acyl-carrier protein] reductase; ssgcid, 3-ketoacyl-(acyl-carrier- protein) reductase, oxidoreductase, structural genomics; 2.05A {Burkholderia pseudomallei} Back     alignment and structure
>1oaa_A Sepiapterin reductase; tetrahydrobiopterin, oxidoreductase; HET: NAP; 1.25A {Mus musculus} SCOP: c.2.1.2 PDB: 1nas_A* 1sep_A* 1z6z_A* Back     alignment and structure
>2izz_A Pyrroline-5-carboxylate reductase 1; amino-acid biosynthesis, NADP, oxidoreductase, proline biosy; HET: NAD; 1.95A {Homo sapiens} PDB: 2ger_A 2gr9_A* 2gra_A* Back     alignment and structure
>3ego_A Probable 2-dehydropantoate 2-reductase; structural genomics, PANE, unknown function, cytoplasm, NADP, oxidoreductase; 1.90A {Bacillus subtilis} Back     alignment and structure
>3ew7_A LMO0794 protein; Q8Y8U8_lismo, putative NAD-dependent epimerase/dehydratase, LMR162, NESG, structural genomics, PSI-2; 2.73A {Listeria monocytogenes} Back     alignment and structure
>1omo_A Alanine dehydrogenase; two-domain, beta-sandwich-dimer, rossmann-fold NAD domain, human MU crystallin homolog; HET: NAD; 2.32A {Archaeoglobus fulgidus} SCOP: c.2.1.13 PDB: 1vll_A Back     alignment and structure
>3v8b_A Putative dehydrogenase, possibly 3-oxoacyl-[acyl- protein] reductase; PSI-biology, structural genomics, protein structure initiati nysgrc; 2.70A {Sinorhizobium meliloti} Back     alignment and structure
>3phh_A Shikimate dehydrogenase; shikimate pathway, helicobacter PYL oxidoreductase, alpha/beta domain, rossmann fold; HET: SKM; 1.42A {Helicobacter pylori} PDB: 3phg_A* 3phi_A* 3phj_A* 4foo_A 4fpx_A 4fos_A* 4fr5_A* 4fq8_A* Back     alignment and structure
>2ydy_A Methionine adenosyltransferase 2 subunit beta; oxidoreductase; 2.25A {Homo sapiens} PDB: 2ydx_A Back     alignment and structure
>3l77_A Short-chain alcohol dehydrogenase; oxidoreductase; HET: NJP PG4; 1.60A {Thermococcus sibiricus} SCOP: c.2.1.0 PDB: 3tn7_A* Back     alignment and structure
>2eez_A Alanine dehydrogenase; TTHA0216, structural genomic NPPSFA, national project on protein structural and function analyses; 2.71A {Thermus thermophilus} Back     alignment and structure
>3doj_A AT3G25530, dehydrogenase-like protein; gamma-hydroxybutyrate dehydrogenase, 4-hydroxybutyrate dehydrogenase; 2.10A {Arabidopsis thaliana} Back     alignment and structure
>3kkj_A Amine oxidase, flavin-containing; oxidoreductase, PSR10, Q888A4, X-RAY, structure, PSI, protein structure initiative; HET: FAD; 2.50A {Pseudomonas syringae PV} Back     alignment and structure
>3hn2_A 2-dehydropantoate 2-reductase; PSI-2, NYSGXRC, structural GE protein structure initiative; 2.50A {Geobacter metallireducens} Back     alignment and structure
>3afn_B Carbonyl reductase; alpha/beta/alpha, rossmann-fold, oxidoreductase; HET: NAP; 1.63A {Sphingomonas SP} PDB: 3afm_A* Back     alignment and structure
>2rcy_A Pyrroline carboxylate reductase; malaria, structural genomics, pyrroline reductase, oxidoredu structural genomics consortium, SGC; HET: NAP; 2.30A {Plasmodium falciparum} Back     alignment and structure
>1jay_A Coenzyme F420H2:NADP+ oxidoreductase (FNO); rossman fold, structural genomics; HET: NAP F42; 1.65A {Archaeoglobus fulgidus} SCOP: c.2.1.6 PDB: 1jax_A* Back     alignment and structure
>3l07_A Bifunctional protein fold; structural genomics, IDP01849, methylenetetrahydrofolate dehydrogenase; 1.88A {Francisella tularensis} Back     alignment and structure
>1yxm_A Pecra, peroxisomal trans 2-enoyl COA reductase; perioxisomes, fatty acid synthesis, short-chain dehydrogenases/reductases, structural genomics; HET: ADE; 1.90A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>4f3y_A DHPR, dihydrodipicolinate reductase; structural genomics, niaid, national institute of allergy AN infectious diseases; 2.10A {Burkholderia thailandensis} Back     alignment and structure
>3hwr_A 2-dehydropantoate 2-reductase; YP_299159.1, PANE/APBA family ketopantoate reductase, struct genomics, joint center for structural genomics; HET: NDP BCN; 2.15A {Ralstonia eutropha} Back     alignment and structure
>2zqz_A L-LDH, L-lactate dehydrogenase; oxidoreductase, rossmann fold, cytoplasm, glycolysis, NAD, phosphoprotein; 2.50A {Lactobacillus casei} PDB: 2zqy_A 3vkv_A* 1llc_A* Back     alignment and structure
>2xxj_A L-LDH, L-lactate dehydrogenase; oxidoreductase, hyperthermophIle; HET: NAD; 1.964A {Thermus thermophilus} PDB: 2xxb_A* 3zzn_A* 2v7p_A* 2e37_A* 2v6m_A* 2xxe_A 4a73_A Back     alignment and structure
>2iz1_A 6-phosphogluconate dehydrogenase, decarboxylating; pentose shunt, oxidoreductase, gluconate utilization; HET: ATR RES P33; 2.30A {Lactococcus lactis} PDB: 2iz0_A* 2iyp_A* 2iyo_A* Back     alignment and structure
>3b1f_A Putative prephenate dehydrogenase; enzyme, 4-hydroxyphenylpyruvate, oxidative decarboxylation pathway, tyrosine biosynthesis, oxidoreduct; HET: NAD; 2.10A {Streptococcus mutans} PDB: 3dzb_A Back     alignment and structure
>3eag_A UDP-N-acetylmuramate:L-alanyl-gamma-D-glutamyl-ME diaminopimelate ligase; UDP-N-acetylmuramate:L-alanyl-G glutamyl-MESO-diaminopimelate ligase; 2.55A {Neisseria meningitidis MC58} Back     alignment and structure
>1iy8_A Levodione reductase; oxidoreductase; HET: NAD; 1.60A {Leifsonia aquatica} SCOP: c.2.1.2 Back     alignment and structure
>4iiu_A 3-oxoacyl-[acyl-carrier protein] reductase; structural genomics, center for structural genomics of infec diseases, csgid; HET: NAP; 2.10A {Escherichia coli} PDB: 4iiv_A* Back     alignment and structure
>2a9f_A Putative malic enzyme ((S)-malate:NAD+ oxidoreductase (decarboxylating)); hypothetical protein, structural genomics, PSI; 2.50A {Streptococcus pyogenes} Back     alignment and structure
>1sby_A Alcohol dehydrogenase; ternary complex, NAD, trifluoroethanol, oxidoreductase; HET: NAD; 1.10A {Scaptodrosophila lebanonensis} SCOP: c.2.1.2 PDB: 1b14_A* 1b15_A* 1a4u_A* 1b2l_A* 1b16_A* 3rj5_A* 3rj9_A* 1mg5_A* Back     alignment and structure
>3imf_A Short chain dehydrogenase; structural genomics, infectious D center for structural genomics of infectious diseases, oxidoreductase, csgid; HET: MSE; 1.99A {Bacillus anthracis str} Back     alignment and structure
>2ydy_A Methionine adenosyltransferase 2 subunit beta; oxidoreductase; 2.25A {Homo sapiens} PDB: 2ydx_A Back     alignment and structure
>2qyt_A 2-dehydropantoate 2-reductase; APC81190, porphyromonas gingi W83, structural genomics, PSI-2; HET: MSE; 2.15A {Porphyromonas gingivalis} Back     alignment and structure
>3u62_A Shikimate dehydrogenase; shikimate pathway, oxidoreductase; 1.45A {Thermotoga maritima} Back     alignment and structure
>2dvm_A Malic enzyme, 439AA long hypothetical malate oxidoreductase; NAD, structural genomics, NPPSFA; HET: NAD MES; 1.60A {Pyrococcus horikoshii} PDB: 1ww8_A* Back     alignment and structure
>3gvx_A Glycerate dehydrogenase related protein; NYSGXRC, PSI-II, 11143J, structural genomics, protein structure initiative; 2.20A {Thermoplasma acidophilum} Back     alignment and structure
>3dtt_A NADP oxidoreductase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: NAP; 1.70A {Arthrobacter SP} Back     alignment and structure
>3e48_A Putative nucleoside-diphosphate-sugar epimerase; alpha-beta protein., structural genomics, PSI-2, protein STR initiative; 1.60A {Staphylococcus aureus subsp} Back     alignment and structure
>3u9l_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.10A {Sinorhizobium meliloti} Back     alignment and structure
>2gdz_A NAD+-dependent 15-hydroxyprostaglandin dehydrogen; dehydrogenase, structural genomics, SH dehydrogenase/reductase, inflammation; HET: NAD; 1.65A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>2iz1_A 6-phosphogluconate dehydrogenase, decarboxylating; pentose shunt, oxidoreductase, gluconate utilization; HET: ATR RES P33; 2.30A {Lactococcus lactis} PDB: 2iz0_A* 2iyp_A* 2iyo_A* Back     alignment and structure
>3fef_A Putative glucosidase LPLD; gulosidase, structural genomics, unknown function, glycosidase, hydrolase, manganese, metal-binding, NAD, PSI- 2; 2.20A {Bacillus subtilis} Back     alignment and structure
>1omo_A Alanine dehydrogenase; two-domain, beta-sandwich-dimer, rossmann-fold NAD domain, human MU crystallin homolog; HET: NAD; 2.32A {Archaeoglobus fulgidus} SCOP: c.2.1.13 PDB: 1vll_A Back     alignment and structure
>1nyt_A Shikimate 5-dehydrogenase; alpha/beta domains, WIDE cleft separation, oxidoreductase; HET: NAP; 1.50A {Escherichia coli} SCOP: c.2.1.7 c.58.1.5 Back     alignment and structure
>3k6j_A Protein F01G10.3, confirmed by transcript evidenc; rossmann fold, oxidoreductase; 2.20A {Caenorhabditis elegans} Back     alignment and structure
>3sc6_A DTDP-4-dehydrorhamnose reductase; RFBD, structural genomics, infectious diseases, bacillus anthracis STR. AMES, rhamnose biosynthetic pathway; HET: NAP; 2.65A {Bacillus anthracis} SCOP: c.2.1.0 Back     alignment and structure
>2hrz_A AGR_C_4963P, nucleoside-diphosphate-sugar epimerase; agrobacterium tumefa structural genomics, PSI-2, protein structure initiative; 1.85A {Agrobacterium tumefaciens} Back     alignment and structure
>2jl1_A Triphenylmethane reductase; oxidoreductase, bioremediation; HET: NAP GOL; 1.96A {Citrobacter SP} PDB: 2vrb_A* 2vrc_A 2vrc_D Back     alignment and structure
>4aj2_A L-lactate dehydrogenase A chain; oxidoreductase-inhibitor complex, fragment-based LEAD genera inhibitors; HET: 52C; 1.75A {Rattus norvegicus} PDB: 4aj1_A* 4aje_A* 4ajh_A* 4aji_A* 4ajj_A* 4ajk_A* 4ajl_A* 4ajn_A* 4ajo_A* 4al4_A* 4aj4_A* 4ajp_A* 1i10_A* 3h3f_A* 9ldt_A* 9ldb_A* 1t2f_A* 1i0z_A* 5ldh_A* 1ldm_A* ... Back     alignment and structure
>1z7e_A Protein aRNA; rossmann fold, OB-like fold, hydrolase; HET: ATP UGA; 3.00A {Escherichia coli} SCOP: b.46.1.1 c.2.1.2 c.65.1.1 Back     alignment and structure
>1zem_A Xylitol dehydrogenase; rossmann fold, dinucleotide-binding domain, oxidoreductase; HET: NAD; 1.90A {Gluconobacter oxydans} SCOP: c.2.1.2 Back     alignment and structure
>1npy_A Hypothetical shikimate 5-dehydrogenase-like protein HI0607; structural genomics, PSI, protein structure initiative; 1.75A {Haemophilus influenzae} SCOP: c.2.1.7 c.58.1.5 Back     alignment and structure
>1o0s_A NAD-ME, NAD-dependent malic enzyme; oxidoreductase, oxidative decarboxylase, rossmann fold, MAla dehydrogenase; HET: NAI; 2.00A {Ascaris suum} SCOP: c.2.1.7 c.58.1.3 PDB: 1llq_A* Back     alignment and structure
>3i83_A 2-dehydropantoate 2-reductase; structural genomics, oxidoreductase, NADP, pantothenate BIOS PSI-2, protein structure initiative; 1.90A {Methylococcus capsulatus} Back     alignment and structure
>2q1w_A Putative nucleotide sugar epimerase/ dehydratase; rossman fold, protein-NAD complex, sugar binding protein; HET: NAD; 2.19A {Bordetella bronchiseptica} Back     alignment and structure
>3cky_A 2-hydroxymethyl glutarate dehydrogenase; rossmann fold, two domain enzyme, oxidoreductase; 2.30A {Eubacterium barkeri} Back     alignment and structure
>3pef_A 6-phosphogluconate dehydrogenase, NAD-binding; gamma-hydroxybutyrate dehydrogenase, succinic semialdehyde R geobacter metallireducens; HET: NAP; 2.07A {Geobacter metallireducens} Back     alignment and structure
>1o6z_A MDH, malate dehydrogenase; halophilic, ION-binding, protein-solvent interaction, oxidoreductase; HET: NAD; 1.95A {Haloarcula marismortui} SCOP: c.2.1.5 d.162.1.1 PDB: 1gt2_A* 2x0r_A* 2j5k_A 2j5q_A 2j5r_A 1d3a_A 1hlp_A* 2hlp_A Back     alignment and structure
>2hun_A 336AA long hypothetical DTDP-glucose 4,6-dehydrat; rossmann fold, structural genomics, NPPSFA; HET: NAD; 2.07A {Pyrococcus horikoshii} Back     alignment and structure
>3h2s_A Putative NADH-flavin reductase; Q03B84, NESG, LCR19, structural genomics, PSI-2, protein structure initiative; HET: NDP; 1.78A {Lactobacillus casei atcc 334} Back     alignment and structure
>2qq5_A DHRS1, dehydrogenase/reductase SDR family member 1; short-chain, structura genomics consortium, SGC, oxidoreductase; 1.80A {Homo sapiens} Back     alignment and structure
>1ek6_A UDP-galactose 4-epimerase; short-chain dehydrogenase, galactosemia, isomerase; HET: NAI UPG; 1.50A {Homo sapiens} SCOP: c.2.1.2 PDB: 1ek5_A* 1hzj_A* 1i3k_A* 1i3l_A* 1i3m_A* 1i3n_A* Back     alignment and structure
>4gbj_A 6-phosphogluconate dehydrogenase NAD-binding; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; 2.05A {Dyadobacter fermentans} Back     alignment and structure
>1ff9_A Saccharopine reductase; lysine biosynthesis, alpha-aminoadipate pathway, dehydrogenase, oxidoreductase; 2.00A {Magnaporthe grisea} SCOP: c.2.1.3 d.81.1.2 PDB: 1e5l_A* 1e5q_A Back     alignment and structure
>3un1_A Probable oxidoreductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.45A {Sinorhizobium meliloti} Back     alignment and structure
>4dqv_A Probable peptide synthetase NRP (peptide synthase; GXXGXXG motif, rossmann fold, short chain dehydrogenase/REDU family, reductase; 2.30A {Mycobacterium tuberculosis} Back     alignment and structure
>3ehe_A UDP-glucose 4-epimerase (GALE-1); PSI-II, NYSGXRC, ST genomics, protein structure initiative, NEW YORK SGX resear for structural genomics; HET: NAD; 1.87A {Archaeoglobus fulgidus} SCOP: c.2.1.0 Back     alignment and structure
>1eq2_A ADP-L-glycero-D-mannoheptose 6-epimerase; N-terminal domain rossmann fold, C-terminal mixed alpha/beta domain; HET: NAP ADQ; 2.00A {Escherichia coli} SCOP: c.2.1.2 Back     alignment and structure
>3gt0_A Pyrroline-5-carboxylate reductase; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG; 2.00A {Bacillus cereus atcc 14579} Back     alignment and structure
>1wma_A Carbonyl reductase [NADPH] 1; oxidoreductase; HET: AB3 NDP PE5 P33; 1.24A {Homo sapiens} SCOP: c.2.1.2 PDB: 3bhi_A* 3bhj_A* 3bhm_A* 2pfg_A* 1n5d_A* 2hrb_A* Back     alignment and structure
>3ijp_A DHPR, dihydrodipicolinate reductase; ssgcid, SBRI, decode biostructures, niaid, amino-acid biosynthesis, cytoplasm; HET: NAP; 2.30A {Bartonella henselae} Back     alignment and structure
>1lld_A L-lactate dehydrogenase; oxidoreductase(CHOH (D)-NAD (A)); HET: NAD; 2.00A {Bifidobacterium longum subsp} SCOP: c.2.1.5 d.162.1.1 PDB: 1lth_T* Back     alignment and structure
>3rkr_A Short chain oxidoreductase; rossmann fold; HET: NAP; 2.42A {Uncultured bacterium BIO5} Back     alignment and structure
>1qyd_A Pinoresinol-lariciresinol reductase; NADPH-dependent aromatic alcohol reductases, pcber, PLR, IFR, lignans, isoflavonoids, plant protein; 2.50A {Thuja plicata} SCOP: c.2.1.2 Back     alignment and structure
>1gpj_A Glutamyl-tRNA reductase; tRNA-dependent tetrapyrrole biosynthesis; HET: GMC CIT; 1.95A {Methanopyrus kandleri} SCOP: a.151.1.1 c.2.1.7 d.58.39.1 Back     alignment and structure
>1vl0_A DTDP-4-dehydrorhamnose reductase, RFBD ortholog; structural joint center for structural genomics, JCSG, protein structu initiative; HET: NAI UNL; 2.05A {Clostridium acetobutylicum} SCOP: c.2.1.2 Back     alignment and structure
>2hun_A 336AA long hypothetical DTDP-glucose 4,6-dehydrat; rossmann fold, structural genomics, NPPSFA; HET: NAD; 2.07A {Pyrococcus horikoshii} Back     alignment and structure
>3hhp_A Malate dehydrogenase; MDH, citric acid cycle, TCA cycle, NAD, oxidoreductase, tricarboxylic acid cycle; 1.45A {Escherichia coli k-12} PDB: 2pwz_A 2cmd_A* 1emd_A* 1ib6_A* 1ie3_A* 4e0b_A* Back     alignment and structure
>1txg_A Glycerol-3-phosphate dehydrogenase [NAD(P)+]; oxidoreductase; 1.70A {Archaeoglobus fulgidus} SCOP: a.100.1.6 c.2.1.6 Back     alignment and structure
>1ja9_A 4HNR, 1,3,6,8-tetrahydroxynaphthalene reductase; protein-NADPH-active site inhibitor complex, oxidoreductase, chain dehydrogenase; HET: NDP PYQ; 1.50A {Magnaporthe grisea} SCOP: c.2.1.2 Back     alignment and structure
>4dyv_A Short-chain dehydrogenase/reductase SDR; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 1.80A {Xanthobacter autotrophicus} Back     alignment and structure
>3svt_A Short-chain type dehydrogenase/reductase; ssgcid, seattle structural genomics center for infectious DI oxidoreductase; 2.00A {Mycobacterium ulcerans} Back     alignment and structure
>1gpj_A Glutamyl-tRNA reductase; tRNA-dependent tetrapyrrole biosynthesis; HET: GMC CIT; 1.95A {Methanopyrus kandleri} SCOP: a.151.1.1 c.2.1.7 d.58.39.1 Back     alignment and structure
>2hk9_A Shikimate dehydrogenase; shikimate pathway, drug design, oxidoreductase; HET: ATR SKM NAP; 2.20A {Aquifex aeolicus} PDB: 2hk8_A 2hk7_A Back     alignment and structure
>3kb6_A D-lactate dehydrogenase; oxidoreductase, D-LDH, NAD, structural genomics, NPPSFA, NAT project on protein structural and functional analyses; HET: MSE NAD 1PE; 2.12A {Aquifex aeolicus} Back     alignment and structure
>2i6t_A Ubiquitin-conjugating enzyme E2-like isoform A; L-lactate dehydrogenase, oxidoreductase, ubiquitin-protein L unknown function; 2.10A {Homo sapiens} PDB: 3dl2_A Back     alignment and structure
>1qyc_A Phenylcoumaran benzylic ether reductase PT1; NADPH-dependent aromatic alcohol reductases, pcber, PLR, IFR, lignans, isoflavonoids, plant protein; 2.20A {Pinus taeda} SCOP: c.2.1.2 Back     alignment and structure
>3k96_A Glycerol-3-phosphate dehydrogenase [NAD(P)+]; GPSA, IDP01976, oxidoreductase, phospholipid biosynthesis; HET: EPE; 2.10A {Coxiella burnetii} Back     alignment and structure
>3ado_A Lambda-crystallin; L-gulonate 3-dehydrogenase, structural genomics, riken struc genomics/proteomics initiative, RSGI, acetylation; 1.70A {Oryctolagus cuniculus} PDB: 3adp_A* 3f3s_A* Back     alignment and structure
>1oc2_A DTDP-glucose 4,6-dehydratase; lyase, NADH, rhamnose; HET: TDX NAD; 1.5A {Streptococcus suis} SCOP: c.2.1.2 PDB: 1ker_A* 1ket_A* 1kep_A* Back     alignment and structure
>3rft_A Uronate dehydrogenase; apoenzyme, rossmann fold, NAD binding, oxidoreductase; 1.90A {Agrobacterium tumefaciens} PDB: 3rfv_A* 3rfx_A* Back     alignment and structure
>3osu_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, csgid, center for structural genomics O infectious diseases; 1.90A {Staphylococcus aureus subsp} SCOP: c.2.1.0 PDB: 3sj7_A* Back     alignment and structure
>2hq1_A Glucose/ribitol dehydrogenase; CTH-1438, structural genomics, southeast collaboratory for structural genomics, secsg, PSI; 1.90A {Clostridium thermocellum} Back     alignment and structure
>3ghy_A Ketopantoate reductase protein; oxidoreductase, NAD-binding domain, PSI-2, NYSGXRC, structur genomics, protein structure initiative; 2.00A {Ralstonia solanacearum} Back     alignment and structure
>3mog_A Probable 3-hydroxybutyryl-COA dehydrogenase; structural genomics, PSI, protein structure initiative, NYSG oxidoreductase; 2.20A {Escherichia coli} Back     alignment and structure
>1xq1_A Putative tropinone reducatse; structural genomics, protein structure initiative, CESG, AT1 reductively methylated protein; 2.10A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 2q45_A Back     alignment and structure
>1e6u_A GDP-fucose synthetase; epimerase/reductase, SDR, RED; HET: NAP; 1.45A {Escherichia coli} SCOP: c.2.1.2 PDB: 1e7q_A* 1bsv_A* 1fxs_A* 1gfs_A 1e7s_A* 1bws_A* 1e7r_A* Back     alignment and structure
>3nep_X Malate dehydrogenase; halophIle, molecular adpatation, NAD, oxidoreductase, tricarboxylic acid cycle; 1.55A {Salinibacter ruber} Back     alignment and structure
>2dc1_A L-aspartate dehydrogenase; NAD, oxidoreductase; HET: CIT NAD; 1.90A {Archaeoglobus fulgidus} Back     alignment and structure
>1spx_A Short-chain reductase family member (5L265); parallel beta-sheet of seven strands in the order 3214567; 2.10A {Caenorhabditis elegans} SCOP: c.2.1.2 Back     alignment and structure
>3g17_A Similar to 2-dehydropantoate 2-reductase; structural genomics, putative 2-dehydropantoate 2-reductase, protein structure initiative; 2.30A {Staphylococcus aureus subsp} Back     alignment and structure
>3hdj_A Probable ornithine cyclodeaminase; APC62486, bordetella pertussis TOH structural genomics, PSI-2, protein structure initiative; 1.70A {Bordetella pertussis} Back     alignment and structure
>3jtm_A Formate dehydrogenase, mitochondrial; mitochondrion, NAD, oxidoreductase, T peptide; 1.30A {Arabidopsis thaliana} PDB: 3n7u_A* 3naq_A Back     alignment and structure
>2gas_A Isoflavone reductase; NADPH-dependent reductase, oxidoreductase; 1.60A {Medicago sativa} Back     alignment and structure
>3e03_A Short chain dehydrogenase; structural genomics, PSI-2, protein structure initiative, NEW YORK structural genomix research consortium; 1.69A {Xanthomonas campestris PV} Back     alignment and structure
>2aef_A Calcium-gated potassium channel MTHK; rossmann fold, helix-turn-helix, Ca2+ binding, flexible interface; 1.70A {Methanothermobacterthermautotrophicus} PDB: 2aej_A 2aem_A 3rbx_A 2ogu_A 2fy8_A 3kxd_A Back     alignment and structure
>3c1o_A Eugenol synthase; phenylpropene, PIP reductase, short-chain dehydrogenase/reductase, oxidoreductase; HET: NAP; 1.80A {Clarkia breweri} Back     alignment and structure
>1nyt_A Shikimate 5-dehydrogenase; alpha/beta domains, WIDE cleft separation, oxidoreductase; HET: NAP; 1.50A {Escherichia coli} SCOP: c.2.1.7 c.58.1.5 Back     alignment and structure
>3s55_A Putative short-chain dehydrogenase/reductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: NAD; 2.10A {Mycobacterium abscessus} SCOP: c.2.1.0 Back     alignment and structure
>1pj3_A NAD-dependent malic enzyme, mitochondrial; oxidative decarboxylase, oxidoreductase; HET: NAD; 2.10A {Homo sapiens} SCOP: c.2.1.7 c.58.1.3 PDB: 1pj2_A* 1do8_A* 1pj4_A* 1qr6_A* 1efl_A* 1pjl_A* 1efk_A* 1gz4_A* 1gz3_A* Back     alignment and structure
>2i99_A MU-crystallin homolog; thyroid hormine binding protein, oxidoreductase; HET: NDP; 2.60A {Homo sapiens} Back     alignment and structure
>3s55_A Putative short-chain dehydrogenase/reductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: NAD; 2.10A {Mycobacterium abscessus} SCOP: c.2.1.0 Back     alignment and structure
>1ek6_A UDP-galactose 4-epimerase; short-chain dehydrogenase, galactosemia, isomerase; HET: NAI UPG; 1.50A {Homo sapiens} SCOP: c.2.1.2 PDB: 1ek5_A* 1hzj_A* 1i3k_A* 1i3l_A* 1i3m_A* 1i3n_A* Back     alignment and structure
>3pxx_A Carveol dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, NAD, tuberculosis; HET: NAD; 2.00A {Mycobacterium avium} SCOP: c.2.1.0 Back     alignment and structure
>3qlj_A Short chain dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, tuberculosis; 1.80A {Mycobacterium avium} Back     alignment and structure
>3i1j_A Oxidoreductase, short chain dehydrogenase/reducta; dimer, MIXE beta, structural genomics, PSI-2; 1.90A {Pseudomonas syringae PV} SCOP: c.2.1.0 Back     alignment and structure
>2nwq_A Probable short-chain dehydrogenase; oxidoreductase; 2.30A {Pseudomonas aeruginosa} Back     alignment and structure
>2x9g_A PTR1, pteridine reductase; short chain dehydrogenase, oxidoreductase; HET: NAP LYA; 1.10A {Trypanosoma brucei brucei} PDB: 2x9n_A* 2x9v_A* 3bmc_A* 3bmd_A* 3bme_A* 3bmf_A* 3bmg_A* 3bmh_A* 3bmi_A* 3bmj_A* 3bmk_A* 3bml_A* 3bmm_A* 3bmn_A* 3bmo_A* 3bmq_A* 3bmr_A* 3gn1_A* 3gn2_A* 3jq6_A* ... Back     alignment and structure
>4ej6_A Putative zinc-binding dehydrogenase; structural genomics, nysgrc, PSI-biology, NEW YORK structura genomics research consortium; 1.89A {Sinorhizobium meliloti} PDB: 4ejm_A* Back     alignment and structure
>4a5o_A Bifunctional protein fold; oxidoreductase, hydrolase; 2.20A {Pseudomonas aeruginosa PAO1} Back     alignment and structure
>1gq2_A Malic enzyme; oxidoreductase, pigeon liver, NADP-dependent, NAD-NADP selectivity, decarboxylase, malate, Mn2+; HET: NAP; 2.5A {Columba livia} SCOP: c.2.1.7 c.58.1.3 PDB: 2aw5_A Back     alignment and structure
>3pxx_A Carveol dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, NAD, tuberculosis; HET: NAD; 2.00A {Mycobacterium avium} SCOP: c.2.1.0 Back     alignment and structure
>1z82_A Glycerol-3-phosphate dehydrogenase; TM0378, structural genom joint center for structural genomics, JCSG, protein structu initiative, PSI; HET: MSE NDP G3H G3P; 2.00A {Thermotoga maritima} Back     alignment and structure
>3l6d_A Putative oxidoreductase; structural genomics, protein structure initiative, oxidoredu PSI-2; HET: MSE; 1.90A {Pseudomonas putida} Back     alignment and structure
>2j6i_A Formate dehydrogenase; oxidoreductase, D-specific-2- hydroxy acid dehydrogenase, cofactor regenerator, yeast, CBFDH; HET: PG4; 1.55A {Candida boidinii} PDB: 2fss_A Back     alignment and structure
>3qiv_A Short-chain dehydrogenase or 3-oxoacyl-[acyl-CARR protein] reductase; structural genomics; 2.25A {Mycobacterium avium subsp} Back     alignment and structure
>3oh8_A Nucleoside-diphosphate sugar epimerase (SULA FAMI; DUF1731_C, northeast structural genomics consortium, NESG, C PSI-biology; 2.00A {Corynebacterium glutamicum} Back     alignment and structure
>2c2x_A Methylenetetrahydrofolate dehydrogenase- methenyltetrahydrofolate cyclohydrolase; NADP; 2.0A {Mycobacterium tuberculosis} PDB: 2c2y_A Back     alignment and structure
>3is3_A 17BETA-hydroxysteroid dehydrogenase; short chain dehydrogenase/REDU SDR, fungi, oxidoreductase; HET: GOL; 1.48A {Cochliobolus lunatus} PDB: 3qwf_A* 3qwh_A* 3qwi_A* 3itd_A Back     alignment and structure
>1vpd_A Tartronate semialdehyde reductase; structural genomics, MCSG, protein structure initiative, PSI, midwest center for structural genomics; HET: MSE TLA; 1.65A {Salmonella typhimurium} SCOP: a.100.1.1 c.2.1.6 Back     alignment and structure
>1f0y_A HCDH, L-3-hydroxyacyl-COA dehydrogenase; abortive ternary complex, oxidoreductase; HET: CAA NAD; 1.80A {Homo sapiens} SCOP: a.100.1.3 c.2.1.6 PDB: 3rqs_A 1lsj_A* 1il0_A* 1lso_A* 1m76_A* 1m75_A* 1f14_A 1f12_A 1f17_A* 3had_A* 2hdh_A* 3hdh_A* Back     alignment and structure
>3hg7_A D-isomer specific 2-hydroxyacid dehydrogenase FAM protein; structural genomics; 1.80A {Aeromonas salmonicida subsp} Back     alignment and structure
>4dmm_A 3-oxoacyl-[acyl-carrier-protein] reductase; rossmann fold, oxoacyl-ACP reductase, NADP binding, fatty AC biosynthsis, oxidoreductase; HET: NAP; 2.38A {Synechococcus elongatus} PDB: 4dml_A* Back     alignment and structure
>3k5p_A D-3-phosphoglycerate dehydrogenase; niaid, ssgcid, seattle structural genomics center for infect disease, brucellosis; 2.15A {Brucella melitensis biovar abortus} Back     alignment and structure
>1orr_A CDP-tyvelose-2-epimerase; rossmann fold, short-chain dehydrogenase/reductase, isomeras; HET: NAD CDP; 1.50A {Salmonella typhi} SCOP: c.2.1.2 Back     alignment and structure
>2cul_A Glucose-inhibited division protein A-related PROT probable oxidoreductase; rossmann fold, protein-FAD complex; HET: FAD; 1.65A {Thermus thermophilus} SCOP: c.3.1.7 Back     alignment and structure
>2ejw_A HDH, homoserine dehydrogenase; NAD-dependent, oxidoreductase; 1.70A {Thermus thermophilus} Back     alignment and structure
>3obb_A Probable 3-hydroxyisobutyrate dehydrogenase; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics; HET: EPE; 2.20A {Pseudomonas aeruginosa} PDB: 3q3c_A* Back     alignment and structure
>3sc6_A DTDP-4-dehydrorhamnose reductase; RFBD, structural genomics, infectious diseases, bacillus anthracis STR. AMES, rhamnose biosynthetic pathway; HET: NAP; 2.65A {Bacillus anthracis} SCOP: c.2.1.0 Back     alignment and structure
>1n2s_A DTDP-4-, DTDP-glucose oxidoreductase; rossman-fold, sugar-nucleotide-binding domain; HET: NAD; 2.00A {Salmonella enterica subsp} SCOP: c.2.1.2 PDB: 1kc1_A* 1kc3_A* 1kbz_A* Back     alignment and structure
>1hye_A L-lactate/malate dehydrogenase; nucleotide binding domain, oxidoreductase; HET: NAP; 1.90A {Methanocaldococcus jannaschii} SCOP: c.2.1.5 d.162.1.1 PDB: 1hyg_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 1099
d1yova1529 c.111.1.2 (A:6-534) Amyloid beta precursor protein 3e-59
d1yova1529 c.111.1.2 (A:6-534) Amyloid beta precursor protein 1e-43
d1yova1529 c.111.1.2 (A:6-534) Amyloid beta precursor protein 2e-33
d1yovb1426 c.111.1.2 (B:12-437) UBA3 {Human (Homo sapiens) [T 4e-44
d1yovb1426 c.111.1.2 (B:12-437) UBA3 {Human (Homo sapiens) [T 2e-19
d1yovb1426 c.111.1.2 (B:12-437) UBA3 {Human (Homo sapiens) [T 7e-16
d1jw9b_247 c.111.1.1 (B:) Molybdenum cofactor biosynthesis pr 7e-21
d1jw9b_247 c.111.1.1 (B:) Molybdenum cofactor biosynthesis pr 4e-14
>d1yova1 c.111.1.2 (A:6-534) Amyloid beta precursor protein-binding protein 1, APPBP1 {Human (Homo sapiens) [TaxId: 9606]} Length = 529 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Activating enzymes of the ubiquitin-like proteins
superfamily: Activating enzymes of the ubiquitin-like proteins
family: Ubiquitin activating enzymes (UBA)
domain: Amyloid beta precursor protein-binding protein 1, APPBP1
species: Human (Homo sapiens) [TaxId: 9606]

 Score =  210 bits (537), Expect = 3e-59
 Identities = 81/517 (15%), Positives = 164/517 (31%), Gaps = 61/517 (11%)

Query: 491 NSRYDAQISVFGAKLQKKLEDAKVFIVGSGALGCEFLKNVALMGVSCGNQGKLTITDDDV 550
             +YD Q+ ++G   Q+ LE A V ++ + A G E LKN+ L G+     G  TI D + 
Sbjct: 5   EQKYDRQLRLWGDHGQEALESAHVCLINATATGTEILKNLVLPGI-----GSFTIIDGNQ 59

Query: 551 IEKSNLSRQFLFRDWNIGQAKSTVAASAATSINPRLNIEALQNRVGPETENVFDDTFWEN 610
           +   +    F  +  +IG+ ++  A      +N  ++   ++       +N  D +F+  
Sbjct: 60  VSGEDAGNNFFLQRSSIGKNRAEAAMEFLQELNSDVSGSFVEESPENLLDN--DPSFFCR 117

Query: 611 ITCVINALDNVNARLYVDQRCLYFQKPLLESGTLGAKCNTQMVIPHLTENYGASRDPPEK 670
            T V+      +  L +       Q PLL   T G     +++I    E+      P   
Sbjct: 118 FTVVVATQLPESTSLRLADVLWNSQIPLLICRTYGLVGYMRIIIK---EHPVIESHPDNA 174

Query: 671 QAPMCTVHSFPHNIDHCLTWARSEFEG-LLEKTPAEVNAYLSNPVEYTTSMANAGDA--- 726
              +     FP   +H  ++     E      TP  V         Y+ +          
Sbjct: 175 LEDLRLDKPFPELREHFQSYDLDHMEKKDHSHTPWIVIIAKYLAQWYSETNGRIPKTYKE 234

Query: 727 -----QARDNLERVLECLDKEKCEIFQDCITWARLKFEDY-FSNRVKQLIFTFPEDAATS 780
                          E    E  E F++ I             + ++ +         T 
Sbjct: 235 KEDFRDLIRQGILKNENGAPEDEENFEEAIKNVNTALNTTQIPSSIEDIFNDDRCINITK 294

Query: 781 TGAPFW---SAPKRF-------PHPLQFSSAD--PSHLHFVMAASILRAETFGIPIPDWT 828
               FW    A K F         P++ +  D       ++   ++ R +       D  
Sbjct: 295 QTPSFWILARALKEFVAKEGQGNLPVRGTIPDMIADSGKYIKLQNVYREK----AKKDAA 350

Query: 829 NNPKMLAEAVDKV-MVPDFLPKKDAKILTDE-------KATTLSTASVDDAAVINDLIIK 880
                +A+ +  +   P+ + +K+ K+L          +  +L+     D    +++I  
Sbjct: 351 AVGNHVAKLLQSIGQAPESISEKELKLLCSNSAFLRVVRCRSLAEEYGLDTINKDEIISS 410

Query: 881 LEQCRKNLPSGFRL--------------KPIQFEKDDDTNYHMDMIAGLANMRARNYSIP 926
           ++     +     L                  ++ ++D       + G       +  + 
Sbjct: 411 MDNPDNEIVLYLMLRAVDRFHKQQGRYPGVSNYQVEEDIGKLKSCLTGFLQEYGLSVMVK 470

Query: 927 EVDKLKAKFIAGRIIPAIATSTAMATGLVCLELYKVL 963
           +    +           IA   A   G    E+ K++
Sbjct: 471 DDYVHEFCRYGAAEPHTIA---AFLGGAAAQEVIKII 504
>d1yova1 c.111.1.2 (A:6-534) Amyloid beta precursor protein-binding protein 1, APPBP1 {Human (Homo sapiens) [TaxId: 9606]} Length = 529 Back     information, alignment and structure
>d1yova1 c.111.1.2 (A:6-534) Amyloid beta precursor protein-binding protein 1, APPBP1 {Human (Homo sapiens) [TaxId: 9606]} Length = 529 Back     information, alignment and structure
>d1yovb1 c.111.1.2 (B:12-437) UBA3 {Human (Homo sapiens) [TaxId: 9606]} Length = 426 Back     information, alignment and structure
>d1yovb1 c.111.1.2 (B:12-437) UBA3 {Human (Homo sapiens) [TaxId: 9606]} Length = 426 Back     information, alignment and structure
>d1yovb1 c.111.1.2 (B:12-437) UBA3 {Human (Homo sapiens) [TaxId: 9606]} Length = 426 Back     information, alignment and structure
>d1jw9b_ c.111.1.1 (B:) Molybdenum cofactor biosynthesis protein MoeB {Escherichia coli [TaxId: 562]} Length = 247 Back     information, alignment and structure
>d1jw9b_ c.111.1.1 (B:) Molybdenum cofactor biosynthesis protein MoeB {Escherichia coli [TaxId: 562]} Length = 247 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query1099
d1yovb1426 UBA3 {Human (Homo sapiens) [TaxId: 9606]} 100.0
d1yova1529 Amyloid beta precursor protein-binding protein 1, 100.0
d1yova1529 Amyloid beta precursor protein-binding protein 1, 100.0
d1jw9b_247 Molybdenum cofactor biosynthesis protein MoeB {Esc 100.0
d1yovb1426 UBA3 {Human (Homo sapiens) [TaxId: 9606]} 100.0
d1jw9b_247 Molybdenum cofactor biosynthesis protein MoeB {Esc 99.97
d1pjqa1113 Siroheme synthase CysG, domain 1 {Salmonella typhi 97.63
d1pjqa1113 Siroheme synthase CysG, domain 1 {Salmonella typhi 97.14
d1y8xb192 UBA3 {Human (Homo sapiens) [TaxId: 9606]} 96.95
d1gpja2159 Glutamyl tRNA-reductase middle domain {Archaeon Me 96.58
d1kyqa1150 Bifunctional dehydrogenase/ferrochelatase Met8p, N 96.47
d1kyqa1150 Bifunctional dehydrogenase/ferrochelatase Met8p, N 96.26
d1lssa_132 Ktn Mja218 {Archaeon Methanococcus jannaschii [Tax 96.23
d1gpja2159 Glutamyl tRNA-reductase middle domain {Archaeon Me 96.18
d1vi2a1182 Putative shikimate dehydrogenase YdiB {Escherichia 96.04
d1bg6a2184 N-(1-D-carboxylethyl)-L-norvaline dehydrogenase {A 96.01
d2jfga193 UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase 95.95
d1vi2a1182 Putative shikimate dehydrogenase YdiB {Escherichia 95.92
d1lssa_132 Ktn Mja218 {Archaeon Methanococcus jannaschii [Tax 95.91
d1e5qa1182 Saccharopine reductase {Rice blast fungus (Magnapo 95.77
d1e5qa1182 Saccharopine reductase {Rice blast fungus (Magnapo 95.7
d1nyta1170 Shikimate 5-dehydrogenase AroE {Escherichia coli [ 95.48
d1onfa2117 Glutathione reductase {Plasmodium falciparum [TaxI 95.42
d3cuma2162 Hydroxyisobutyrate dehydrogenase {Pseudomonas aeru 95.38
d1npya1167 Shikimate 5-dehydrogenase-like protein HI0607 {Hae 95.37
d2ldxa1159 Lactate dehydrogenase {Mouse (Mus musculus) [TaxId 95.16
d2pgda2176 6-phosphogluconate dehydrogenase {Sheep (Ovis orie 95.14
d1pzga1154 Lactate dehydrogenase {Toxoplasma gondii [TaxId: 5 95.01
d1jqba2174 Bacterial secondary alcohol dehydrogenase {Clostri 94.91
d1ldna1148 Lactate dehydrogenase {Bacillus stearothermophilus 94.91
d1i0za1160 Lactate dehydrogenase {Human (Homo sapiens), heart 94.9
d1gesa2116 Glutathione reductase {Escherichia coli [TaxId: 56 94.84
d1qp8a1181 Putative formate dehydrogenase {Archaeon Pyrobacul 94.8
d1hyha1146 L-2-hydroxyisocapronate dehydrogenase, L-HICDH {La 94.75
d1ks9a2167 Ketopantoate reductase PanE {Escherichia coli [Tax 94.74
d1nyta1170 Shikimate 5-dehydrogenase AroE {Escherichia coli [ 94.73
d1xg5a_257 Putative dehydrogenase ARPG836 (MGC4172) {Human (H 94.49
d1pl8a2171 Ketose reductase (sorbitol dehydrogenase) {Human ( 94.45
d1vm6a3128 Dihydrodipicolinate reductase {Thermotoga maritima 94.44
d1npya1167 Shikimate 5-dehydrogenase-like protein HI0607 {Hae 94.44
d2g5ca2171 Prephenate dehydrogenase TyrA {Aquifex aeolicus [T 94.4
d1xg5a_257 Putative dehydrogenase ARPG836 (MGC4172) {Human (H 94.39
d2f1ka2165 Prephenate dehydrogenase TyrA {Synechocystis sp. p 94.36
d1bg6a2184 N-(1-D-carboxylethyl)-L-norvaline dehydrogenase {A 94.32
d1hyea1145 MJ0490, lactate/malate dehydrogenase {Archaeon Met 94.31
d2hmva1134 Ktn bsu222 {Bacillus subtilis [TaxId: 1423]} 94.17
d1v59a2122 Dihydrolipoamide dehydrogenase {Baker's yeast (Sac 94.12
d1ps9a3179 2,4-dienoyl-CoA reductase, middle domain {Escheric 94.02
d1h6va2122 Mammalian thioredoxin reductase {Rat (Rattus norve 94.02
d1llda1143 Lactate dehydrogenase {Bifidobacterium longum, str 94.01
d2hmva1134 Ktn bsu222 {Bacillus subtilis [TaxId: 1423]} 93.96
d1vj0a2182 Hypothetical protein TM0436 {Thermotoga maritima [ 93.94
d1wdka3186 Fatty oxidation complex alpha subunit, middle doma 93.93
d1t2da1150 Lactate dehydrogenase {Malaria parasite (Plasmodiu 93.91
d1ebda2117 Dihydrolipoamide dehydrogenase {Bacillus stearothe 93.81
d1nvta1177 Shikimate 5-dehydrogenase AroE {Archaeon Methanoco 93.8
d1d7ya2121 NADH-dependent ferredoxin reductase, BphA4 {Pseudo 93.77
d1d1ta2176 Alcohol dehydrogenase {Human (Homo sapiens), diffe 93.77
d3cuma2162 Hydroxyisobutyrate dehydrogenase {Pseudomonas aeru 93.62
d1p77a1171 Shikimate 5-dehydrogenase AroE {Haemophilus influe 93.49
d1id1a_153 Rck domain from putative potassium channel Kch {Es 93.44
d2jhfa2176 Alcohol dehydrogenase {Horse (Equus caballus) [Tax 93.34
d1ez4a1146 Lactate dehydrogenase {Lactobacillus pentosus [Tax 93.3
d1nhpa2123 NADH peroxidase {Enterococcus faecalis [TaxId: 135 93.3
d1f8fa2174 Benzyl alcohol dehydrogenase {Acinetobacter calcoa 93.26
d1iy8a_258 Levodione reductase {Corynebacterium aquaticum [Ta 93.2
d1lvla2115 Dihydrolipoamide dehydrogenase {Pseudomonas putida 93.19
d1mlda1144 Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 982 93.15
d1pgja2178 6-phosphogluconate dehydrogenase {Trypanosoma bruc 93.15
d1e3ia2174 Alcohol dehydrogenase {Mouse (Mus musculus), class 93.09
d1j4aa1197 D-lactate dehydrogenase {Lactobacillus helveticus 93.09
d3grsa2125 Glutathione reductase {Human (Homo sapiens) [TaxId 93.08
d1hyha1146 L-2-hydroxyisocapronate dehydrogenase, L-HICDH {La 93.07
d1xhca2122 NADH oxidase /nitrite reductase {Pyrococcus furios 93.06
d3lada2119 Dihydrolipoamide dehydrogenase {Azotobacter vinela 93.03
d1mx3a1193 Transcription corepressor CtbP {Human (Homo sapien 93.03
d1feca2117 Trypanothione reductase {Crithidia fasciculata [Ta 93.0
d1dxya1199 D-2-hydroxyisocaproate dehydrogenase {Lactobacillu 92.97
d1ojta2125 Dihydrolipoamide dehydrogenase {Neisseria meningit 92.94
d2f1ka2165 Prephenate dehydrogenase TyrA {Synechocystis sp. p 92.73
d1pl8a2171 Ketose reductase (sorbitol dehydrogenase) {Human ( 92.7
d2jfga193 UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase 92.67
d2naca1188 Formate dehydrogenase {Pseudomonas sp., strain 101 92.63
d1guza1142 Malate dehydrogenase {Chlorobium vibrioforme [TaxI 92.62
d1e3ja2170 Ketose reductase (sorbitol dehydrogenase) {Silverl 92.55
d1a5za1140 Lactate dehydrogenase {Thermotoga maritima [TaxId: 92.53
d1e3ja2170 Ketose reductase (sorbitol dehydrogenase) {Silverl 92.48
d1jqba2174 Bacterial secondary alcohol dehydrogenase {Clostri 92.47
d1vpda2161 Hydroxyisobutyrate dehydrogenase {Salmonella typhi 92.45
d1q1ra2133 Putidaredoxin reductase {Pseudomonas putida [TaxId 92.45
d1ojua1142 Malate dehydrogenase {Archaeon Archaeoglobus fulgi 92.41
d1a5za1140 Lactate dehydrogenase {Thermotoga maritima [TaxId: 92.38
d1sc6a1188 Phosphoglycerate dehydrogenase {Escherichia coli [ 92.37
d1zema1260 Xylitol dehydrogenase {Gluconobacter oxydans [TaxI 92.37
d1gtea4196 Dihydropyrimidine dehydrogenase, domain 2 {Pig (Su 92.3
d1luaa1191 Methylene-tetrahydromethanopterin dehydrogenase {M 92.29
d1uxja1142 Malate dehydrogenase {Chloroflexus aurantiacus [Ta 92.28
d1ks9a2167 Ketopantoate reductase PanE {Escherichia coli [Tax 92.22
d2pgda2176 6-phosphogluconate dehydrogenase {Sheep (Ovis orie 92.18
d1p3da196 UDP-N-acetylmuramate-alanine ligase MurC {Haemophi 92.18
d1pzga1154 Lactate dehydrogenase {Toxoplasma gondii [TaxId: 5 92.14
d1i36a2152 Conserved hypothetical protein MTH1747 {Archaeon M 92.09
d1gdha1191 D-glycerate dehydrogenase {Hyphomicrobium methylov 92.09
d2ldxa1159 Lactate dehydrogenase {Mouse (Mus musculus) [TaxId 92.02
d1p0fa2174 Alcohol dehydrogenase {Frog (Rana perezi) [TaxId: 92.02
d1mo9a2121 NADH-dependent 2-ketopropyl coenzyme M oxidoreduct 92.02
d1p77a1171 Shikimate 5-dehydrogenase AroE {Haemophilus influe 92.01
d1gtea4196 Dihydropyrimidine dehydrogenase, domain 2 {Pig (Su 91.86
d1hyea1145 MJ0490, lactate/malate dehydrogenase {Archaeon Met 91.64
d2fzwa2176 Alcohol dehydrogenase {Human (Homo sapiens), diffe 91.61
d1txga2180 Glycerol-3- phosphate dehydrogenase {Archaeoglobus 91.57
d1yqga2152 Pyrroline-5-carboxylate reductase ProC {Neisseria 91.57
d1yxma1297 Peroxisomal trans 2-enoyl CoA reductase {Human (Ho 91.45
d1vj0a2182 Hypothetical protein TM0436 {Thermotoga maritima [ 91.42
d1hdoa_205 Biliverdin IX beta reductase {Human (Homo sapiens) 91.39
d2b69a1312 UDP-glucuronate decarboxylase 1 {Human (Homo sapie 91.21
d1d7ya2121 NADH-dependent ferredoxin reductase, BphA4 {Pseudo 91.15
d1dxla2123 Dihydrolipoamide dehydrogenase {Garden pea (Pisum 91.01
d1ez4a1146 Lactate dehydrogenase {Lactobacillus pentosus [Tax 90.91
d1iy8a_258 Levodione reductase {Corynebacterium aquaticum [Ta 90.88
d1xhla_274 Hypothetical protein F25D1.5 {Caenorhabditis elega 90.78
d1i0za1160 Lactate dehydrogenase {Human (Homo sapiens), heart 90.74
d2vapa1209 Cell-division protein FtsZ {Archaeon Methanococcus 90.73
d1luaa1191 Methylene-tetrahydromethanopterin dehydrogenase {M 90.69
d1w5fa1194 Cell-division protein FtsZ {Thermotoga maritima [T 90.68
d1vpda2161 Hydroxyisobutyrate dehydrogenase {Salmonella typhi 90.66
d1nvta1177 Shikimate 5-dehydrogenase AroE {Archaeon Methanoco 90.63
d1ldna1148 Lactate dehydrogenase {Bacillus stearothermophilus 90.48
d1ps9a3179 2,4-dienoyl-CoA reductase, middle domain {Escheric 90.4
d1t2da1150 Lactate dehydrogenase {Malaria parasite (Plasmodiu 90.39
d1o6za1142 Malate dehydrogenase {Archaeon Haloarcula marismor 90.33
d1xkqa_272 Hypothetical protein R05D8.7 {Caenorhabditis elega 90.26
d1fcda1186 Flavocytochrome c sulfide dehydrogenase, FCSD, fla 90.19
d1id1a_153 Rck domain from putative potassium channel Kch {Es 90.0
d1uxja1142 Malate dehydrogenase {Chloroflexus aurantiacus [Ta 89.89
d1fmca_255 7-alpha-hydroxysteroid dehydrogenase {Escherichia 89.87
d1y6ja1142 Lactate dehydrogenase {Clostridium thermocellum [T 89.81
d1pj5a2305 N,N-dimethylglycine oxidase {Arthrobacter globifor 89.74
d1guza1142 Malate dehydrogenase {Chlorobium vibrioforme [TaxI 89.7
d1spxa_264 Glucose dehydrogenase (5l265) {Nematode (Caenorhab 89.68
d2cvza2156 Hydroxyisobutyrate dehydrogenase {Thermus thermoph 89.67
d1ofua1198 Cell-division protein FtsZ {Pseudomonas aeruginosa 89.54
d1zk4a1251 R-specific alcohol dehydrogenase {Lactobacillus br 89.52
d2bkaa1232 TAT-interacting protein TIP30 {Human (Homo sapiens 89.51
d1hdoa_205 Biliverdin IX beta reductase {Human (Homo sapiens) 89.5
d1u8xx1167 Maltose-6'-phosphate glucosidase GlvA {Bacillus su 89.44
d2gdza1254 15-hydroxyprostaglandin dehydrogenase, PGDH {Human 89.44
d1yl7a1135 Dihydrodipicolinate reductase {Mycobacterium tuber 89.35
d1mlda1144 Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 982 89.33
d1f8fa2174 Benzyl alcohol dehydrogenase {Acinetobacter calcoa 89.3
d1w6ua_294 2,4-dienoyl-CoA reductase, mitochondrial (DECR) {H 89.24
d2bgka1268 Rhizome secoisolariciresinol dehydrogenase {Mayapp 89.21
d1h2ba2172 Alcohol dehydrogenase {Archaeon Aeropyrum pernix [ 89.13
d2pv7a2152 Prephenate dehydrogenase TyrA {Haemophilus influen 88.99
d1wdka3186 Fatty oxidation complex alpha subunit, middle doma 88.9
d1aoga2117 Trypanothione reductase {Trypanosoma cruzi [TaxId: 88.87
d1ae1a_258 Tropinone reductase {Jimsonweed (Datura stramonium 88.84
d1llda1143 Lactate dehydrogenase {Bifidobacterium longum, str 88.84
d1obba1171 Alpha-glucosidase AglA {Thermotoga maritima [TaxId 88.84
d2hjsa1144 Usg-1 protein homolog PA3116 {Pseudomonas aerugino 88.8
d1zema1260 Xylitol dehydrogenase {Gluconobacter oxydans [TaxI 88.78
d1j5pa4132 Hypothetical protein TM1643 {Thermotoga maritima [ 88.71
d1c0pa1268 D-aminoacid oxidase, N-terminal domain {Rhodotorul 88.7
d1k2wa_256 Sorbitol dehydrogenase {Rhodobacter sphaeroides [T 88.69
d1e3ia2174 Alcohol dehydrogenase {Mouse (Mus musculus), class 88.56
d2ag5a1245 Dehydrogenase/reductase SDR family member 6, DHRS6 88.53
d1sbya1254 Drosophila alcohol dehydrogenase {Fly (Drosophila 88.53
d2c07a1251 beta-keto acyl carrier protein reductase {Malaria 88.42
d2vapa1209 Cell-division protein FtsZ {Archaeon Methanococcus 88.39
d1ebda2117 Dihydrolipoamide dehydrogenase {Bacillus stearothe 88.32
d2cmda1145 Malate dehydrogenase {Escherichia coli [TaxId: 562 88.23
d1xhca2122 NADH oxidase /nitrite reductase {Pyrococcus furios 88.1
d1vl8a_251 Gluconate 5-dehydrogenase {Thermotoga maritima [Ta 88.0
d1ygya1184 Phosphoglycerate dehydrogenase {Mycobacterium tube 87.99
d1y6ja1142 Lactate dehydrogenase {Clostridium thermocellum [T 87.95
d1w5fa1194 Cell-division protein FtsZ {Thermotoga maritima [T 87.93
d1i36a2152 Conserved hypothetical protein MTH1747 {Archaeon M 87.91
d1xhla_274 Hypothetical protein F25D1.5 {Caenorhabditis elega 87.9
d1f0ya2192 Short chain L-3-hydroxyacyl CoA dehydrogenase {Hum 87.66
d2ew8a1247 (s)-1-phenylethanol dehydrogenase {Azoarcus sp. eb 87.61
d2jhfa2176 Alcohol dehydrogenase {Horse (Equus caballus) [Tax 87.44
d1nhpa2123 NADH peroxidase {Enterococcus faecalis [TaxId: 135 87.42
d1mv8a2202 GDP-mannose 6-dehydrogenase {Pseudomonas aeruginos 87.35
d1f0ya2192 Short chain L-3-hydroxyacyl CoA dehydrogenase {Hum 87.32
d2g5ca2171 Prephenate dehydrogenase TyrA {Aquifex aeolicus [T 87.3
d1yb1a_244 17-beta-hydroxysteroid dehydrogenase type XI {Huma 87.21
d1ojua1142 Malate dehydrogenase {Archaeon Archaeoglobus fulgi 87.1
d1geea_261 Glucose dehydrogenase {Bacillus megaterium [TaxId: 86.99
d1t4ba1146 Aspartate beta-semialdehyde dehydrogenase {Escheri 86.95
d2fy8a1129 Potassium channel-related protein MthK {Archaeon M 86.9
d1d1ta2176 Alcohol dehydrogenase {Human (Homo sapiens), diffe 86.89
d2b69a1312 UDP-glucuronate decarboxylase 1 {Human (Homo sapie 86.85
d1b5qa1347 Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]} 86.74
d1j6ua189 UDP-N-acetylmuramate-alanine ligase MurC {Thermoto 86.65
d1onfa2117 Glutathione reductase {Plasmodium falciparum [TaxI 86.58
d1pj5a2305 N,N-dimethylglycine oxidase {Arthrobacter globifor 86.51
d1u8xx1167 Maltose-6'-phosphate glucosidase GlvA {Bacillus su 86.5
d1xkqa_272 Hypothetical protein R05D8.7 {Caenorhabditis elega 86.47
d1q1ra1185 Putidaredoxin reductase {Pseudomonas putida [TaxId 86.43
d1k0ia1292 p-Hydroxybenzoate hydroxylase, PHBH {Pseudomonas a 86.34
d1gesa2116 Glutathione reductase {Escherichia coli [TaxId: 56 86.32
d1ydea1250 Retinal dehydrogenase/reductase 3 {Human (Homo sap 86.29
d1v59a2122 Dihydrolipoamide dehydrogenase {Baker's yeast (Sac 86.2
d1p0fa2174 Alcohol dehydrogenase {Frog (Rana perezi) [TaxId: 86.17
d1ryia1276 Glycine oxidase ThiO {Bacillus sp. [TaxId: 1409]} 86.16
d1xhca1167 NADH oxidase /nitrite reductase {Pyrococcus furios 86.06
d1pgja2178 6-phosphogluconate dehydrogenase {Trypanosoma bruc 86.03
d1cjca2230 Adrenodoxin reductase of mitochondrial p450 system 85.95
d1xq1a_259 Tropinone reductase {Thale cress (Arabidopsis thal 85.95
d1spxa_264 Glucose dehydrogenase (5l265) {Nematode (Caenorhab 85.95
d1diha1162 Dihydrodipicolinate reductase {Escherichia coli [T 85.86
d2pv7a2152 Prephenate dehydrogenase TyrA {Haemophilus influen 85.77
d1bdba_276 Cis-biphenyl-2,3-dihydrodiol-2,3-dehydrogenase {Ps 85.71
d1up7a1162 6-phospho-beta-glucosidase {Thermotoga maritima [T 85.68
d2ae2a_259 Tropinone reductase {Jimsonweed (Datura stramonium 85.67
d1lvla2115 Dihydrolipoamide dehydrogenase {Pseudomonas putida 85.62
d1g0oa_272 1,3,8-trihydroxynaphtalene reductase (THNR, naphto 85.42
d1seza1373 Protoporphyrinogen oxidase {Tobacco (Nicotiana tab 85.4
d1cdoa2175 Alcohol dehydrogenase {Cod (Gadus callarias) [TaxI 85.37
d1j5pa4132 Hypothetical protein TM1643 {Thermotoga maritima [ 85.23
d1fcda1186 Flavocytochrome c sulfide dehydrogenase, FCSD, fla 85.22
d1wmaa1275 Carbonyl reductase/20beta-hydroxysteroid dehydroge 85.07
d1djqa3233 Trimethylamine dehydrogenase, middle domain {Methy 85.05
d1yxma1297 Peroxisomal trans 2-enoyl CoA reductase {Human (Ho 84.96
d1n1ea2189 Glycerol-3- phosphate dehydrogenase {Trypanosome ( 84.92
d2voua1265 Dihydroxypyridine hydroxylase DhpH {Arthrobacter n 84.88
d1ofua1198 Cell-division protein FtsZ {Pseudomonas aeruginosa 84.83
d1up7a1162 6-phospho-beta-glucosidase {Thermotoga maritima [T 84.73
d1c1da1201 Phenylalanine dehydrogenase {Rhodococcus sp., M4 [ 84.72
d1q1ra2133 Putidaredoxin reductase {Pseudomonas putida [TaxId 84.67
d1y7ta1154 Malate dehydrogenase {Thermus thermophilus [TaxId: 84.58
d1txga2180 Glycerol-3- phosphate dehydrogenase {Archaeoglobus 84.48
d1gega_255 meso-2,3-butanediol dehydrogenase {Klebsiella pneu 84.48
d1nffa_244 Putative oxidoreductase Rv2002 {Mycobacterium tube 84.41
d2rhca1257 beta-keto acyl carrier protein reductase {Streptom 84.35
d1obba1171 Alpha-glucosidase AglA {Thermotoga maritima [TaxId 84.28
d1b5qa1347 Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]} 84.28
d3grsa2125 Glutathione reductase {Human (Homo sapiens) [TaxId 84.18
d1jaya_212 Coenzyme F420H2:NADP+ oxidoreductase (FNO) {Archae 84.1
d1m6ia2137 Apoptosis-inducing factor (AIF) {Human (Homo sapie 84.02
d1h6va2122 Mammalian thioredoxin reductase {Rat (Rattus norve 84.0
d1fmca_255 7-alpha-hydroxysteroid dehydrogenase {Escherichia 83.92
d1c0pa1268 D-aminoacid oxidase, N-terminal domain {Rhodotorul 83.91
d1sbya1254 Drosophila alcohol dehydrogenase {Fly (Drosophila 83.91
d1d7ya1183 NADH-dependent ferredoxin reductase, BphA4 {Pseudo 83.81
d1ydwa1184 Probable oxidoreductase At4g09670 {Thale cress (Ar 83.78
d1seza1373 Protoporphyrinogen oxidase {Tobacco (Nicotiana tab 83.64
d2a4ka1241 beta-keto acyl carrier protein reductase {Thermus 83.59
d1i24a_393 Sulfolipid biosynthesis protein SQD1 {Thale cress 83.48
d1y1pa1342 Aldehyde reductase II {Sporobolomyces salmonicolor 83.35
d1zk4a1251 R-specific alcohol dehydrogenase {Lactobacillus br 83.25
d1djqa3233 Trimethylamine dehydrogenase, middle domain {Methy 83.11
d2voua1265 Dihydroxypyridine hydroxylase DhpH {Arthrobacter n 83.04
d5mdha1154 Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 982 83.02
d1uufa2168 Hypothetical protein YahK {Escherichia coli [TaxId 82.99
d1w6ua_294 2,4-dienoyl-CoA reductase, mitochondrial (DECR) {H 82.98
d1jvba2170 Alcohol dehydrogenase {Archaeon Sulfolobus solfata 82.91
d1yb1a_244 17-beta-hydroxysteroid dehydrogenase type XI {Huma 82.9
d1qyda_312 Pinoresinol-lariciresinol reductase {Giant arborvi 82.86
d2bgka1268 Rhizome secoisolariciresinol dehydrogenase {Mayapp 82.67
d1jvba2170 Alcohol dehydrogenase {Archaeon Sulfolobus solfata 82.64
d1cjca2230 Adrenodoxin reductase of mitochondrial p450 system 82.41
d2gdza1254 15-hydroxyprostaglandin dehydrogenase, PGDH {Human 82.36
d1rq2a1198 Cell-division protein FtsZ {Mycobacterium tubercul 82.23
d1vm6a3128 Dihydrodipicolinate reductase {Thermotoga maritima 82.23
d7mdha1175 Malate dehydrogenase {Sorghum (Sorghum vulgare), c 82.14
d1db3a_357 GDP-mannose 4,6-dehydratase {Escherichia coli [Tax 81.89
d2bi7a1314 UDP-galactopyranose mutase, N-terminal domain {Kle 81.88
d1h5qa_260 Mannitol dehydrogenase {Mushroom (Agaricus bisporu 81.79
d1o6za1142 Malate dehydrogenase {Archaeon Haloarcula marismor 81.75
d2iida1370 L-aminoacid oxidase {Malayan pit viper (Calloselas 81.69
d1ja9a_259 1,3,6,8-tetrahydroxynaphthalene reductase {Rice bl 81.67
d3lada2119 Dihydrolipoamide dehydrogenase {Azotobacter vinela 81.43
d1vl6a1222 Malate oxidoreductase (malic enzyme) {Thermotoga m 81.38
d1pjca1168 L-alanine dehydrogenase {Phormidium lapideum [TaxI 81.33
d1uufa2168 Hypothetical protein YahK {Escherichia coli [TaxId 81.28
d1mo9a2121 NADH-dependent 2-ketopropyl coenzyme M oxidoreduct 81.26
d1ojta2125 Dihydrolipoamide dehydrogenase {Neisseria meningit 81.23
d1geea_261 Glucose dehydrogenase {Bacillus megaterium [TaxId: 81.19
d2fzwa2176 Alcohol dehydrogenase {Human (Homo sapiens), diffe 81.01
d1k0ia1292 p-Hydroxybenzoate hydroxylase, PHBH {Pseudomonas a 80.99
d1xeaa1167 Putative oxidoreductase VCA1048 {Vibrio cholerae [ 80.74
d1vl8a_251 Gluconate 5-dehydrogenase {Thermotoga maritima [Ta 80.52
d1s6ya1169 6-phospho-beta-glucosidase {Bacillus stearothermop 80.36
d1xhca1167 NADH oxidase /nitrite reductase {Pyrococcus furios 80.31
d3c96a1288 Monooxygenase PhzS {Pseudomonas aeruginosa [TaxId: 80.27
d2c07a1251 beta-keto acyl carrier protein reductase {Malaria 80.23
>d1yovb1 c.111.1.2 (B:12-437) UBA3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Activating enzymes of the ubiquitin-like proteins
superfamily: Activating enzymes of the ubiquitin-like proteins
family: Ubiquitin activating enzymes (UBA)
domain: UBA3
species: Human (Homo sapiens) [TaxId: 9606]

Probab=100.00  E-value=9e-64  Score=582.01  Aligned_cols=359  Identities=28%  Similarity=0.457  Sum_probs=273.7

Q ss_pred             hhhhhhhcC-HHHHHHHhcCcEEEEcCCcchHHHHHHHHHcCCCCCCCccEEEecCCccccccCCcccccccCcccchHH
Q 001331          494 YDAQISVFG-AKLQKKLEDAKVFIVGSGALGCEFLKNVALMGVSCGNQGKLTITDDDVIEKSNLSRQFLFRDWNIGQAKS  572 (1099)
Q Consensus       494 ydrqi~l~G-~~~q~~L~~~~v~vvG~GglG~evlk~La~~Gv~~~~~g~i~ivD~D~Ie~sNLnRQflf~~~diG~~Ka  572 (1099)
                      |.++...-| +..|.+|+++||+||||||+|||++|+|+++||     |+|+|+|+|+|+.|||||||||+++|||++||
T Consensus        19 ~~~~~~~~~~e~~~~~l~~~kVlvvG~GglG~ei~k~L~~~Gv-----g~i~lvD~D~Ve~sNL~RQflf~~~diG~~Ka   93 (426)
T d1yovb1          19 FTHPDFEPSTESLQFLLDTCKVLVIGAGGLGCELLKNLALSGF-----RQIHVIDMDTIDVSNLNRQFLFRPKDIGRPKA   93 (426)
T ss_dssp             TCCTTCCCCSSHHHHHHHHCCEEEECSSTTHHHHHHHHHTTTC-----CCEEEECCCBCCGGGGGTCTTCCGGGTTSBHH
T ss_pred             CcCcccccChHHHHHHHhcCeEEEECCCHHHHHHHHHHHHcCC-----CeEEEEECCCcchhhhcccccCChhHcCcHHH
Confidence            444333334 356889999999999999999999999999999     99999999999999999999999999999999


Q ss_pred             HHHHHHHHhhCCCCeEEEEecccCcccccccchhhhcCCCEEEEccCchHHHHHHHhhcc------------cccccEEE
Q 001331          573 TVAASAATSINPRLNIEALQNRVGPETENVFDDTFWENITCVINALDNVNARLYVDQRCL------------YFQKPLLE  640 (1099)
Q Consensus       573 ~vaa~~l~~~np~~~i~~~~~~v~~~~e~~~~~~~~~~~DvVi~alDn~~ar~~i~~~c~------------~~~~Pli~  640 (1099)
                      ++|+++++++||+++|+++..++.+     ++++|++++|+||+|+||+++|++++++|+            ..++|+|+
T Consensus        94 ~~a~~~l~~~np~v~i~~~~~~i~~-----~~~~~~~~~DlVi~~~Dn~~aR~~in~~c~~l~k~~~~~~~~~~~iPlI~  168 (426)
T d1yovb1          94 EVAAEFLNDRVPNCNVVPHFNKIQD-----FNDTFYRQFHIIVCGLDSIIARRWINGMLISLLNYEDGVLDPSSIVPLID  168 (426)
T ss_dssp             HHHHHHHHHHSTTCCCEEECSCGGG-----BCHHHHTTCSEEEECCSCHHHHHHHHHHHHHTCCEETTEECGGGCCCEEE
T ss_pred             HHHHHHHHhhCCCCceEeeeccccc-----hHHHHHHhcchheeccCcHHHHHHHHHHHHHhhcccccccccccCCceEE
Confidence            9999999999999999999988865     335789999999999999999999999997            45789999


Q ss_pred             cCcCcccceeEEEeCcccccCCCCCC--CCCCCCCcccccCCCCCcchhHHHHHHHhhhhccCChhhhhhhcCCChhhhh
Q 001331          641 SGTLGAKCNTQMVIPHLTENYGASRD--PPEKQAPMCTVHSFPHNIDHCLTWARSEFEGLLEKTPAEVNAYLSNPVEYTT  718 (1099)
Q Consensus       641 sgt~G~~G~~~v~ip~~t~cy~c~~~--p~~~~~p~Ct~~~~P~~~~Hci~wAr~~F~~lF~~~~~~~~~~l~~~~~~~~  718 (1099)
                      +|+.|++|++++++|+.|+||.|..+  |+++++|.||++++|+.++|||+|||.++                       
T Consensus       169 gg~~G~~G~~~vi~p~~t~Cy~C~~~~~p~~~~~p~CTi~~~P~~~~hci~~ak~l~-----------------------  225 (426)
T d1yovb1         169 GGTEGFKGNARVILPGMTACIECTLELYPPQVNFPMCTIASMPRLPEHCIEYVRMLQ-----------------------  225 (426)
T ss_dssp             EEEETTEEEEEEECTTTSCCGGGGGGGSCCCCCCCHHHHHHCCCSHHHHHHHHHHTH-----------------------
T ss_pred             eEEeeeEEEEEEECCCCCCCcCcCCCCCCCCCCCCcccccCCCCCchheeehhhhhc-----------------------
Confidence            99999999999999999999999644  78889999999999999999999998520                       


Q ss_pred             hhhhcCchhHHHHHHHHHHHhhhhcccchHHHHHHHHHHHHHHHHHHHHHHhhhCCccccccCCCCCccCCCCCCCcccc
Q 001331          719 SMANAGDAQARDNLERVLECLDKEKCEIFQDCITWARLKFEDYFSNRVKQLIFTFPEDAATSTGAPFWSAPKRFPHPLQF  798 (1099)
Q Consensus       719 ~~~~~~~~~~~~~l~~~~~~l~~~~~~~~~~c~~~a~~~f~~~F~~~i~~ll~~~p~d~~~~~g~~fWs~~kr~P~pl~f  798 (1099)
                                                        |.+                                 .+..      
T Consensus       226 ----------------------------------~~~---------------------------------~~~~------  232 (426)
T d1yovb1         226 ----------------------------------WPK---------------------------------EQPF------  232 (426)
T ss_dssp             ----------------------------------HHH---------------------------------SCTT------
T ss_pred             ----------------------------------ccc---------------------------------cccc------
Confidence                                              100                                 0000      


Q ss_pred             CCCCCchhHHHHHHHHHHHHHcCCCCCCCCCChHHHHHHhhhcCCCCCCCCCCcceecccccccccccCcCcHHHHHHHH
Q 001331          799 SSADPSHLHFVMAASILRAETFGIPIPDWTNNPKMLAEAVDKVMVPDFLPKKDAKILTDEKATTLSTASVDDAAVINDLI  878 (1099)
Q Consensus       799 d~~~~~h~~fi~~~a~l~a~~~~i~~~~~~~~~~~~~~~~~~~~~~~f~~~~~~~~~~~e~~~~~~~~~~~~~~~~~~l~  878 (1099)
                                                                                                      
T Consensus       233 --------------------------------------------------------------------------------  232 (426)
T d1yovb1         233 --------------------------------------------------------------------------------  232 (426)
T ss_dssp             --------------------------------------------------------------------------------
T ss_pred             --------------------------------------------------------------------------------
Confidence                                                                                            


Q ss_pred             HHHHHhhhcCCCCCCcCCceeeccCCCCchhHHHHHHhhhhhhccCCCCccHHHHHHHhccccchhhhhHHHHHHHHHHH
Q 001331          879 IKLEQCRKNLPSGFRLKPIQFEKDDDTNYHMDMIAGLANMRARNYSIPEVDKLKAKFIAGRIIPAIATSTAMATGLVCLE  958 (1099)
Q Consensus       879 ~~l~~~~~~~~~~~~~~p~~FeKDDd~n~hidFI~aasNLRA~ny~I~~~d~~~~K~iAG~IIPAIATTtA~VaGl~~lE  958 (1099)
                                     ...+.|++||+  .||+||+++||+||.+|+|+..+++.+|++||+||||||||||+|||++++|
T Consensus       233 ---------------~~~~~~d~dd~--~~i~~i~~~a~~ra~~~~I~~~~~~~~k~ia~nIIPaiatTnAIVagl~~~E  295 (426)
T d1yovb1         233 ---------------GEGVPLDGDDP--EHIQWIFQKSLERASQYNIRGVTYRLTQGVVKRIIPAVASTNAVIAAVCATE  295 (426)
T ss_dssp             ---------------STTCCCCTTCH--HHHHHHHHHHHHHHHHTTCCCCCHHHHHHHHTTCCCCCHHHHHHHHHHHHHH
T ss_pred             ---------------cccCCCCCCCH--HHHHHHHHHHHHHHHhcCCCCccHHHHHHHhhccccccccHHHHHHHHHHHH
Confidence                           00123566654  4999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHhcCCCCccccccccc-ccccCcccccCCCCCccc-ccCCcceeEEeEEEcCCCCcHHHHHHHHHHc-CCce--eee
Q 001331          959 LYKVLDGGHKLEDYRNTFA-NLALPLFSMAEPVPPKVI-KHRDMSWTVWDRWILKDNPTLRELIQWLKDK-GLNA--YSI 1033 (1099)
Q Consensus       959 l~K~l~~~~~~~~~rn~f~-nla~p~~~~~eP~~~~~~-~~~~~~~t~Wd~~~v~~~~TL~~li~~~~~~-~l~~--~~i 1033 (1099)
                      ++|++.+..+  ..+|.|+ +-..+.+..+.+..+... ..++.   .|..+.+..++||+||+++++++ +++.  +++
T Consensus       296 ~iK~lt~~~~--p~~n~~~~~~~~~~~~~~~~~~k~~~C~vC~~---~~~~~~~~~~~tL~~li~~~~~~~~l~~~~p~~  370 (426)
T d1yovb1         296 VFKIATSAYI--PLNNYLVFNDVDGLYTYTFEAERKENCPACSQ---LPQNIQFSPSAKLQEVLDYLTNSASLQMKSPAI  370 (426)
T ss_dssp             HHHHHHCSSC--CCCSEEEEECSBSCEEEEECCCCCTTCTTTCS---SCBCCC------CTTHHHHTTTCSSSCCSSCCE
T ss_pred             HHHHHhcCCc--cccceEEEecCCCceEeeeeccCCCCCCeeCC---ceEEEEECCCCCHHHHHHHHHHhhCcCccCCcc
Confidence            9999998542  2233332 333344333333322221 12221   12345566789999999999987 6654  333


Q ss_pred             ----ecCCceeecCCCc----chhccccCcHHHHH
Q 001331         1034 ----SCGSCLLFNSMFP----RHKERMDKKVVDLA 1060 (1099)
Q Consensus      1034 ----~~g~~~LY~~~~~----~~~~~l~~~l~~l~ 1060 (1099)
                          ..+..+||..+.|    ..++||+|+|+||.
T Consensus       371 ~~~~~~~~~~Ly~~~~~~le~~~~~nl~k~L~eL~  405 (426)
T d1yovb1         371 TATLEGKNRTLYLQSVTSIEERTRPNLSKTLKELG  405 (426)
T ss_dssp             ECC-----CEECCCC----CGGGSTTC--------
T ss_pred             eeeecCCCcEEEecCCchhhHHhhhhhcCCHHHhC
Confidence                3467899988755    34789999999994
>d1yova1 c.111.1.2 (A:6-534) Amyloid beta precursor protein-binding protein 1, APPBP1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yova1 c.111.1.2 (A:6-534) Amyloid beta precursor protein-binding protein 1, APPBP1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jw9b_ c.111.1.1 (B:) Molybdenum cofactor biosynthesis protein MoeB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1yovb1 c.111.1.2 (B:12-437) UBA3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jw9b_ c.111.1.1 (B:) Molybdenum cofactor biosynthesis protein MoeB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1pjqa1 c.2.1.11 (A:1-113) Siroheme synthase CysG, domain 1 {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1pjqa1 c.2.1.11 (A:1-113) Siroheme synthase CysG, domain 1 {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1y8xb1 c.111.1.2 (B:349-440) UBA3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gpja2 c.2.1.7 (A:144-302) Glutamyl tRNA-reductase middle domain {Archaeon Methanopyrus kandleri [TaxId: 2320]} Back     information, alignment and structure
>d1kyqa1 c.2.1.11 (A:1-150) Bifunctional dehydrogenase/ferrochelatase Met8p, N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1kyqa1 c.2.1.11 (A:1-150) Bifunctional dehydrogenase/ferrochelatase Met8p, N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1lssa_ c.2.1.9 (A:) Ktn Mja218 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1gpja2 c.2.1.7 (A:144-302) Glutamyl tRNA-reductase middle domain {Archaeon Methanopyrus kandleri [TaxId: 2320]} Back     information, alignment and structure
>d1vi2a1 c.2.1.7 (A:107-288) Putative shikimate dehydrogenase YdiB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1bg6a2 c.2.1.6 (A:4-187) N-(1-D-carboxylethyl)-L-norvaline dehydrogenase {Arthrobacter, strain 1c [TaxId: 1663]} Back     information, alignment and structure
>d2jfga1 c.5.1.1 (A:1-93) UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase MurD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1vi2a1 c.2.1.7 (A:107-288) Putative shikimate dehydrogenase YdiB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1lssa_ c.2.1.9 (A:) Ktn Mja218 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1e5qa1 c.2.1.3 (A:2-124,A:392-450) Saccharopine reductase {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} Back     information, alignment and structure
>d1e5qa1 c.2.1.3 (A:2-124,A:392-450) Saccharopine reductase {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} Back     information, alignment and structure
>d1nyta1 c.2.1.7 (A:102-271) Shikimate 5-dehydrogenase AroE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1onfa2 c.3.1.5 (A:154-270) Glutathione reductase {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d3cuma2 c.2.1.6 (A:1-162) Hydroxyisobutyrate dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1npya1 c.2.1.7 (A:103-269) Shikimate 5-dehydrogenase-like protein HI0607 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d2ldxa1 c.2.1.5 (A:1-159) Lactate dehydrogenase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2pgda2 c.2.1.6 (A:1-176) 6-phosphogluconate dehydrogenase {Sheep (Ovis orientalis aries) [TaxId: 9940]} Back     information, alignment and structure
>d1pzga1 c.2.1.5 (A:14-163) Lactate dehydrogenase {Toxoplasma gondii [TaxId: 5811]} Back     information, alignment and structure
>d1jqba2 c.2.1.1 (A:1140-1313) Bacterial secondary alcohol dehydrogenase {Clostridium beijerinckii [TaxId: 1520]} Back     information, alignment and structure
>d1ldna1 c.2.1.5 (A:15-162) Lactate dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1i0za1 c.2.1.5 (A:1-160) Lactate dehydrogenase {Human (Homo sapiens), heart isoform (H chain) [TaxId: 9606]} Back     information, alignment and structure
>d1gesa2 c.3.1.5 (A:147-262) Glutathione reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1qp8a1 c.2.1.4 (A:83-263) Putative formate dehydrogenase {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d1hyha1 c.2.1.5 (A:21-166) L-2-hydroxyisocapronate dehydrogenase, L-HICDH {Lactobacillus confusus [TaxId: 1583]} Back     information, alignment and structure
>d1ks9a2 c.2.1.6 (A:1-167) Ketopantoate reductase PanE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1nyta1 c.2.1.7 (A:102-271) Shikimate 5-dehydrogenase AroE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xg5a_ c.2.1.2 (A:) Putative dehydrogenase ARPG836 (MGC4172) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pl8a2 c.2.1.1 (A:146-316) Ketose reductase (sorbitol dehydrogenase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vm6a3 c.2.1.3 (A:1-96,A:183-214) Dihydrodipicolinate reductase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1npya1 c.2.1.7 (A:103-269) Shikimate 5-dehydrogenase-like protein HI0607 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d2g5ca2 c.2.1.6 (A:30-200) Prephenate dehydrogenase TyrA {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1xg5a_ c.2.1.2 (A:) Putative dehydrogenase ARPG836 (MGC4172) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2f1ka2 c.2.1.6 (A:1-165) Prephenate dehydrogenase TyrA {Synechocystis sp. pcc 6803 [TaxId: 1148]} Back     information, alignment and structure
>d1bg6a2 c.2.1.6 (A:4-187) N-(1-D-carboxylethyl)-L-norvaline dehydrogenase {Arthrobacter, strain 1c [TaxId: 1663]} Back     information, alignment and structure
>d1hyea1 c.2.1.5 (A:1-145) MJ0490, lactate/malate dehydrogenase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d2hmva1 c.2.1.9 (A:7-140) Ktn bsu222 {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1v59a2 c.3.1.5 (A:161-282) Dihydrolipoamide dehydrogenase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ps9a3 c.4.1.1 (A:331-465,A:628-671) 2,4-dienoyl-CoA reductase, middle domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1h6va2 c.3.1.5 (A:171-292) Mammalian thioredoxin reductase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1llda1 c.2.1.5 (A:7-149) Lactate dehydrogenase {Bifidobacterium longum, strain am101-2 [TaxId: 216816]} Back     information, alignment and structure
>d2hmva1 c.2.1.9 (A:7-140) Ktn bsu222 {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1vj0a2 c.2.1.1 (A:156-337) Hypothetical protein TM0436 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1wdka3 c.2.1.6 (A:311-496) Fatty oxidation complex alpha subunit, middle domain {Pseudomonas fragi [TaxId: 296]} Back     information, alignment and structure
>d1t2da1 c.2.1.5 (A:1-150) Lactate dehydrogenase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d1ebda2 c.3.1.5 (A:155-271) Dihydrolipoamide dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1nvta1 c.2.1.7 (A:111-287) Shikimate 5-dehydrogenase AroE {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1d7ya2 c.3.1.5 (A:116-236) NADH-dependent ferredoxin reductase, BphA4 {Pseudomonas sp., KKS102 [TaxId: 306]} Back     information, alignment and structure
>d1d1ta2 c.2.1.1 (A:163-338) Alcohol dehydrogenase {Human (Homo sapiens), different isozymes [TaxId: 9606]} Back     information, alignment and structure
>d3cuma2 c.2.1.6 (A:1-162) Hydroxyisobutyrate dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1p77a1 c.2.1.7 (A:102-272) Shikimate 5-dehydrogenase AroE {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1id1a_ c.2.1.9 (A:) Rck domain from putative potassium channel Kch {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2jhfa2 c.2.1.1 (A:164-339) Alcohol dehydrogenase {Horse (Equus caballus) [TaxId: 9796]} Back     information, alignment and structure
>d1ez4a1 c.2.1.5 (A:16-162) Lactate dehydrogenase {Lactobacillus pentosus [TaxId: 1589]} Back     information, alignment and structure
>d1nhpa2 c.3.1.5 (A:120-242) NADH peroxidase {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1f8fa2 c.2.1.1 (A:163-336) Benzyl alcohol dehydrogenase {Acinetobacter calcoaceticus [TaxId: 471]} Back     information, alignment and structure
>d1iy8a_ c.2.1.2 (A:) Levodione reductase {Corynebacterium aquaticum [TaxId: 144185]} Back     information, alignment and structure
>d1lvla2 c.3.1.5 (A:151-265) Dihydrolipoamide dehydrogenase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1mlda1 c.2.1.5 (A:1-144) Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1pgja2 c.2.1.6 (A:1-178) 6-phosphogluconate dehydrogenase {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1e3ia2 c.2.1.1 (A:168-341) Alcohol dehydrogenase {Mouse (Mus musculus), class II [TaxId: 10090]} Back     information, alignment and structure
>d1j4aa1 c.2.1.4 (A:104-300) D-lactate dehydrogenase {Lactobacillus helveticus [TaxId: 1587]} Back     information, alignment and structure
>d3grsa2 c.3.1.5 (A:166-290) Glutathione reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hyha1 c.2.1.5 (A:21-166) L-2-hydroxyisocapronate dehydrogenase, L-HICDH {Lactobacillus confusus [TaxId: 1583]} Back     information, alignment and structure
>d1xhca2 c.3.1.5 (A:104-225) NADH oxidase /nitrite reductase {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d3lada2 c.3.1.5 (A:159-277) Dihydrolipoamide dehydrogenase {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d1mx3a1 c.2.1.4 (A:126-318) Transcription corepressor CtbP {Human (Homo sapiens), Ctbp1 [TaxId: 9606]} Back     information, alignment and structure
>d1feca2 c.3.1.5 (A:170-286) Trypanothione reductase {Crithidia fasciculata [TaxId: 5656]} Back     information, alignment and structure
>d1dxya1 c.2.1.4 (A:101-299) D-2-hydroxyisocaproate dehydrogenase {Lactobacillus casei [TaxId: 1582]} Back     information, alignment and structure
>d1ojta2 c.3.1.5 (A:276-400) Dihydrolipoamide dehydrogenase {Neisseria meningitidis [TaxId: 487]} Back     information, alignment and structure
>d2f1ka2 c.2.1.6 (A:1-165) Prephenate dehydrogenase TyrA {Synechocystis sp. pcc 6803 [TaxId: 1148]} Back     information, alignment and structure
>d1pl8a2 c.2.1.1 (A:146-316) Ketose reductase (sorbitol dehydrogenase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2jfga1 c.5.1.1 (A:1-93) UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase MurD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2naca1 c.2.1.4 (A:148-335) Formate dehydrogenase {Pseudomonas sp., strain 101 [TaxId: 306]} Back     information, alignment and structure
>d1guza1 c.2.1.5 (A:1-142) Malate dehydrogenase {Chlorobium vibrioforme [TaxId: 1098]} Back     information, alignment and structure
>d1e3ja2 c.2.1.1 (A:143-312) Ketose reductase (sorbitol dehydrogenase) {Silverleaf whitefly (Bemisia argentifolii) [TaxId: 77855]} Back     information, alignment and structure
>d1a5za1 c.2.1.5 (A:22-163) Lactate dehydrogenase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1e3ja2 c.2.1.1 (A:143-312) Ketose reductase (sorbitol dehydrogenase) {Silverleaf whitefly (Bemisia argentifolii) [TaxId: 77855]} Back     information, alignment and structure
>d1jqba2 c.2.1.1 (A:1140-1313) Bacterial secondary alcohol dehydrogenase {Clostridium beijerinckii [TaxId: 1520]} Back     information, alignment and structure
>d1vpda2 c.2.1.6 (A:3-163) Hydroxyisobutyrate dehydrogenase {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1q1ra2 c.3.1.5 (A:115-247) Putidaredoxin reductase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1ojua1 c.2.1.5 (A:22-163) Malate dehydrogenase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1a5za1 c.2.1.5 (A:22-163) Lactate dehydrogenase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1sc6a1 c.2.1.4 (A:108-295) Phosphoglycerate dehydrogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1zema1 c.2.1.2 (A:3-262) Xylitol dehydrogenase {Gluconobacter oxydans [TaxId: 442]} Back     information, alignment and structure
>d1gtea4 c.4.1.1 (A:184-287,A:441-532) Dihydropyrimidine dehydrogenase, domain 2 {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1luaa1 c.2.1.7 (A:98-288) Methylene-tetrahydromethanopterin dehydrogenase {Methylobacterium extorquens [TaxId: 408]} Back     information, alignment and structure
>d1uxja1 c.2.1.5 (A:2-143) Malate dehydrogenase {Chloroflexus aurantiacus [TaxId: 1108]} Back     information, alignment and structure
>d1ks9a2 c.2.1.6 (A:1-167) Ketopantoate reductase PanE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2pgda2 c.2.1.6 (A:1-176) 6-phosphogluconate dehydrogenase {Sheep (Ovis orientalis aries) [TaxId: 9940]} Back     information, alignment and structure
>d1p3da1 c.5.1.1 (A:11-106) UDP-N-acetylmuramate-alanine ligase MurC {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1pzga1 c.2.1.5 (A:14-163) Lactate dehydrogenase {Toxoplasma gondii [TaxId: 5811]} Back     information, alignment and structure
>d1i36a2 c.2.1.6 (A:1-152) Conserved hypothetical protein MTH1747 {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1gdha1 c.2.1.4 (A:101-291) D-glycerate dehydrogenase {Hyphomicrobium methylovorum [TaxId: 84]} Back     information, alignment and structure
>d2ldxa1 c.2.1.5 (A:1-159) Lactate dehydrogenase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1p0fa2 c.2.1.1 (A:1164-1337) Alcohol dehydrogenase {Frog (Rana perezi) [TaxId: 8403]} Back     information, alignment and structure
>d1mo9a2 c.3.1.5 (A:193-313) NADH-dependent 2-ketopropyl coenzyme M oxidoreductase/carboxylase {Xanthobacter sp., py2 [TaxId: 35809]} Back     information, alignment and structure
>d1p77a1 c.2.1.7 (A:102-272) Shikimate 5-dehydrogenase AroE {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1gtea4 c.4.1.1 (A:184-287,A:441-532) Dihydropyrimidine dehydrogenase, domain 2 {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1hyea1 c.2.1.5 (A:1-145) MJ0490, lactate/malate dehydrogenase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d2fzwa2 c.2.1.1 (A:163-338) Alcohol dehydrogenase {Human (Homo sapiens), different isozymes [TaxId: 9606]} Back     information, alignment and structure
>d1txga2 c.2.1.6 (A:1-180) Glycerol-3- phosphate dehydrogenase {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1yqga2 c.2.1.6 (A:1-152) Pyrroline-5-carboxylate reductase ProC {Neisseria meningitidis, serogroup B [TaxId: 487]} Back     information, alignment and structure
>d1yxma1 c.2.1.2 (A:7-303) Peroxisomal trans 2-enoyl CoA reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vj0a2 c.2.1.1 (A:156-337) Hypothetical protein TM0436 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1hdoa_ c.2.1.2 (A:) Biliverdin IX beta reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2b69a1 c.2.1.2 (A:4-315) UDP-glucuronate decarboxylase 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1d7ya2 c.3.1.5 (A:116-236) NADH-dependent ferredoxin reductase, BphA4 {Pseudomonas sp., KKS102 [TaxId: 306]} Back     information, alignment and structure
>d1dxla2 c.3.1.5 (A:153-275) Dihydrolipoamide dehydrogenase {Garden pea (Pisum sativum) [TaxId: 3888]} Back     information, alignment and structure
>d1ez4a1 c.2.1.5 (A:16-162) Lactate dehydrogenase {Lactobacillus pentosus [TaxId: 1589]} Back     information, alignment and structure
>d1iy8a_ c.2.1.2 (A:) Levodione reductase {Corynebacterium aquaticum [TaxId: 144185]} Back     information, alignment and structure
>d1xhla_ c.2.1.2 (A:) Hypothetical protein F25D1.5 {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1i0za1 c.2.1.5 (A:1-160) Lactate dehydrogenase {Human (Homo sapiens), heart isoform (H chain) [TaxId: 9606]} Back     information, alignment and structure
>d2vapa1 c.32.1.1 (A:23-231) Cell-division protein FtsZ {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1luaa1 c.2.1.7 (A:98-288) Methylene-tetrahydromethanopterin dehydrogenase {Methylobacterium extorquens [TaxId: 408]} Back     information, alignment and structure
>d1w5fa1 c.32.1.1 (A:22-215) Cell-division protein FtsZ {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1vpda2 c.2.1.6 (A:3-163) Hydroxyisobutyrate dehydrogenase {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1nvta1 c.2.1.7 (A:111-287) Shikimate 5-dehydrogenase AroE {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1ldna1 c.2.1.5 (A:15-162) Lactate dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1ps9a3 c.4.1.1 (A:331-465,A:628-671) 2,4-dienoyl-CoA reductase, middle domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1t2da1 c.2.1.5 (A:1-150) Lactate dehydrogenase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d1o6za1 c.2.1.5 (A:22-162) Malate dehydrogenase {Archaeon Haloarcula marismortui [TaxId: 2238]} Back     information, alignment and structure
>d1xkqa_ c.2.1.2 (A:) Hypothetical protein R05D8.7 {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1fcda1 c.3.1.5 (A:1-114,A:256-327) Flavocytochrome c sulfide dehydrogenase, FCSD, flavin-binding subunit {Purple phototrophic bacterium (Chromatium vinosum) [TaxId: 1049]} Back     information, alignment and structure
>d1id1a_ c.2.1.9 (A:) Rck domain from putative potassium channel Kch {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1uxja1 c.2.1.5 (A:2-143) Malate dehydrogenase {Chloroflexus aurantiacus [TaxId: 1108]} Back     information, alignment and structure
>d1fmca_ c.2.1.2 (A:) 7-alpha-hydroxysteroid dehydrogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1y6ja1 c.2.1.5 (A:7-148) Lactate dehydrogenase {Clostridium thermocellum [TaxId: 1515]} Back     information, alignment and structure
>d1pj5a2 c.3.1.2 (A:4-219,A:339-427) N,N-dimethylglycine oxidase {Arthrobacter globiformis [TaxId: 1665]} Back     information, alignment and structure
>d1guza1 c.2.1.5 (A:1-142) Malate dehydrogenase {Chlorobium vibrioforme [TaxId: 1098]} Back     information, alignment and structure
>d1spxa_ c.2.1.2 (A:) Glucose dehydrogenase (5l265) {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d2cvza2 c.2.1.6 (A:2-157) Hydroxyisobutyrate dehydrogenase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1ofua1 c.32.1.1 (A:11-208) Cell-division protein FtsZ {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1zk4a1 c.2.1.2 (A:1-251) R-specific alcohol dehydrogenase {Lactobacillus brevis [TaxId: 1580]} Back     information, alignment and structure
>d2bkaa1 c.2.1.2 (A:5-236) TAT-interacting protein TIP30 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hdoa_ c.2.1.2 (A:) Biliverdin IX beta reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u8xx1 c.2.1.5 (X:3-169) Maltose-6'-phosphate glucosidase GlvA {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2gdza1 c.2.1.2 (A:3-256) 15-hydroxyprostaglandin dehydrogenase, PGDH {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yl7a1 c.2.1.3 (A:2-105,A:215-245) Dihydrodipicolinate reductase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1mlda1 c.2.1.5 (A:1-144) Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1f8fa2 c.2.1.1 (A:163-336) Benzyl alcohol dehydrogenase {Acinetobacter calcoaceticus [TaxId: 471]} Back     information, alignment and structure
>d1w6ua_ c.2.1.2 (A:) 2,4-dienoyl-CoA reductase, mitochondrial (DECR) {Human (Homo sapiens), [TaxId: 9606]} Back     information, alignment and structure
>d2bgka1 c.2.1.2 (A:11-278) Rhizome secoisolariciresinol dehydrogenase {Mayapple (Podophyllum peltatum) [TaxId: 35933]} Back     information, alignment and structure
>d1h2ba2 c.2.1.1 (A:155-326) Alcohol dehydrogenase {Archaeon Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d2pv7a2 c.2.1.6 (A:92-243) Prephenate dehydrogenase TyrA {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1wdka3 c.2.1.6 (A:311-496) Fatty oxidation complex alpha subunit, middle domain {Pseudomonas fragi [TaxId: 296]} Back     information, alignment and structure
>d1aoga2 c.3.1.5 (A:170-286) Trypanothione reductase {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d1ae1a_ c.2.1.2 (A:) Tropinone reductase {Jimsonweed (Datura stramonium), I [TaxId: 4076]} Back     information, alignment and structure
>d1llda1 c.2.1.5 (A:7-149) Lactate dehydrogenase {Bifidobacterium longum, strain am101-2 [TaxId: 216816]} Back     information, alignment and structure
>d1obba1 c.2.1.5 (A:2-172) Alpha-glucosidase AglA {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2hjsa1 c.2.1.3 (A:3-129,A:320-336) Usg-1 protein homolog PA3116 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1zema1 c.2.1.2 (A:3-262) Xylitol dehydrogenase {Gluconobacter oxydans [TaxId: 442]} Back     information, alignment and structure
>d1c0pa1 c.4.1.2 (A:999-1193,A:1289-1361) D-aminoacid oxidase, N-terminal domain {Rhodotorula gracilis [TaxId: 5286]} Back     information, alignment and structure
>d1k2wa_ c.2.1.2 (A:) Sorbitol dehydrogenase {Rhodobacter sphaeroides [TaxId: 1063]} Back     information, alignment and structure
>d1e3ia2 c.2.1.1 (A:168-341) Alcohol dehydrogenase {Mouse (Mus musculus), class II [TaxId: 10090]} Back     information, alignment and structure
>d2ag5a1 c.2.1.2 (A:1-245) Dehydrogenase/reductase SDR family member 6, DHRS6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sbya1 c.2.1.2 (A:1-254) Drosophila alcohol dehydrogenase {Fly (Drosophila lebanonensis) [TaxId: 7225]} Back     information, alignment and structure
>d2c07a1 c.2.1.2 (A:54-304) beta-keto acyl carrier protein reductase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d2vapa1 c.32.1.1 (A:23-231) Cell-division protein FtsZ {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1ebda2 c.3.1.5 (A:155-271) Dihydrolipoamide dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d2cmda1 c.2.1.5 (A:1-145) Malate dehydrogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xhca2 c.3.1.5 (A:104-225) NADH oxidase /nitrite reductase {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1vl8a_ c.2.1.2 (A:) Gluconate 5-dehydrogenase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1ygya1 c.2.1.4 (A:99-282) Phosphoglycerate dehydrogenase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1y6ja1 c.2.1.5 (A:7-148) Lactate dehydrogenase {Clostridium thermocellum [TaxId: 1515]} Back     information, alignment and structure
>d1w5fa1 c.32.1.1 (A:22-215) Cell-division protein FtsZ {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1i36a2 c.2.1.6 (A:1-152) Conserved hypothetical protein MTH1747 {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1xhla_ c.2.1.2 (A:) Hypothetical protein F25D1.5 {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1f0ya2 c.2.1.6 (A:12-203) Short chain L-3-hydroxyacyl CoA dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ew8a1 c.2.1.2 (A:3-249) (s)-1-phenylethanol dehydrogenase {Azoarcus sp. ebn1 [TaxId: 76114]} Back     information, alignment and structure
>d2jhfa2 c.2.1.1 (A:164-339) Alcohol dehydrogenase {Horse (Equus caballus) [TaxId: 9796]} Back     information, alignment and structure
>d1nhpa2 c.3.1.5 (A:120-242) NADH peroxidase {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1mv8a2 c.2.1.6 (A:1-202) GDP-mannose 6-dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1f0ya2 c.2.1.6 (A:12-203) Short chain L-3-hydroxyacyl CoA dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2g5ca2 c.2.1.6 (A:30-200) Prephenate dehydrogenase TyrA {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1yb1a_ c.2.1.2 (A:) 17-beta-hydroxysteroid dehydrogenase type XI {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ojua1 c.2.1.5 (A:22-163) Malate dehydrogenase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1geea_ c.2.1.2 (A:) Glucose dehydrogenase {Bacillus megaterium [TaxId: 1404]} Back     information, alignment and structure
>d1t4ba1 c.2.1.3 (A:1-133,A:355-367) Aspartate beta-semialdehyde dehydrogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2fy8a1 c.2.1.9 (A:116-244) Potassium channel-related protein MthK {Archaeon Methanothermobacter thermautotrophicus [TaxId: 145262]} Back     information, alignment and structure
>d1d1ta2 c.2.1.1 (A:163-338) Alcohol dehydrogenase {Human (Homo sapiens), different isozymes [TaxId: 9606]} Back     information, alignment and structure
>d2b69a1 c.2.1.2 (A:4-315) UDP-glucuronate decarboxylase 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1b5qa1 c.3.1.2 (A:5-293,A:406-463) Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]} Back     information, alignment and structure
>d1j6ua1 c.5.1.1 (A:0-88) UDP-N-acetylmuramate-alanine ligase MurC {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1onfa2 c.3.1.5 (A:154-270) Glutathione reductase {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1pj5a2 c.3.1.2 (A:4-219,A:339-427) N,N-dimethylglycine oxidase {Arthrobacter globiformis [TaxId: 1665]} Back     information, alignment and structure
>d1u8xx1 c.2.1.5 (X:3-169) Maltose-6'-phosphate glucosidase GlvA {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1xkqa_ c.2.1.2 (A:) Hypothetical protein R05D8.7 {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1q1ra1 c.3.1.5 (A:2-114,A:248-319) Putidaredoxin reductase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1k0ia1 c.3.1.2 (A:1-173,A:276-394) p-Hydroxybenzoate hydroxylase, PHBH {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1gesa2 c.3.1.5 (A:147-262) Glutathione reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ydea1 c.2.1.2 (A:4-253) Retinal dehydrogenase/reductase 3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v59a2 c.3.1.5 (A:161-282) Dihydrolipoamide dehydrogenase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1p0fa2 c.2.1.1 (A:1164-1337) Alcohol dehydrogenase {Frog (Rana perezi) [TaxId: 8403]} Back     information, alignment and structure
>d1ryia1 c.3.1.2 (A:1-218,A:307-364) Glycine oxidase ThiO {Bacillus sp. [TaxId: 1409]} Back     information, alignment and structure
>d1xhca1 c.3.1.5 (A:1-103,A:226-289) NADH oxidase /nitrite reductase {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1pgja2 c.2.1.6 (A:1-178) 6-phosphogluconate dehydrogenase {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1cjca2 c.4.1.1 (A:6-106,A:332-460) Adrenodoxin reductase of mitochondrial p450 systems {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1xq1a_ c.2.1.2 (A:) Tropinone reductase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1spxa_ c.2.1.2 (A:) Glucose dehydrogenase (5l265) {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1diha1 c.2.1.3 (A:2-130,A:241-273) Dihydrodipicolinate reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2pv7a2 c.2.1.6 (A:92-243) Prephenate dehydrogenase TyrA {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1bdba_ c.2.1.2 (A:) Cis-biphenyl-2,3-dihydrodiol-2,3-dehydrogenase {Pseudomonas sp., lb400 [TaxId: 306]} Back     information, alignment and structure
>d1up7a1 c.2.1.5 (A:1-162) 6-phospho-beta-glucosidase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2ae2a_ c.2.1.2 (A:) Tropinone reductase {Jimsonweed (Datura stramonium), II [TaxId: 4076]} Back     information, alignment and structure
>d1lvla2 c.3.1.5 (A:151-265) Dihydrolipoamide dehydrogenase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1g0oa_ c.2.1.2 (A:) 1,3,8-trihydroxynaphtalene reductase (THNR, naphtol reductase) {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} Back     information, alignment and structure
>d1seza1 c.3.1.2 (A:13-329,A:442-497) Protoporphyrinogen oxidase {Tobacco (Nicotiana tabacum) [TaxId: 4097]} Back     information, alignment and structure
>d1cdoa2 c.2.1.1 (A:165-339) Alcohol dehydrogenase {Cod (Gadus callarias) [TaxId: 8053]} Back     information, alignment and structure
>d1fcda1 c.3.1.5 (A:1-114,A:256-327) Flavocytochrome c sulfide dehydrogenase, FCSD, flavin-binding subunit {Purple phototrophic bacterium (Chromatium vinosum) [TaxId: 1049]} Back     information, alignment and structure
>d1wmaa1 c.2.1.2 (A:2-276) Carbonyl reductase/20beta-hydroxysteroid dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1djqa3 c.4.1.1 (A:341-489,A:646-729) Trimethylamine dehydrogenase, middle domain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} Back     information, alignment and structure
>d1yxma1 c.2.1.2 (A:7-303) Peroxisomal trans 2-enoyl CoA reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1n1ea2 c.2.1.6 (A:9-197) Glycerol-3- phosphate dehydrogenase {Trypanosome (Leishmania mexicana) [TaxId: 5665]} Back     information, alignment and structure
>d2voua1 c.3.1.2 (A:2-163,A:292-394) Dihydroxypyridine hydroxylase DhpH {Arthrobacter nicotinovorans [TaxId: 29320]} Back     information, alignment and structure
>d1ofua1 c.32.1.1 (A:11-208) Cell-division protein FtsZ {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1up7a1 c.2.1.5 (A:1-162) 6-phospho-beta-glucosidase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1c1da1 c.2.1.7 (A:149-349) Phenylalanine dehydrogenase {Rhodococcus sp., M4 [TaxId: 1831]} Back     information, alignment and structure
>d1q1ra2 c.3.1.5 (A:115-247) Putidaredoxin reductase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1y7ta1 c.2.1.5 (A:0-153) Malate dehydrogenase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1txga2 c.2.1.6 (A:1-180) Glycerol-3- phosphate dehydrogenase {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1gega_ c.2.1.2 (A:) meso-2,3-butanediol dehydrogenase {Klebsiella pneumoniae [TaxId: 573]} Back     information, alignment and structure
>d1nffa_ c.2.1.2 (A:) Putative oxidoreductase Rv2002 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2rhca1 c.2.1.2 (A:5-261) beta-keto acyl carrier protein reductase {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
>d1obba1 c.2.1.5 (A:2-172) Alpha-glucosidase AglA {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1b5qa1 c.3.1.2 (A:5-293,A:406-463) Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]} Back     information, alignment and structure
>d3grsa2 c.3.1.5 (A:166-290) Glutathione reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jaya_ c.2.1.6 (A:) Coenzyme F420H2:NADP+ oxidoreductase (FNO) {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1m6ia2 c.3.1.5 (A:264-400) Apoptosis-inducing factor (AIF) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6va2 c.3.1.5 (A:171-292) Mammalian thioredoxin reductase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1fmca_ c.2.1.2 (A:) 7-alpha-hydroxysteroid dehydrogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1c0pa1 c.4.1.2 (A:999-1193,A:1289-1361) D-aminoacid oxidase, N-terminal domain {Rhodotorula gracilis [TaxId: 5286]} Back     information, alignment and structure
>d1sbya1 c.2.1.2 (A:1-254) Drosophila alcohol dehydrogenase {Fly (Drosophila lebanonensis) [TaxId: 7225]} Back     information, alignment and structure
>d1d7ya1 c.3.1.5 (A:5-115,A:237-308) NADH-dependent ferredoxin reductase, BphA4 {Pseudomonas sp., KKS102 [TaxId: 306]} Back     information, alignment and structure
>d1ydwa1 c.2.1.3 (A:6-133,A:305-360) Probable oxidoreductase At4g09670 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1seza1 c.3.1.2 (A:13-329,A:442-497) Protoporphyrinogen oxidase {Tobacco (Nicotiana tabacum) [TaxId: 4097]} Back     information, alignment and structure
>d2a4ka1 c.2.1.2 (A:2-242) beta-keto acyl carrier protein reductase {Thermus thermophilus, TTHB020 [TaxId: 274]} Back     information, alignment and structure
>d1i24a_ c.2.1.2 (A:) Sulfolipid biosynthesis protein SQD1 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1y1pa1 c.2.1.2 (A:2-343) Aldehyde reductase II {Sporobolomyces salmonicolor [TaxId: 5005]} Back     information, alignment and structure
>d1zk4a1 c.2.1.2 (A:1-251) R-specific alcohol dehydrogenase {Lactobacillus brevis [TaxId: 1580]} Back     information, alignment and structure
>d1djqa3 c.4.1.1 (A:341-489,A:646-729) Trimethylamine dehydrogenase, middle domain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} Back     information, alignment and structure
>d2voua1 c.3.1.2 (A:2-163,A:292-394) Dihydroxypyridine hydroxylase DhpH {Arthrobacter nicotinovorans [TaxId: 29320]} Back     information, alignment and structure
>d5mdha1 c.2.1.5 (A:1-154) Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1uufa2 c.2.1.1 (A:145-312) Hypothetical protein YahK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1w6ua_ c.2.1.2 (A:) 2,4-dienoyl-CoA reductase, mitochondrial (DECR) {Human (Homo sapiens), [TaxId: 9606]} Back     information, alignment and structure
>d1jvba2 c.2.1.1 (A:144-313) Alcohol dehydrogenase {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1yb1a_ c.2.1.2 (A:) 17-beta-hydroxysteroid dehydrogenase type XI {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qyda_ c.2.1.2 (A:) Pinoresinol-lariciresinol reductase {Giant arborvitae (Thuja plicata) [TaxId: 3316]} Back     information, alignment and structure
>d2bgka1 c.2.1.2 (A:11-278) Rhizome secoisolariciresinol dehydrogenase {Mayapple (Podophyllum peltatum) [TaxId: 35933]} Back     information, alignment and structure
>d1jvba2 c.2.1.1 (A:144-313) Alcohol dehydrogenase {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1cjca2 c.4.1.1 (A:6-106,A:332-460) Adrenodoxin reductase of mitochondrial p450 systems {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2gdza1 c.2.1.2 (A:3-256) 15-hydroxyprostaglandin dehydrogenase, PGDH {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rq2a1 c.32.1.1 (A:8-205) Cell-division protein FtsZ {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1vm6a3 c.2.1.3 (A:1-96,A:183-214) Dihydrodipicolinate reductase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d7mdha1 c.2.1.5 (A:23-197) Malate dehydrogenase {Sorghum (Sorghum vulgare), chloroplast [TaxId: 4558]} Back     information, alignment and structure
>d1db3a_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2bi7a1 c.4.1.3 (A:2-247,A:317-384) UDP-galactopyranose mutase, N-terminal domain {Klebsiella pneumoniae [TaxId: 573]} Back     information, alignment and structure
>d1h5qa_ c.2.1.2 (A:) Mannitol dehydrogenase {Mushroom (Agaricus bisporus) [TaxId: 5341]} Back     information, alignment and structure
>d1o6za1 c.2.1.5 (A:22-162) Malate dehydrogenase {Archaeon Haloarcula marismortui [TaxId: 2238]} Back     information, alignment and structure
>d2iida1 c.3.1.2 (A:4-319,A:433-486) L-aminoacid oxidase {Malayan pit viper (Calloselasma rhodostoma) [TaxId: 8717]} Back     information, alignment and structure
>d1ja9a_ c.2.1.2 (A:) 1,3,6,8-tetrahydroxynaphthalene reductase {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} Back     information, alignment and structure
>d3lada2 c.3.1.5 (A:159-277) Dihydrolipoamide dehydrogenase {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d1vl6a1 c.2.1.7 (A:155-376) Malate oxidoreductase (malic enzyme) {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1pjca1 c.2.1.4 (A:136-303) L-alanine dehydrogenase {Phormidium lapideum [TaxId: 32060]} Back     information, alignment and structure
>d1uufa2 c.2.1.1 (A:145-312) Hypothetical protein YahK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1mo9a2 c.3.1.5 (A:193-313) NADH-dependent 2-ketopropyl coenzyme M oxidoreductase/carboxylase {Xanthobacter sp., py2 [TaxId: 35809]} Back     information, alignment and structure
>d1ojta2 c.3.1.5 (A:276-400) Dihydrolipoamide dehydrogenase {Neisseria meningitidis [TaxId: 487]} Back     information, alignment and structure
>d1geea_ c.2.1.2 (A:) Glucose dehydrogenase {Bacillus megaterium [TaxId: 1404]} Back     information, alignment and structure
>d2fzwa2 c.2.1.1 (A:163-338) Alcohol dehydrogenase {Human (Homo sapiens), different isozymes [TaxId: 9606]} Back     information, alignment and structure
>d1k0ia1 c.3.1.2 (A:1-173,A:276-394) p-Hydroxybenzoate hydroxylase, PHBH {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1xeaa1 c.2.1.3 (A:2-122,A:267-312) Putative oxidoreductase VCA1048 {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1vl8a_ c.2.1.2 (A:) Gluconate 5-dehydrogenase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1s6ya1 c.2.1.5 (A:4-172) 6-phospho-beta-glucosidase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1xhca1 c.3.1.5 (A:1-103,A:226-289) NADH oxidase /nitrite reductase {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d3c96a1 c.3.1.2 (A:4-182,A:294-402) Monooxygenase PhzS {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d2c07a1 c.2.1.2 (A:54-304) beta-keto acyl carrier protein reductase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure