Citrus Sinensis ID: 001407

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820-------830-------840-------850-------860-------870-------880-------890-------900-------910-------920-------930-------940-------950-------960-------970-------980-------990------1000------1010------1020------1030------1040------1050------1060------1070------1080---
MDSSDTVQIVGIWGMGGIGKTTLAKAIFDQFSHEFEGSCFVSDVRGNSETAGGLEHLQKQMLSTTLSEKLEVAGPNIPHFTKERVRRMKLLIVLDDVNEVGQLKRLIGELDQFGQGSRIVVTTRDKRVLEKFRGEEKKIYRVNGLEFEEAFEHFCNFAFKENHCPEDLNWHSRSVVSYTKGNPLVLEVLGSSLCLKRKSHWGKVLHDLNRICESEIHDIYDILKISFNKLTPRVKSIFLDIACFFEGEDKDFVASILDDSESDVLDILIDKSLVSISGNFLNMHDILQEMGRQIVRQESEKEPGKRSRLWDPKEISRVLKHNKGTDAIEGIFLDLSKIKGINLDPRAFTNMSNLRLFKFYVPKFYEIEKLPSMSTEEQLSYSKVQLPNGLDYLPKKLRYLHWDTYPLRTLPSNFKPKNLVELNLRCSKVEQPWEGEKACVPSSIQNFKYLSALSFKGCQSLRSFPSNLHFVCPVTINFSYCVNLIEFPQISGKVTRLYLGQSAIEEVPSSIECLTDLEVLDLRGCKRLKRISTSFCKLRSLVTLILLGCLNLEHFPEILEKMEHLKRIYSDRTPITELPSSFENLPGLEVLFVEDCSKLDNLPDNIGSLEYLYYILAAASAISQLPSSVALSNMLRSLDSSHCKGLESFPRTFLLGLSAMGLLHISDYAVREIPQEIAYLSSLEILYLSGNNFESLPAIIKQMSQLRFIHLEDFNMLQSLPELPLCLKYLHLIDCKMLQSLPVLPFCLESLDLTGCNMLRSLPELPLCLQYLNLEDCNMLRSLPELPLCLQLLTVRNCNRLQSLPEILLCLQELDASVLEKLSKHSPDLQWAPESLKSAAICFEFTNCLKLNGKANNKILADSLLRIRHMAIASLRLGYEMAINEKLSELRGSLIVLPGSEIPDWFSNQSSGSSICIQLPPHSSCRNLIGFAFCAVLDSKKVDSDCFRYFYVSFQFDLEIKTLSETKHVDLGYNSRYIEDLIDSDRVILGFKPCLNVGFPDGYHHTIATFKFFAERKFYKIKRCGLCPVYANPSETKDNTFTINFATEVWKLDDLPSASGTLDVEELELSPKRICRANQINTP
ccccccEEEEEEEcccccHHHHHHHHHHHHHHccccEEEEccccccHHcccccHHHHHHHHHHHHccccccccccccHHHHHHHHccccEEEEEEccccHHHHHHHHccccccccccEEEEEcccHHHHHHHccccccEEEcccccHHHHHHHHHHHccccccccccHHHHHHHHHHHcccccccHHHHccccccccHHHHHHHHHHHHHccccccccHHHHEEEccccccHHccccEEEEEcccccccHHHHHHHHccccccHHHHcccccccEEEccEEEccHHHHHHHHHHHHHHcccccccccccccHHHHHHHHccccccccEEEEEEEccccccccccHHHHccccccEEEEEEccccccccccccccHHHHcccccccccccccccccccEEEEEcccccccccccccccccEEEEccccccccccccccccccccccccccccEEEccccccccccccccccccccEEEccccccccccccccccccHHcccccccEEccccccccccccEEEcccccccccccccccccccccEEEcccccccEEccHHHcccccccEEcccccccEEEcccccccccccEEEcccccccccccccccccHHHHHHHccccccccccccccccccccEEEcccccccccccccccccccccHHHcccccccccccccccccccccEEEccccccccccccccccccccEEEccccccccccccccccccEEEcccccccccccccccccccccccccccccccccccccccEEEccccccccccccccccccEEccccccccccccccHHHHHccccccccccccccccccccccccccccEEEEEEccccccHHHcHHHHHHHHHHHHHHHHHHHcccHHHHHHccccccccEEEEEccccccccccccccccEEEEEcccccccccccEEEEEEEEccccccccccccEEEEEEEEEEEEccccccEEEEccccccccccccccEEEEEEEcccccccccccEEEEEEEEEEEEcccEEEEEEEEEEEEccccccccccccccccccccccccccccccccccccccccccccccccccccc
ccccccEEEEEEEccccccHHHHHHHHHHHHHHHccHHHHHHHHHcccccccHHHHHHHHHHHHHHccccccccccHHHHHHHHHcccEEEEEEcccccHHHHHHHHccccccccccEEEEEEccHHHHHHccccccEEEEEccccHHHHHHHHHHHHHccccccccHHHHHHHHHHHHccccHHHHHHHHHHccccHHHHHHHHHHHHHccccccHHHHHHHEEccccccHHHHHHHHHHHHHHccccHHHHHHHHHHcHHHHHHHHHHcEEEEEccccEEHHHHHHHHHHHHHHHcccccccccEEcccHHHHHHHHHccccccEEEEEEEEcccccEEcccHHHHHHHcccEEEEEEcccccccccccccHHcccccccccEcccccccccHccEEEEEcccccccccccccHHHEEEEEccccHHHHHHccccccccHHHccccccEEEEcccccccccccccccccccHEEEccccccccccccHHHcHcEEEcccccccEccccHccHcccEEEEccccccHccccccccccccccEEEccccccHHcccHHcccccccEEEEccccccccccccHcccccccEEEccccccHcccccccccHHHHHHHcccccccccccccHcccccccEEEccccccHcccccHHcccccccEEEEccccccccccccHccHHcccEEEcccccccccccHHHHcccccEEEccccccHccccccccccHHEccccccccccccccHHHccEEcccccccHHHcHHHHHHccEEcccccccccccccccHHccEEEcccccHHccccccHHHHHHHHHcccccccccccccccccHHcccccEEEEccccHHHHHcccccccHHHHHHHHHHHcccHHccHHHHHHHHHHcccccEEEcccccccHHHEEcccccEEEEEcccccccccccEEEEEEEEEEccccccccccEEEEEEEEEEccccccccccccccccccccccccccEEEEEEcccccccccccccEEEEEEEEEcccccEEEEEcEEEEEEEccccccccccccccccccccccccccccccccHHHccccHHccccccccccc
MDSSDTVQIVGIwgmggigktTLAKAIFDQFshefegscfvsdvrgnsetaggLEHLQKQMLSTTLSEklevagpniphfTKERVRRMKLLIVLDDVNEVGQLKRLIGEldqfgqgsrivvttRDKRVLEKFRGEEKKIYRVNGLEFEEAFEHFCnfafkenhcpedlnwhsrsvvsytkgnPLVLEVLGsslclkrkshwGKVLHDLNRICESEIHDIYDILKISFNKLTPRVKSIFLDIacffegedkDFVAsilddsesdvLDILIDKSLVSISGNFLNMHDILQEMGRQIVRqesekepgkrsrlwdpkeISRVLkhnkgtdaiEGIFLDLskikginldpraftnmsnlrlfkfyvpkfyeieklpsmsteeqlsyskvqlpngldylpkklrylhwdtyplrtlpsnfkpknlVELNLRCskveqpwegekacvpssiqnFKYLSAlsfkgcqslrsfpsnlhfvcpvtINFSYCVNliefpqisgkvtrlylgqsaieevpssiecltdlevldlrgckrLKRISTSFCKLRSLVTLILLGCLNLEHFPEILEKMEHLKRiysdrtpitelpssfenlpglevlfvedcskldnlpdnigsLEYLYYILAAASAISQLPSSVALSNMLRSLdsshckglesfprTFLLGLSAMGLLHISDYAVREIPQEIAYLSSLEILYLSGNNFESLPAIIKQMSQLRFIHLEdfnmlqslpelplcLKYLHLIdckmlqslpvlpfclesldltgcnmlrslpelplclqylnledcnmlrslpelplclqlltvrncnrlqSLPEILLCLQELDASVLEKLSkhspdlqwapeslKSAAICFEFTNclklngkaNNKILADSLLRIRHMAIASLRLGYEMAINEKLSELRGSlivlpgseipdwfsnqssgssiciqlpphsscrnlIGFAFCAVldskkvdsdcfrYFYVSFQFDLEIktlsetkhvdlgynsryiedlidsdrvilgfkpclnvgfpdgyhhtIATFKFFAERKFYkikrcglcpvyanpsetkdntfTINFATEvwklddlpsasgtldveelelspkricranqintp
MDSSDTVQIVGIWGMGGIGKTTLAKAIFDQFSHEFEGSCFVSDVRGNSETAGGLEHLQKQMLSTTLSeklevagpniphftkeRVRRMKLLIVLDDVNEVGQLKRLigeldqfgqgsrivvttrdkrvlekfrgeekkiyrvNGLEFEEAFEHFCNFAFKENHCPEDLNWHSRSVVSYTKGNPLVLEVLGSSLCLKRKSHWGKVLHDLNRICESEIHDIYDILKISFNKLTPRVKSIFLDIACFFEGEDKDFVASILDDSESDVLDILIDKSLVSISGNFLNMHDILQEMGRQIVRqesekepgkrsrlwdpkeisrvlkhnkgtdaiEGIFLDLSKIKGINLDPRAFTNMSNLRLFKFYVPKFYEIEKLPSMSTEEQLSYSKVQLPNGLDYLPKKLRYLHWDTYPLrtlpsnfkpknlVELNLRCSKVEQPWEGEKACVPSSIQNFKYLSALSFKGCQSLRSFPSNLHFVCPVTINFSYCVNLIEFPQISGKVTRLYLGQSAIEevpssiecltdlevldlrgcKRLKRistsfcklrSLVTLILLGCLNLEHFPEILEKMEHLKRIYSDRTPITELPSSFENLPGLEVLFVEDCSKLDNLPDNIGSLEYLYYILAAASAISQLPSSVALSNMLRSLDSSHCKGLESFPRTFLLGLSAMGLLHISDYAVREIPQEIAYLSSLEILYLSGNNFESLPAIIKQMSQLRFIHLEDFNMLQSLPELPLCLKYLHLIDCKMLQSLPVLPFCLESLDLTGCNMLRSLPELPLCLQYLNLEDCNMLRSLPELPLCLQLLTVRNCNRLQSLPEILLCLQELDASVLEKLSKHSPDLQWAPESLKSAAICFEFTNCLKLNGKANNKILADSLLRIRHMAIASLRLGYEMAINEKLSELRGSLIVLPGSEIPDWFSNQSSGSSICIQLPPHSSCRNLIGFAFCAVLDSKKVDSDCFRYFYVSFQFdleiktlsetkhvdlgyNSRYIEDLIDSDRVILGFKPCLNVGFPDGYHHTIATFKFFAERKFYKIKRCGLCPVyanpsetkdnTFTINFATEVWKLDDLPSASGTldveelelspkricranqintp
MDSSDTVQIVGIWGMGGIGKTTLAKAIFDQFSHEFEGSCFVSDVRGNSETAGGLEHLQKQMLSTTLSEKLEVAGPNIPHFTKERVRRMKLLIVLDDVNEVGQLKRLIGELDQFGQGSRIVVTTRDKRVLEKFRGEEKKIYRVNGLEFEEAFEHFCNFAFKENHCPEDLNWHSRSVVSYTKGNPLVLEVLGSSLCLKRKSHWGKVLHDLNRICESEIHDIYDILKISFNKLTPRVKSIFLDIACFFEGEDKDFVASILDDSESDVLDILIDKSLVSISGNFLNMHDILQEMGRQIVRQESEKEPGKRSRLWDPKEISRVLKHNKGTDAIEGIFLDLSKIKGINLDPRAFTNMSNLRLFKFYVPKFYEIEKLPSMSTEEQLSYSKVQLPNGLDYLPKKLRYLHWDTYPLRTLPSNFKPKNLVELNLRCSKVEQPWEGEKACVPSSIQNFKYLSALSFKGCQSLRSFPSNLHFVCPVTINFSYCVNLIEFPQISGKVTRLYLGQSAIEEVPSSIECLTDLEVLDLRGCKRLKRISTSFCKLRSLVTLILLGCLNLEHFPEILEKMEHLKRIYSDRTPITELPSSFENLPGLEVLFVEDCSKLDNLPDNIGsleylyyilaaasaisqlpssVALSNMLRSLDSSHCKGLESFPRTFLLGLSAMGLLHISDYAVREIPQEIAYLSSLEILYLSGNNFESLPAIIKQMSQLRFIHLEDFNMLQSLPELPLCLKYLHLIDCKMLQSLPVLPFCLESLDLTGCNMLRSLPELPLCLQYLNLEDCNMlrslpelplclqllTVRNCNRLQSLPEILLCLQELDASVLEKLSKHSPDLQWAPESLKSAAICFEFTNCLKLNGKANNKILADSLLRIRHMAIASLRLGYEMAINEKLSELRGSLIVLPGSEIPDWFSNQSSGSSICIQLPPHSSCRNLIGFAFCAVLDSKKVDSDCFRYFYVSFQFDLEIKTLSETKHVDLGYNSRYIEDLIDSDRVILGFKPCLNVGFPDGYHHTIATFKFFAERKFYKIKRCGLCPVYANPSETKDNTFTINFATEVWKLDDLPSASGTLDVEELELSPKRICRANQINTP
******VQIVGIWGMGGIGKTTLAKAIFDQFSHEFEGSCFVSDVR************************LEVAGPNIPHFTKERVRRMKLLIVLDDVNEVGQLKRLIGELDQFGQGSRIVVTTRDKRVLEKFRGEEKKIYRVNGLEFEEAFEHFCNFAFKENHCPEDLNWHSRSVVSYTKGNPLVLEVLGSSLCLKRKSHWGKVLHDLNRICESEIHDIYDILKISFNKLTPRVKSIFLDIACFFEGEDKDFVASILDDSESDVLDILIDKSLVSISGNFLNMHDILQEMG************************SRVLKHNKGTDAIEGIFLDLSKIKGINLDPRAFTNMSNLRLFKFYVPKFYEIEKLP*******LSYSKVQLPNGLDYLPKKLRYLHWDTYPLRTLPSNFKPKNLVELNLRCSKVEQPWEGEKACVPSSIQNFKYLSALSFKGCQSLRSFPSNLHFVCPVTINFSYCVNLIEFPQISGKVTRLYLGQSAIEEVPSSIECLTDLEVLDLRGCKRLKRISTSFCKLRSLVTLILLGCLNLEHFPEILEKMEHLKRIYSDRTPITELPSSFENLPGLEVLFVEDCSKLDNLPDNIGSLEYLYYILAAASAISQLPSSVALSNMLRSLDSSHCKGLESFPRTFLLGLSAMGLLHISDYAVREIPQEIAYLSSLEILYLSGNNFESLPAIIKQMSQLRFIHLEDFNMLQSLPELPLCLKYLHLIDCKMLQSLPVLPFCLESLDLTGCNMLRSLPELPLCLQYLNLEDCNMLRSLPELPLCLQLLTVRNCNRLQSLPEILLCLQELDASVLEKLSKHSPDLQWAPESLKSAAICFEFTNCLKLNGKANNKILADSLLRIRHMAIASLRLGYEMAINEKLSELRGSLIVLPGSEIPDWFSNQSSGSSICIQLPPHSSCRNLIGFAFCAVLDSKKVDSDCFRYFYVSFQFDLEIKTLSETKHVDLGYNSRYIEDLIDSDRVILGFKPCLNVGFPDGYHHTIATFKFFAERKFYKIKRCGLCPVYANPSETKDNTFTINFATEVWKLDDLP***************************
***SDTVQIVGIWGMGGIGKTTLAKAIFDQFSHEFEGSCFVSDVRGNSETAGGLEHLQKQMLSTTLSEKLEVAGPNIPHFTKERVRRMKLLIVLDDVNEVGQLKRLIGELDQFGQGSRIVVTTRDKRVLEKFRGEEKKIYRVNGLEFEEAFEHFCNFAFKENHCPEDLNWHSRSVVSYTKGNPLVLEVLGSSLCLKRKSHWGKVLHDLNRICESEIHDIYDILKISFNKLTPRVKSIFLDIACFFEGEDKDFVASILDDSESDVLDILIDKSLVSISGNFLNMHDILQEMGRQIVRQESEKEPGKRSRLWDPKEISRVLKHNKGTDAIEGIFLDLSKIKGINLDPRAFTNMSNLRLFKFYVPKFYEIEKLPSMSTEEQLSYSKVQLPNGLDYLPKKLRYLHWDTYPLRTLPSNFKPKNLVELNLRCSKVEQPWEGEKACVPSSIQNFKYLSALSFKGCQSLRSFPSNLHFVCPVTINFSYCVNLIEFPQISGKVTRLYLGQSAIEEVPSSIECLTDLEVLDLRGCKRLKRISTSFCKLRSLVTLILLGCLNLEHFPEILEKMEHLKRIYSDRTPITELPSSFENLPGLEVLFVEDCSKLDNLPDNIGSLEYLYYILAAASAISQLPSSVALSNMLRSLDSSHCKGLESFPRTFLLGLSAMGLLHISDYAVREIPQEIAYLSSLEILYLSGNNFESLPAIIKQMSQLRFIHLEDFNMLQSLPELPLCLKYLHLIDCKMLQSLPVLPFCLESLDLTGCNMLRSLPELPLCLQYLNLEDCNMLRSLPELPLCLQLLTVRNCNRLQSLPEILLCLQELDASVLEKLSKHSPDLQWAPESLKSAAICFEFTNCLKLNGKANNKILADSLLRIRHMAIASLRLGYEMAINEKLSELRGSLIVLPGSEIPDWFSNQSSGSSICIQLPPHSSCRNLIGFAFCAVLDSKKVDSDCFRYFYVSFQFDLEIKTLSETKHVDLGYNSRYIEDLIDSDRVILGFKPCLNVGFPDGYHHTIATFKFFAERKFYKIKRCGLCPVYA****************************************************
MDSSDTVQIVGIWGMGGIGKTTLAKAIFDQFSHEFEGSCFVSDVRGNSETAGGLEHLQKQMLSTTLSEKLEVAGPNIPHFTKERVRRMKLLIVLDDVNEVGQLKRLIGELDQFGQGSRIVVTTRDKRVLEKFRGEEKKIYRVNGLEFEEAFEHFCNFAFKENHCPEDLNWHSRSVVSYTKGNPLVLEVLGSSLCLKRKSHWGKVLHDLNRICESEIHDIYDILKISFNKLTPRVKSIFLDIACFFEGEDKDFVASILDDSESDVLDILIDKSLVSISGNFLNMHDILQEMGRQIV*************LWDPKEISRVLKHNKGTDAIEGIFLDLSKIKGINLDPRAFTNMSNLRLFKFYVPKFYEIEKLPSMSTEEQLSYSKVQLPNGLDYLPKKLRYLHWDTYPLRTLPSNFKPKNLVELNLRCSKVEQPWEGEKACVPSSIQNFKYLSALSFKGCQSLRSFPSNLHFVCPVTINFSYCVNLIEFPQISGKVTRLYLGQSAIEEVPSSIECLTDLEVLDLRGCKRLKRISTSFCKLRSLVTLILLGCLNLEHFPEILEKMEHLKRIYSDRTPITELPSSFENLPGLEVLFVEDCSKLDNLPDNIGSLEYLYYILAAASAISQLPSSVALSNMLRSLDSSHCKGLESFPRTFLLGLSAMGLLHISDYAVREIPQEIAYLSSLEILYLSGNNFESLPAIIKQMSQLRFIHLEDFNMLQSLPELPLCLKYLHLIDCKMLQSLPVLPFCLESLDLTGCNMLRSLPELPLCLQYLNLEDCNMLRSLPELPLCLQLLTVRNCNRLQSLPEILLCLQELDASVLEKLSKHSPDLQWAPESLKSAAICFEFTNCLKLNGKANNKILADSLLRIRHMAIASLRLGYEMAINEKLSELRGSLIVLPGSEIPDWFSNQSSGSSICIQLPPHSSCRNLIGFAFCAVLDSKKVDSDCFRYFYVSFQFDLEIKTLSETKHVDLGYNSRYIEDLIDSDRVILGFKPCLNVGFPDGYHHTIATFKFFAERKFYKIKRCGLCPVYANPSETKDNTFTINFATEVWKLDDLPSASGTLDVEELELSPKRICRANQINTP
****DTVQIVGIWGMGGIGKTTLAKAIFDQFSHEFEGSCFVSDVRGNSETAGGLEHLQKQMLSTTLSEKLEVAGPNIPHFTKERVRRMKLLIVLDDVNEVGQLKRLIGELDQFGQGSRIVVTTRDKRVLEKFRGEEKKIYRVNGLEFEEAFEHFCNFAFKENHCPEDLNWHSRSVVSYTKGNPLVLEVLGSSLCLKRKSHWGKVLHDLNRICESEIHDIYDILKISFNKLTPRVKSIFLDIACFFEGEDKDFVASILDDSESDVLDILIDKSLVSISGNFLNMHDILQEMGRQIVRQESEKEPGKRSRLWDPKEISRVLKHNKGTDAIEGIFLDLSKIKGINLDPRAFTNMSNLRLFKFYVPKFYEIEKLPSMSTEEQLSYSKVQLPNGLDYLPKKLRYLHWDTYPLRTLPSNFKPKNLVELNLRCSKVEQPWEGEKACVPSSIQNFKYLSALSFKGCQSLRSFPSNLHFVCPVTINFSYCVNLIEFPQISGKVTRLYLGQSAIEEVPSSIECLTDLEVLDLRGCKRLKRISTSFCKLRSLVTLILLGCLNLEHFPEILEKMEHLKRIYSDRTPITELPSSFENLPGLEVLFVEDCSKLDNLPDNIGSLEYLYYILAAASAISQLPSSVALSNMLRSLDSSHCKGLESFPRTFLLGLSAMGLLHISDYAVREIPQEIAYLSSLEILYLSGNNFESLPAIIKQMSQLRFIHLEDFNMLQSLPELPLCLKYLHLIDCKMLQSLPVLPFCLESLDLTGCNMLRSLPELPLCLQYLNLEDCNMLRSLPELPLCLQLLTVRNCNRLQSLPEILLCLQELDASVLEKLSKHSPDLQWAPESLKSAAICFEFTNCLKLNGKANNKILADSLLRIRHMAIASLRLGYEMAINEKLSELRGSLIVLPGSEIPDWFSNQSSGSSICIQLPPHSSCRNLIGFAFCAVLDSKKVDSDCFRYFYVSFQFDLEIKTLSETKHVDLGYNSRYIEDLIDSDRVILGFKPCLNVGFPDGYHHTIATFKFFAERKFYKIKRCGLCPVYANP**************************************************
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MDSSDTVQIVGIWGMGGIGKTTLAKAIFDQFSHEFEGSCFVSDVRGNSETAGGLEHLQKQMLSTTLSEKLEVAGPNIPHFTKERVRRMKLLIVLDDVNEVGQLKRLIGELDQFGQGSRIVVTTRDKRVLEKFRGEEKKIYRVNGLEFEEAFEHFCNFAFKENHCPEDLNWHSRSVVSYTKGNPLVLEVLGSSLCLKRKSHWGKVLHDLNRICESEIHDIYDILKISFNKLTPRVKSIFLDIACFFEGEDKDFVASILDDSESDVLDILIDKSLVSISGNFLNMHDILQEMGRQIVRQESEKEPGKRSRLWDPKEISRVLKHNKGTDAIEGIFLDLSKIKGINLDPRAFTNMSNLRLFKFYVPKFYEIEKLPSMSTEEQLSYSKVQLPNGLDYLPKKLRYLHWDTYPLRTLPSNFKPKNLVELNLRCSKVEQPWEGEKACVPSSIQNFKYLSALSFKGCQSLRSFPSNLHFVCPVTINFSYCVNLIEFPQISGKVTRLYLGQSAIEEVPSSIECLTDLEVLDLRGCKRLKRISTSFCKLRSLVTLILLGCLNLEHFPEILEKMEHLKRIYSDRTPITELPSSFENLPGLEVLFVEDCSKLDNLPDNIGSLEYLYYILAAASAISQLPSSVALSNMLRSLDSSHCKGLESFPRTFLLGLSAMGLLHISDYAVREIPQEIAYLSSLEILYLSGNNFESLPAIIKQMSQLRFIHLEDFNMLQSLPELPLCLKYLHLIDCKMLQSLPVLPFCLESLDLTGCNMLRSLPELPLCLQYLNLEDCNMLRSLPELPLCLQLLTVRNCNRLQSLPEILLCLQELDASVLEKLSKHSPDLQWAPESLKSAAICFEFTNCLKLNGKANNKILADSLLRIRHMAIASLRLGYEMAINEKLSELRGSLIVLPGSEIPDWFSNQSSGSSICIQLPPHSSCRNLIGFAFCAVLDSKKVDSDCFRYFYVSFQFDLEIKTLSETKHVDLGYNSRYIEDLIDSDRVILGFKPCLNVGFPDGYHHTIATFKFFAERKFYKIKRCGLCPVYANPSETKDNTFTINFATEVWKLDDLPSASGTLDVEELELSPKRICRANQINTP
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query1083 2.2.26 [Sep-21-2011]
Q9SZ671895 Probable WRKY transcripti no no 0.507 0.290 0.368 7e-88
Q403921144 TMV resistance protein N N/A no 0.608 0.576 0.334 8e-88
Q9FH83 1288 Probable WRKY transcripti no no 0.595 0.500 0.306 1e-78
Q9FL92 1372 Probable WRKY transcripti no no 0.536 0.423 0.311 3e-77
O825001095 Putative disease resistan no no 0.518 0.512 0.320 2e-76
O235301301 Protein SUPPRESSOR OF npr no no 0.703 0.585 0.282 4e-75
Q9FKN7 1613 Protein DA1-related 4 OS= no no 0.547 0.367 0.277 1e-63
Q9LVT1623 Putative disease resistan no no 0.493 0.858 0.233 3e-22
Q9SZA7816 Probable disease resistan no no 0.480 0.637 0.251 2e-18
Q9FW44787 Disease resistance protei no no 0.484 0.667 0.254 2e-16
>sp|Q9SZ67|WRK19_ARATH Probable WRKY transcription factor 19 OS=Arabidopsis thaliana GN=WRKY19 PE=2 SV=1 Back     alignment and function desciption
 Score =  326 bits (835), Expect = 7e-88,   Method: Compositional matrix adjust.
 Identities = 241/654 (36%), Positives = 333/654 (50%), Gaps = 104/654 (15%)

Query: 7    VQIVGIWGMGGIGKTTLAKAIFDQFSHEFEGSCFVSDVRGNSETAGGLEHLQKQMLSTTL 66
            V+ +GIWG  GIGKTT+A+ IF + S ++E    + D+    E  G        +    L
Sbjct: 837  VRSIGIWGTVGIGKTTIAEEIFRKISVQYETCVVLKDLHKEVEVKG-----HDAVRENFL 891

Query: 67   SEKLEVAGPNIPH----------FTKERVRRMKLLIVLDDVNEVGQLKRLIGELDQFGQG 116
            SE LEV     PH          F + R++R ++L++LDDVN+   +   +G L+ FG G
Sbjct: 892  SEVLEVE----PHVIRISDIKTSFLRSRLQRKRILVILDDVNDYRDVDTFLGTLNYFGPG 947

Query: 117  SRIVVTTRDKRVLEKFRGEEKKIYRVNGLEFEEAF----EHFCNFAFKENHCPEDLNWHS 172
            SRI++T+R++RV    + +   +Y V  L+  ++        C         PE     S
Sbjct: 948  SRIIMTSRNRRVFVLCKIDH--VYEVKPLDIPKSLLLLDRGTCQIVLS----PEVYKTLS 1001

Query: 173  RSVVSYTKGNPLVLEVLGSSLCLKRKSHWGKVLHDLNRICESEIHDIYDILKISFNKLTP 232
              +V ++ GNP VL+ L S   + R+  W K+  ++     S I+ I  I + S   L  
Sbjct: 1002 LELVKFSNGNPQVLQFLSS---IDRE--WNKLSQEVKTT--SPIY-IPGIFEKSCCGLDD 1053

Query: 233  RVKSIFLDIACFFEGEDKDFVASILDD---SESDVLDILIDKSLVSISG-NFLNMHDILQ 288
              + IFLDIACFF   DKD VA +LD    S       L+DKSL++IS  N ++M   +Q
Sbjct: 1054 NERGIFLDIACFFNRIDKDNVAMLLDGCGFSAHVGFRGLVDKSLLTISQHNLVDMLSFIQ 1113

Query: 289  EMGRQIVRQESEKEPGKRSRLWDPKEISRVLKHNKGTDAIEGIFLDLSKIKGINLDPRAF 348
              GR+IVRQES   PG RSRLW+   I  V  ++ GT AIEGIFLD+  +K  + +P  F
Sbjct: 1114 ATGREIVRQESADRPGDRSRLWNADYIRHVFINDTGTSAIEGIFLDMLNLK-FDANPNVF 1172

Query: 349  TNMSNLRLFKFYVPKFYEIEKLPSMSTEEQLSYSKVQLPNGLDYLPKKLRYLHWDTYPLR 408
              M NLRL K Y  K            EE+     V  P GL+YLP KLR LHW+ YPL 
Sbjct: 1173 EKMCNLRLLKLYCSK-----------AEEK---HGVSFPQGLEYLPSKLRLLHWEYYPLS 1218

Query: 409  TLPSNFKPKNLVELNLRCSKVEQPWEGEKA--C----------------------VP--S 442
            +LP +F P+NLVELNL  S  ++ W+G+KA  C                      +P  S
Sbjct: 1219 SLPKSFNPENLVELNLPSSCAKKLWKGKKARFCTTNSSLEKLKKMRLSYSDQLTKIPRLS 1278

Query: 443  SIQNF---------------------KYLSALSFKGCQSLRSFPSNLHFVCPVTINFSYC 481
            S  N                      K L  L+ KGC  L + PS +       +N S C
Sbjct: 1279 SATNLEHIDLEGCNSLLSLSQSISYLKKLVFLNLKGCSKLENIPSMVDLESLEVLNLSGC 1338

Query: 482  VNLIEFPQISGKVTRLYLGQSAIEEVPSSIECLTDLEVLDLRGCKRLKRISTSFCKLRSL 541
              L  FP+IS  V  LY+G + I+E+PSSI+ L  LE LDL   + LK + TS  KL+ L
Sbjct: 1339 SKLGNFPEISPNVKELYMGGTMIQEIPSSIKNLVLLEKLDLENSRHLKNLPTSIYKLKHL 1398

Query: 542  VTLILLGCLNLEHFPEILEKMEHLKRIYSDRTPITELPSSFENLPGL-EVLFVE 594
             TL L GC++LE FP+   +M+ L+ +   RT I ELPSS   L  L E+LFV+
Sbjct: 1399 ETLNLSGCISLERFPDSSRRMKCLRFLDLSRTDIKELPSSISYLTALDELLFVD 1452
Transcription factor. Interacts specifically with the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element. May act also as a disease resistance protein with a serine/threonine-protein kinase activity.
Arabidopsis thaliana (taxid: 3702)
>sp|Q40392|TMVRN_NICGU TMV resistance protein N OS=Nicotiana glutinosa GN=N PE=1 SV=1 Back     alignment and function description
>sp|Q9FH83|WRK52_ARATH Probable WRKY transcription factor 52 OS=Arabidopsis thaliana GN=WRKY52 PE=2 SV=3 Back     alignment and function description
>sp|Q9FL92|WRK16_ARATH Probable WRKY transcription factor 16 OS=Arabidopsis thaliana GN=WRKY16 PE=2 SV=1 Back     alignment and function description
>sp|O82500|Y4117_ARATH Putative disease resistance protein At4g11170 OS=Arabidopsis thaliana GN=At4g11170 PE=2 SV=1 Back     alignment and function description
>sp|O23530|SNC1_ARATH Protein SUPPRESSOR OF npr1-1, CONSTITUTIVE 1 OS=Arabidopsis thaliana GN=SNC1 PE=1 SV=3 Back     alignment and function description
>sp|Q9FKN7|DAR4_ARATH Protein DA1-related 4 OS=Arabidopsis thaliana GN=DAR4 PE=1 SV=2 Back     alignment and function description
>sp|Q9LVT1|DRL39_ARATH Putative disease resistance protein At5g47280 OS=Arabidopsis thaliana GN=At5g47280 PE=3 SV=1 Back     alignment and function description
>sp|Q9SZA7|DRL29_ARATH Probable disease resistance protein At4g33300 OS=Arabidopsis thaliana GN=At4g33300 PE=2 SV=3 Back     alignment and function description
>sp|Q9FW44|ADR1_ARATH Disease resistance protein ADR1 OS=Arabidopsis thaliana GN=ADR1 PE=2 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query1083
255544956 1403 leucine-rich repeat containing protein, 0.909 0.702 0.344 1e-148
224127917 1470 tir-nbs-lrr resistance protein [Populus 0.831 0.612 0.354 1e-145
2555632021158 leucine-rich repeat containing protein, 0.618 0.578 0.423 1e-145
359486075 1291 PREDICTED: TMV resistance protein N-like 0.850 0.713 0.341 1e-135
359486073 1296 PREDICTED: TMV resistance protein N-like 0.854 0.713 0.332 1e-133
451798990 1335 TMV resistance protein N-like protein 7 0.881 0.715 0.339 1e-132
224145021 1561 tir-nbs-lrr resistance protein [Populus 0.835 0.579 0.342 1e-130
225448053 1468 PREDICTED: TMV resistance protein N-like 0.858 0.633 0.343 1e-130
224145030 1435 tir-nbs-lrr resistance protein [Populus 0.830 0.626 0.345 1e-128
359487015 1610 PREDICTED: TMV resistance protein N-like 0.870 0.585 0.340 1e-128
>gi|255544956|ref|XP_002513539.1| leucine-rich repeat containing protein, putative [Ricinus communis] gi|223547447|gb|EEF48942.1| leucine-rich repeat containing protein, putative [Ricinus communis] Back     alignment and taxonomy information
 Score =  531 bits (1369), Expect = e-148,   Method: Compositional matrix adjust.
 Identities = 400/1161 (34%), Positives = 584/1161 (50%), Gaps = 176/1161 (15%)

Query: 1    MDSSDTVQIVGIWGMGGIGKTTLAKAIFDQFSHEFEGSCFVSDVRGNSETAGGLEHLQKQ 60
            M+ +  V  VGIWGMGGIGKTT AKA+F Q S+E E + FV++VR  SE    +  L+ +
Sbjct: 212  MEFTTNVLFVGIWGMGGIGKTTTAKALFTQISNELEAAYFVANVREESEKRT-VVRLRDE 270

Query: 61   MLSTTLSEK-LEVAGPNI-PHFTKERVRRMKLLIVLDDVNEVGQLKRLIGELDQFGQGSR 118
            +LS  L E+ L +   +I P F   R+RR ++LIVLDDV+ V QL  L G+   FG GSR
Sbjct: 271  ILSNILEEENLHLGMRSILPRFILNRLRRKRILIVLDDVSNVEQLTTLAGDHSWFGSGSR 330

Query: 119  IVVTTRDKRVLEKFRGEEKKIYRVNGLEFEEAFEHFCNFAFKENHCPEDLNWHSRSVVSY 178
            +++T+RDK+VL        +IY V GL + EA +      FK+NH  E     S+ VV+Y
Sbjct: 331  VIITSRDKQVL---VNAADRIYEVKGLNYCEALQLLSFKVFKQNHPVEGYIELSKRVVNY 387

Query: 179  TKGNPLVLEVLGSSLCLKRKSHWGKVLHDLNRICESEIHDIYDILKISFNKLTPRVKSIF 238
            TKG PL L VL S L  K++  W   L  L    ES   +I  +LKIS+++L    K IF
Sbjct: 388  TKGVPLALNVLASFLYSKQREEWTSTLEKLE---ESSNLEIQKVLKISYDELEWVDKDIF 444

Query: 239  LDIACFFEGEDKDFVASILDDSE---SDVLDILIDKSLVSISGNFLNMHDILQEMGRQIV 295
            LDIACFF+G D D+V +ILD  +   S  +  L+DKSL++I  N L+MHD+LQEMG+ IV
Sbjct: 445  LDIACFFKGADVDYVTTILDGCDFFPSIGISRLVDKSLIAIIDNKLDMHDLLQEMGQHIV 504

Query: 296  RQESEKEPGKRSRLWDPKEISRVLKHNKGTDAIEGIFLDLSKIKGINLDPRAFTNMSNLR 355
            ++ES + PGK SRLW P+ I  VL  N+GT A EGIFLD+SKI+ ++L   AF+ M NLR
Sbjct: 505  QKESSENPGKNSRLWTPESIHHVLTGNRGTFATEGIFLDISKIEKVDLSSVAFSKMWNLR 564

Query: 356  LFKFYVPKFYEIEKLPSMSTEEQLSYSKVQLPNGLDYLPKKLRYLHWDTYPLRTLPSNFK 415
            L KFY   F   +      +E  L        +GL  LP KL +LHW  YP  +LPSNF 
Sbjct: 565  LLKFYHNSFLSWKNPTGFVSESTLDSR-----DGLQSLPNKLCFLHWHGYPWESLPSNFS 619

Query: 416  PKNLVELNLRCSKVEQPWEGEKAC------------------------------------ 439
             +NLVELN+  S+V++ W G K                                      
Sbjct: 620  MENLVELNMPFSQVKELWTGVKHLQKLKLLDLHDSELLVTLPDLSSASNLEKIILNNCTS 679

Query: 440  ---VPSSIQNFKYLSALSFKGCQSLRSFPSNLHFVCPVTINFSYCVNLIEFPQISGKVTR 496
               +PSSIQ  + L  LS   C+ L+S PS +      T+N S C NL +FP+ISG++  
Sbjct: 680  LLEIPSSIQCLRKLVCLSLSNCKELQSLPSLIPLKYLKTLNLSSCSNLKKFPEISGEIEE 739

Query: 497  LYLGQSAIEEVPSSIECLTDLEVLDLRGCKRLKRISTSFCKLRSLVTLILLGCLNLEHFP 556
            L+L  + +EE PSS++ L  L +L L  C+ LK +  S   L SL  L L  C +L++FP
Sbjct: 740  LHLDGTGLEEWPSSVQYLDKLRLLSLDHCEDLKSLPGSI-HLNSLDNLDLSWCSSLKNFP 798

Query: 557  EILEKMEHLKRIYSDRTPITELPSSFENLPGLEVLFVEDCSKLDNLPDNIGSLEYLYYIL 616
            +++  +++L       T I ELPSS  +L  L  L ++D +++  LP +IG+L  L  + 
Sbjct: 799  DVVGNIKYLN---VGHTAIEELPSSIGSLVSLTKLNLKD-TEIKELPSSIGNLSSLVELN 854

Query: 617  AAASAISQLPSSVALSNMLRSLDSSHCKGLESFPRTFLLGLSAMGLLHISDYAVREIPQE 676
               S+I +LPSS+   + L  L+ +    +E  P + L  LS++   ++    +  +P  
Sbjct: 855  LKESSIKELPSSIGCLSSLVKLNIA-VVDIEELPSS-LGQLSSLVEFNLEKSTLTALPSS 912

Query: 677  IAYLSSLEILYLSGNNFESLPAIIKQMSQLRFIHLEDFNMLQSLP----ELPLCLKYLHL 732
            I  L+SL  L L+    + LP  I  +S L  ++L    ML SLP    EL  CL+ L+L
Sbjct: 913  IGCLTSLVKLNLAVTEIKELPPSIGCLSSLVELNLSQCPMLGSLPFSIGELK-CLEKLYL 971

Query: 733  IDCKMLQSLPVLPFCLESLD---LTGCNMLRSLPELPLC--------------------- 768
               + L+S+P     L+ L    L  C  L  LP L  C                     
Sbjct: 972  CGLRRLRSIPSSIRELKRLQDVYLNHCTKLSKLPSLSGCSSLRDLVLSYSGIVKVPGSLG 1031

Query: 769  ---------------------------LQYLNLEDCNMLRSLPELPLCLQLLTVRNCNRL 801
                                       L+ L++  C  L++LPELP  +++L   NC  L
Sbjct: 1032 YLSSLQVLLLKGNNFMRIPATIRQLSWLEVLDISYCKRLKALPELPQRIRVLVAHNCTSL 1091

Query: 802  QSLPEILLCLQELDASVLEKLSKHSPDLQWAPESLKSAAICFEFTNCLKLNGKANNKILA 861
            +++   L+  QE          + SPD ++           F F NC+ L   A + I+ 
Sbjct: 1092 KTVSSPLIQFQESQ--------EQSPDDKYG----------FTFANCVSLEKNARSNIVE 1133

Query: 862  DSLLRIRHMAIASLRL--GYEMAINEKLSELRGSLIVLPGSEIPDWFSNQSSGSSICIQL 919
             +LL+ +H+A A L L   YE         L   ++  PGSEIP+ F  Q++G+S+   L
Sbjct: 1134 SALLKTQHLATAVLELLTSYEEI-------LVSPVVCFPGSEIPECFRYQNTGASVTTLL 1186

Query: 920  PPHSSCRNLIGFAFCAVLDSKKVDSDCFRYFYVSFQFDLEIKTLSETKHVD-LGYNSRYI 978
            P       L+GF FCAV++ +       R++   F F  + +   E ++ D L + S+ I
Sbjct: 1187 PSKWHNNKLVGFTFCAVIELEN------RHYQDGFTFQCDCRI--ENEYGDSLEFTSKEI 1238

Query: 979  EDL-----IDSDRVILGFKPCLNVGFPDGYHH-----TIATFKF--FAERKF-------- 1018
             +       ++D V L    C+ +   + Y         A F+F  + E ++        
Sbjct: 1239 GEWGNQFEFETDHVFLWNTSCIYILTEERYEQLRKNSCTAIFEFACYTEDEYKVMLPGAN 1298

Query: 1019 -YKIKRCGLCPVYANPSETKD 1038
             +K+K  G  PVYA   +  D
Sbjct: 1299 SFKVKNSGFNPVYAKDEKEWD 1319

Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|224127917|ref|XP_002329209.1| tir-nbs-lrr resistance protein [Populus trichocarpa] gi|222870990|gb|EEF08121.1| tir-nbs-lrr resistance protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|255563202|ref|XP_002522604.1| leucine-rich repeat containing protein, putative [Ricinus communis] gi|223538080|gb|EEF39691.1| leucine-rich repeat containing protein, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|359486075|ref|XP_002273047.2| PREDICTED: TMV resistance protein N-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|359486073|ref|XP_002272820.2| PREDICTED: TMV resistance protein N-like, partial [Vitis vinifera] Back     alignment and taxonomy information
>gi|451798990|gb|AGF69193.1| TMV resistance protein N-like protein 7 [Vitis labrusca] Back     alignment and taxonomy information
>gi|224145021|ref|XP_002325498.1| tir-nbs-lrr resistance protein [Populus trichocarpa] gi|222862373|gb|EEE99879.1| tir-nbs-lrr resistance protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|225448053|ref|XP_002273151.1| PREDICTED: TMV resistance protein N-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|224145030|ref|XP_002325501.1| tir-nbs-lrr resistance protein [Populus trichocarpa] gi|222862376|gb|EEE99882.1| tir-nbs-lrr resistance protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|359487015|ref|XP_003633506.1| PREDICTED: TMV resistance protein N-like [Vitis vinifera] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query1083
TAIR|locus:21181061219 AT4G12010 [Arabidopsis thalian 0.653 0.580 0.338 1.4e-96
TAIR|locus:21759911294 AT5G17680 [Arabidopsis thalian 0.809 0.677 0.309 1.1e-90
TAIR|locus:21634261187 TAO1 "target of AVRB operation 0.665 0.607 0.323 2.3e-87
TAIR|locus:20534051215 AT2G14080 [Arabidopsis thalian 0.687 0.613 0.316 6e-83
TAIR|locus:2155189980 AT5G49140 [Arabidopsis thalian 0.531 0.587 0.356 3.7e-80
TAIR|locus:21479921189 AT5G11250 [Arabidopsis thalian 0.682 0.621 0.308 3.9e-79
TAIR|locus:20818101226 AT3G51570 [Arabidopsis thalian 0.537 0.474 0.331 3.1e-78
TAIR|locus:2146243900 AT5G18360 [Arabidopsis thalian 0.533 0.642 0.347 2.1e-77
TAIR|locus:21674571191 AT5G36930 [Arabidopsis thalian 0.334 0.303 0.427 6.7e-76
TAIR|locus:21530721229 AT5G51630 [Arabidopsis thalian 0.674 0.593 0.298 8.3e-74
TAIR|locus:2118106 AT4G12010 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 960 (343.0 bits), Expect = 1.4e-96, P = 1.4e-96
 Identities = 261/771 (33%), Positives = 415/771 (53%)

Query:     5 DTVQIVGIWGMGGIGKTTLAKAIFDQFSHEFEGSCFVSDVRGNSETAGGLEHLQKQMLST 64
             DTV I+GI GM GIGKTTLA  ++ +   +F+GSCF++++R NS  +G LE L +++ ST
Sbjct:   207 DTVHIIGIVGMVGIGKTTLADCLYGRMRGQFDGSCFLTNIRENSGRSG-LESLLQKLFST 265

Query:    65 TLSEK-LEVAGPNIPHFTKER-VRRMKLLIVLDDVNEVGQLKRLIGELDQFGQGSRIVVT 122
              L+++ LE+  P   H   ER ++  +LLIVLDDVN+  Q++ L+G    +  GSRI++T
Sbjct:   266 VLNDRDLEIGAPGNAHERFERRLKSKRLLIVLDDVNDEKQIRYLMGHCKWYQGGSRIIIT 325

Query:   123 TRDKRVLEKFRGEEKKIYRVNGLEFEEAFEHFCNFAFKENHCPEDLNWHSRSVVSYTKGN 182
             TRD +++E  +G +  + ++N     EA + F   AF  +   ++    +  V+ Y KG+
Sbjct:   326 TRDSKLIETIKGRKYVLPKLND---REALKLFSLNAFSNSFPLKEFEGLTNMVLDYAKGH 382

Query:   183 PLVLEVLGSSLCLKRKSHWGKVLHDLNRICESEIH-DIYDILKISFNKLTPRVKSIFLDI 241
             PL L+VLGS LC +   +W      L+R+ +S  H DIY++L+ S+ +LT   K++FLDI
Sbjct:   383 PLALKVLGSDLCERDDLYWEA---KLDRL-KSRSHGDIYEVLETSYEELTTEQKNVFLDI 438

Query:   242 ACFFEGEDKDFVASILDDSESDVLDI---LIDKSLVSISGNFLNMHDILQEMGRQI-VRQ 297
             ACFF  E+ D+V S+L+    DV  +   L+DK L+++S N + MHD+LQ M ++I ++ 
Sbjct:   439 ACFFRSENVDYVTSLLNSHGVDVSGVVKDLVDKCLITLSDNRIEMHDMLQTMAKEISLKV 498

Query:   298 ESE--------KEPGKRS----RLWDPKEISRVLKHNKGTDAIEGIFLDLSKIKGINLDP 345
             E+            G +     RLWD ++I  +L    GTD I GIFLD SK++ + L  
Sbjct:   499 ETIGIRDCRWLSRHGNQCQWHIRLWDSEDICDLLTEGLGTDKIRGIFLDTSKLRAMRLSA 558

Query:   346 RAFTNMSNLRLFKFYVPKFYEIEKLPSMSTEEQLSYSKVQLPNGLDYLPKKLRYLHWDTY 405
             +AF  M NL+  K Y       +   S   E +    K+ L  GL +LP +L YLHW  Y
Sbjct:   559 KAFQGMYNLKYLKIY-------DSHCSRGCEAEF---KLHLRRGLSFLPNELTYLHWHGY 608

Query:   406 PLRTLPSNFKPKNLVELNLRCSKVEQPWEGEKACVPSSIQNFKYLSALSFKGCQSLRSFP 465
             PL+++P +F PKNLV+L L  S++E+ W+ EK      ++      +++ + C  L    
Sbjct:   609 PLQSIPLDFDPKNLVDLKLPHSQLEEIWDDEKDV--GMLKWVDLSHSINLRQCLGL---- 662

Query:   466 SNLHFVCPVTINFSYCVNLIEFPQISGKVTRL-YLGQ---SAIEEVPSSIECLTDLEVLD 521
             +N H +    +N   C +L + P     + +L YL     +++  +P  I+  + L+ L 
Sbjct:   663 ANAHNL--ERLNLEGCTSLKKLPSTINCLEKLIYLNLRDCTSLRSLPKGIKTQS-LQTLI 719

Query:   522 LRGCKRLKRISTSFCKLRSLVTLILLGCLNLEHFPEILEKMEHLKRI-YSDRTPITELPS 580
             L GC  LK+    F  +   V ++LL    ++  PE ++    L  +   +   +  L S
Sbjct:   720 LSGCSSLKK----FPLISENVEVLLLDGTVIKSLPESIQTFRRLALLNLKNCKKLKHLSS 775

Query:   581 SFENLPGLEVLFVEDCSKLDNLPDNIGXXXXXXXXXXXXXXXXXXXXXVALSNMLR-SL- 638
                 L  L+ L +  CS+L+  P+                        + LSN+   SL 
Sbjct:   776 DLYKLKCLQELILSGCSQLEVFPEIKEDMESLEILLMDDTSITEMPKMMHLSNIKTFSLC 835

Query:   639 -DSSHCKGLESF-PRTFLLGLSAMGLLHISDYAVREIPQEIAYLSSLEILYLSGNNFESL 696
               SSH      F P T  LG S +  L++S  ++ ++P  I  LSSL+ L LSGNN E+L
Sbjct:   836 GTSSHVSVSMFFMPPT--LGCSRLTDLYLSRCSLYKLPDNIGGLSSLQSLCLSGNNIENL 893

Query:   697 PAIIKQMSQLRFIHLEDFNMLQSLPELPLCLKYLHLIDCKMLQSL--PVLP 745
             P    Q++ L++  L+   ML+SLP LP  L+YL   +C+ L++L  P+ P
Sbjct:   894 PESFNQLNNLKWFDLKFCKMLKSLPVLPQNLQYLDAHECESLETLANPLTP 944
GO:0005634 "nucleus" evidence=ISM
GO:0006952 "defense response" evidence=IEA;ISS
GO:0007165 "signal transduction" evidence=IEA
GO:0043531 "ADP binding" evidence=IEA
GO:0006612 "protein targeting to membrane" evidence=RCA
GO:0009963 "positive regulation of flavonoid biosynthetic process" evidence=RCA
GO:0010363 "regulation of plant-type hypersensitive response" evidence=RCA
TAIR|locus:2175991 AT5G17680 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2163426 TAO1 "target of AVRB operation1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2053405 AT2G14080 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2155189 AT5G49140 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2147992 AT5G11250 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2081810 AT3G51570 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2146243 AT5G18360 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2167457 AT5G36930 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2153072 AT5G51630 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
eugene3.01250003
tir-nbs-lrr resistance protein (1470 aa)
(Populus trichocarpa)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query1083
PLN032101153 PLN03210, PLN03210, Resistant to P 1e-103
pfam00931285 pfam00931, NB-ARC, NB-ARC domain 2e-43
PRK15387 788 PRK15387, PRK15387, E3 ubiquitin-protein ligase Ss 3e-09
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 1e-07
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 4e-07
PRK15370754 PRK15370, PRK15370, E3 ubiquitin-protein ligase Sl 6e-07
PRK15387788 PRK15387, PRK15387, E3 ubiquitin-protein ligase Ss 3e-06
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 2e-05
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 2e-05
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 2e-05
PLN00113968 PLN00113, PLN00113, leucine-rich repeat receptor-l 9e-04
pfam0772520 pfam07725, LRR_3, Leucine Rich Repeat 0.004
>gnl|CDD|215633 PLN03210, PLN03210, Resistant to P Back     alignment and domain information 
 Score =  351 bits (901), Expect = e-103
 Identities = 297/1001 (29%), Positives = 447/1001 (44%), Gaps = 231/1001 (23%)

Query: 4    SDTVQIVGIWGMGGIGKTTLAKAIFDQFSHEFEGSCFVSDV----------RGNSETAGG 53
            S+ V++VGIWG  GIGKTT+A+A+F + S +F+ S F+               N +    
Sbjct: 204  SEEVRMVGIWGSSGIGKTTIARALFSRLSRQFQSSVFIDRAFISKSMEIYSSANPDDYNM 263

Query: 54   LEHLQKQMLSTTLSEKLEVAGPNIPHF--TKERVRRMKLLIVLDDVNEVGQLKRLIGELD 111
              HLQ+  LS  L +K       I H    +ER++  K+LI +DD+++   L  L G+  
Sbjct: 264  KLHLQRAFLSEILDKK----DIKIYHLGAMEERLKHRKVLIFIDDLDDQDVLDALAGQTQ 319

Query: 112  QFGQGSRIVVTTRDKRVLEKFRGEEKKIYRVNGLEFEEAFEHFCNFAFKENHCPEDLNWH 171
             FG GSRI+V T+DK  L     +   IY V     E A E FC  AFK+N  P+     
Sbjct: 320  WFGSGSRIIVITKDKHFLRAHGIDH--IYEVCLPSNELALEMFCRSAFKKNSPPDGFMEL 377

Query: 172  SRSVVSYTKGN-PLVLEVLGSSLCLKRKSHWGKVLHDLNRICESEIHDIYDILKISFNKL 230
            + S V+   GN PL L VLGS L  + K  W  +L  L    + +I      L++S++ L
Sbjct: 378  A-SEVALRAGNLPLGLNVLGSYLRGRDKEDWMDMLPRLRNGLDGKIEKT---LRVSYDGL 433

Query: 231  TPRV-KSIFLDIACFFEGEDKDFVASILDDSESDV---LDILIDKSLVSISGNFLNMHDI 286
              +  K+IF  IAC F GE  + +  +L +S+ DV   L  L+DKSL+ +  + + MH +
Sbjct: 434  NNKKDKAIFRHIACLFNGEKVNDIKLLLANSDLDVNIGLKNLVDKSLIHVREDIVEMHSL 493

Query: 287  LQEMGRQIVRQESEKEPGKRSRLWDPKEISRVLKHNKGTDAIEGIFLDLSKIKGINLDPR 346
            LQEMG++IVR +S  EPG+R  L D K+I  VL+ N GT  + GI LD+ +I  +++   
Sbjct: 494  LQEMGKEIVRAQSN-EPGEREFLVDAKDICDVLEDNTGTKKVLGITLDIDEIDELHIHEN 552

Query: 347  AFTNMSNLRLFKFYVPKFYEIEKLPSMSTEEQLSYSKVQLPNGLDYLPKKLRYLHWDTYP 406
            AF  M NL   KFY  K+            +Q    +  LP G DYLP KLR L WD YP
Sbjct: 553  AFKGMRNLLFLKFYTKKW------------DQKKEVRWHLPEGFDYLPPKLRLLRWDKYP 600

Query: 407  LRTLPSNFKPKNLVELNLRCSKVEQPWEGEKACVPSSIQNFKYLSALSFKGCQSLRSFP- 465
            LR +PSNF+P+NLV+L ++ SK+E+ W+G        + +   L  +  +G ++L+  P 
Sbjct: 601  LRCMPSNFRPENLVKLQMQGSKLEKLWDG--------VHSLTGLRNIDLRGSKNLKEIPD 652

Query: 466  ----SNLHFVCPVTINFSYCVNLIEFPQISGKVTRLYLGQSAIEEVPSSIECLTDLEVLD 521
                +NL      T+  S C +L+E                    +PSSI+ L  LE LD
Sbjct: 653  LSMATNLE-----TLKLSDCSSLVE--------------------LPSSIQYLNKLEDLD 687

Query: 522  LRGCKRLKRISTSFCKLRSLVTLILLGCLNLEHFPEILEKMEHLKRIYSDRTPITELPSS 581
            +  C+ L+ + T    L+SL  L L GC  L+ FP+I                       
Sbjct: 688  MSRCENLEILPTGI-NLKSLYRLNLSGCSRLKSFPDI----------------------- 723

Query: 582  FENLPGLEVLFVEDCSKLDNLPDNIGSLEYLYYILAAASAISQLPSSVALSNMLRSLDSS 641
                                   NI  L  L       +AI + PS++ L N+       
Sbjct: 724  ---------------------STNISWL-DLD-----ETAIEEFPSNLRLENL------- 749

Query: 642  HCKGLESFPRTFLLGLSAMGLLHISDYAVREIPQEIAYLSSLEILYLSGN-NFESLPAII 700
                         L L  M    + +      P       SL  L+LS   +   LP+ I
Sbjct: 750  -----------DELILCEMKSEKLWERVQPLTPLMTMLSPSLTRLFLSDIPSLVELPSSI 798

Query: 701  KQMSQLRFIHLEDFNMLQSLPELPLCLKYLHLIDCKMLQSLPV---LPFCLESLDLTGCN 757
            + + +L                     ++L + +C  L++LP    L   LESLDL+GC+
Sbjct: 799  QNLHKL---------------------EHLEIENCINLETLPTGINLES-LESLDLSGCS 836

Query: 758  MLRSLPELPLCLQYLNLEDCNMLRSLPELPLC------LQLLTVRNCNRLQSL-PEI--L 808
             LR+ P++   +  LNL        + E+P        L  L +  CN LQ +   I  L
Sbjct: 837  RLRTFPDISTNISDLNLSRT----GIEEVPWWIEKFSNLSFLDMNGCNNLQRVSLNISKL 892

Query: 809  LCLQELDASVLEKLSKHS--------PDLQWAPESLKSAAICFEFTNCLKLNGKANNKIL 860
              L+ +D S    L++ S                S   + +C  F NC  L+ +A     
Sbjct: 893  KHLETVDFSDCGALTEASWNGSPSEVAMATDNIHSKLPSTVCINFINCFNLDQEA----- 947

Query: 861  ADSLLRIRHMAIASLRLGYEMAINEKLSELRGSLIVLPGSEIPDWFSNQSSGSS-ICIQL 919
               LL+ + +                        ++L G E+P +F+++++G+S   I L
Sbjct: 948  ---LLQQQSIFKQ---------------------LILSGEEVPSYFTHRTTGASLTNIPL 983

Query: 920  PPHSSCRNLIGFAFCAVLDSKKVDSDCFRYFYVSFQFDLEI 960
               S C+    F  CAV     VDS+ F  F +S  FD+++
Sbjct: 984  LHISPCQPFFRFRACAV-----VDSESF--FIISVSFDIQV 1017

syringae 6; Provisional. Length = 1153
>gnl|CDD|216202 pfam00931, NB-ARC, NB-ARC domain Back     alignment and domain information
>gnl|CDD|185285 PRK15387, PRK15387, E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|185268 PRK15370, PRK15370, E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>gnl|CDD|185285 PRK15387, PRK15387, E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|191828 pfam07725, LRR_3, Leucine Rich Repeat Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 1083
PLN032101153 Resistant to P. syringae 6; Provisional 100.0
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 100.0
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 100.0
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 100.0
PF00931287 NB-ARC: NB-ARC domain; InterPro: IPR002182 This is 100.0
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 99.94
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.94
KOG4194873 consensus Membrane glycoprotein LIG-1 [Signal tran 99.94
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.94
KOG0472565 consensus Leucine-rich repeat protein [Function un 99.93
KOG0472565 consensus Leucine-rich repeat protein [Function un 99.93
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.91
PLN032101153 Resistant to P. syringae 6; Provisional 99.91
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.86
PRK15387788 E3 ubiquitin-protein ligase SspH2; Provisional 99.79
PRK15387788 E3 ubiquitin-protein ligase SspH2; Provisional 99.78
PRK15370754 E3 ubiquitin-protein ligase SlrP; Provisional 99.72
PRK15370754 E3 ubiquitin-protein ligase SlrP; Provisional 99.69
KOG4237498 consensus Extracellular matrix protein slit, conta 99.68
KOG0617264 consensus Ras suppressor protein (contains leucine 99.61
KOG4237498 consensus Extracellular matrix protein slit, conta 99.6
KOG0617264 consensus Ras suppressor protein (contains leucine 99.54
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.48
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.42
PRK04841903 transcriptional regulator MalT; Provisional 99.3
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 99.24
PF05729166 NACHT: NACHT domain 99.09
KOG3207505 consensus Beta-tubulin folding cofactor E [Posttra 99.03
KOG0532722 consensus Leucine-rich repeat (LRR) protein, conta 99.02
TIGR03015269 pepcterm_ATPase putative secretion ATPase, PEP-CTE 98.97
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 98.95
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 98.93
KOG1259490 consensus Nischarin, modulator of integrin alpha5 98.9
COG2909894 MalT ATP-dependent transcriptional regulator [Tran 98.86
PRK15386426 type III secretion protein GogB; Provisional 98.83
KOG0532722 consensus Leucine-rich repeat (LRR) protein, conta 98.81
KOG3207505 consensus Beta-tubulin folding cofactor E [Posttra 98.8
KOG1259490 consensus Nischarin, modulator of integrin alpha5 98.79
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 98.78
TIGR00635305 ruvB Holliday junction DNA helicase, RuvB subunit. 98.77
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 98.7
PRK00080328 ruvB Holliday junction DNA helicase RuvB; Reviewed 98.7
COG2256436 MGS1 ATPase related to the helicase subunit of the 98.69
PRK06893229 DNA replication initiation factor; Validated 98.68
PRK00411394 cdc6 cell division control protein 6; Reviewed 98.66
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 98.63
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 98.62
COG3903414 Predicted ATPase [General function prediction only 98.6
TIGR02928365 orc1/cdc6 family replication initiation protein. M 98.58
PF01637234 Arch_ATPase: Archaeal ATPase; InterPro: IPR011579 98.56
PRK15386426 type III secretion protein GogB; Provisional 98.53
PF13173128 AAA_14: AAA domain 98.51
TIGR03420226 DnaA_homol_Hda DnaA regulatory inactivator Hda. Me 98.43
PLN03150623 hypothetical protein; Provisional 98.4
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 98.36
PLN03150623 hypothetical protein; Provisional 98.32
PRK13342413 recombination factor protein RarA; Reviewed 98.3
PF13401131 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S 98.25
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 98.25
PRK08727233 hypothetical protein; Validated 98.18
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.16
TIGR01242364 26Sp45 26S proteasome subunit P45 family. Many pro 98.13
PRK09087226 hypothetical protein; Validated 98.11
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.11
PRK08084235 DNA replication initiation factor; Provisional 98.11
TIGR00678188 holB DNA polymerase III, delta' subunit. At positi 98.07
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 98.05
PRK05642234 DNA replication initiation factor; Validated 98.04
PF00308219 Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013 98.03
PRK14087450 dnaA chromosomal replication initiation protein; P 98.03
PF05496233 RuvB_N: Holliday junction DNA helicase ruvB N-term 97.97
KOG2028554 consensus ATPase related to the helicase subunit o 97.96
PRK14963504 DNA polymerase III subunits gamma and tau; Provisi 97.95
PRK09376416 rho transcription termination factor Rho; Provisio 97.95
COG3899849 Predicted ATPase [General function prediction only 97.94
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 97.94
PRK14961363 DNA polymerase III subunits gamma and tau; Provisi 97.91
PRK08903227 DnaA regulatory inactivator Hda; Validated 97.9
PRK05564313 DNA polymerase III subunit delta'; Validated 97.9
PLN03025319 replication factor C subunit; Provisional 97.89
PRK12402337 replication factor C small subunit 2; Reviewed 97.89
PRK13341725 recombination factor protein RarA/unknown domain f 97.88
PRK14949944 DNA polymerase III subunits gamma and tau; Provisi 97.87
cd00009151 AAA The AAA+ (ATPases Associated with a wide varie 97.86
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 97.83
cd01128249 rho_factor Transcription termination factor rho is 97.82
PRK06645507 DNA polymerase III subunits gamma and tau; Validat 97.81
PRK07003830 DNA polymerase III subunits gamma and tau; Validat 97.81
PRK14960702 DNA polymerase III subunits gamma and tau; Provisi 97.8
PRK00149450 dnaA chromosomal replication initiation protein; R 97.8
PRK03992389 proteasome-activating nucleotidase; Provisional 97.79
PRK14088440 dnaA chromosomal replication initiation protein; P 97.77
PRK12422445 chromosomal replication initiation protein; Provis 97.77
TIGR02881261 spore_V_K stage V sporulation protein K. Members o 97.76
PRK14957546 DNA polymerase III subunits gamma and tau; Provisi 97.76
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 97.76
KOG2982418 consensus Uncharacterized conserved protein [Funct 97.76
PRK07471365 DNA polymerase III subunit delta'; Validated 97.76
PRK14962472 DNA polymerase III subunits gamma and tau; Provisi 97.74
PRK07940394 DNA polymerase III subunit delta'; Validated 97.73
PRK12323700 DNA polymerase III subunits gamma and tau; Provisi 97.72
PRK06620214 hypothetical protein; Validated 97.71
PRK04195482 replication factor C large subunit; Provisional 97.7
TIGR00767415 rho transcription termination factor Rho. Members 97.7
PTZ001121164 origin recognition complex 1 protein; Provisional 97.7
PRK14956484 DNA polymerase III subunits gamma and tau; Provisi 97.7
TIGR00362405 DnaA chromosomal replication initiator protein Dna 97.69
PF14516331 AAA_35: AAA-like domain 97.68
PRK00440319 rfc replication factor C small subunit; Reviewed 97.67
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 97.62
PRK08691709 DNA polymerase III subunits gamma and tau; Validat 97.61
PTZ00361438 26 proteosome regulatory subunit 4-like protein; P 97.6
PRK14955397 DNA polymerase III subunits gamma and tau; Provisi 97.6
TIGR02397355 dnaX_nterm DNA polymerase III, subunit gamma and t 97.59
PRK09112351 DNA polymerase III subunit delta'; Validated 97.58
TIGR03689512 pup_AAA proteasome ATPase. In the Actinobacteria, 97.56
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 97.56
PRK05707328 DNA polymerase III subunit delta'; Validated 97.55
PTZ00454398 26S protease regulatory subunit 6B-like protein; P 97.54
PRK14964491 DNA polymerase III subunits gamma and tau; Provisi 97.54
KOG2982418 consensus Uncharacterized conserved protein [Funct 97.54
COG0593408 DnaA ATPase involved in DNA replication initiation 97.54
PRK08116268 hypothetical protein; Validated 97.53
PRK07994647 DNA polymerase III subunits gamma and tau; Validat 97.52
CHL00181287 cbbX CbbX; Provisional 97.51
PF00004132 AAA: ATPase family associated with various cellula 97.5
TIGR02880284 cbbX_cfxQ probable Rubsico expression protein CbbX 97.49
PRK14086617 dnaA chromosomal replication initiation protein; P 97.48
TIGR02903615 spore_lon_C ATP-dependent protease, Lon family. Me 97.47
KOG4341483 consensus F-box protein containing LRR [General fu 97.47
PHA02544316 44 clamp loader, small subunit; Provisional 97.44
COG1222406 RPT1 ATP-dependent 26S proteasome regulatory subun 97.42
PRK14970367 DNA polymerase III subunits gamma and tau; Provisi 97.41
PRK14951618 DNA polymerase III subunits gamma and tau; Provisi 97.41
PRK14959624 DNA polymerase III subunits gamma and tau; Provisi 97.39
PRK05896605 DNA polymerase III subunits gamma and tau; Validat 97.38
PRK14958509 DNA polymerase III subunits gamma and tau; Provisi 97.36
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 97.35
PLN00020413 ribulose bisphosphate carboxylase/oxygenase activa 97.35
KOG4341483 consensus F-box protein containing LRR [General fu 97.33
PRK14969527 DNA polymerase III subunits gamma and tau; Provisi 97.31
COG1474366 CDC6 Cdc6-related protein, AAA superfamily ATPase 97.31
PRK14954620 DNA polymerase III subunits gamma and tau; Provisi 97.28
PRK08181269 transposase; Validated 97.28
KOG3665699 consensus ZYG-1-like serine/threonine protein kina 97.26
COG1373398 Predicted ATPase (AAA+ superfamily) [General funct 97.26
PRK14950585 DNA polymerase III subunits gamma and tau; Provisi 97.24
smart00382148 AAA ATPases associated with a variety of cellular 97.23
CHL00176638 ftsH cell division protein; Validated 97.23
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 97.22
PRK07133725 DNA polymerase III subunits gamma and tau; Validat 97.22
KOG0741744 consensus AAA+-type ATPase [Posttranslational modi 97.2
cd01133274 F1-ATPase_beta F1 ATP synthase beta subunit, nucle 97.19
PF01695178 IstB_IS21: IstB-like ATP binding protein; InterPro 97.18
PRK06305451 DNA polymerase III subunits gamma and tau; Validat 97.18
PRK14952584 DNA polymerase III subunits gamma and tau; Provisi 97.18
PRK08451535 DNA polymerase III subunits gamma and tau; Validat 97.17
PRK14953486 DNA polymerase III subunits gamma and tau; Provisi 97.17
KOG0989346 consensus Replication factor C, subunit RFC4 [Repl 97.14
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 97.13
PRK09183259 transposase/IS protein; Provisional 97.12
KOG3665699 consensus ZYG-1-like serine/threonine protein kina 97.12
PRK06526254 transposase; Provisional 97.11
PRK07764824 DNA polymerase III subunits gamma and tau; Validat 97.07
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 97.07
TIGR01241495 FtsH_fam ATP-dependent metalloprotease FtsH. HflB( 97.06
PRK09111598 DNA polymerase III subunits gamma and tau; Validat 97.05
PRK14948620 DNA polymerase III subunits gamma and tau; Provisi 97.04
PRK12377248 putative replication protein; Provisional 97.04
KOG0744423 consensus AAA+-type ATPase [Posttranslational modi 97.03
PRK06871325 DNA polymerase III subunit delta'; Validated 97.0
cd01131198 PilT Pilus retraction ATPase PilT. PilT is a nucle 96.96
PRK06921266 hypothetical protein; Provisional 96.95
CHL00195489 ycf46 Ycf46; Provisional 96.94
PF07728139 AAA_5: AAA domain (dynein-related subfamily); Inte 96.93
PF13191185 AAA_16: AAA ATPase domain; PDB: 2V1U_A. 96.92
PRK10536262 hypothetical protein; Provisional 96.91
PRK14971614 DNA polymerase III subunits gamma and tau; Provisi 96.88
PRK08769319 DNA polymerase III subunit delta'; Validated 96.87
PRK06647563 DNA polymerase III subunits gamma and tau; Validat 96.86
KOG0733802 consensus Nuclear AAA ATPase (VCP subfamily) [Post 96.86
PF04665241 Pox_A32: Poxvirus A32 protein; InterPro: IPR006758 96.86
PRK07952244 DNA replication protein DnaC; Validated 96.85
TIGR01243733 CDC48 AAA family ATPase, CDC48 subfamily. This sub 96.83
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 96.83
PF02562205 PhoH: PhoH-like protein; InterPro: IPR003714 PhoH 96.82
COG3267269 ExeA Type II secretory pathway, component ExeA (pr 96.78
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 96.74
PRK06090319 DNA polymerase III subunit delta'; Validated 96.73
TIGR02640262 gas_vesic_GvpN gas vesicle protein GvpN. Members o 96.71
PF05673249 DUF815: Protein of unknown function (DUF815); Inte 96.71
KOG0735952 consensus AAA+-type ATPase [Posttranslational modi 96.71
PRK06835329 DNA replication protein DnaC; Validated 96.69
PRK07993334 DNA polymerase III subunit delta'; Validated 96.69
PRK08118167 topology modulation protein; Reviewed 96.67
KOG2227529 consensus Pre-initiation complex, subunit CDC6, AA 96.66
PTZ00202550 tuzin; Provisional 96.66
cd00561159 CobA_CobO_BtuR ATP:corrinoid adenosyltransferase B 96.66
PRK07399314 DNA polymerase III subunit delta'; Validated 96.64
PRK08058329 DNA polymerase III subunit delta'; Validated 96.63
PHA00729226 NTP-binding motif containing protein 96.62
cd01120165 RecA-like_NTPases RecA-like NTPases. This family i 96.6
PF05621302 TniB: Bacterial TniB protein; InterPro: IPR008868 96.55
PRK05563559 DNA polymerase III subunits gamma and tau; Validat 96.55
PRK12608380 transcription termination factor Rho; Provisional 96.54
KOG2543438 consensus Origin recognition complex, subunit 5 [R 96.53
PRK05541176 adenylylsulfate kinase; Provisional 96.53
COG1484254 DnaC DNA replication protein [DNA replication, rec 96.53
PRK06964342 DNA polymerase III subunit delta'; Validated 96.48
PF13207121 AAA_17: AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6 96.46
TIGR02639731 ClpA ATP-dependent Clp protease ATP-binding subuni 96.46
PRK14965576 DNA polymerase III subunits gamma and tau; Provisi 96.46
PRK07261171 topology modulation protein; Provisional 96.45
PRK10733644 hflB ATP-dependent metalloprotease; Reviewed 96.45
TIGR01243733 CDC48 AAA family ATPase, CDC48 subfamily. This sub 96.45
PRK04132846 replication factor C small subunit; Provisional 96.41
COG4608268 AppF ABC-type oligopeptide transport system, ATPas 96.4
PF00448196 SRP54: SRP54-type protein, GTPase domain; InterPro 96.4
PRK10865857 protein disaggregation chaperone; Provisional 96.38
PRK08939306 primosomal protein DnaI; Reviewed 96.38
cd03221144 ABCF_EF-3 ABCF_EF-3 Elongation factor 3 (EF-3) is 96.38
TIGR02639731 ClpA ATP-dependent Clp protease ATP-binding subuni 96.36
KOG0743457 consensus AAA+-type ATPase [Posttranslational modi 96.35
COG1618179 Predicted nucleotide kinase [Nucleotide transport 96.34
PRK04296190 thymidine kinase; Provisional 96.29
COG2255332 RuvB Holliday junction resolvasome, helicase subun 96.25
PRK08699325 DNA polymerase III subunit delta'; Validated 96.23
COG1223368 Predicted ATPase (AAA+ superfamily) [General funct 96.22
KOG0991333 consensus Replication factor C, subunit RFC2 [Repl 96.16
cd03222177 ABC_RNaseL_inhibitor The ABC ATPase RNase L inhibi 96.11
cd03214180 ABC_Iron-Siderophores_B12_Hemin ABC transporters, 96.11
TIGR03345852 VI_ClpV1 type VI secretion ATPase, ClpV1 family. M 96.1
PRK11331459 5-methylcytosine-specific restriction enzyme subun 96.08
KOG0730693 consensus AAA+-type ATPase [Posttranslational modi 96.07
PRK11889436 flhF flagellar biosynthesis regulator FlhF; Provis 96.03
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 96.02
COG1121254 ZnuC ABC-type Mn/Zn transport systems, ATPase comp 95.99
cd03216163 ABC_Carb_Monos_I This family represents the domain 95.98
KOG0651388 consensus 26S proteasome regulatory complex, ATPas 95.97
KOG0733802 consensus Nuclear AAA ATPase (VCP subfamily) [Post 95.95
cd03223166 ABCD_peroxisomal_ALDP Peroxisomal ATP-binding cass 95.94
TIGR03345852 VI_ClpV1 type VI secretion ATPase, ClpV1 family. M 95.92
TIGR00602637 rad24 checkpoint protein rad24. This family is bas 95.92
KOG0728404 consensus 26S proteasome regulatory complex, ATPas 95.91
TIGR03346852 chaperone_ClpB ATP-dependent chaperone ClpB. Membe 95.9
PF13671143 AAA_33: AAA domain; PDB: 1LTQ_A 2IA5_K 1RC8_A 1LY1 95.89
cd00267157 ABC_ATPase ABC (ATP-binding cassette) transporter 95.86
PRK14722374 flhF flagellar biosynthesis regulator FlhF; Provis 95.84
COG1875436 NYN ribonuclease and ATPase of PhoH family domains 95.84
PRK11034758 clpA ATP-dependent Clp protease ATP-binding subuni 95.83
PF00406151 ADK: Adenylate kinase; InterPro: IPR000850 Adenyla 95.82
TIGR01420343 pilT_fam pilus retraction protein PilT. This model 95.81
COG2884223 FtsE Predicted ATPase involved in cell division [C 95.81
cd01394218 radB RadB. The archaeal protein radB shares simila 95.79
cd01393226 recA_like RecA is a bacterial enzyme which has rol 95.77
COG0464494 SpoVK ATPases of the AAA+ class [Posttranslational 95.76
COG0542786 clpA ATP-binding subunits of Clp protease and DnaK 95.76
CHL00095821 clpC Clp protease ATP binding subunit 95.74
cd00544169 CobU Adenosylcobinamide kinase / adenosylcobinamid 95.71
cd01121372 Sms Sms (bacterial radA) DNA repair protein. This 95.71
cd03229178 ABC_Class3 This class is comprised of all BPD (Bin 95.69
PF13177162 DNA_pol3_delta2: DNA polymerase III, delta subunit 95.67
KOG2123388 consensus Uncharacterized conserved protein [Funct 95.66
cd03230173 ABC_DR_subfamily_A This family of ATP-binding prot 95.65
PRK06762166 hypothetical protein; Provisional 95.62
KOG1947482 consensus Leucine rich repeat proteins, some prote 95.56
cd03247178 ABCC_cytochrome_bd The CYD subfamily implicated in 95.56
COG0572218 Udk Uridine kinase [Nucleotide transport and metab 95.56
TIGR01359183 UMP_CMP_kin_fam UMP-CMP kinase family. This subfam 95.55
PF07726131 AAA_3: ATPase family associated with various cellu 95.55
CHL00095821 clpC Clp protease ATP binding subunit 95.54
TIGR00763775 lon ATP-dependent protease La. This protein is ind 95.47
PRK11034758 clpA ATP-dependent Clp protease ATP-binding subuni 95.47
PF13238129 AAA_18: AAA domain; PDB: 3IIK_A 3IIJ_A 3IIL_A 1RKB 95.42
cd03238176 ABC_UvrA The excision repair protein UvrA; Nucleot 95.42
PRK10865857 protein disaggregation chaperone; Provisional 95.41
TIGR00708173 cobA cob(I)alamin adenosyltransferase. Alternate n 95.4
PF00485194 PRK: Phosphoribulokinase / Uridine kinase family; 95.4
KOG2035351 consensus Replication factor C, subunit RFC3 [Cell 95.4
cd03283199 ABC_MutS-like MutS-like homolog in eukaryotes. The 95.38
cd03115173 SRP The signal recognition particle (SRP) mediates 95.37
cd03246173 ABCC_Protease_Secretion This family represents the 95.34
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 95.33
PF10443431 RNA12: RNA12 protein; InterPro: IPR018850 Mitochon 95.32
KOG0731774 consensus AAA+-type ATPase containing the peptidas 95.32
COG1136226 SalX ABC-type antimicrobial peptide transport syst 95.31
cd01135276 V_A-ATPase_B V/A-type ATP synthase (non-catalytic) 95.29
PRK08356195 hypothetical protein; Provisional 95.27
PF01583156 APS_kinase: Adenylylsulphate kinase; InterPro: IPR 95.27
PRK14974336 cell division protein FtsY; Provisional 95.26
TIGR02237209 recomb_radB DNA repair and recombination protein R 95.26
PRK09280463 F0F1 ATP synthase subunit beta; Validated 95.23
PRK12723388 flagellar biosynthesis regulator FlhF; Provisional 95.22
COG1124252 DppF ABC-type dipeptide/oligopeptide/nickel transp 95.19
cd03233202 ABC_PDR_domain1 The pleiotropic drug resistance (P 95.19
TIGR03346852 chaperone_ClpB ATP-dependent chaperone ClpB. Membe 95.19
PRK12724432 flagellar biosynthesis regulator FlhF; Provisional 95.18
PTZ00301210 uridine kinase; Provisional 95.18
COG0488530 Uup ATPase components of ABC transporters with dup 95.16
PRK06696223 uridine kinase; Validated 95.15
PRK05480209 uridine/cytidine kinase; Provisional 95.15
PRK09361225 radB DNA repair and recombination protein RadB; Pr 95.13
TIGR03574249 selen_PSTK L-seryl-tRNA(Sec) kinase, archaeal. Mem 95.12
cd03237246 ABC_RNaseL_inhibitor_domain2 The ATPase domain 2 o 95.11
TIGR02858270 spore_III_AA stage III sporulation protein AA. Mem 95.11
cd03228171 ABCC_MRP_Like The MRP (Mutidrug Resistance Protein 95.1
KOG0734752 consensus AAA+-type ATPase containing the peptidas 95.05
COG0563178 Adk Adenylate kinase and related kinases [Nucleoti 95.01
TIGR01039461 atpD ATP synthase, F1 beta subunit. The sequences 95.01
PRK05703424 flhF flagellar biosynthesis regulator FlhF; Valida 95.01
cd03232192 ABC_PDR_domain2 The pleiotropic drug resistance-li 94.99
PRK08233182 hypothetical protein; Provisional 94.98
cd0201969 NK Nucleoside/nucleotide kinase (NK) is a protein 94.98
PRK04040188 adenylate kinase; Provisional 94.97
PRK12597461 F0F1 ATP synthase subunit beta; Provisional 94.97
COG0466782 Lon ATP-dependent Lon protease, bacterial type [Po 94.97
COG1120258 FepC ABC-type cobalamin/Fe3+-siderophores transpor 94.95
PRK12726407 flagellar biosynthesis regulator FlhF; Provisional 94.92
PRK07667193 uridine kinase; Provisional 94.92
TIGR00416454 sms DNA repair protein RadA. The gene protuct code 94.88
PRK00771437 signal recognition particle protein Srp54; Provisi 94.88
PRK06067234 flagellar accessory protein FlaH; Validated 94.86
cd03240204 ABC_Rad50 The catalytic domains of Rad50 are simil 94.86
cd03217200 ABC_FeS_Assembly ABC-type transport system involve 94.85
PRK03839180 putative kinase; Provisional 94.81
cd00983325 recA RecA is a bacterial enzyme which has roles in 94.81
COG0470325 HolB ATPase involved in DNA replication [DNA repli 94.8
PF00910107 RNA_helicase: RNA helicase; InterPro: IPR000605 He 94.79
PF00006215 ATP-synt_ab: ATP synthase alpha/beta family, nucle 94.77
cd01122271 GP4d_helicase GP4d_helicase is a homohexameric 5'- 94.77
cd02027149 APSK Adenosine 5'-phosphosulfate kinase (APSK) cat 94.76
TIGR00235207 udk uridine kinase. Model contains a number of lon 94.76
TIGR03499282 FlhF flagellar biosynthetic protein FlhF. 94.76
PRK05986191 cob(I)alamin adenolsyltransferase/cobinamide ATP-d 94.75
KOG2123388 consensus Uncharacterized conserved protein [Funct 94.73
cd03220224 ABC_KpsT_Wzt ABC_KpsT_Wzt The KpsT/Wzt ABC transpo 94.68
TIGR02012321 tigrfam_recA protein RecA. This model describes or 94.68
PF08433270 KTI12: Chromatin associated protein KTI12 ; InterP 94.66
PRK00625173 shikimate kinase; Provisional 94.66
PF03969362 AFG1_ATPase: AFG1-like ATPase; InterPro: IPR005654 94.66
cd03268208 ABC_BcrA_bacitracin_resist The BcrA subfamily repr 94.65
cd01125239 repA Hexameric Replicative Helicase RepA. RepA is 94.63
COG1428216 Deoxynucleoside kinases [Nucleotide transport and 94.61
cd04121189 Rab40 Rab40 subfamily. This subfamily contains Rab 94.6
PRK11823446 DNA repair protein RadA; Provisional 94.59
COG4618580 ArpD ABC-type protease/lipase transport system, AT 94.58
TIGR03740223 galliderm_ABC gallidermin-class lantibiotic protec 94.58
COG0055468 AtpD F0F1-type ATP synthase, beta subunit [Energy 94.58
cd03235213 ABC_Metallic_Cations ABC component of the metal-ty 94.56
TIGR00959428 ffh signal recognition particle protein. This mode 94.55
PF07724171 AAA_2: AAA domain (Cdc48 subfamily); InterPro: IPR 94.54
TIGR00960216 3a0501s02 Type II (General) Secretory Pathway (IIS 94.53
PTZ00088229 adenylate kinase 1; Provisional 94.51
PRK10787784 DNA-binding ATP-dependent protease La; Provisional 94.49
COG5635824 Predicted NTPase (NACHT family) [Signal transducti 94.48
PRK10867433 signal recognition particle protein; Provisional 94.47
TIGR01360188 aden_kin_iso1 adenylate kinase, isozyme 1 subfamil 94.46
PRK06547172 hypothetical protein; Provisional 94.45
cd03263220 ABC_subfamily_A The ABCA subfamily mediates the tr 94.44
PRK09354349 recA recombinase A; Provisional 94.43
KOG1947482 consensus Leucine rich repeat proteins, some prote 94.42
CHL002062281 ycf2 Ycf2; Provisional 94.4
PF13604196 AAA_30: AAA domain; PDB: 1W36_G 3K70_G 3UPU_B 3GPL 94.4
cd03281213 ABC_MSH5_euk MutS5 homolog in eukaryotes. The MutS 94.35
KOG0730693 consensus AAA+-type ATPase [Posttranslational modi 94.32
PRK12678672 transcription termination factor Rho; Provisional 94.32
PRK06217183 hypothetical protein; Validated 94.31
PF03205140 MobB: Molybdopterin guanine dinucleotide synthesis 94.3
cd03213194 ABCG_EPDR ABCG transporters are involved in eye pi 94.29
COG2607287 Predicted ATPase (AAA+ superfamily) [General funct 94.27
cd03266218 ABC_NatA_sodium_exporter NatA is the ATPase compon 94.26
TIGR01069771 mutS2 MutS2 family protein. Function of MutS2 is u 94.24
cd01129264 PulE-GspE PulE/GspE The type II secretory pathway 94.23
cd02028179 UMPK_like Uridine monophosphate kinase_like (UMPK_ 94.19
PRK00131175 aroK shikimate kinase; Reviewed 94.19
cd03215182 ABC_Carb_Monos_II This family represents domain II 94.18
cd01132274 F1_ATPase_alpha F1 ATP synthase alpha, central dom 94.18
PRK13543214 cytochrome c biogenesis protein CcmA; Provisional 94.17
COG0396251 sufC Cysteine desulfurase activator ATPase [Posttr 94.16
TIGR00064272 ftsY signal recognition particle-docking protein F 94.16
cd03264211 ABC_drug_resistance_like ABC-type multidrug transp 94.15
PRK00889175 adenylylsulfate kinase; Provisional 94.15
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 94.13
TIGR01188302 drrA daunorubicin resistance ABC transporter ATP-b 94.12
COG1066456 Sms Predicted ATP-dependent serine protease [Postt 94.09
PRK13947171 shikimate kinase; Provisional 94.07
TIGR03305449 alt_F1F0_F1_bet alternate F1F0 ATPase, F1 subunit 94.05
PRK03846198 adenylylsulfate kinase; Provisional 94.03
cd03285222 ABC_MSH2_euk MutS2 homolog in eukaryotes. The MutS 94.01
cd03284216 ABC_MutS1 MutS1 homolog in eukaryotes. The MutS pr 93.98
cd00227175 CPT Chloramphenicol (Cm) phosphotransferase (CPT). 93.98
cd00071137 GMPK Guanosine monophosphate kinase (GMPK, EC 2.7. 93.98
cd03278197 ABC_SMC_barmotin Barmotin is a tight junction-asso 93.95
PRK08972444 fliI flagellum-specific ATP synthase; Validated 93.94
PF00625183 Guanylate_kin: Guanylate kinase; InterPro: IPR0081 93.92
KOG2228408 consensus Origin recognition complex, subunit 4 [R 93.92
PRK10751173 molybdopterin-guanine dinucleotide biosynthesis pr 93.92
COG4088261 Predicted nucleotide kinase [Nucleotide transport 93.91
COG0488530 Uup ATPase components of ABC transporters with dup 93.87
PRK07132299 DNA polymerase III subunit delta'; Validated 93.8
PRK14723767 flhF flagellar biosynthesis regulator FlhF; Provis 93.77
PRK13948182 shikimate kinase; Provisional 93.75
PRK13537306 nodulation ABC transporter NodI; Provisional 93.74
cd02024187 NRK1 Nicotinamide riboside kinase (NRK) is an enzy 93.74
PRK13647274 cbiO cobalt transporter ATP-binding subunit; Provi 93.74
KOG1514767 consensus Origin recognition complex, subunit 1, a 93.73
PRK14721420 flhF flagellar biosynthesis regulator FlhF; Provis 93.73
COG3640255 CooC CO dehydrogenase maturation factor [Cell divi 93.71
PF10236309 DAP3: Mitochondrial ribosomal death-associated pro 93.69
cd02025220 PanK Pantothenate kinase (PanK) catalyzes the phos 93.65
TIGR01425429 SRP54_euk signal recognition particle protein SRP5 93.63
PRK13409590 putative ATPase RIL; Provisional 93.61
cd02023198 UMPK Uridine monophosphate kinase (UMPK, EC 2.7.1. 93.58
PRK12727559 flagellar biosynthesis regulator FlhF; Provisional 93.58
KOG0062582 consensus ATPase component of ABC transporters wit 93.55
COG1126240 GlnQ ABC-type polar amino acid transport system, A 93.55
PF0772520 LRR_3: Leucine Rich Repeat; InterPro: IPR011713 Le 93.54
PRK09270229 nucleoside triphosphate hydrolase domain-containin 93.52
COG1419407 FlhF Flagellar GTP-binding protein [Cell motility 93.5
cd03300232 ABC_PotA_N PotA is an ABC-type transporter and the 93.5
PF03215519 Rad17: Rad17 cell cycle checkpoint protein 93.49
PF00154322 RecA: recA bacterial DNA recombination protein; In 93.49
cd01130186 VirB11-like_ATPase Type IV secretory pathway compo 93.48
PRK13949169 shikimate kinase; Provisional 93.46
TIGR02322179 phosphon_PhnN phosphonate metabolism protein/1,5-b 93.45
KOG1969877 consensus DNA replication checkpoint protein CHL12 93.44
cd03287222 ABC_MSH3_euk MutS3 homolog in eukaryotes. The MutS 93.44
COG1936180 Predicted nucleotide kinase (related to CMP and AM 93.43
PRK09544251 znuC high-affinity zinc transporter ATPase; Review 93.42
KOG1532366 consensus GTPase XAB1, interacts with DNA repair p 93.42
cd03282204 ABC_MSH4_euk MutS4 homolog in eukaryotes. The MutS 93.42
COG0444316 DppD ABC-type dipeptide/oligopeptide/nickel transp 93.41
TIGR03522301 GldA_ABC_ATP gliding motility-associated ABC trans 93.41
CHL00060494 atpB ATP synthase CF1 beta subunit 93.4
smart00763361 AAA_PrkA PrkA AAA domain. This is a family of PrkA 93.39
TIGR00073207 hypB hydrogenase accessory protein HypB. HypB is i 93.38
COG0468279 RecA RecA/RadA recombinase [DNA replication, recom 93.38
TIGR00176155 mobB molybdopterin-guanine dinucleotide biosynthes 93.36
cd03289275 ABCC_CFTR2 The CFTR subfamily domain 2. The cystic 93.36
PRK08927442 fliI flagellum-specific ATP synthase; Validated 93.35
cd02020147 CMPK Cytidine monophosphate kinase (CMPK) catalyze 93.34
TIGR03771223 anch_rpt_ABC anchored repeat-type ABC transporter, 93.31
KOG0736953 consensus Peroxisome assembly factor 2 containing 93.29
COG0194191 Gmk Guanylate kinase [Nucleotide transport and met 93.26
cd02021150 GntK Gluconate kinase (GntK) catalyzes the phospho 93.26
PF03266168 NTPase_1: NTPase; InterPro: IPR004948 This entry r 93.25
KOG0079198 consensus GTP-binding protein H-ray, small G prote 93.23
CHL00059485 atpA ATP synthase CF1 alpha subunit 93.23
PRK00279215 adk adenylate kinase; Reviewed 93.22
COG4555245 NatA ABC-type Na+ transport system, ATPase compone 93.2
TIGR01650327 PD_CobS cobaltochelatase, CobS subunit. This model 93.2
PRK13768253 GTPase; Provisional 93.19
PRK10463290 hydrogenase nickel incorporation protein HypB; Pro 93.18
PRK05057172 aroK shikimate kinase I; Reviewed 93.18
COG0703172 AroK Shikimate kinase [Amino acid transport and me 93.17
cd00464154 SK Shikimate kinase (SK) is the fifth enzyme in th 93.16
PRK12339197 2-phosphoglycerate kinase; Provisional 93.15
COG1131293 CcmA ABC-type multidrug transport system, ATPase c 93.14
cd01428194 ADK Adenylate kinase (ADK) catalyzes the reversibl 93.13
COG2812515 DnaX DNA polymerase III, gamma/tau subunits [DNA r 93.12
PRK10416318 signal recognition particle-docking protein FtsY; 93.1
PRK13946184 shikimate kinase; Provisional 93.07
PRK05800170 cobU adenosylcobinamide kinase/adenosylcobinamide- 93.04
PRK15453290 phosphoribulokinase; Provisional 93.02
COG0003322 ArsA Predicted ATPase involved in chromosome parti 93.01
COG3638258 ABC-type phosphate/phosphonate transport system, A 93.0
TIGR03324497 alt_F1F0_F1_al alternate F1F0 ATPase, F1 subunit a 93.0
PRK00409782 recombination and DNA strand exchange inhibitor pr 92.98
KOG0737386 consensus AAA+-type ATPase [Posttranslational modi 92.95
PRK14493274 putative bifunctional molybdopterin-guanine dinucl 92.95
PRK05439311 pantothenate kinase; Provisional 92.94
TIGR01287275 nifH nitrogenase iron protein. This model describe 92.93
PF00437270 T2SE: Type II/IV secretion system protein; InterPr 92.9
PRK13536340 nodulation factor exporter subunit NodI; Provision 92.88
TIGR00554290 panK_bact pantothenate kinase, bacterial type. Sho 92.88
PF00158168 Sigma54_activat: Sigma-54 interaction domain; Inte 92.86
PRK15429686 formate hydrogenlyase transcriptional activator Fh 92.86
COG1102179 Cmk Cytidylate kinase [Nucleotide transport and me 92.85
TIGR03263180 guanyl_kin guanylate kinase. Members of this famil 92.83
PRK13236296 nitrogenase reductase; Reviewed 92.82
PRK13975196 thymidylate kinase; Provisional 92.82
TIGR02788308 VirB11 P-type DNA transfer ATPase VirB11. The VirB 92.81
TIGR00968237 3a0106s01 sulfate ABC transporter, ATP-binding pro 92.81
cd01136326 ATPase_flagellum-secretory_path_III Flagellum-spec 92.8
PF12775272 AAA_7: P-loop containing dynein motor region D3; P 92.78
PRK14738206 gmk guanylate kinase; Provisional 92.76
PRK11608326 pspF phage shock protein operon transcriptional ac 92.75
COG2274709 SunT ABC-type bacteriocin/lantibiotic exporters, c 92.74
cd01124187 KaiC KaiC is a circadian clock protein primarily f 92.74
PF13481193 AAA_25: AAA domain; PDB: 1G8Y_J 1OLO_A 1NLF_C. 92.74
TIGR01041458 ATP_syn_B_arch ATP synthase archaeal, B subunit. A 92.73
PRK13546264 teichoic acids export protein ATP-binding subunit; 92.72
cd0198399 Fer4_NifH The Fer4_NifH superfamily contains a var 92.72
TIGR02902531 spore_lonB ATP-dependent protease LonB. Members of 92.69
cd03116159 MobB Molybdenum is an essential trace element in t 92.69
COG4107258 PhnK ABC-type phosphonate transport system, ATPase 92.68
PRK13657588 cyclic beta-1,2-glucan ABC transporter; Provisiona 92.65
TIGR00455184 apsK adenylylsulfate kinase (apsK). Important resi 92.62
smart00072184 GuKc Guanylate kinase homologues. Active enzymes c 92.62
COG1703323 ArgK Putative periplasmic protein kinase ArgK and 92.61
>PLN03210 Resistant to P Back     alignment and domain information 
Probab=100.00  E-value=4.3e-99  Score=968.18  Aligned_cols=855  Identities=32%  Similarity=0.526  Sum_probs=679.0

Q ss_pred             CCCCeEEEEEEcCCCCcHHHHHHHHHHHhcccCceEEEEeec--cccc---c-----ccCCHHHHHHHHHHhhhcc-ccc
Q 001407            3 SSDTVQIVGIWGMGGIGKTTLAKAIFDQFSHEFEGSCFVSDV--RGNS---E-----TAGGLEHLQKQMLSTTLSE-KLE   71 (1083)
Q Consensus         3 ~~~~~~vv~I~G~gGiGKTtLA~~~~~~~~~~F~~~~~~~~~--~~~~---~-----~~~~l~~l~~~ll~~l~~~-~~~   71 (1083)
                      ..++++|||||||||+||||||+++|+++..+|++.+|+...  +...   .     .......++++++.++... ...
T Consensus       203 ~~~~~~vvgI~G~gGiGKTTLA~~l~~~l~~~F~g~vfv~~~~v~~~~~~~~~~~~~~~~~~~~l~~~~l~~il~~~~~~  282 (1153)
T PLN03210        203 ESEEVRMVGIWGSSGIGKTTIARALFSRLSRQFQSSVFIDRAFISKSMEIYSSANPDDYNMKLHLQRAFLSEILDKKDIK  282 (1153)
T ss_pred             ccCceEEEEEEcCCCCchHHHHHHHHHHHhhcCCeEEEeeccccccchhhcccccccccchhHHHHHHHHHHHhCCCCcc
Confidence            356799999999999999999999999999999999998642  1110   0     0011234666666664322 111


Q ss_pred             cCCCCchHHHHHHhcCceeEEEEeCCCChHHHHHHhhccCCCCCCcEEEEEecchhHHhhhccccccEEEecCCCHHHHH
Q 001407           72 VAGPNIPHFTKERVRRMKLLIVLDDVNEVGQLKRLIGELDQFGQGSRIVVTTRDKRVLEKFRGEEKKIYRVNGLEFEEAF  151 (1083)
Q Consensus        72 ~~~~~~~~~~~~~l~~kr~LlVlDdv~~~~~~~~l~~~~~~~~~gsrIiiTTR~~~v~~~~~~~~~~~~~v~~L~~~ea~  151 (1083)
                      ..   ....++++++++|+||||||||+.++|+.+.....|+++||+||||||+++++..++  .+++|+|+.++++||+
T Consensus       283 ~~---~~~~~~~~L~~krvLLVLDdv~~~~~l~~L~~~~~~~~~GsrIIiTTrd~~vl~~~~--~~~~~~v~~l~~~ea~  357 (1153)
T PLN03210        283 IY---HLGAMEERLKHRKVLIFIDDLDDQDVLDALAGQTQWFGSGSRIIVITKDKHFLRAHG--IDHIYEVCLPSNELAL  357 (1153)
T ss_pred             cC---CHHHHHHHHhCCeEEEEEeCCCCHHHHHHHHhhCccCCCCcEEEEEeCcHHHHHhcC--CCeEEEecCCCHHHHH
Confidence            11   226788999999999999999999999999998899999999999999999998776  7789999999999999


Q ss_pred             HHHHHhhcCCCCCCchhHHHHHHHHHhhCCCchhHHHHhhhhcCCCHHHHHHHHHHHhhhcCcchhhHHhHhhhcccCCC
Q 001407          152 EHFCNFAFKENHCPEDLNWHSRSVVSYTKGNPLVLEVLGSSLCLKRKSHWGKVLHDLNRICESEIHDIYDILKISFNKLT  231 (1083)
Q Consensus       152 ~Lf~~~a~~~~~~~~~~~~l~~~i~~~~~glPLal~~l~~~L~~~~~~~w~~~l~~l~~~~~~~~~~i~~~l~~Sy~~L~  231 (1083)
                      +||+++||++..+++++.+++++|+++|+|+|||++++|++|++++..+|+++++++++....++   ..+|++||++|+
T Consensus       358 ~LF~~~Af~~~~~~~~~~~l~~~iv~~c~GLPLAl~vlgs~L~~k~~~~W~~~l~~L~~~~~~~I---~~~L~~SYd~L~  434 (1153)
T PLN03210        358 EMFCRSAFKKNSPPDGFMELASEVALRAGNLPLGLNVLGSYLRGRDKEDWMDMLPRLRNGLDGKI---EKTLRVSYDGLN  434 (1153)
T ss_pred             HHHHHHhcCCCCCcHHHHHHHHHHHHHhCCCcHHHHHHHHHHcCCCHHHHHHHHHHHHhCccHHH---HHHHHHhhhccC
Confidence            99999999988888889999999999999999999999999999999999999999988665555   999999999997


Q ss_pred             c-cccceEEEEeeccCCCChhHHHHHHhhh---hHhhhHHHhhccceEEeCCEEEeeHHHHHHHHHHHhhccccCCCccc
Q 001407          232 P-RVKSIFLDIACFFEGEDKDFVASILDDS---ESDVLDILIDKSLVSISGNFLNMHDILQEMGRQIVRQESEKEPGKRS  307 (1083)
Q Consensus       232 ~-~~k~~fl~~a~f~~~~~~~~~~~~l~~~---~~~~l~~L~~~sLi~~~~~~~~mHdll~~~~~~~~~~~~~~~~~~~~  307 (1083)
                      + .+|.||+++||||.+++++.+..+++++   ++.+++.|++++||+...++++|||++|+||++++++++ .+|++|+
T Consensus       435 ~~~~k~~Fl~ia~ff~~~~~~~v~~~l~~~~~~~~~~l~~L~~ksLi~~~~~~~~MHdLl~~~~r~i~~~~~-~~~~~r~  513 (1153)
T PLN03210        435 NKKDKAIFRHIACLFNGEKVNDIKLLLANSDLDVNIGLKNLVDKSLIHVREDIVEMHSLLQEMGKEIVRAQS-NEPGERE  513 (1153)
T ss_pred             ccchhhhhheehhhcCCCCHHHHHHHHHhcCCCchhChHHHHhcCCEEEcCCeEEhhhHHHHHHHHHHHhhc-CCCCcce
Confidence            6 5999999999999999999999999876   677899999999999999999999999999999999997 7899999


Q ss_pred             cCCChhHHHHHHhcCcCCCcEeeEEeecCcccccccChhhhcCCCCCceEeeecCcccccccCCCCchhhccccceeecC
Q 001407          308 RLWDPKEISRVLKHNKGTDAIEGIFLDLSKIKGINLDPRAFTNMSNLRLFKFYVPKFYEIEKLPSMSTEEQLSYSKVQLP  387 (1083)
Q Consensus       308 ~l~~~~~i~~~l~~~~~~~~~~~i~l~ls~~~~~~~~~~~f~~l~~Lr~L~l~~n~l~~i~~l~~l~~l~~l~~~~~~l~  387 (1083)
                      |+|+++||++++++++|++.+++|++|++......+++++|.+|++|++|+++.+....            .......+|
T Consensus       514 ~l~~~~di~~vl~~~~g~~~v~~i~l~~~~~~~~~i~~~aF~~m~~L~~L~~~~~~~~~------------~~~~~~~lp  581 (1153)
T PLN03210        514 FLVDAKDICDVLEDNTGTKKVLGITLDIDEIDELHIHENAFKGMRNLLFLKFYTKKWDQ------------KKEVRWHLP  581 (1153)
T ss_pred             eEeCHHHHHHHHHhCcccceeeEEEeccCccceeeecHHHHhcCccccEEEEecccccc------------cccceeecC
Confidence            99999999999999999999999999999998899999999999999999998764211            122346789


Q ss_pred             CCCCCCCCCCcEEEcCCCCCCCCCCCCCCCCceEEEcCCCccccccCCCccccCcccccCCCCcEEeccCCcCCcccCCC
Q 001407          388 NGLDYLPKKLRYLHWDTYPLRTLPSNFKPKNLVELNLRCSKVEQPWEGEKACVPSSIQNFKYLSALSFKGCQSLRSFPSN  467 (1083)
Q Consensus       388 ~~~~~~~~~L~~L~l~~~~l~~lp~~~~l~~L~~L~L~~n~i~~lw~~~~~~~p~~~~~l~~L~~L~L~~~~~l~~lp~~  467 (1083)
                      +++..+|.+||+|+|.+|+++.+|..|.+.+|++|+|++|+++.+|++        +..+++|+.|+|++|..++.+|..
T Consensus       582 ~~~~~lp~~Lr~L~~~~~~l~~lP~~f~~~~L~~L~L~~s~l~~L~~~--------~~~l~~Lk~L~Ls~~~~l~~ip~l  653 (1153)
T PLN03210        582 EGFDYLPPKLRLLRWDKYPLRCMPSNFRPENLVKLQMQGSKLEKLWDG--------VHSLTGLRNIDLRGSKNLKEIPDL  653 (1153)
T ss_pred             cchhhcCcccEEEEecCCCCCCCCCcCCccCCcEEECcCccccccccc--------cccCCCCCEEECCCCCCcCcCCcc
Confidence            999999999999999999999999999999999999999999998654        458999999999999888888876


Q ss_pred             CCCCCCcEEEecCCcCccccCCCcCCccEEEcCCccccccCccccCCCCCcEEEeeCCCCcccccccccCCCCCcEEecc
Q 001407          468 LHFVCPVTINFSYCVNLIEFPQISGKVTRLYLGQSAIEEVPSSIECLTDLEVLDLRGCKRLKRISTSFCKLRSLVTLILL  547 (1083)
Q Consensus       468 ~~~~~L~~l~l~~~~~l~~~~~~~~~L~~L~L~~~~l~~lp~~i~~l~~L~~L~L~~~~~~~~lp~~l~~l~~L~~L~L~  547 (1083)
                      ..+++|+.|++++|..+                    ..+|.+++++++|+.|++++|..++.+|..+ ++++|++|+++
T Consensus       654 s~l~~Le~L~L~~c~~L--------------------~~lp~si~~L~~L~~L~L~~c~~L~~Lp~~i-~l~sL~~L~Ls  712 (1153)
T PLN03210        654 SMATNLETLKLSDCSSL--------------------VELPSSIQYLNKLEDLDMSRCENLEILPTGI-NLKSLYRLNLS  712 (1153)
T ss_pred             ccCCcccEEEecCCCCc--------------------cccchhhhccCCCCEEeCCCCCCcCccCCcC-CCCCCCEEeCC
Confidence            66677777777777544                    4667788899999999999999999999876 89999999999


Q ss_pred             CCcCcccCchhhhhccccCeeccCCCCCCCCCcccCCCCCCcEEeccCCCCCc-------cCCCCcCCCchhhhhhcccc
Q 001407          548 GCLNLEHFPEILEKMEHLKRIYSDRTPITELPSSFENLPGLEVLFVEDCSKLD-------NLPDNIGSLEYLYYILAAAS  620 (1083)
Q Consensus       548 ~~~~~~~~p~~l~~l~~L~~L~l~~~~l~~lp~~~~~l~~L~~L~l~~~~~~~-------~~p~~l~~l~~L~~L~l~~~  620 (1083)
                      +|..++.+|..   ..+|++|++++|.+..+|..+ .+++|+.|.+.++....       ..+......++|+.|++++|
T Consensus       713 gc~~L~~~p~~---~~nL~~L~L~~n~i~~lP~~~-~l~~L~~L~l~~~~~~~l~~~~~~l~~~~~~~~~sL~~L~Ls~n  788 (1153)
T PLN03210        713 GCSRLKSFPDI---STNISWLDLDETAIEEFPSNL-RLENLDELILCEMKSEKLWERVQPLTPLMTMLSPSLTRLFLSDI  788 (1153)
T ss_pred             CCCCccccccc---cCCcCeeecCCCccccccccc-cccccccccccccchhhccccccccchhhhhccccchheeCCCC
Confidence            99988888864   467899999999999999876 58899999887754221       11122234578999999998


Q ss_pred             c-ccCCCchhhcccCccEEEcCCCCCCCCcCcccccCCCCccEEEecCCCC-CcCchhccCCCCCcEEEeeCCCCcccch
Q 001407          621 A-ISQLPSSVALSNMLRSLDSSHCKGLESFPRTFLLGLSAMGLLHISDYAV-REIPQEIAYLSSLEILYLSGNNFESLPA  698 (1083)
Q Consensus       621 ~-i~~lp~~~~~l~~L~~L~l~~~~~~~~~~~~~~~~~~~L~~L~l~~~~l-~~lp~~l~~l~~L~~L~Ls~n~l~~lp~  698 (1083)
                      . +..+|..++.+++|+.|++++|...+.+|...  .+++|+.|++++|.. ..+|.   ..++|+.|+|++|.++.+|.
T Consensus       789 ~~l~~lP~si~~L~~L~~L~Ls~C~~L~~LP~~~--~L~sL~~L~Ls~c~~L~~~p~---~~~nL~~L~Ls~n~i~~iP~  863 (1153)
T PLN03210        789 PSLVELPSSIQNLHKLEHLEIENCINLETLPTGI--NLESLESLDLSGCSRLRTFPD---ISTNISDLNLSRTGIEEVPW  863 (1153)
T ss_pred             CCccccChhhhCCCCCCEEECCCCCCcCeeCCCC--CccccCEEECCCCCccccccc---cccccCEeECCCCCCccChH
Confidence            5 56799999999999999999998888777653  689999999999854 44554   24789999999999999999


Q ss_pred             hhhCCCCCCEeeccCcccCCCCCCCC---CCccEEeecCCCCCCcCCCCCCCCcEEeecCCCCCccCCCCCCCccEEecc
Q 001407          699 IIKQMSQLRFIHLEDFNMLQSLPELP---LCLKYLHLIDCKMLQSLPVLPFCLESLDLTGCNMLRSLPELPLCLQYLNLE  775 (1083)
Q Consensus       699 ~l~~l~~L~~L~L~~~~~l~~lp~~~---~~L~~L~l~~c~~l~~l~~~~~~L~~L~Ls~n~~~~~~~~~~~~L~~L~ls  775 (1083)
                      ++..+++|+.|+|++|+.+..+|..+   ++|+.|++.+|..+..++..          +++                  
T Consensus       864 si~~l~~L~~L~L~~C~~L~~l~~~~~~L~~L~~L~l~~C~~L~~~~l~----------~~~------------------  915 (1153)
T PLN03210        864 WIEKFSNLSFLDMNGCNNLQRVSLNISKLKHLETVDFSDCGALTEASWN----------GSP------------------  915 (1153)
T ss_pred             HHhcCCCCCEEECCCCCCcCccCcccccccCCCeeecCCCcccccccCC----------CCc------------------
Confidence            99999999999999999988887533   34555555555544433210          000                  


Q ss_pred             CCCCCCcCCCcccccceeecccccCcCcchhhhhccccchhhHHhhhhcCCCCCccCccccccccceeeecCcccccccc
Q 001407          776 DCNMLRSLPELPLCLQLLTVRNCNRLQSLPEILLCLQELDASVLEKLSKHSPDLQWAPESLKSAAICFEFTNCLKLNGKA  855 (1083)
Q Consensus       776 ~n~~l~~lp~~~~sL~~L~i~~c~~l~~lp~~l~~L~~L~~l~l~~l~~~~~~l~~~p~~l~~~l~~l~i~~C~~L~~~~  855 (1083)
                                  .  ....+.++. ...                            +|     ....+.|.||.+|++.+
T Consensus       916 ------------~--~~~~~~~n~-~~~----------------------------~p-----~~~~l~f~nC~~L~~~a  947 (1153)
T PLN03210        916 ------------S--EVAMATDNI-HSK----------------------------LP-----STVCINFINCFNLDQEA  947 (1153)
T ss_pred             ------------h--hhhhhcccc-ccc----------------------------CC-----chhccccccccCCCchh
Confidence                        0  000000000 000                            01     12346789999999877


Q ss_pred             hhhhHHHHHHHHHHHHHHhhhhhhHHHHhhhhhcccccEEEecCCCCCcccccCCCCceEE-EECCCCCCCCCcceeEEE
Q 001407          856 NNKILADSLLRIRHMAIASLRLGYEMAINEKLSELRGSLIVLPGSEIPDWFSNQSSGSSIC-IQLPPHSSCRNLIGFAFC  934 (1083)
Q Consensus       856 ~~~i~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~Pg~~iP~wf~~~~~g~si~-~~lp~~~~~~~~~gf~~c  934 (1083)
                      |..-        +                     .....+++||.+||+||.||+.|++++ |++|++|.+..|+||++|
T Consensus       948 ~l~~--------~---------------------~~~~~~~l~g~evp~~f~hr~~g~sl~~i~l~~~~~~~~~~~f~~c  998 (1153)
T PLN03210        948 LLQQ--------Q---------------------SIFKQLILSGEEVPSYFTHRTTGASLTNIPLLHISPCQPFFRFRAC  998 (1153)
T ss_pred             hhcc--------c---------------------ccceEEECCCccCchhccCCcccceeeeeccCCcccCCCccceEEE
Confidence            5210        0                     012237899999999999999999998 999999998899999999


Q ss_pred             EEeccCCCCCccccccccceeEEEEEeeccCCcceeccccccccCCCcCCceEEEEEeccCc-------cc--C----CC
Q 001407          935 AVLDSKKVDSDCFRYFYVSFQFDLEIKTLSETKHVDLGYNSRYIEDLIDSDRVILGFKPCLN-------VG--F----PD 1001 (1083)
Q Consensus       935 ~v~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~sdh~~~~y~~~~~-------~~--~----~~ 1001 (1083)
                      +|+++......     ...+.+.|.|++.+..+...         +.+.++|+|+.|....+       ..  .    ..
T Consensus       999 ~v~~~~~~~~~-----~~~~~~~~~c~~~~~~~~~~---------~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~ 1064 (1153)
T PLN03210        999 AVVDSESFFII-----SVSFDIQVCCRFIDRLGNHF---------DSPYQPHVFSVTKKGSHLVIFDCCFPLNEDNAPLA 1064 (1153)
T ss_pred             EEEecCccccC-----CCceeEEEEEEEECCCCCcc---------ccCCCceeEeeeccccceEEecccccccccccchh
Confidence            99988764322     22468889998876532210         12345555555443211       00  0    11


Q ss_pred             C--CceEEEEEEEeecCCceEEEEeeceeeecCCCC
Q 001407         1002 G--YHHTIATFKFFAERKFYKIKRCGLCPVYANPSE 1035 (1083)
Q Consensus      1002 ~--~~~~~~~f~f~~~~~~~~vk~CGv~liy~~d~~ 1035 (1083)
                      +  |++..+.|+|......++||+|||+++|+.+..
T Consensus      1065 ~~~~~~~~~~f~~~~~~~~~~~~~cg~~~~~~~~~~ 1100 (1153)
T PLN03210       1065 ELNYDHVDIQFRLTNKNSQLKLKGCGIRLSEDDSSL 1100 (1153)
T ss_pred             ccCCceeeEEEEEecCCCCeEEEeeeEEEeccCCCc
Confidence            2  334444555554444579999999999965544

syringae 6; Provisional
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>PF00931 NB-ARC: NB-ARC domain; InterPro: IPR002182 This is the NB-ARC domain, a novel signalling motif found in bacteria and eukaryotes, shared by plant resistance gene products and regulators of cell death in animals [] Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>PRK04841 transcriptional regulator MalT; Provisional Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>PF05729 NACHT: NACHT domain Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>TIGR03015 pepcterm_ATPase putative secretion ATPase, PEP-CTERM locus subfamily Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>COG2909 MalT ATP-dependent transcriptional regulator [Transcription] Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>TIGR00635 ruvB Holliday junction DNA helicase, RuvB subunit Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>PRK00080 ruvB Holliday junction DNA helicase RuvB; Reviewed Back     alignment and domain information
>COG2256 MGS1 ATPase related to the helicase subunit of the Holliday junction resolvase [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK06893 DNA replication initiation factor; Validated Back     alignment and domain information
>PRK00411 cdc6 cell division control protein 6; Reviewed Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>COG3903 Predicted ATPase [General function prediction only] Back     alignment and domain information
>TIGR02928 orc1/cdc6 family replication initiation protein Back     alignment and domain information
>PF01637 Arch_ATPase: Archaeal ATPase; InterPro: IPR011579 This domain has been found in a number of bacterial and archaeal proteins, all of which contain a conserved P-loop motif that is involved in binding ATP Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>PF13173 AAA_14: AAA domain Back     alignment and domain information
>TIGR03420 DnaA_homol_Hda DnaA regulatory inactivator Hda Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>PRK13342 recombination factor protein RarA; Reviewed Back     alignment and domain information
>PF13401 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S_B Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>PRK08727 hypothetical protein; Validated Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>TIGR01242 26Sp45 26S proteasome subunit P45 family Back     alignment and domain information
>PRK09087 hypothetical protein; Validated Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>PRK08084 DNA replication initiation factor; Provisional Back     alignment and domain information
>TIGR00678 holB DNA polymerase III, delta' subunit Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK05642 DNA replication initiation factor; Validated Back     alignment and domain information
>PF00308 Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013317 This entry represents the central domain of bacterial DnaA proteins [, , ] that play an important role in initiating and regulating chromosomal replication Back     alignment and domain information
>PRK14087 dnaA chromosomal replication initiation protein; Provisional Back     alignment and domain information
>PF05496 RuvB_N: Holliday junction DNA helicase ruvB N-terminus; InterPro: IPR008824 The RuvB protein makes up part of the RuvABC revolvasome which catalyses the resolution of Holliday junctions that arise during genetic recombination and DNA repair Back     alignment and domain information
>KOG2028 consensus ATPase related to the helicase subunit of the Holliday junction resolvase [Replication, recombination and repair] Back     alignment and domain information
>PRK14963 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK09376 rho transcription termination factor Rho; Provisional Back     alignment and domain information
>COG3899 Predicted ATPase [General function prediction only] Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK14961 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK08903 DnaA regulatory inactivator Hda; Validated Back     alignment and domain information
>PRK05564 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PLN03025 replication factor C subunit; Provisional Back     alignment and domain information
>PRK12402 replication factor C small subunit 2; Reviewed Back     alignment and domain information
>PRK13341 recombination factor protein RarA/unknown domain fusion protein; Reviewed Back     alignment and domain information
>PRK14949 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>cd00009 AAA The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>cd01128 rho_factor Transcription termination factor rho is a bacterial ATP-dependent RNA/DNA helicase Back     alignment and domain information
>PRK06645 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK07003 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK14960 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK00149 dnaA chromosomal replication initiation protein; Reviewed Back     alignment and domain information
>PRK03992 proteasome-activating nucleotidase; Provisional Back     alignment and domain information
>PRK14088 dnaA chromosomal replication initiation protein; Provisional Back     alignment and domain information
>PRK12422 chromosomal replication initiation protein; Provisional Back     alignment and domain information
>TIGR02881 spore_V_K stage V sporulation protein K Back     alignment and domain information
>PRK14957 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK07471 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK14962 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK07940 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK12323 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK06620 hypothetical protein; Validated Back     alignment and domain information
>PRK04195 replication factor C large subunit; Provisional Back     alignment and domain information
>TIGR00767 rho transcription termination factor Rho Back     alignment and domain information
>PTZ00112 origin recognition complex 1 protein; Provisional Back     alignment and domain information
>PRK14956 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>TIGR00362 DnaA chromosomal replication initiator protein DnaA Back     alignment and domain information
>PF14516 AAA_35: AAA-like domain Back     alignment and domain information
>PRK00440 rfc replication factor C small subunit; Reviewed Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>PRK08691 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PTZ00361 26 proteosome regulatory subunit 4-like protein; Provisional Back     alignment and domain information
>PRK14955 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>TIGR02397 dnaX_nterm DNA polymerase III, subunit gamma and tau Back     alignment and domain information
>PRK09112 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>TIGR03689 pup_AAA proteasome ATPase Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>PRK05707 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PTZ00454 26S protease regulatory subunit 6B-like protein; Provisional Back     alignment and domain information
>PRK14964 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG0593 DnaA ATPase involved in DNA replication initiation [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK08116 hypothetical protein; Validated Back     alignment and domain information
>PRK07994 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>CHL00181 cbbX CbbX; Provisional Back     alignment and domain information
>PF00004 AAA: ATPase family associated with various cellular activities (AAA); InterPro: IPR003959 AAA ATPases (ATPases Associated with diverse cellular Activities) form a large protein family and play a number of roles in the cell including cell-cycle regulation, protein proteolysis and disaggregation, organelle biogenesis and intracellular transport Back     alignment and domain information
>TIGR02880 cbbX_cfxQ probable Rubsico expression protein CbbX Back     alignment and domain information
>PRK14086 dnaA chromosomal replication initiation protein; Provisional Back     alignment and domain information
>TIGR02903 spore_lon_C ATP-dependent protease, Lon family Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>PHA02544 44 clamp loader, small subunit; Provisional Back     alignment and domain information
>COG1222 RPT1 ATP-dependent 26S proteasome regulatory subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK14970 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14951 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14959 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK05896 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK14958 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>PLN00020 ribulose bisphosphate carboxylase/oxygenase activase -RuBisCO activase (RCA); Provisional Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>PRK14969 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>COG1474 CDC6 Cdc6-related protein, AAA superfamily ATPase [DNA replication, recombination, and repair / Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK14954 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK08181 transposase; Validated Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>COG1373 Predicted ATPase (AAA+ superfamily) [General function prediction only] Back     alignment and domain information
>PRK14950 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>smart00382 AAA ATPases associated with a variety of cellular activities Back     alignment and domain information
>CHL00176 ftsH cell division protein; Validated Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>PRK07133 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>KOG0741 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd01133 F1-ATPase_beta F1 ATP synthase beta subunit, nucleotide-binding domain Back     alignment and domain information
>PF01695 IstB_IS21: IstB-like ATP binding protein; InterPro: IPR002611 Proteins in this entry contain an ATP/GTP binding P-loop motif Back     alignment and domain information
>PRK06305 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK14952 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK08451 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK14953 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>KOG0989 consensus Replication factor C, subunit RFC4 [Replication, recombination and repair] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>PRK09183 transposase/IS protein; Provisional Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>PRK06526 transposase; Provisional Back     alignment and domain information
>PRK07764 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>TIGR01241 FtsH_fam ATP-dependent metalloprotease FtsH Back     alignment and domain information
>PRK09111 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK14948 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK12377 putative replication protein; Provisional Back     alignment and domain information
>KOG0744 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK06871 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>cd01131 PilT Pilus retraction ATPase PilT Back     alignment and domain information
>PRK06921 hypothetical protein; Provisional Back     alignment and domain information
>CHL00195 ycf46 Ycf46; Provisional Back     alignment and domain information
>PF07728 AAA_5: AAA domain (dynein-related subfamily); InterPro: IPR011704 The ATPases Associated to a variety of cellular Activities (AAA) are a family distinguished by a highly conserved module of 230 amino acids [] Back     alignment and domain information
>PF13191 AAA_16: AAA ATPase domain; PDB: 2V1U_A Back     alignment and domain information
>PRK10536 hypothetical protein; Provisional Back     alignment and domain information
>PRK14971 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK08769 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK06647 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>KOG0733 consensus Nuclear AAA ATPase (VCP subfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF04665 Pox_A32: Poxvirus A32 protein; InterPro: IPR006758 This entry contains uncharacterised proteins belonging to the B354L family which include the pox virus A32 protein Back     alignment and domain information
>PRK07952 DNA replication protein DnaC; Validated Back     alignment and domain information
>TIGR01243 CDC48 AAA family ATPase, CDC48 subfamily Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>PF02562 PhoH: PhoH-like protein; InterPro: IPR003714 PhoH is a cytoplasmic protein and predicted ATPase that is induced by phosphate starvation and belongings to the phosphate regulon (pho) in Escherichia coli [] Back     alignment and domain information
>COG3267 ExeA Type II secretory pathway, component ExeA (predicted ATPase) [Intracellular trafficking and secretion] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>PRK06090 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>TIGR02640 gas_vesic_GvpN gas vesicle protein GvpN Back     alignment and domain information
>PF05673 DUF815: Protein of unknown function (DUF815); InterPro: IPR008533 This domain consists of several bacterial proteins of unknown function Back     alignment and domain information
>KOG0735 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK06835 DNA replication protein DnaC; Validated Back     alignment and domain information
>PRK07993 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK08118 topology modulation protein; Reviewed Back     alignment and domain information
>KOG2227 consensus Pre-initiation complex, subunit CDC6, AAA+ superfamily ATPase [Replication, recombination and repair; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PTZ00202 tuzin; Provisional Back     alignment and domain information
>cd00561 CobA_CobO_BtuR ATP:corrinoid adenosyltransferase BtuR/CobO/CobP Back     alignment and domain information
>PRK07399 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK08058 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PHA00729 NTP-binding motif containing protein Back     alignment and domain information
>cd01120 RecA-like_NTPases RecA-like NTPases Back     alignment and domain information
>PF05621 TniB: Bacterial TniB protein; InterPro: IPR008868 This family consists of several bacterial TniB NTP-binding proteins Back     alignment and domain information
>PRK05563 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK12608 transcription termination factor Rho; Provisional Back     alignment and domain information
>KOG2543 consensus Origin recognition complex, subunit 5 [Replication, recombination and repair] Back     alignment and domain information
>PRK05541 adenylylsulfate kinase; Provisional Back     alignment and domain information
>COG1484 DnaC DNA replication protein [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK06964 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PF13207 AAA_17: AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6_G 2QT1_A 2QSZ_A 2QSY_A 2QT0_A 2QG6_A 2P0E_A Back     alignment and domain information
>TIGR02639 ClpA ATP-dependent Clp protease ATP-binding subunit clpA Back     alignment and domain information
>PRK14965 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK07261 topology modulation protein; Provisional Back     alignment and domain information
>PRK10733 hflB ATP-dependent metalloprotease; Reviewed Back     alignment and domain information
>TIGR01243 CDC48 AAA family ATPase, CDC48 subfamily Back     alignment and domain information
>PRK04132 replication factor C small subunit; Provisional Back     alignment and domain information
>COG4608 AppF ABC-type oligopeptide transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>PF00448 SRP54: SRP54-type protein, GTPase domain; InterPro: IPR000897 The signal recognition particle (SRP) is a multimeric protein, which along with its conjugate receptor (SR), is involved in targeting secretory proteins to the rough endoplasmic reticulum (RER) membrane in eukaryotes, or to the plasma membrane in prokaryotes [, ] Back     alignment and domain information
>PRK10865 protein disaggregation chaperone; Provisional Back     alignment and domain information
>PRK08939 primosomal protein DnaI; Reviewed Back     alignment and domain information
>cd03221 ABCF_EF-3 ABCF_EF-3 Elongation factor 3 (EF-3) is a cytosolic protein required by fungal ribosomes for in vitro protein synthesis and for in vivo growth Back     alignment and domain information
>TIGR02639 ClpA ATP-dependent Clp protease ATP-binding subunit clpA Back     alignment and domain information
>KOG0743 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG1618 Predicted nucleotide kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK04296 thymidine kinase; Provisional Back     alignment and domain information
>COG2255 RuvB Holliday junction resolvasome, helicase subunit [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK08699 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>COG1223 Predicted ATPase (AAA+ superfamily) [General function prediction only] Back     alignment and domain information
>KOG0991 consensus Replication factor C, subunit RFC2 [Replication, recombination and repair] Back     alignment and domain information
>cd03222 ABC_RNaseL_inhibitor The ABC ATPase RNase L inhibitor (RLI) is a key enzyme in ribosomal biogenesis, formation of translation preinitiation complexes, and assembly of HIV capsids Back     alignment and domain information
>cd03214 ABC_Iron-Siderophores_B12_Hemin ABC transporters, involved in the uptake of siderophores, heme, and vitamin B12, are widely conserved in bacteria and archaea Back     alignment and domain information
>TIGR03345 VI_ClpV1 type VI secretion ATPase, ClpV1 family Back     alignment and domain information
>PRK11331 5-methylcytosine-specific restriction enzyme subunit McrB; Provisional Back     alignment and domain information
>KOG0730 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK11889 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>COG1121 ZnuC ABC-type Mn/Zn transport systems, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>cd03216 ABC_Carb_Monos_I This family represents the domain I of the carbohydrate uptake proteins that transport only monosaccharides (Monos) Back     alignment and domain information
>KOG0651 consensus 26S proteasome regulatory complex, ATPase RPT4 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0733 consensus Nuclear AAA ATPase (VCP subfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd03223 ABCD_peroxisomal_ALDP Peroxisomal ATP-binding cassette transporter (Pat) is involved in the import of very long-chain fatty acids (VLCFA) into the peroxisome Back     alignment and domain information
>TIGR03345 VI_ClpV1 type VI secretion ATPase, ClpV1 family Back     alignment and domain information
>TIGR00602 rad24 checkpoint protein rad24 Back     alignment and domain information
>KOG0728 consensus 26S proteasome regulatory complex, ATPase RPT6 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR03346 chaperone_ClpB ATP-dependent chaperone ClpB Back     alignment and domain information
>PF13671 AAA_33: AAA domain; PDB: 1LTQ_A 2IA5_K 1RC8_A 1LY1_A 1RRC_A 1RPZ_A 3ZVM_A 1YJ5_A 3ZVL_A 3U7E_B Back     alignment and domain information
>cd00267 ABC_ATPase ABC (ATP-binding cassette) transporter nucleotide-binding domain; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules Back     alignment and domain information
>PRK14722 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>COG1875 NYN ribonuclease and ATPase of PhoH family domains [General function prediction only] Back     alignment and domain information
>PRK11034 clpA ATP-dependent Clp protease ATP-binding subunit; Provisional Back     alignment and domain information
>PF00406 ADK: Adenylate kinase; InterPro: IPR000850 Adenylate kinases (ADK) are phosphotransferases that catalyse the reversible reaction AMP + MgATP = ADP + MgADP an essential reaction for many processes in living cells Back     alignment and domain information
>TIGR01420 pilT_fam pilus retraction protein PilT Back     alignment and domain information
>COG2884 FtsE Predicted ATPase involved in cell division [Cell division and chromosome partitioning] Back     alignment and domain information
>cd01394 radB RadB Back     alignment and domain information
>cd01393 recA_like RecA is a bacterial enzyme which has roles in homologous recombination, DNA repair, and the induction of the SOS response Back     alignment and domain information
>COG0464 SpoVK ATPases of the AAA+ class [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG0542 clpA ATP-binding subunits of Clp protease and DnaK/DnaJ chaperones [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>CHL00095 clpC Clp protease ATP binding subunit Back     alignment and domain information
>cd00544 CobU Adenosylcobinamide kinase / adenosylcobinamide phosphate guanyltransferase (CobU) Back     alignment and domain information
>cd01121 Sms Sms (bacterial radA) DNA repair protein Back     alignment and domain information
>cd03229 ABC_Class3 This class is comprised of all BPD (Binding Protein Dependent) systems that are largely represented in archaea and eubacteria and are primarily involved in scavenging solutes from the environment Back     alignment and domain information
>PF13177 DNA_pol3_delta2: DNA polymerase III, delta subunit; PDB: 1NJF_B 3GLG_G 1XXH_I 1NJG_A 3GLF_B 3GLI_G 1IQP_E 2GNO_A 1SXJ_E 1A5T_A Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>cd03230 ABC_DR_subfamily_A This family of ATP-binding proteins belongs to a multisubunit transporter involved in drug resistance (BcrA and DrrA), nodulation, lipid transport, and lantibiotic immunity Back     alignment and domain information
>PRK06762 hypothetical protein; Provisional Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>cd03247 ABCC_cytochrome_bd The CYD subfamily implicated in cytochrome bd biogenesis Back     alignment and domain information
>COG0572 Udk Uridine kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>TIGR01359 UMP_CMP_kin_fam UMP-CMP kinase family Back     alignment and domain information
>PF07726 AAA_3: ATPase family associated with various cellular activities (AAA); InterPro: IPR011703 This entry includes some of the AAA proteins not detected by the IPR003959 from INTERPRO model Back     alignment and domain information
>CHL00095 clpC Clp protease ATP binding subunit Back     alignment and domain information
>TIGR00763 lon ATP-dependent protease La Back     alignment and domain information
>PRK11034 clpA ATP-dependent Clp protease ATP-binding subunit; Provisional Back     alignment and domain information
>PF13238 AAA_18: AAA domain; PDB: 3IIK_A 3IIJ_A 3IIL_A 1RKB_A 3IIM_A 2AXP_A 3KB2_A 1KHT_A 1NKS_A 3H86_C Back     alignment and domain information
>cd03238 ABC_UvrA The excision repair protein UvrA; Nucleotide excision repair in eubacteria is a process that repairs DNA damage by the removal of a 12-13-mer oligonucleotide containing the lesion Back     alignment and domain information
>PRK10865 protein disaggregation chaperone; Provisional Back     alignment and domain information
>TIGR00708 cobA cob(I)alamin adenosyltransferase Back     alignment and domain information
>PF00485 PRK: Phosphoribulokinase / Uridine kinase family; InterPro: IPR006083 Phosphoribulokinase (PRK) 2 Back     alignment and domain information
>KOG2035 consensus Replication factor C, subunit RFC3 [Cell cycle control, cell division, chromosome partitioning; Replication, recombination and repair] Back     alignment and domain information
>cd03283 ABC_MutS-like MutS-like homolog in eukaryotes Back     alignment and domain information
>cd03115 SRP The signal recognition particle (SRP) mediates the transport to or across the plasma membrane in bacteria and the endoplasmic reticulum in eukaryotes Back     alignment and domain information
>cd03246 ABCC_Protease_Secretion This family represents the ABC component of the protease secretion system PrtD, a 60-kDa integral membrane protein sharing 37% identity with HlyB, the ABC component of the alpha-hemolysin secretion pathway, in the C-terminal domain Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>PF10443 RNA12: RNA12 protein; InterPro: IPR018850 Mitochondrial escape protein 2 (also known as RNA12) plays a role in maintaining the mitochondrial genome and in controlling mtDNA escape [, ] Back     alignment and domain information
>KOG0731 consensus AAA+-type ATPase containing the peptidase M41 domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG1136 SalX ABC-type antimicrobial peptide transport system, ATPase component [Defense mechanisms] Back     alignment and domain information
>cd01135 V_A-ATPase_B V/A-type ATP synthase (non-catalytic) subunit B Back     alignment and domain information
>PRK08356 hypothetical protein; Provisional Back     alignment and domain information
>PF01583 APS_kinase: Adenylylsulphate kinase; InterPro: IPR002891 Protein phosphorylation, which plays a key role in most cellular activities, is a reversible process mediated by protein kinases and phosphoprotein phosphatases Back     alignment and domain information
>PRK14974 cell division protein FtsY; Provisional Back     alignment and domain information
>TIGR02237 recomb_radB DNA repair and recombination protein RadB Back     alignment and domain information
>PRK09280 F0F1 ATP synthase subunit beta; Validated Back     alignment and domain information
>PRK12723 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>COG1124 DppF ABC-type dipeptide/oligopeptide/nickel transport system, ATPase component [Amino acid transport and metabolism / Inorganic ion transport and metabolism] Back     alignment and domain information
>cd03233 ABC_PDR_domain1 The pleiotropic drug resistance (PDR) family of ATP-binding cassette (ABC) transporters Back     alignment and domain information
>TIGR03346 chaperone_ClpB ATP-dependent chaperone ClpB Back     alignment and domain information
>PRK12724 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PTZ00301 uridine kinase; Provisional Back     alignment and domain information
>COG0488 Uup ATPase components of ABC transporters with duplicated ATPase domains [General function prediction only] Back     alignment and domain information
>PRK06696 uridine kinase; Validated Back     alignment and domain information
>PRK05480 uridine/cytidine kinase; Provisional Back     alignment and domain information
>PRK09361 radB DNA repair and recombination protein RadB; Provisional Back     alignment and domain information
>TIGR03574 selen_PSTK L-seryl-tRNA(Sec) kinase, archaeal Back     alignment and domain information
>cd03237 ABC_RNaseL_inhibitor_domain2 The ATPase domain 2 of RNase L inhibitor Back     alignment and domain information
>TIGR02858 spore_III_AA stage III sporulation protein AA Back     alignment and domain information
>cd03228 ABCC_MRP_Like The MRP (Mutidrug Resistance Protein)-like transporters are involved in drug, peptide, and lipid export Back     alignment and domain information
>KOG0734 consensus AAA+-type ATPase containing the peptidase M41 domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG0563 Adk Adenylate kinase and related kinases [Nucleotide transport and metabolism] Back     alignment and domain information
>TIGR01039 atpD ATP synthase, F1 beta subunit Back     alignment and domain information
>PRK05703 flhF flagellar biosynthesis regulator FlhF; Validated Back     alignment and domain information
>cd03232 ABC_PDR_domain2 The pleiotropic drug resistance-like (PDR) family of ATP-binding cassette (ABC) transporters Back     alignment and domain information
>PRK08233 hypothetical protein; Provisional Back     alignment and domain information
>cd02019 NK Nucleoside/nucleotide kinase (NK) is a protein superfamily consisting of multiple families of enzymes that share structural similarity and are functionally related to the catalysis of the reversible phosphate group transfer from nucleoside triphosphates to nucleosides/nucleotides, nucleoside monophosphates, or sugars Back     alignment and domain information
>PRK04040 adenylate kinase; Provisional Back     alignment and domain information
>PRK12597 F0F1 ATP synthase subunit beta; Provisional Back     alignment and domain information
>COG0466 Lon ATP-dependent Lon protease, bacterial type [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG1120 FepC ABC-type cobalamin/Fe3+-siderophores transport systems, ATPase components [Inorganic ion transport and metabolism / Coenzyme metabolism] Back     alignment and domain information
>PRK12726 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PRK07667 uridine kinase; Provisional Back     alignment and domain information
>TIGR00416 sms DNA repair protein RadA Back     alignment and domain information
>PRK00771 signal recognition particle protein Srp54; Provisional Back     alignment and domain information
>PRK06067 flagellar accessory protein FlaH; Validated Back     alignment and domain information
>cd03240 ABC_Rad50 The catalytic domains of Rad50 are similar to the ATP-binding cassette of ABC transporters, but are not associated with membrane-spanning domains Back     alignment and domain information
>cd03217 ABC_FeS_Assembly ABC-type transport system involved in Fe-S cluster assembly, ATPase component Back     alignment and domain information
>PRK03839 putative kinase; Provisional Back     alignment and domain information
>cd00983 recA RecA is a bacterial enzyme which has roles in homologous recombination, DNA repair, and the induction of the SOS response Back     alignment and domain information
>COG0470 HolB ATPase involved in DNA replication [DNA replication, recombination, and repair] Back     alignment and domain information
>PF00910 RNA_helicase: RNA helicase; InterPro: IPR000605 Helicases have been classified in 5 superfamilies (SF1-SF5) Back     alignment and domain information
>PF00006 ATP-synt_ab: ATP synthase alpha/beta family, nucleotide-binding domain This Pfam entry corresponds to chains a,b,c,d,e and f; InterPro: IPR000194 ATPases (or ATP synthases) are membrane-bound enzyme complexes/ion transporters that combine ATP synthesis and/or hydrolysis with the transport of protons across a membrane Back     alignment and domain information
>cd01122 GP4d_helicase GP4d_helicase is a homohexameric 5'-3' helicases Back     alignment and domain information
>cd02027 APSK Adenosine 5'-phosphosulfate kinase (APSK) catalyzes the phosphorylation of adenosine 5'-phosphosulfate to form 3'-phosphoadenosine 5'-phosphosulfate (PAPS) Back     alignment and domain information
>TIGR00235 udk uridine kinase Back     alignment and domain information
>TIGR03499 FlhF flagellar biosynthetic protein FlhF Back     alignment and domain information
>PRK05986 cob(I)alamin adenolsyltransferase/cobinamide ATP-dependent adenolsyltransferase; Validated Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>cd03220 ABC_KpsT_Wzt ABC_KpsT_Wzt The KpsT/Wzt ABC transporter subfamily is involved in extracellular polysaccharide export Back     alignment and domain information
>TIGR02012 tigrfam_recA protein RecA Back     alignment and domain information
>PF08433 KTI12: Chromatin associated protein KTI12 ; InterPro: IPR013641 This is a family of chromatin associated proteins which interact with the Elongator complex, a component of the elongating form of RNA polymerase II [] Back     alignment and domain information
>PRK00625 shikimate kinase; Provisional Back     alignment and domain information
>PF03969 AFG1_ATPase: AFG1-like ATPase; InterPro: IPR005654 ATPase family gene 1 (AFG1) ATPase is a 377 amino acid putative protein with an ATPase motif typical of the protein family including SEC18p PAS1, CDC48-VCP and TBP Back     alignment and domain information
>cd03268 ABC_BcrA_bacitracin_resist The BcrA subfamily represents ABC transporters involved in peptide antibiotic resistance Back     alignment and domain information
>cd01125 repA Hexameric Replicative Helicase RepA Back     alignment and domain information
>COG1428 Deoxynucleoside kinases [Nucleotide transport and metabolism] Back     alignment and domain information
>cd04121 Rab40 Rab40 subfamily Back     alignment and domain information
>PRK11823 DNA repair protein RadA; Provisional Back     alignment and domain information
>COG4618 ArpD ABC-type protease/lipase transport system, ATPase and permease components [General function prediction only] Back     alignment and domain information
>TIGR03740 galliderm_ABC gallidermin-class lantibiotic protection ABC transporter, ATP-binding subunit Back     alignment and domain information
>COG0055 AtpD F0F1-type ATP synthase, beta subunit [Energy production and conversion] Back     alignment and domain information
>cd03235 ABC_Metallic_Cations ABC component of the metal-type transporters Back     alignment and domain information
>TIGR00959 ffh signal recognition particle protein Back     alignment and domain information
>PF07724 AAA_2: AAA domain (Cdc48 subfamily); InterPro: IPR013093 ATPases Associated to a variety of cellular Activities (AAA) are a family distinguished by a highly conserved module of 230 amino acids [] Back     alignment and domain information
>TIGR00960 3a0501s02 Type II (General) Secretory Pathway (IISP) Family protein Back     alignment and domain information
>PTZ00088 adenylate kinase 1; Provisional Back     alignment and domain information
>PRK10787 DNA-binding ATP-dependent protease La; Provisional Back     alignment and domain information
>COG5635 Predicted NTPase (NACHT family) [Signal transduction mechanisms] Back     alignment and domain information
>PRK10867 signal recognition particle protein; Provisional Back     alignment and domain information
>TIGR01360 aden_kin_iso1 adenylate kinase, isozyme 1 subfamily Back     alignment and domain information
>PRK06547 hypothetical protein; Provisional Back     alignment and domain information
>cd03263 ABC_subfamily_A The ABCA subfamily mediates the transport of a variety of lipid compounds Back     alignment and domain information
>PRK09354 recA recombinase A; Provisional Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>CHL00206 ycf2 Ycf2; Provisional Back     alignment and domain information
>PF13604 AAA_30: AAA domain; PDB: 1W36_G 3K70_G 3UPU_B 3GPL_A 3E1S_A 3GP8_A Back     alignment and domain information
>cd03281 ABC_MSH5_euk MutS5 homolog in eukaryotes Back     alignment and domain information
>KOG0730 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK12678 transcription termination factor Rho; Provisional Back     alignment and domain information
>PRK06217 hypothetical protein; Validated Back     alignment and domain information
>PF03205 MobB: Molybdopterin guanine dinucleotide synthesis protein B; PDB: 2F1R_B 1P9N_A 1NP6_B 2NPI_A 1XJC_A Back     alignment and domain information
>cd03213 ABCG_EPDR ABCG transporters are involved in eye pigment (EP) precursor transport, regulation of lipid-trafficking mechanisms, and pleiotropic drug resistance (DR) Back     alignment and domain information
>COG2607 Predicted ATPase (AAA+ superfamily) [General function prediction only] Back     alignment and domain information
>cd03266 ABC_NatA_sodium_exporter NatA is the ATPase component of a bacterial ABC-type Na+ transport system called NatAB, which catalyzes ATP-dependent electrogenic Na+ extrusion without mechanically coupled proton or K+ uptake Back     alignment and domain information
>TIGR01069 mutS2 MutS2 family protein Back     alignment and domain information
>cd01129 PulE-GspE PulE/GspE The type II secretory pathway is the main terminal branch of the general secretory pathway (GSP) Back     alignment and domain information
>cd02028 UMPK_like Uridine monophosphate kinase_like (UMPK_like) is a family of proteins highly similar to the uridine monophosphate kinase (UMPK, EC 2 Back     alignment and domain information
>PRK00131 aroK shikimate kinase; Reviewed Back     alignment and domain information
>cd03215 ABC_Carb_Monos_II This family represents domain II of the carbohydrate uptake proteins that transport only monosaccharides (Monos) Back     alignment and domain information
>cd01132 F1_ATPase_alpha F1 ATP synthase alpha, central domain Back     alignment and domain information
>PRK13543 cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>COG0396 sufC Cysteine desulfurase activator ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR00064 ftsY signal recognition particle-docking protein FtsY Back     alignment and domain information
>cd03264 ABC_drug_resistance_like ABC-type multidrug transport system, ATPase component Back     alignment and domain information
>PRK00889 adenylylsulfate kinase; Provisional Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>TIGR01188 drrA daunorubicin resistance ABC transporter ATP-binding subunit Back     alignment and domain information
>COG1066 Sms Predicted ATP-dependent serine protease [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK13947 shikimate kinase; Provisional Back     alignment and domain information
>TIGR03305 alt_F1F0_F1_bet alternate F1F0 ATPase, F1 subunit beta Back     alignment and domain information
>PRK03846 adenylylsulfate kinase; Provisional Back     alignment and domain information
>cd03285 ABC_MSH2_euk MutS2 homolog in eukaryotes Back     alignment and domain information
>cd03284 ABC_MutS1 MutS1 homolog in eukaryotes Back     alignment and domain information
>cd00227 CPT Chloramphenicol (Cm) phosphotransferase (CPT) Back     alignment and domain information
>cd00071 GMPK Guanosine monophosphate kinase (GMPK, EC 2 Back     alignment and domain information
>cd03278 ABC_SMC_barmotin Barmotin is a tight junction-associated protein expressed in rat epithelial cells which is thought to have an important regulatory role in tight junction barrier function Back     alignment and domain information
>PRK08972 fliI flagellum-specific ATP synthase; Validated Back     alignment and domain information
>PF00625 Guanylate_kin: Guanylate kinase; InterPro: IPR008144 Guanylate kinase (2 Back     alignment and domain information
>KOG2228 consensus Origin recognition complex, subunit 4 [Replication, recombination and repair] Back     alignment and domain information
>PRK10751 molybdopterin-guanine dinucleotide biosynthesis protein B; Provisional Back     alignment and domain information
>COG4088 Predicted nucleotide kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>COG0488 Uup ATPase components of ABC transporters with duplicated ATPase domains [General function prediction only] Back     alignment and domain information
>PRK07132 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK14723 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PRK13948 shikimate kinase; Provisional Back     alignment and domain information
>PRK13537 nodulation ABC transporter NodI; Provisional Back     alignment and domain information
>cd02024 NRK1 Nicotinamide riboside kinase (NRK) is an enzyme involved in the metabolism of nicotinamide adenine dinucleotide (NAD+) Back     alignment and domain information
>PRK13647 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>KOG1514 consensus Origin recognition complex, subunit 1, and related proteins [Replication, recombination and repair] Back     alignment and domain information
>PRK14721 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>COG3640 CooC CO dehydrogenase maturation factor [Cell division and chromosome partitioning] Back     alignment and domain information
>PF10236 DAP3: Mitochondrial ribosomal death-associated protein 3; InterPro: IPR019368 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms Back     alignment and domain information
>cd02025 PanK Pantothenate kinase (PanK) catalyzes the phosphorylation of pantothenic acid to form 4'-phosphopantothenic, which is the first of five steps in coenzyme A (CoA) biosynthetic pathway Back     alignment and domain information
>TIGR01425 SRP54_euk signal recognition particle protein SRP54 Back     alignment and domain information
>PRK13409 putative ATPase RIL; Provisional Back     alignment and domain information
>cd02023 UMPK Uridine monophosphate kinase (UMPK, EC 2 Back     alignment and domain information
>PRK12727 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>KOG0062 consensus ATPase component of ABC transporters with duplicated ATPase domains/Translation elongation factor EF-3b [Amino acid transport and metabolism; Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>COG1126 GlnQ ABC-type polar amino acid transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>PF07725 LRR_3: Leucine Rich Repeat; InterPro: IPR011713 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>PRK09270 nucleoside triphosphate hydrolase domain-containing protein; Reviewed Back     alignment and domain information
>COG1419 FlhF Flagellar GTP-binding protein [Cell motility and secretion] Back     alignment and domain information
>cd03300 ABC_PotA_N PotA is an ABC-type transporter and the ATPase component of the spermidine/putrescine-preferential uptake system consisting of PotA, -B, -C, and -D Back     alignment and domain information
>PF03215 Rad17: Rad17 cell cycle checkpoint protein Back     alignment and domain information
>PF00154 RecA: recA bacterial DNA recombination protein; InterPro: IPR013765 The recA gene product is a multifunctional enzyme that plays a role in homologous recombination, DNA repair and induction of the SOS response [] Back     alignment and domain information
>cd01130 VirB11-like_ATPase Type IV secretory pathway component VirB11, and related ATPases Back     alignment and domain information
>PRK13949 shikimate kinase; Provisional Back     alignment and domain information
>TIGR02322 phosphon_PhnN phosphonate metabolism protein/1,5-bisphosphokinase (PRPP-forming) PhnN Back     alignment and domain information
>KOG1969 consensus DNA replication checkpoint protein CHL12/CTF18 [Cell cycle control, cell division, chromosome partitioning; Replication, recombination and repair] Back     alignment and domain information
>cd03287 ABC_MSH3_euk MutS3 homolog in eukaryotes Back     alignment and domain information
>COG1936 Predicted nucleotide kinase (related to CMP and AMP kinases) [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK09544 znuC high-affinity zinc transporter ATPase; Reviewed Back     alignment and domain information
>KOG1532 consensus GTPase XAB1, interacts with DNA repair protein XPA [Replication, recombination and repair] Back     alignment and domain information
>cd03282 ABC_MSH4_euk MutS4 homolog in eukaryotes Back     alignment and domain information
>COG0444 DppD ABC-type dipeptide/oligopeptide/nickel transport system, ATPase component [Amino acid transport and metabolism / Inorganic ion transport and metabolism] Back     alignment and domain information
>TIGR03522 GldA_ABC_ATP gliding motility-associated ABC transporter ATP-binding subunit GldA Back     alignment and domain information
>CHL00060 atpB ATP synthase CF1 beta subunit Back     alignment and domain information
>smart00763 AAA_PrkA PrkA AAA domain Back     alignment and domain information
>TIGR00073 hypB hydrogenase accessory protein HypB Back     alignment and domain information
>COG0468 RecA RecA/RadA recombinase [DNA replication, recombination, and repair] Back     alignment and domain information
>TIGR00176 mobB molybdopterin-guanine dinucleotide biosynthesis protein MobB Back     alignment and domain information
>cd03289 ABCC_CFTR2 The CFTR subfamily domain 2 Back     alignment and domain information
>PRK08927 fliI flagellum-specific ATP synthase; Validated Back     alignment and domain information
>cd02020 CMPK Cytidine monophosphate kinase (CMPK) catalyzes the reversible phosphorylation of cytidine monophosphate (CMP) to produce cytidine diphosphate (CDP), using ATP as the preferred phosphoryl donor Back     alignment and domain information
>TIGR03771 anch_rpt_ABC anchored repeat-type ABC transporter, ATP-binding subunit Back     alignment and domain information
>KOG0736 consensus Peroxisome assembly factor 2 containing the AAA+-type ATPase domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG0194 Gmk Guanylate kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>cd02021 GntK Gluconate kinase (GntK) catalyzes the phosphoryl transfer from ATP to gluconate Back     alignment and domain information
>PF03266 NTPase_1: NTPase; InterPro: IPR004948 This entry represents a family of nucleoside-triphosphatases which have activity towards ATP, GTP, CTP, TTP and UTP and may hydrolyse nucleoside diphosphates with lower efficiency [] Back     alignment and domain information
>KOG0079 consensus GTP-binding protein H-ray, small G protein superfamily [General function prediction only] Back     alignment and domain information
>CHL00059 atpA ATP synthase CF1 alpha subunit Back     alignment and domain information
>PRK00279 adk adenylate kinase; Reviewed Back     alignment and domain information
>COG4555 NatA ABC-type Na+ transport system, ATPase component [Energy production and conversion / Inorganic ion transport and metabolism] Back     alignment and domain information
>TIGR01650 PD_CobS cobaltochelatase, CobS subunit Back     alignment and domain information
>PRK13768 GTPase; Provisional Back     alignment and domain information
>PRK10463 hydrogenase nickel incorporation protein HypB; Provisional Back     alignment and domain information
>PRK05057 aroK shikimate kinase I; Reviewed Back     alignment and domain information
>COG0703 AroK Shikimate kinase [Amino acid transport and metabolism] Back     alignment and domain information
>cd00464 SK Shikimate kinase (SK) is the fifth enzyme in the shikimate pathway, a seven-step biosynthetic pathway which converts erythrose-4-phosphate to chorismic acid, found in bacteria, fungi and plants Back     alignment and domain information
>PRK12339 2-phosphoglycerate kinase; Provisional Back     alignment and domain information
>COG1131 CcmA ABC-type multidrug transport system, ATPase component [Defense mechanisms] Back     alignment and domain information
>cd01428 ADK Adenylate kinase (ADK) catalyzes the reversible phosphoryl transfer from adenosine triphosphates (ATP) to adenosine monophosphates (AMP) and to yield adenosine diphosphates (ADP) Back     alignment and domain information
>COG2812 DnaX DNA polymerase III, gamma/tau subunits [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK10416 signal recognition particle-docking protein FtsY; Provisional Back     alignment and domain information
>PRK13946 shikimate kinase; Provisional Back     alignment and domain information
>PRK05800 cobU adenosylcobinamide kinase/adenosylcobinamide-phosphate guanylyltransferase; Validated Back     alignment and domain information
>PRK15453 phosphoribulokinase; Provisional Back     alignment and domain information
>COG0003 ArsA Predicted ATPase involved in chromosome partitioning [Cell division and chromosome partitioning] Back     alignment and domain information
>COG3638 ABC-type phosphate/phosphonate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>TIGR03324 alt_F1F0_F1_al alternate F1F0 ATPase, F1 subunit alpha Back     alignment and domain information
>PRK00409 recombination and DNA strand exchange inhibitor protein; Reviewed Back     alignment and domain information
>KOG0737 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK14493 putative bifunctional molybdopterin-guanine dinucleotide biosynthesis protein MobB/MoaE; Provisional Back     alignment and domain information
>PRK05439 pantothenate kinase; Provisional Back     alignment and domain information
>TIGR01287 nifH nitrogenase iron protein Back     alignment and domain information
>PF00437 T2SE: Type II/IV secretion system protein; InterPro: IPR001482 A number of bacterial proteins, some of which are involved in a general secretion pathway (GSP) for the export of proteins (also called the type II pathway) belong to this group [, ] Back     alignment and domain information
>PRK13536 nodulation factor exporter subunit NodI; Provisional Back     alignment and domain information
>TIGR00554 panK_bact pantothenate kinase, bacterial type Back     alignment and domain information
>PF00158 Sigma54_activat: Sigma-54 interaction domain; InterPro: IPR002078 Some bacterial regulatory proteins activate the expression of genes from promoters recognised by core RNA polymerase associated with the alternative sigma-54 factor Back     alignment and domain information
>PRK15429 formate hydrogenlyase transcriptional activator FhlA; Provisional Back     alignment and domain information
>COG1102 Cmk Cytidylate kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>TIGR03263 guanyl_kin guanylate kinase Back     alignment and domain information
>PRK13236 nitrogenase reductase; Reviewed Back     alignment and domain information
>PRK13975 thymidylate kinase; Provisional Back     alignment and domain information
>TIGR02788 VirB11 P-type DNA transfer ATPase VirB11 Back     alignment and domain information
>TIGR00968 3a0106s01 sulfate ABC transporter, ATP-binding protein Back     alignment and domain information
>cd01136 ATPase_flagellum-secretory_path_III Flagellum-specific ATPase/type III secretory pathway virulence-related protein Back     alignment and domain information
>PF12775 AAA_7: P-loop containing dynein motor region D3; PDB: 4AKI_A 4AI6_B 4AKH_A 4AKG_A 3QMZ_A 3VKH_A 3VKG_A Back     alignment and domain information
>PRK14738 gmk guanylate kinase; Provisional Back     alignment and domain information
>PRK11608 pspF phage shock protein operon transcriptional activator; Provisional Back     alignment and domain information
>COG2274 SunT ABC-type bacteriocin/lantibiotic exporters, contain an N-terminal double-glycine peptidase domain [Defense mechanisms] Back     alignment and domain information
>cd01124 KaiC KaiC is a circadian clock protein primarily found in cyanobacteria KaiC is a RecA-like ATPase, having both Walker A and Walker B motifs Back     alignment and domain information
>PF13481 AAA_25: AAA domain; PDB: 1G8Y_J 1OLO_A 1NLF_C Back     alignment and domain information
>TIGR01041 ATP_syn_B_arch ATP synthase archaeal, B subunit Back     alignment and domain information
>PRK13546 teichoic acids export protein ATP-binding subunit; Provisional Back     alignment and domain information
>cd01983 Fer4_NifH The Fer4_NifH superfamily contains a variety of proteins which share a common ATP-binding domain Back     alignment and domain information
>TIGR02902 spore_lonB ATP-dependent protease LonB Back     alignment and domain information
>cd03116 MobB Molybdenum is an essential trace element in the form of molybdenum cofactor (Moco) which is associated with the metabolism of nitrogen, carbon and sulfur by redox active enzymes Back     alignment and domain information
>COG4107 PhnK ABC-type phosphonate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK13657 cyclic beta-1,2-glucan ABC transporter; Provisional Back     alignment and domain information
>TIGR00455 apsK adenylylsulfate kinase (apsK) Back     alignment and domain information
>smart00072 GuKc Guanylate kinase homologues Back     alignment and domain information
>COG1703 ArgK Putative periplasmic protein kinase ArgK and related GTPases of G3E family [Amino acid transport and metabolism] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query1083
3sfz_A1249 Crystal Structure Of Full-Length Murine Apaf-1 Leng 6e-10
3shf_A1256 Crystal Structure Of The R265s Mutant Of Full-Lengt 3e-09
3cvr_A 571 Crystal Structure Of The Full Length Ipah3 Length = 7e-09
1z6t_A591 Structure Of The Apoptotic Protease-activating Fact 1e-07
4fcg_A328 Structure Of The Leucine-Rich Repeat Domain Of The 2e-07
3iza_B1263 Structure Of An Apoptosome-Procaspase-9 Card Comple 6e-07
1g9u_A454 Crystal Structure Of Yopm-leucine Rich Effector Pro 2e-06
3g06_A622 The Salmonella Virulence Effector Ssph2 Functions A 1e-04
4b8c_D727 Nuclease Module Of The Yeast Ccr4-Not Complex Lengt 8e-04
>pdb|3SFZ|A Chain A, Crystal Structure Of Full-Length Murine Apaf-1 Length = 1249 Back     alignment and structure 
Iteration: 1

 Score = 63.5 bits (153), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 92/343 (26%), Positives = 146/343 (42%), Gaps = 54/343 (15%)
Query: 10  VGIWGMGGIGKTTLA-KAIFDQFSHEFEGSCFVSDVR----GNSETAGGLEHLQKQMLST 64
           V I+GM G GK+ LA +A+ D   H     CF   V     G  + +G L  LQ   +  
Sbjct: 150 VTIYGMAGCGKSVLAAEAVRD---HSLLEGCFSGGVHWVSIGKQDKSGLLMKLQNLCMRL 206
Query: 65  TLSEKLEVAGPNIPHFTKERVRRMKL------LIVLDDVNEVGQLKRLIGELDQFGQGSR 118
              E      P      K+R+R + L      L++LDDV +   LK        F    +
Sbjct: 207 DQEESFSQRLPLNIEEAKDRLRVLMLRKHPRSLLILDDVWDPWVLK-------AFDNQCQ 259
Query: 119 IVVTTRDKRVLEKFRGEEKKIYRVNGLEFEEAFEHFCNFAFKENHCPEDLNWHSRSVVSY 178
           I++TTRDK V +   G +  +   +GL  E+  E    F    N   EDL   + S++  
Sbjct: 260 ILLTTRDKSVTDSVMGPKHVVPVESGLGREKGLEILSLFV---NMKKEDLPAEAHSIIKE 316
Query: 179 TKGNPLVLEVLGSSLCLKRKSHWGKVLHDLN-----RICESEIHD---IYDILKISFNKL 230
            KG+PLV+ ++G +L     + W   L  L      RI +S  +D   + + + IS   L
Sbjct: 317 CKGSPLVVSLIG-ALLRDFPNRWAYYLRQLQNKQFKRIRKSSSYDYEALDEAMSISVEML 375
Query: 231 TPRVKSIFLDIACFFEGEDKDF-----VASILDDSES----DVLDILIDKSLVSISGNFL 281
              +K  + D++       KD      V  +L D E+    D+L   ++KSL+  + N  
Sbjct: 376 REDIKDYYTDLSIL----QKDVKVPTKVLCVLWDLETEEVEDILQEFVNKSLLFCNRNGK 431
Query: 282 N----MHDI----LQEMGRQIVRQESEKEPGKRSRLWDPKEIS 316
           +    +HD+    L E  R  ++    K   +  R + P  +S
Sbjct: 432 SFCYYLHDLQVDFLTEKNRSQLQDLHRKMVTQFQRYYQPHTLS 474
>pdb|3SHF|A Chain A, Crystal Structure Of The R265s Mutant Of Full-Length Murine Apaf-1 Length = 1256 Back     alignment and structure
>pdb|3CVR|A Chain A, Crystal Structure Of The Full Length Ipah3 Length = 571 Back     alignment and structure
>pdb|1Z6T|A Chain A, Structure Of The Apoptotic Protease-activating Factor 1 Bound To Adp Length = 591 Back     alignment and structure
>pdb|4FCG|A Chain A, Structure Of The Leucine-Rich Repeat Domain Of The Type Iii Effector Xcv3220 (Xopl) Length = 328 Back     alignment and structure
>pdb|1G9U|A Chain A, Crystal Structure Of Yopm-leucine Rich Effector Protein From Yersinia Pestis Length = 454 Back     alignment and structure
>pdb|3G06|A Chain A, The Salmonella Virulence Effector Ssph2 Functions As A Novel E3 Ligase Length = 622 Back     alignment and structure
>pdb|4B8C|D Chain D, Nuclease Module Of The Yeast Ccr4-Not Complex Length = 727 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query1083
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 5e-45
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 2e-39
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 2e-25
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 4e-15
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 9e-13
1vt4_I1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-42
1vt4_I1221 APAF-1 related killer DARK; drosophila apoptosome, 5e-11
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 8e-11
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-10
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 3e-41
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 2e-39
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 8e-28
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 8e-16
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 1e-04
2a5y_B549 CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis 1e-40
1z6t_A591 APAF-1, apoptotic protease activating factor 1; ca 2e-33
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 4e-33
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 2e-26
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 1e-22
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 6e-13
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 1e-28
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 2e-24
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 3e-21
3sfz_A1249 APAF-1, apoptotic peptidase activating factor 1; a 2e-26
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 8e-26
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 5e-21
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 3e-17
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 4e-11
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 1e-23
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 9e-21
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 2e-20
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 1e-06
1o6v_A466 Internalin A; bacterial infection, extracellular r 2e-23
1o6v_A466 Internalin A; bacterial infection, extracellular r 6e-10
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 8e-23
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 7e-21
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 4e-16
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 8e-23
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 5e-18
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 1e-13
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 3e-11
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 7e-07
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 5e-22
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 1e-19
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 2e-13
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 2e-21
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 2e-14
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 6e-10
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 4e-21
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 3e-20
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 7e-19
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 1e-18
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 4e-18
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 1e-15
3j0a_A844 TOLL-like receptor 5; membrane protein, leucine-ri 2e-20
3j0a_A844 TOLL-like receptor 5; membrane protein, leucine-ri 1e-18
3j0a_A844 TOLL-like receptor 5; membrane protein, leucine-ri 3e-15
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 1e-14
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 4e-09
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 6e-07
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 5e-20
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 1e-17
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 4e-09
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 9e-06
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 7e-20
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 5e-14
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 3e-09
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 9e-20
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 5e-19
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 2e-18
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 4e-16
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 3e-19
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 2e-13
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 8e-10
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 5e-19
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 3e-14
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 2e-09
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 4e-08
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 7e-19
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 2e-09
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 5e-05
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 2e-18
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 4e-11
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 1e-07
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 3e-18
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 1e-09
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 4e-06
4fmz_A347 Internalin; leucine rich repeat, structural genomi 6e-17
4fmz_A347 Internalin; leucine rich repeat, structural genomi 2e-15
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 1e-16
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 6e-12
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 2e-06
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 4e-05
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 3e-16
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 5e-16
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 5e-10
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 1e-06
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 7e-16
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 4e-11
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 1e-05
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 2e-05
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 1e-15
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 6e-12
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 5e-05
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 2e-15
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 1e-11
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 4e-09
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 2e-15
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 2e-09
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 5e-15
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 8e-14
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 6e-13
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 7e-12
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 1e-11
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 8e-13
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 9e-13
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 2e-09
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 1e-08
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 3e-12
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 3e-12
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 1e-09
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 3e-06
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 7e-06
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 8e-06
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 5e-12
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 2e-10
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 8e-10
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 5e-07
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 5e-12
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 3e-08
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 2e-06
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 3e-06
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 7e-12
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 1e-10
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 5e-04
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 7e-12
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 3e-10
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 8e-12
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 9e-12
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 7e-11
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 6e-10
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 8e-10
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 2e-10
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 7e-06
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 6e-10
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 6e-10
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 1e-08
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 3e-07
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 2e-05
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 9e-10
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 5e-06
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 8e-04
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 4e-09
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 1e-07
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 5e-09
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 2e-06
4ezg_A197 Putative uncharacterized protein; internalin-A, le 2e-08
4ezg_A197 Putative uncharacterized protein; internalin-A, le 3e-05
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 4e-07
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 3e-06
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 4e-06
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 4e-06
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 6e-05
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 4e-06
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 1e-05
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 9e-06
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 1e-05
2fna_A357 Conserved hypothetical protein; structural genomic 1e-05
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 5e-05
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 9e-04
3m19_A251 Variable lymphocyte receptor A diversity region; a 6e-05
3m19_A251 Variable lymphocyte receptor A diversity region; a 8e-05
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 7e-05
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 1e-04
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 2e-04
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 7e-04
2qby_A386 CDC6 homolog 1, cell division control protein 6 ho 8e-04
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 9e-04
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
 Score =  164 bits (418), Expect = 5e-45
 Identities = 70/359 (19%), Positives = 120/359 (33%), Gaps = 58/359 (16%)

Query: 443 SIQNFKYLSALSFKGCQSLRSFPSNLH-FVCPVTINFSYCVNLIEFPQISGKVTRLYLGQ 501
              +      L F+G  +LR +   L  +      + +   +       +          
Sbjct: 7   HHHHSSGRENLYFQGSTALRPYHDVLSQWQRHYNADRNRWHSAWRQANSN-NPQIETRTG 65

Query: 502 SAIEEVPSSIECLTD--LEVLDLRGCKRLKRISTSFCKLRSLVTLILLGCLNLEHFPEIL 559
            A++     +E  T      L+LR    L +      +L  L  + +     L   P+ +
Sbjct: 66  RALKATADLLEDATQPGRVALELRSVP-LPQFPDQAFRLSHLQHMTIDAA-GLMELPDTM 123

Query: 560 EKMEHLKRIYSDRTPITELPSSFENLPGLEVLFVEDCSKLDNLPDNIGSLEYLYYILAAA 619
           ++   L+ +   R P+  LP+S  +L  L  L +  C +L  LP+ + S +         
Sbjct: 124 QQFAGLETLTLARNPLRALPASIASLNRLRELSIRACPELTELPEPLASTDAS------- 176

Query: 620 SAISQLPSSVALSNMLRSLDSSHCKGLESFPRTFLLGLSAMGLLHISDYAVREIPQEIAY 679
                L +       L+SL                               +R +P  IA 
Sbjct: 177 GEHQGLVN-------LQSLRLEWTG-------------------------IRSLPASIAN 204

Query: 680 LSSLEILYLSGNNFESLPAIIKQMSQLRFIHLEDFNMLQSLPE----LPLCLKYLHLIDC 735
           L +L+ L +  +   +L   I  + +L  + L     L++ P         LK L L DC
Sbjct: 205 LQNLKSLKIRNSPLSALGPAIHHLPKLEELDLRGCTALRNYPPIFGGRA-PLKRLILKDC 263

Query: 736 KMLQSLPV----LPFCLESLDLTGCNMLRSLPELP---LCLQYLNLEDCNMLRSLPELP 787
             L +LP+    L   LE LDL GC  L  LP L         + +      +     P
Sbjct: 264 SNLLTLPLDIHRLT-QLEKLDLRGCVNLSRLPSLIAQLPANCIILVPPHLQAQLDQHRP 321
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>2a5y_B CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis elegans} SCOP: a.4.5.80 a.77.1.3 c.37.1.20 PDB: 3lqq_A* 3lqr_A* Length = 549 Back     alignment and structure
>1z6t_A APAF-1, apoptotic protease activating factor 1; caspase activation, ADP, nucleotide binding, CARD, apoptosis; HET: ADP; 2.21A {Homo sapiens} Length = 591 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* Length = 1249 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336 Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2fna_A Conserved hypothetical protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE ADP; 2.00A {Sulfolobus solfataricus} SCOP: a.4.5.11 c.37.1.20 Length = 357 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>2qby_A CDC6 homolog 1, cell division control protein 6 homolog 1; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} Length = 386 Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Length = 177 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

No hit with probability above 80.00

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 1083
d2a5yb3277 c.37.1.20 (B:109-385) CED-4, NB-ARC domain {Caenor 2e-31
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 6e-10
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 8e-09
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 1e-08
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 2e-05
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 8e-05
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 9e-05
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 1e-04
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 0.003
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 1e-09
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 6e-05
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 3e-06
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 3e-06
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 8e-04
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 1e-05
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 6e-04
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 2e-05
d2ca6a1344 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom 3e-04
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 0.002
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 0.002
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 0.003
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 0.004
>d2a5yb3 c.37.1.20 (B:109-385) CED-4, NB-ARC domain {Caenorhabditis elegans [TaxId: 6239]} Length = 277 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Extended AAA-ATPase domain
domain: CED-4, NB-ARC domain
species: Caenorhabditis elegans [TaxId: 6239]

 Score =  122 bits (307), Expect = 2e-31
 Identities = 34/248 (13%), Positives = 72/248 (29%), Gaps = 25/248 (10%)

Query: 3   SSDTVQIVGIWGMGGIGKTTLAKAIFDQF----SHEFEGSCFVSDVRGNSETAGGLEHLQ 58
                  + + G  G GK+ +A     +        ++   ++ D     ++    +   
Sbjct: 40  CDLDSFFLFLHGRAGSGKSVIASQALSKSDQLIGINYDSIVWLKDSGTAPKS--TFDLFT 97

Query: 59  KQMLSTTLSEKLEVAGPNI--------PHFTKERVRRMKLLIVLDDVNEVGQLKRLIGEL 110
             +L     + L                      + R   L V DDV +   ++      
Sbjct: 98  DILLMLKSEDDLLNFPSVEHVTSVVLKRMICNALIDRPNTLFVFDDVVQEETIRWA---- 153

Query: 111 DQFGQGSRIVVTTRDKRVLEKFRGEEKKIYRVNGLEFEEAFEHFCNFAFKENHCPEDLNW 170
                  R +VTTRD  +         +   V  LE +E ++    +        ++ + 
Sbjct: 154 --QELRLRCLVTTRDVEISNAASQT-CEFIEVTSLEIDECYDFLEAYGMPMPVGEKEEDV 210

Query: 171 HSRSVVSYTKGNPLVLEVLGSSLCLKRKSHWGKVLHDLNRICESEIHDIYDILKISFNKL 230
                +  + GNP  L +   S   K            N++    +  +  I   S+  L
Sbjct: 211 -LNKTIELSSGNPATLMMFFKSCEPKTFEKM---AQLNNKLESRGLVGVECITPYSYKSL 266

Query: 231 TPRVKSIF 238
              ++   
Sbjct: 267 AMALQRCV 274
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query1083
d2a5yb3277 CED-4, NB-ARC domain {Caenorhabditis elegans [TaxI 100.0
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.96
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.94
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.93
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.93
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.93
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.92
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.91
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.9
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.86
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.85
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.84
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.84
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.76
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.73
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.67
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.66
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.65
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.65
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.65
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.62
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.59
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.57
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 99.47
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 99.46
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.39
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 99.29
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 99.28
d2fnaa2283 Archaeal ATPase SSO1545 {Sulfolobus solfataricus [ 99.24
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.23
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.04
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 98.98
d2ifga3156 High affinity nerve growth factor receptor, N-term 98.9
d2ifga3156 High affinity nerve growth factor receptor, N-term 98.84
d1fnna2276 CDC6, N-domain {Archaeon Pyrobaculum aerophilum [T 98.75
d1sxje2252 Replication factor C5 {Baker's yeast (Saccharomyce 98.72
d1sxjd2237 Replication factor C2 {Baker's yeast (Saccharomyce 98.67
d1sxjc2227 Replication factor C3 {Baker's yeast (Saccharomyce 98.63
d1sxjb2224 Replication factor C4 {Baker's yeast (Saccharomyce 98.62
d1a5ta2207 delta prime subunit of DNA polymerase III, N-domai 98.61
d1l8qa2213 Chromosomal replication initiation factor DnaA {Aq 98.56
d1d2na_246 Hexamerization domain of N-ethylmalemide-sensitive 98.54
d1iqpa2231 Replication factor C {Archaeon Pyrococcus furiosus 98.53
d1njfa_239 delta prime subunit of DNA polymerase III, N-domai 98.53
d1w5sa2287 CDC6-like protein APE0152, N-terminal domain {Aero 98.5
d1sxja2253 Replication factor C1 {Baker's yeast (Saccharomyce 98.49
d1e32a2258 Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu 98.49
d1r6bx2268 ClpA, an Hsp100 chaperone, AAA+ modules {Escherich 98.49
d1ixza_247 AAA domain of cell division protein FtsH {Thermus 98.48
d1lv7a_256 AAA domain of cell division protein FtsH {Escheric 98.44
d1r7ra3265 Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu 98.3
d1in4a2238 Holliday junction helicase RuvB {Thermotoga mariti 98.27
d1ixsb2239 Holliday junction helicase RuvB {Thermus thermophi 98.12
d1qvra2387 ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 97.96
d1jbka_195 ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} 97.96
d1gvnb_273 Plasmid maintenance system epsilon/zeta, toxin zet 97.62
d1ls1a2207 GTPase domain of the signal sequence recognition p 97.56
d1ye8a1178 Hypothetical kinase-like protein Aq_1292 {Aquifex 97.43
d2gnoa2198 gamma subunit of DNA polymerase III, N-domain {The 97.35
d1lw7a2192 Transcriptional regulator NadR, ribosylnicotinamid 97.31
d1v43a3239 Hypothetical protein PH0022, N-terminal domain {Py 97.27
d2awna2232 Maltose transport protein MalK, N-terminal domain 97.25
d2i3ba1189 Cancer-related NTPase, C1orf57 {Human (Homo sapien 97.24
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 97.23
d1svma_362 Papillomavirus large T antigen helicase domain {Si 97.22
d1r6bx3315 ClpA, an Hsp100 chaperone, AAA+ modules {Escherich 97.2
d1m8pa3183 ATP sulfurylase C-terminal domain {Fungus (Penicil 97.19
d1rz3a_198 Hypothetical protein rbstp0775 {Bacillus stearothe 97.19
d1cp2a_269 Nitrogenase iron protein {Clostridium pasteurianum 97.18
d1ofha_309 HslU {Haemophilus influenzae [TaxId: 727]} 97.18
d1g2912240 Maltose transport protein MalK, N-terminal domain 97.16
d1qvra3315 ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 97.14
d2qy9a2211 GTPase domain of the signal recognition particle r 97.08
d1kaga_169 Shikimate kinase (AroK) {Escherichia coli [TaxId: 97.06
d1vmaa2213 GTPase domain of the signal recognition particle r 97.05
d1l2ta_230 MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 97.04
d1bifa1213 6-phosphofructo-2-kinase/fructose-2,6-bisphosphata 97.04
d1j8yf2211 GTPase domain of the signal sequence recognition p 97.04
d1np6a_170 Molybdopterin-guanine dinucleotide biosynthesis pr 97.03
d2bdta1176 Hypothetical protein BH3686 {Bacillus halodurans [ 97.01
d3dhwc1240 Methionine import ATP-binding protein MetN {Escher 96.95
d2jdid3276 Central domain of beta subunit of F1 ATP synthase 96.94
d1okkd2207 GTPase domain of the signal recognition particle r 96.94
d1ihua2279 Arsenite-translocating ATPase ArsA {Escherichia co 96.93
d1x6va3195 Adenosine-5'phosphosulfate kinase (APS kinase) {Hu 96.92
d1vpla_238 Putative ABC transporter TM0544 {Thermotoga mariti 96.91
d1w44a_321 NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} 96.9
d1knqa_171 Gluconate kinase {Escherichia coli [TaxId: 562]} 96.89
d2iyva1165 Shikimate kinase (AroK) {Mycobacterium tuberculosi 96.89
d1oxxk2242 Glucose transport protein GlcV, N-terminal domain 96.89
d3b60a1253 Multidrug resistance ABC transporter MsbA, C-termi 96.85
d1rkba_173 Adenylate kinase {Human (Homo sapiens), isoenzyme 96.83
d2afhe1289 Nitrogenase iron protein {Azotobacter vinelandii [ 96.82
d1khta_190 Adenylate kinase {Archaeon Methanococcus voltae [T 96.81
d1ihua1296 Arsenite-translocating ATPase ArsA {Escherichia co 96.8
d1qhxa_178 Chloramphenicol phosphotransferase {Streptomyces v 96.8
d2pmka1241 Haemolysin B ATP-binding protein {Escherichia coli 96.78
d1ukza_196 Uridylate kinase {Baker's yeast (Saccharomyces cer 96.77
d1ly1a_152 Polynucleotide kinase, kinase domain {Bacteriophag 96.76
d1ji0a_240 Branched chain aminoacid ABC transporter {Thermoto 96.75
d1nksa_194 Adenylate kinase {Archaeon Sulfolobus acidocaldari 96.74
d1viaa_161 Shikimate kinase (AroK) {Campylobacter jejuni [Tax 96.7
d1xjca_165 Molybdopterin-guanine dinucleotide biosynthesis pr 96.66
d2onka1240 Molybdate/tungstate import ATP-binding protein Wtp 96.65
d1qf9a_194 UMP/CMP kinase {Dictyostelium discoideum [TaxId: 4 96.64
d1mv5a_242 Multidrug resistance ABC transporter LmrA, C-termi 96.6
d3d31a2229 Sulfate/molybdate ABC transporter, ATP-binding pro 96.6
d1r0wa_281 Cystic fibrosis transmembrane conductance regulato 96.59
d1mo6a1269 RecA protein, ATPase-domain {Mycobacterium tubercu 96.59
d1uj2a_213 Uridine-cytidine kinase 2 {Human (Homo sapiens) [T 96.51
d1e6ca_170 Shikimate kinase (AroK) {Erwinia chrysanthemi [Tax 96.51
d1jj7a_251 Peptide transporter Tap1, C-terminal ABC domain {H 96.5
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 96.48
d1sq5a_308 Pantothenate kinase PanK {Escherichia coli [TaxId: 96.47
d2qm8a1323 Metallochaperone MeaB {Methylobacterium extorquens 96.47
d1xpua3289 Transcription termination factor Rho, ATPase domai 96.46
d2p67a1327 LAO/AO transport system kinase ArgK {Escherichia c 96.44
d1g6ha_254 MJ1267 {Archaeon Methanococcus jannaschii [TaxId: 96.44
d2hyda1255 Putative multidrug export ATP-binding/permease pro 96.4
d1y63a_174 Probable kinase LmjF30.1890 {Leishmania major [Tax 96.39
d1lvga_190 Guanylate kinase {Mouse (Mus musculus) [TaxId: 100 96.39
d1gkya_186 Guanylate kinase {Baker's yeast (Saccharomyces cer 96.38
d1zp6a1176 Hypothetical protein Atu3015 {Agrobacterium tumefa 96.37
d1ckea_225 CMP kinase {Escherichia coli [TaxId: 562]} 96.37
d1kgda_178 Guanylate kinase-like domain of Cask {Human (Homo 96.35
d1hyqa_232 Cell division regulator MinD {Archaeon Archaeoglob 96.26
d1m7ga_208 Adenosine-5'phosphosulfate kinase (APS kinase) {Fu 96.15
d1q3ta_223 CMP kinase {Streptococcus pneumoniae [TaxId: 1313] 96.13
d1fx0a3276 Central domain of alpha subunit of F1 ATP synthase 96.13
d1u94a1263 RecA protein, ATPase-domain {Escherichia coli [Tax 96.12
d1yj5a2172 5' polynucleotide kinase-3' phosphatase, C-termina 96.11
d1ak2a1190 Adenylate kinase {Cow (Bos taurus), mitochondrial 96.09
d1g3qa_237 Cell division regulator MinD {Archaeon Pyrococcus 96.06
d1tf7a2242 Circadian clock protein KaiC {Synechococcus sp. st 96.01
d1xp8a1268 RecA protein, ATPase-domain {Deinococcus radiodura 96.01
d1teva_194 UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606] 95.97
d1nn5a_209 Thymidylate kinase {Human (Homo sapiens) [TaxId: 9 95.94
d1a7ja_288 Phosphoribulokinase {Rhodobacter sphaeroides [TaxI 95.91
d2jdia3285 Central domain of alpha subunit of F1 ATP synthase 95.91
d2ocpa1241 Deoxyguanosine kinase {Human (Homo sapiens) [TaxId 95.84
d1odfa_286 Hypothetical protein Ygr205W {Baker's yeast (Sacch 95.83
d1znwa1182 Guanylate kinase {Mycobacterium tuberculosis [TaxI 95.81
d2ak3a1189 Adenylate kinase {Cow (Bos taurus), mitochondrial 95.71
d1akya1180 Adenylate kinase {Baker's yeast (Saccharomyces cer 95.68
d1zaka1189 Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} 95.61
d2vp4a1197 Deoxyribonucleoside kinase {Fruit fly (Drosophila 95.5
d3adka_194 Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} 95.5
d1zina1182 Adenylate kinase {Bacillus stearothermophilus [Tax 95.47
d2cdna1181 Adenylate kinase {Mycobacterium tuberculosis [TaxI 95.45
d1gsia_208 Thymidylate kinase {Mycobacterium tuberculosis [Ta 95.36
d1s96a_205 Guanylate kinase {Escherichia coli [TaxId: 562]} 95.29
d1uf9a_191 Dephospho-CoA kinase {Thermus thermophilus [TaxId: 95.26
d1yrba1244 ATP(GTP)-binding protein PAB0955 {Pyrococcus abyss 95.23
d1g41a_443 HslU {Haemophilus influenzae [TaxId: 727]} 95.21
d1pzna2254 DNA repair protein Rad51, catalytic domain {Archae 95.19
d1s3ga1182 Adenylate kinase {Bacillus globisporus [TaxId: 145 95.14
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 95.11
d1p6xa_333 Thymidine kinase {Equine herpesvirus type 4 [TaxId 94.94
d1tmka_214 Thymidylate kinase {Baker's yeast (Saccharomyces c 94.71
d1v5wa_258 Meiotic recombination protein DMC1/LIM15 homolog { 94.68
d1e4va1179 Adenylate kinase {Escherichia coli [TaxId: 562]} 94.68
d1p5zb_241 Deoxycytidine kinase {Human (Homo sapiens) [TaxId: 94.6
d1byia_224 Dethiobiotin synthetase {Escherichia coli [TaxId: 94.48
d1um8a_364 ClpX {Helicobacter pylori [TaxId: 210]} 94.26
d1sgwa_200 Putative ABC transporter PF0895 {Pyrococcus furios 94.17
d1vhta_208 Dephospho-CoA kinase {Escherichia coli [TaxId: 562 94.16
d1b0ua_258 ATP-binding subunit of the histidine permease {Sal 94.15
d1deka_241 Deoxynucleoside monophosphate kinase {Bacteriophag 94.02
d4tmka_210 Thymidylate kinase {Escherichia coli [TaxId: 562]} 93.95
d1n0wa_242 DNA repair protein Rad51, catalytic domain {Human 93.91
d2i1qa2258 DNA repair protein Rad51, catalytic domain {Archae 93.79
d2bv3a2276 Elongation factor G (EF-G), N-terminal (G) domain 93.77
d1jjva_205 Dephospho-CoA kinase {Haemophilus influenzae [TaxI 93.72
d1r8sa_160 ADP-ribosylation factor {Human (Homo sapiens), ARF 93.48
d1z0fa1166 Rab14 {Human (Homo sapiens) [TaxId: 9606]} 93.47
d1nija1222 Hypothetical protein YjiA, N-terminal domain {Esch 93.43
d2a5ja1173 Rab2b {Human (Homo sapiens) [TaxId: 9606]} 93.35
d1g8pa_333 ATPase subunit of magnesium chelatase, BchI {Rhodo 93.34
d1osna_331 Thymidine kinase {Varicella-zoster virus [TaxId: 1 93.3
d2atxa1185 RhoQ {Human (Homo sapiens) [TaxId: 9606]} 93.25
d1z06a1165 Rab-33b {Mouse (Mus musculus) [TaxId: 10090]} 93.22
d1z2aa1164 Rab23 {Mouse (Mus musculus) [TaxId: 10090]} 93.13
d1upta_169 ADP-ribosylation factor {Human (Homo sapiens), ARL 93.07
d1svia_195 Probable GTPase EngB {Bacillus subtilis [TaxId: 14 93.06
d1z08a1167 Rab21 {Human (Homo sapiens) [TaxId: 9606]} 93.03
d1tf7a1242 Circadian clock protein KaiC {Synechococcus sp. st 92.96
d1ny5a2247 Transcriptional activator sigm54 (NtrC1), C-termin 92.94
d3raba_169 Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} 92.9
d2fn4a1173 r-Ras {Human (Homo sapiens) [TaxId: 9606]} 92.86
d1z0ja1167 Rab-22a {Mouse (Mus musculus) [TaxId: 10090]} 92.86
d2atva1168 Ras-like estrogen-regulated growth inhibitor, RERG 92.85
d1r2qa_170 Rab5a {Human (Homo sapiens) [TaxId: 9606]} 92.81
d2ew1a1171 Rab30 {Human (Homo sapiens) [TaxId: 9606]} 92.78
d1yzqa1164 Rab6 {Human (Homo sapiens) [TaxId: 9606]} 92.77
d1kaoa_167 Rap2a {Human (Homo sapiens) [TaxId: 9606]} 92.7
d2erxa1171 di-Ras2 {Human (Homo sapiens) [TaxId: 9606]} 92.68
d2f7sa1186 Rab27b {Human (Homo sapiens) [TaxId: 9606]} 92.66
d1nlfa_274 Hexameric replicative helicase repA {Escherichia c 92.64
d1mh1a_183 Rac {Human (Homo sapiens) [TaxId: 9606]} 92.63
d1ky3a_175 Rab-related protein ypt7p {Baker's yeast (Saccharo 92.55
d1kmqa_177 RhoA {Human (Homo sapiens) [TaxId: 9606]} 92.55
d1svsa1195 Transducin (alpha subunit) {Rat (Rattus norvegicus 92.54
d2fh5b1207 Signal recognition particle receptor beta-subunit 92.51
d1szpa2251 DNA repair protein Rad51, catalytic domain {Baker' 92.5
d1c1ya_167 Rap1A {Human (Homo sapiens) [TaxId: 9606]} 92.47
d2gjsa1168 Rad {Human (Homo sapiens) [TaxId: 9606]} 92.46
d1wf3a1178 GTPase Era, N-terminal domain {Thermus thermophilu 92.39
d2bcgy1194 GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisi 92.37
d1cr2a_277 Gene 4 protein (g4p, DNA primase), helicase domain 92.36
d1f6ba_186 SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: 92.33
d2erya1171 r-Ras2 {Human (Homo sapiens) [TaxId: 9606]} 92.32
d2g6ba1170 Rab26 {Human (Homo sapiens) [TaxId: 9606]} 92.32
d1mkya1171 Probable GTPase Der, N-terminal and middle domains 92.3
d2bmea1174 Rab4a {Human (Homo sapiens) [TaxId: 9606]} 92.26
d1ksha_165 ADP-ribosylation factor {Mouse (Mus musculus), ARL 92.21
d1egaa1179 GTPase Era, N-terminal domain {Escherichia coli [T 92.18
d2dy1a2267 Elongation factor G (EF-G), N-terminal (G) domain 92.18
d1zcba2200 Transducin (alpha subunit) {Mouse (Mus musculus) [ 92.13
d1x3sa1177 Rab18 {Human (Homo sapiens) [TaxId: 9606]} 92.11
d1l7vc_231 ABC transporter involved in vitamin B12 uptake, Bt 92.06
d1g16a_166 Rab-related protein Sec4 {Baker's yeast (Saccharom 92.05
d2ngra_191 CDC42 {Human (Homo sapiens) [TaxId: 9606]} 92.04
d1m7ba_179 RhoE (RND3) {Mouse (Mus musculus) [TaxId: 10090]} 92.0
d2f9la1175 Rab11b {Human (Homo sapiens) [TaxId: 9606]} 91.97
d1ek0a_170 Ypt51 {Baker's yeast (Saccharomyces cerevisiae) [T 91.96
d1xtqa1167 GTP-binding protein RheB {Human (Homo sapiens) [Ta 91.85
d2g3ya1172 GTP-binding protein GEM {Human (Homo sapiens) [Tax 91.84
d2bcjq2200 Transducin (alpha subunit) {Mouse (Mus musculus) [ 91.67
d1nrjb_209 Signal recognition particle receptor beta-subunit 91.67
d1azta2221 Transducin (alpha subunit) {Cow (Bos taurus) [TaxI 91.66
d1fzqa_176 ADP-ribosylation factor {Mouse (Mus musculus), ARL 91.6
d1moza_182 ADP-ribosylation factor {Baker's yeast (Saccharomy 91.58
d1e2ka_329 Thymidine kinase {Herpes simplex virus type 1, dif 91.57
d1vg8a_184 Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]} 91.55
d1u8za_168 Ras-related protein RalA {Cotton-top tamarin (Sagu 91.51
d1ctqa_166 cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9 91.45
d1htwa_158 Hypothetical protein HI0065 {Haemophilus influenza 91.43
d2bmja1175 Centaurin gamma 1, G domain {Human (Homo sapiens) 91.42
d1kkma_176 HPr kinase HprK C-terminal domain {Lactobacillus c 91.39
d1wmsa_174 Rab9a {Human (Homo sapiens) [TaxId: 9606]} 91.36
d1x1ra1169 Ras-related protein M-Ras (XRas) {Mouse (Mus muscu 91.29
d1zd9a1164 ADP-ribosylation factor {Human (Homo sapiens), ARL 91.11
d2qtvb1166 SAR1 {Baker's yeast (Saccharomyces cerevisiae) [Ta 91.01
d1udxa2180 Obg GTP-binding protein middle domain {Thermus the 91.0
d1e0sa_173 ADP-ribosylation factor {Human (Homo sapiens), ARF 90.61
d1lnza2185 Obg GTP-binding protein middle domain {Bacillus su 90.37
d1i2ma_170 Ran {Human (Homo sapiens) [TaxId: 9606]} 90.12
d1ko7a2169 HPr kinase HprK C-terminal domain {Staphylococcus 90.07
d1knxa2177 HPr kinase HprK C-terminal domain {Mycoplasma pneu 90.0
d1zj6a1177 ADP-ribosylation factor {Human (Homo sapiens), ARL 89.9
d2cxxa1184 GTP-binding protein engB {Pyrococcus horikoshii [T 89.8
g1f2t.1292 Rad50 {Archaeon Pyrococcus furiosus [TaxId: 2261]} 89.41
d1mkya2186 Probable GTPase Der, N-terminal and middle domains 89.19
d1n0ua2341 Elongation factor 2 (eEF-2), N-terminal (G) domain 89.09
d2fu5c1173 Rab8a {Mouse (Mus musculus) [TaxId: 10090]} 88.92
d1wb9a2234 DNA repair protein MutS, the C-terminal domain {Es 88.89
d2gj8a1161 Probable tRNA modification GTPase TrmE (MnmE), G d 88.81
d1puia_188 Probable GTPase EngB {Escherichia coli [TaxId: 562 88.39
d1u0la2225 Probable GTPase EngC (YjeQ), C-terminal domain {Th 88.29
d1e9ra_433 Bacterial conjugative coupling protein TrwB {Esche 87.84
d1u0ja_267 Rep 40 protein helicase domain {Adeno-associated v 84.75
d1xzpa2160 TrmE GTPase domain {Thermotoga maritima [TaxId: 23 84.25
g1ii8.1369 Rad50 {Archaeon Pyrococcus furiosus [TaxId: 2261]} 84.02
d1h65a_257 Chloroplast protein translocon GTPase Toc34 {Garde 83.9
d1pjra1318 DEXX box DNA helicase {Bacillus stearothermophilus 82.83
d1uaaa1306 DEXX box DNA helicase {Escherichia coli, RepD [Tax 82.77
d1jala1278 YchF GTP-binding protein N-terminal domain {Haemop 82.13
d1g7sa4227 Initiation factor IF2/eIF5b, N-terminal (G) domain 81.83
d1t9ha2231 Probable GTPase EngC (YjeQ), C-terminal domain {Ba 81.56
d1tq4a_400 Interferon-inducible GTPase {Mouse (Mus musculus) 81.06
d1f5na2277 Interferon-induced guanylate-binding protein 1 (GB 80.85
>d2a5yb3 c.37.1.20 (B:109-385) CED-4, NB-ARC domain {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Extended AAA-ATPase domain
domain: CED-4, NB-ARC domain
species: Caenorhabditis elegans [TaxId: 6239]

Probab=100.00  E-value=2.6e-43  Score=272.10  Aligned_cols=224  Identities=16%  Similarity=0.184  Sum_probs=173.9

Q ss_pred             CCCCEEEEEEECCCCCCHHHHHHHHHHH----HCCCCCEEEEEEECCCCCCCCCCHHHHHHHHHHHHHCCC-CCCCC--C
Q ss_conf             9998599999859999289999999998----302672279973134433346887899999997420134-35579--9
Q 001407            3 SSDTVQIVGIWGMGGIGKTTLAKAIFDQ----FSHEFEGSCFVSDVRGNSETAGGLEHLQKQMLSTTLSEK-LEVAG--P   75 (1083)
Q Consensus         3 ~~~~~~vi~I~G~gGiGKTtLA~~~~~~----~~~~F~~~~~~~~~~~~s~~~~~l~~l~~~~l~~l~~~~-~~~~~--~   75 (1083)
                      .+.+.++|+|+|||||||||||+++|++    ....|+.++|+...+..+ . ..+......++....... ...+.  .
T Consensus        40 ~~~~~~~v~I~GmgGiGKTtLA~~v~~~~~~~~~~~f~~~~Wv~vs~~~~-~-~~l~~~~~~~~~~~~~~~~~~~~~~~~  117 (277)
T d2a5yb3          40 CDLDSFFLFLHGRAGSGKSVIASQALSKSDQLIGINYDSIVWLKDSGTAP-K-STFDLFTDILLMLKSEDDLLNFPSVEH  117 (277)
T ss_dssp             TTSSSEEEEEECSTTSSHHHHHHHHHHHCSSTBTTTBSEEEEEECCCCST-T-HHHHHHHHHHHHHTTTSCCTTCCCCTT
T ss_pred             CCCCCEEEEEECCCCCCHHHHHHHHHHHHHHHHHHCCCEEEEEEECCCCC-H-HHHHHHHHHHHHHHCCHHHCCCCCCHH
T ss_conf             68784089997799788899999999855655401276489999368777-7-789999999998722022027863212


Q ss_pred             C-----CHHHHHHHHCCCEEEEEEECCCCHHHHHHHHHCCCCCCCCCEEEEEECCHHHHHHHCCCCCCEEEECCCCHHHH
Q ss_conf             9-----61789997407416999808999288999960227789996999991643577630366321898069998779
Q 001407           76 N-----IPHFTKERVRRMKLLIVLDDVNEVGQLKRLIGELDQFGQGSRIVVTTRDKRVLEKFRGEEKKIYRVNGLEFEEA  150 (1083)
Q Consensus        76 ~-----~~~~~~~~l~~kk~LlVLDdv~~~~~~~~l~~~~~~~~~gs~IiiTTR~~~~~~~~~~~~~~~~~l~~L~~~ea  150 (1083)
                      .     ....+.+.+.++++|+||||||+..+++.+..      .||+||||||++.++..+.. ....|++++|+.+||
T Consensus       118 ~~~~~~~~~~~~~~L~~kr~LlVLDDv~~~~~~~~~~~------~~srilvTTR~~~v~~~~~~-~~~~~~l~~L~~~ea  190 (277)
T d2a5yb3         118 VTSVVLKRMICNALIDRPNTLFVFDDVVQEETIRWAQE------LRLRCLVTTRDVEISNAASQ-TCEFIEVTSLEIDEC  190 (277)
T ss_dssp             CCHHHHHHHHHHHHTTSTTEEEEEEEECCHHHHHHHHH------TTCEEEEEESBGGGGGGCCS-CEEEEECCCCCHHHH
T ss_pred             HHHHHHHHHHHHHHHCCCCEEEECCHHHHHHHHHHHCC------CCCEEEEEEEHHHHHHHCCC-CCCEEECCCCCHHHH
T ss_conf             33699999999998446881675250667766555204------57559999644899986378-871687788997999


Q ss_pred             HHHHHHHHCCCCCCCCHHHHHHHHHHHHHCCCCHHHHHHHHHHCCCCHHHHHHHHHHHHHHCCCCHHHHHHHHHHCCCCC
Q ss_conf             99997853089999911589999999751899205788864306888878999999874203754034785764110388
Q 001407          151 FEHFCNFAFKENHCPEDLNWHSRSVVSYTKGNPLVLEVLGSSLCLKRKSHWGKVLHDLNRICESEIHDIYDILKISFNKL  230 (1083)
Q Consensus       151 ~~lf~~~a~~~~~~~~~~~~l~~~i~~~~~glPlal~~l~~~L~~~~~~~w~~~l~~l~~~~~~~~~~i~~~l~~sy~~L  230 (1083)
                      ++||.+++|....+ +...+++++|+++|+|+|||++++|+.|+.++.++|.+..+++......++   ..++..||+.|
T Consensus       191 ~~Lf~~~~~~~~~~-~~~~~~~~~iv~~c~GlPLAl~~ig~~l~~k~~~~~~~~~~~L~~~~~~~v---~~il~~sY~~L  266 (277)
T d2a5yb3         191 YDFLEAYGMPMPVG-EKEEDVLNKTIELSSGNPATLMMFFKSCEPKTFEKMAQLNNKLESRGLVGV---ECITPYSYKSL  266 (277)
T ss_dssp             HHHHHHTSCCCC---CHHHHHHHHHHHHHTTCHHHHHHHHTTCCSSSHHHHHHHHHHHHHHCSSTT---CCCSSSSSSSH
T ss_pred             HHHHHHHHCCCCCC-HHHHHHHHHHHHHHCCCHHHHHHHHHHHCCCCHHHHHHHHHHHHCCCHHHH---HHHHHHHHHCC
T ss_conf             99999984776674-256799999999958998999999998655989999999999734867889---99999988512


Q ss_pred             CCCCCCEEE
Q ss_conf             900225177
Q 001407          231 TPRVKSIFL  239 (1083)
Q Consensus       231 ~~~~k~~fl  239 (1083)
                      +.+.|.||.
T Consensus       267 ~~~lk~c~~  275 (277)
T d2a5yb3         267 AMALQRCVE  275 (277)
T ss_dssp             HHHHHHHHH
T ss_pred             CHHHHHHHH
T ss_conf             699999997
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d2fnaa2 c.37.1.20 (A:1-283) Archaeal ATPase SSO1545 {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fnna2 c.37.1.20 (A:1-276) CDC6, N-domain {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d1sxje2 c.37.1.20 (E:4-255) Replication factor C5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1sxjd2 c.37.1.20 (D:26-262) Replication factor C2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1sxjc2 c.37.1.20 (C:12-238) Replication factor C3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1sxjb2 c.37.1.20 (B:7-230) Replication factor C4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1a5ta2 c.37.1.20 (A:1-207) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1l8qa2 c.37.1.20 (A:77-289) Chromosomal replication initiation factor DnaA {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1d2na_ c.37.1.20 (A:) Hexamerization domain of N-ethylmalemide-sensitive fusion (NSF) protein {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d1iqpa2 c.37.1.20 (A:2-232) Replication factor C {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1njfa_ c.37.1.20 (A:) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1w5sa2 c.37.1.20 (A:7-293) CDC6-like protein APE0152, N-terminal domain {Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1sxja2 c.37.1.20 (A:295-547) Replication factor C1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1e32a2 c.37.1.20 (A:201-458) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1r6bx2 c.37.1.20 (X:169-436) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ixza_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1lv7a_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1r7ra3 c.37.1.20 (A:471-735) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1in4a2 c.37.1.20 (A:17-254) Holliday junction helicase RuvB {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1ixsb2 c.37.1.20 (B:4-242) Holliday junction helicase RuvB {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1qvra2 c.37.1.20 (A:149-535) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1jbka_ c.37.1.20 (A:) ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1gvnb_ c.37.1.21 (B:) Plasmid maintenance system epsilon/zeta, toxin zeta subunit {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1ls1a2 c.37.1.10 (A:89-295) GTPase domain of the signal sequence recognition protein Ffh {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1ye8a1 c.37.1.11 (A:1-178) Hypothetical kinase-like protein Aq_1292 {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d2gnoa2 c.37.1.20 (A:11-208) gamma subunit of DNA polymerase III, N-domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1lw7a2 c.37.1.1 (A:220-411) Transcriptional regulator NadR, ribosylnicotinamide kinase domain {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1v43a3 c.37.1.12 (A:7-245) Hypothetical protein PH0022, N-terminal domain {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d2awna2 c.37.1.12 (A:4-235) Maltose transport protein MalK, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2i3ba1 c.37.1.11 (A:1-189) Cancer-related NTPase, C1orf57 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1svma_ c.37.1.20 (A:) Papillomavirus large T antigen helicase domain {Simian virus 40 [TaxId: 10633]} Back     information, alignment and structure
>d1r6bx3 c.37.1.20 (X:437-751) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1m8pa3 c.37.1.15 (A:391-573) ATP sulfurylase C-terminal domain {Fungus (Penicillium chrysogenum) [TaxId: 5076]} Back     information, alignment and structure
>d1rz3a_ c.37.1.6 (A:) Hypothetical protein rbstp0775 {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1cp2a_ c.37.1.10 (A:) Nitrogenase iron protein {Clostridium pasteurianum [TaxId: 1501]} Back     information, alignment and structure
>d1ofha_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1g2912 c.37.1.12 (1:1-240) Maltose transport protein MalK, N-terminal domain {Archaeon Thermococcus litoralis [TaxId: 2265]} Back     information, alignment and structure
>d1qvra3 c.37.1.20 (A:536-850) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2qy9a2 c.37.1.10 (A:285-495) GTPase domain of the signal recognition particle receptor FtsY {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1kaga_ c.37.1.2 (A:) Shikimate kinase (AroK) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1vmaa2 c.37.1.10 (A:82-294) GTPase domain of the signal recognition particle receptor FtsY {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1l2ta_ c.37.1.12 (A:) MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1bifa1 c.37.1.7 (A:37-249) 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase, kinase domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1j8yf2 c.37.1.10 (F:87-297) GTPase domain of the signal sequence recognition protein Ffh {Archaeon Acidianus ambivalens [TaxId: 2283]} Back     information, alignment and structure
>d1np6a_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2bdta1 c.37.1.25 (A:1-176) Hypothetical protein BH3686 {Bacillus halodurans [TaxId: 86665]} Back     information, alignment and structure
>d3dhwc1 c.37.1.12 (C:1-240) Methionine import ATP-binding protein MetN {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2jdid3 c.37.1.11 (D:82-357) Central domain of beta subunit of F1 ATP synthase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1okkd2 c.37.1.10 (D:97-303) GTPase domain of the signal recognition particle receptor FtsY {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1ihua2 c.37.1.10 (A:308-586) Arsenite-translocating ATPase ArsA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1x6va3 c.37.1.4 (A:34-228) Adenosine-5'phosphosulfate kinase (APS kinase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vpla_ c.37.1.12 (A:) Putative ABC transporter TM0544 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1w44a_ c.37.1.11 (A:) NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} Back     information, alignment and structure
>d1knqa_ c.37.1.17 (A:) Gluconate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2iyva1 c.37.1.2 (A:2-166) Shikimate kinase (AroK) {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1oxxk2 c.37.1.12 (K:1-242) Glucose transport protein GlcV, N-terminal domain {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d3b60a1 c.37.1.12 (A:329-581) Multidrug resistance ABC transporter MsbA, C-terminal domain {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1rkba_ c.37.1.1 (A:) Adenylate kinase {Human (Homo sapiens), isoenzyme 6 [TaxId: 9606]} Back     information, alignment and structure
>d2afhe1 c.37.1.10 (E:1-289) Nitrogenase iron protein {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d1khta_ c.37.1.1 (A:) Adenylate kinase {Archaeon Methanococcus voltae [TaxId: 2188]} Back     information, alignment and structure
>d1ihua1 c.37.1.10 (A:1-296) Arsenite-translocating ATPase ArsA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1qhxa_ c.37.1.3 (A:) Chloramphenicol phosphotransferase {Streptomyces venezuelae [TaxId: 54571]} Back     information, alignment and structure
>d2pmka1 c.37.1.12 (A:467-707) Haemolysin B ATP-binding protein {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ukza_ c.37.1.1 (A:) Uridylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ly1a_ c.37.1.1 (A:) Polynucleotide kinase, kinase domain {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d1ji0a_ c.37.1.12 (A:) Branched chain aminoacid ABC transporter {Thermotoga maritima, TM1139 [TaxId: 2336]} Back     information, alignment and structure
>d1nksa_ c.37.1.1 (A:) Adenylate kinase {Archaeon Sulfolobus acidocaldarius [TaxId: 2285]} Back     information, alignment and structure
>d1viaa_ c.37.1.2 (A:) Shikimate kinase (AroK) {Campylobacter jejuni [TaxId: 197]} Back     information, alignment and structure
>d1xjca_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d2onka1 c.37.1.12 (A:1-240) Molybdate/tungstate import ATP-binding protein WtpC (ModC) {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1qf9a_ c.37.1.1 (A:) UMP/CMP kinase {Dictyostelium discoideum [TaxId: 44689]} Back     information, alignment and structure
>d1mv5a_ c.37.1.12 (A:) Multidrug resistance ABC transporter LmrA, C-terminal domain {Lactococcus lactis [TaxId: 1358]} Back     information, alignment and structure
>d3d31a2 c.37.1.12 (A:1-229) Sulfate/molybdate ABC transporter, ATP-binding protein {Methanosarcina acetivorans [TaxId: 2214]} Back     information, alignment and structure
>d1r0wa_ c.37.1.12 (A:) Cystic fibrosis transmembrane conductance regulator, CFTR, nucleotide-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1mo6a1 c.37.1.11 (A:1-269) RecA protein, ATPase-domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1uj2a_ c.37.1.6 (A:) Uridine-cytidine kinase 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1e6ca_ c.37.1.2 (A:) Shikimate kinase (AroK) {Erwinia chrysanthemi [TaxId: 556]} Back     information, alignment and structure
>d1jj7a_ c.37.1.12 (A:) Peptide transporter Tap1, C-terminal ABC domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1sq5a_ c.37.1.6 (A:) Pantothenate kinase PanK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2qm8a1 c.37.1.10 (A:5-327) Metallochaperone MeaB {Methylobacterium extorquens [TaxId: 408]} Back     information, alignment and structure
>d1xpua3 c.37.1.11 (A:129-417) Transcription termination factor Rho, ATPase domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2p67a1 c.37.1.10 (A:1-327) LAO/AO transport system kinase ArgK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1g6ha_ c.37.1.12 (A:) MJ1267 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d2hyda1 c.37.1.12 (A:324-578) Putative multidrug export ATP-binding/permease protein SAV1866 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1y63a_ c.37.1.1 (A:) Probable kinase LmjF30.1890 {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d1lvga_ c.37.1.1 (A:) Guanylate kinase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1gkya_ c.37.1.1 (A:) Guanylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1zp6a1 c.37.1.25 (A:6-181) Hypothetical protein Atu3015 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1ckea_ c.37.1.1 (A:) CMP kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1kgda_ c.37.1.1 (A:) Guanylate kinase-like domain of Cask {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hyqa_ c.37.1.10 (A:) Cell division regulator MinD {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1m7ga_ c.37.1.4 (A:) Adenosine-5'phosphosulfate kinase (APS kinase) {Fungus (Penicillium chrysogenum) [TaxId: 5076]} Back     information, alignment and structure
>d1q3ta_ c.37.1.1 (A:) CMP kinase {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d1fx0a3 c.37.1.11 (A:97-372) Central domain of alpha subunit of F1 ATP synthase {Spinach (Spinacia oleracea), chloroplast [TaxId: 3562]} Back     information, alignment and structure
>d1u94a1 c.37.1.11 (A:6-268) RecA protein, ATPase-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1yj5a2 c.37.1.1 (A:351-522) 5' polynucleotide kinase-3' phosphatase, C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ak2a1 c.37.1.1 (A:14-146,A:177-233) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-2 [TaxId: 9913]} Back     information, alignment and structure
>d1g3qa_ c.37.1.10 (A:) Cell division regulator MinD {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1tf7a2 c.37.1.11 (A:256-497) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} Back     information, alignment and structure
>d1xp8a1 c.37.1.11 (A:15-282) RecA protein, ATPase-domain {Deinococcus radiodurans [TaxId: 1299]} Back     information, alignment and structure
>d1teva_ c.37.1.1 (A:) UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nn5a_ c.37.1.1 (A:) Thymidylate kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a7ja_ c.37.1.6 (A:) Phosphoribulokinase {Rhodobacter sphaeroides [TaxId: 1063]} Back     information, alignment and structure
>d2jdia3 c.37.1.11 (A:95-379) Central domain of alpha subunit of F1 ATP synthase {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2ocpa1 c.37.1.1 (A:37-277) Deoxyguanosine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1odfa_ c.37.1.6 (A:) Hypothetical protein Ygr205W {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1znwa1 c.37.1.1 (A:20-201) Guanylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2ak3a1 c.37.1.1 (A:0-124,A:162-225) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-3 [TaxId: 9913]} Back     information, alignment and structure
>d1akya1 c.37.1.1 (A:3-130,A:169-220) Adenylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1zaka1 c.37.1.1 (A:3-127,A:159-222) Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} Back     information, alignment and structure
>d2vp4a1 c.37.1.1 (A:12-208) Deoxyribonucleoside kinase {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d3adka_ c.37.1.1 (A:) Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1zina1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d2cdna1 c.37.1.1 (A:1-181) Adenylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1gsia_ c.37.1.1 (A:) Thymidylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1s96a_ c.37.1.1 (A:) Guanylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1uf9a_ c.37.1.1 (A:) Dephospho-CoA kinase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1yrba1 c.37.1.10 (A:1-244) ATP(GTP)-binding protein PAB0955 {Pyrococcus abyssi [TaxId: 29292]} Back     information, alignment and structure
>d1g41a_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1pzna2 c.37.1.11 (A:96-349) DNA repair protein Rad51, catalytic domain {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1s3ga1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus globisporus [TaxId: 1459]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1p6xa_ c.37.1.1 (A:) Thymidine kinase {Equine herpesvirus type 4 [TaxId: 10331]} Back     information, alignment and structure
>d1tmka_ c.37.1.1 (A:) Thymidylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1v5wa_ c.37.1.11 (A:) Meiotic recombination protein DMC1/LIM15 homolog {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1e4va1 c.37.1.1 (A:1-121,A:157-214) Adenylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1p5zb_ c.37.1.1 (B:) Deoxycytidine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1byia_ c.37.1.10 (A:) Dethiobiotin synthetase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1um8a_ c.37.1.20 (A:) ClpX {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1sgwa_ c.37.1.12 (A:) Putative ABC transporter PF0895 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1vhta_ c.37.1.1 (A:) Dephospho-CoA kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1b0ua_ c.37.1.12 (A:) ATP-binding subunit of the histidine permease {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1deka_ c.37.1.1 (A:) Deoxynucleoside monophosphate kinase {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d4tmka_ c.37.1.1 (A:) Thymidylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1n0wa_ c.37.1.11 (A:) DNA repair protein Rad51, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2i1qa2 c.37.1.11 (A:65-322) DNA repair protein Rad51, catalytic domain {Archaeon Methanococcus voltae [TaxId: 2188]} Back     information, alignment and structure
>d2bv3a2 c.37.1.8 (A:7-282) Elongation factor G (EF-G), N-terminal (G) domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1jjva_ c.37.1.1 (A:) Dephospho-CoA kinase {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1r8sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF1 [TaxId: 9606]} Back     information, alignment and structure
>d1z0fa1 c.37.1.8 (A:8-173) Rab14 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nija1 c.37.1.10 (A:2-223) Hypothetical protein YjiA, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2a5ja1 c.37.1.8 (A:9-181) Rab2b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g8pa_ c.37.1.20 (A:) ATPase subunit of magnesium chelatase, BchI {Rhodobacter capsulatus [TaxId: 1061]} Back     information, alignment and structure
>d1osna_ c.37.1.1 (A:) Thymidine kinase {Varicella-zoster virus [TaxId: 10335]} Back     information, alignment and structure
>d2atxa1 c.37.1.8 (A:9-193) RhoQ {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z06a1 c.37.1.8 (A:32-196) Rab-33b {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1z2aa1 c.37.1.8 (A:8-171) Rab23 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1upta_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARL1 [TaxId: 9606]} Back     information, alignment and structure
>d1svia_ c.37.1.8 (A:) Probable GTPase EngB {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1z08a1 c.37.1.8 (A:17-183) Rab21 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tf7a1 c.37.1.11 (A:14-255) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} Back     information, alignment and structure
>d1ny5a2 c.37.1.20 (A:138-384) Transcriptional activator sigm54 (NtrC1), C-terminal domain {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d3raba_ c.37.1.8 (A:) Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2fn4a1 c.37.1.8 (A:24-196) r-Ras {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z0ja1 c.37.1.8 (A:2-168) Rab-22a {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2atva1 c.37.1.8 (A:5-172) Ras-like estrogen-regulated growth inhibitor, RERG {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1r2qa_ c.37.1.8 (A:) Rab5a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ew1a1 c.37.1.8 (A:4-174) Rab30 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yzqa1 c.37.1.8 (A:14-177) Rab6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kaoa_ c.37.1.8 (A:) Rap2a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2erxa1 c.37.1.8 (A:6-176) di-Ras2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2f7sa1 c.37.1.8 (A:5-190) Rab27b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nlfa_ c.37.1.11 (A:) Hexameric replicative helicase repA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1mh1a_ c.37.1.8 (A:) Rac {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ky3a_ c.37.1.8 (A:) Rab-related protein ypt7p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1kmqa_ c.37.1.8 (A:) RhoA {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1svsa1 c.37.1.8 (A:32-60,A:182-347) Transducin (alpha subunit) {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2fh5b1 c.37.1.8 (B:63-269) Signal recognition particle receptor beta-subunit {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1szpa2 c.37.1.11 (A:145-395) DNA repair protein Rad51, catalytic domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1c1ya_ c.37.1.8 (A:) Rap1A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2gjsa1 c.37.1.8 (A:91-258) Rad {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wf3a1 c.37.1.8 (A:3-180) GTPase Era, N-terminal domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2bcgy1 c.37.1.8 (Y:3-196) GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1cr2a_ c.37.1.11 (A:) Gene 4 protein (g4p, DNA primase), helicase domain {Bacteriophage T7 [TaxId: 10760]} Back     information, alignment and structure
>d1f6ba_ c.37.1.8 (A:) SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d2erya1 c.37.1.8 (A:10-180) r-Ras2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2g6ba1 c.37.1.8 (A:58-227) Rab26 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mkya1 c.37.1.8 (A:2-172) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2bmea1 c.37.1.8 (A:6-179) Rab4a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ksha_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL2 [TaxId: 10090]} Back     information, alignment and structure
>d1egaa1 c.37.1.8 (A:4-182) GTPase Era, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2dy1a2 c.37.1.8 (A:8-274) Elongation factor G (EF-G), N-terminal (G) domain {Thermus thermophilus, EF-G-2 [TaxId: 274]} Back     information, alignment and structure
>d1zcba2 c.37.1.8 (A:47-75,A:202-372) Transducin (alpha subunit) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x3sa1 c.37.1.8 (A:2-178) Rab18 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1l7vc_ c.37.1.12 (C:) ABC transporter involved in vitamin B12 uptake, BtuD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1g16a_ c.37.1.8 (A:) Rab-related protein Sec4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2ngra_ c.37.1.8 (A:) CDC42 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m7ba_ c.37.1.8 (A:) RhoE (RND3) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2f9la1 c.37.1.8 (A:8-182) Rab11b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ek0a_ c.37.1.8 (A:) Ypt51 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1xtqa1 c.37.1.8 (A:3-169) GTP-binding protein RheB {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2g3ya1 c.37.1.8 (A:73-244) GTP-binding protein GEM {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bcjq2 c.37.1.8 (Q:38-66,Q:184-354) Transducin (alpha subunit) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1nrjb_ c.37.1.8 (B:) Signal recognition particle receptor beta-subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1azta2 c.37.1.8 (A:35-65,A:202-391) Transducin (alpha subunit) {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1fzqa_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL3 [TaxId: 10090]} Back     information, alignment and structure
>d1moza_ c.37.1.8 (A:) ADP-ribosylation factor {Baker's yeast (Saccharomyces cerevisiae), ARL1 [TaxId: 4932]} Back     information, alignment and structure
>d1e2ka_ c.37.1.1 (A:) Thymidine kinase {Herpes simplex virus type 1, different strains [TaxId: 10298]} Back     information, alignment and structure
>d1vg8a_ c.37.1.8 (A:) Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1u8za_ c.37.1.8 (A:) Ras-related protein RalA {Cotton-top tamarin (Saguinus oedipus) [TaxId: 9490]} Back     information, alignment and structure
>d1ctqa_ c.37.1.8 (A:) cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1htwa_ c.37.1.18 (A:) Hypothetical protein HI0065 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d2bmja1 c.37.1.8 (A:66-240) Centaurin gamma 1, G domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kkma_ c.91.1.2 (A:) HPr kinase HprK C-terminal domain {Lactobacillus casei [TaxId: 1582]} Back     information, alignment and structure
>d1wmsa_ c.37.1.8 (A:) Rab9a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x1ra1 c.37.1.8 (A:10-178) Ras-related protein M-Ras (XRas) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1zd9a1 c.37.1.8 (A:18-181) ADP-ribosylation factor {Human (Homo sapiens), ARL8A [TaxId: 9606]} Back     information, alignment and structure
>d2qtvb1 c.37.1.8 (B:24-189) SAR1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1udxa2 c.37.1.8 (A:157-336) Obg GTP-binding protein middle domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1e0sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF6 [TaxId: 9606]} Back     information, alignment and structure
>d1lnza2 c.37.1.8 (A:158-342) Obg GTP-binding protein middle domain {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1i2ma_ c.37.1.8 (A:) Ran {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ko7a2 c.91.1.2 (A:130-298) HPr kinase HprK C-terminal domain {Staphylococcus xylosus [TaxId: 1288]} Back     information, alignment and structure
>d1knxa2 c.91.1.2 (A:133-309) HPr kinase HprK C-terminal domain {Mycoplasma pneumoniae [TaxId: 2104]} Back     information, alignment and structure
>d1zj6a1 c.37.1.8 (A:2-178) ADP-ribosylation factor {Human (Homo sapiens), ARL5A [TaxId: 9606]} Back     information, alignment and structure
>d2cxxa1 c.37.1.8 (A:2-185) GTP-binding protein engB {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1mkya2 c.37.1.8 (A:173-358) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1n0ua2 c.37.1.8 (A:3-343) Elongation factor 2 (eEF-2), N-terminal (G) domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2fu5c1 c.37.1.8 (C:3-175) Rab8a {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wb9a2 c.37.1.12 (A:567-800) DNA repair protein MutS, the C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2gj8a1 c.37.1.8 (A:216-376) Probable tRNA modification GTPase TrmE (MnmE), G domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1puia_ c.37.1.8 (A:) Probable GTPase EngB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1u0la2 c.37.1.8 (A:69-293) Probable GTPase EngC (YjeQ), C-terminal domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1e9ra_ c.37.1.11 (A:) Bacterial conjugative coupling protein TrwB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1u0ja_ c.37.1.20 (A:) Rep 40 protein helicase domain {Adeno-associated virus 2, AAV2 [TaxId: 10804]} Back     information, alignment and structure
>d1xzpa2 c.37.1.8 (A:212-371) TrmE GTPase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1h65a_ c.37.1.8 (A:) Chloroplast protein translocon GTPase Toc34 {Garden pea (Pisum sativum) [TaxId: 3888]} Back     information, alignment and structure
>d1pjra1 c.37.1.19 (A:1-318) DEXX box DNA helicase {Bacillus stearothermophilus, PcrA [TaxId: 1422]} Back     information, alignment and structure
>d1uaaa1 c.37.1.19 (A:2-307) DEXX box DNA helicase {Escherichia coli, RepD [TaxId: 562]} Back     information, alignment and structure
>d1jala1 c.37.1.8 (A:1-278) YchF GTP-binding protein N-terminal domain {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1g7sa4 c.37.1.8 (A:1-227) Initiation factor IF2/eIF5b, N-terminal (G) domain {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1t9ha2 c.37.1.8 (A:68-298) Probable GTPase EngC (YjeQ), C-terminal domain {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1tq4a_ c.37.1.8 (A:) Interferon-inducible GTPase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1f5na2 c.37.1.8 (A:7-283) Interferon-induced guanylate-binding protein 1 (GBP1), N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure