Citrus Sinensis ID: 001412

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820-------830-------840-------850-------860-------870-------880-------890-------900-------910-------920-------930-------940-------950-------960-------970-------980-------990------1000------1010------1020------1030------1040------1050------1060------1070------1080--
MGCVYSRACIGEICTPRDARIRIKEPQQTTSRTTNEIAVFSPASSSSDGPDAETRDQISQLNPELGITRLSRVSSQFLPPEGSRTVKVPSAKYELRYSFLSQRGYYPDALDKANQDSFCIHTPFGTSQDDHFFGVFDGHGEFGAQCSQFVKRKLCENLLRNNKFHEDAVDACHSSYLTTNSQLHADVLDDSMSGTTAVTVLVRGRTIYVANSGDSRAVLAERRGKEIVAVDLSIDQTPFREDELERVKLSGARVLTLDQIEGLKNPDVQCWGTEEGDDGDPPRLWVPNGMYPGTAFTRSIGDSIAETIGVVANPEIVVWELTNDHPFFVLASDGVFEFLSSQAVVDMVAKYKDPRDACAAIVAESYRLWLQYETRTDDITVIVVHINGLKNTAVNQSIPPGVFLRTPVPQVIEVTGSESPSTFGWSSRNQRIRHDLSRARLRAIENSLENGQIWVPSSSAHRKTWEEEAHIERALHDHFLFRKLTDSQCHVLLDCMQRVEVQAGDIVVKQGGEGDCFYVVGSGEFEVMATQEEKNGEVPRVLQRYTAEKLSSFGELALMYNKPLQASVRAVTNGMLWALKREDFRGILMSEFSNLSSLKLLRSVDLLSRLTILQLSHLADTLSEVSFSAGQTIVNMNEGVAALYIIQRGQVRITFDADLLSNANVCSLKSDLHVEDDGTQSSKELSVEKSEGSYFGEWTLLGEHMGSLTAVAVDDVVCAILTKEKFDLVVGPLTKISHDDQNSKDYSSDIPKKPAKSIDISSLAKVSLTDMEWRKCLYSTDCSEIGLVLLRDSENFLSLKRFSKQKVKCLGKEVQVLKEKNLMKSVSPSACVPQILCTCADSMHAGLLLNTYLACPLASILHTPLDEQSARFCAASVVAALEDLHKRGVLYRGVSPDVLMLDKSGHLQLVDFRFGKGLSGNRTFTICGMADYLAPEIVQGKGHGLAADWWALGVLIYFMLQGEMPFGSWRESEIDIVAKIAKGQLSLPQNLSPEAVDLLTKLLVVDENTRLGSQGPTSVKTHPWFRDVDWKGIAESTSPVPHEIMSRISQHLDSHFEDSPVFQASPPRDVEELNVPEWLDDW
ccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEccccEEEEEEEEEccccccccccccccccEEEEccccccccccEEEEEcccccccHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHcccccccccccEEEEEEEEccEEEEEEcccccEEEEEEcccEEEEEEcccccccccHHHHHHHHHHccEEEEHHHHcccccccccccccccccccccccccccccccccccccccHHHHHHHHcccccccEEEEEEEcccccEEEEEcccEEEEEcHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHccccccccccccccccccccHHHHHHHHHHHHHccccccccHHHHHHHHHccEEEEEccccEEEEccccccEEEEEEEEEEEEEEcccccccccccEEEEEcccccccccccHHccccccEEEEEEEEcEEEEEEcHHHHHHHHHHHHHHHHHHHHHHHcHHcccccHHHHHHHHHHHcEEEEccccEEEEccccccEEEEEEccEEEEEEccccccccccccccccccccccccccccccEEEccccccccccccccccccccEEEEEccEEEEEEEcccccccccccccccccccccccccccccccccccccccccccccccccEEEEEEEccccEEEEEEEEcccccEEEEEcccHHHHHHHcHHHHHHHHHHHHHHcccccccccccccccccccEEEEEccccccHHHHHHHccccccccEEHHHHHHHHHHHHHccccEEccccccEEEEcccccEEEEEccccccccccccccccccccccccHHHcccccccHHHHHHHHHHHHHHHccccccccccccHHHHHHHHHcccccccccccHHHHHHHHHHcccccccccccccHHHHHcccccccccHHHHHcccccccccccccccccccccccccccccccccccccccccccccccc
cccEEEcHccccEEccccccccccccccccccccccccccccccccccccccccHHHHHcccccccccccHHccccccccccccEEEEccccEEEEEEEEHccccccccccccccccEEEEccccccccccEEEEEccccccHHHHHHHHHHHcHHHHHHcccccccHHHHHHHHHHHHHHHHHHHcccccccccEEEEEEEcccEEEEEEcccccEEEEEEccccEEEEEcccccccccHHHHHHHHHcccEEEEEcHHcccccccHHccccccccccccccEEEccccccccHcEccccHHHHHHccEEEccEEEEEEccccccEEEEEcccEEEEEccHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHcccccEEEEEEEccccccccccccccccccccccccccccccccccccccccccccccHHHHHcccccccccccccccEEEcccccccccHHHHHHHHHHHHccHHHHcccHHHHHHHHHHHcccEcccccEEEEEcccccEEEEEEccEEEEEEccccccccccccEEEEEcccccccHHHHHHcccccEEEEEEEcccEEEEEcHHHHHHHHHHccHHHHHHHHHHccHHHHcccHHHHHHHHHHHHHHEcccccEEEEccccccEEEEEEccEEEEEEEcccccccccHccccccHccccccccccEEEEEcccccccHHHHHccccccEEEEEEcccEEEEEEcHHHHHHHHccHHHHHHHcHHHHHHHHccHHHHHHHHcHHHHccccHHHHHHHHEcccccccEEEEEEEcccccEEHHHHHcHHHHHHcHHHHHHHHHHHHHHHccccccEEEEEEcccccHHHHEHHHHHcccHHHHHHHccccHHHHHHHHHHHHHHHHHHHHccEEcccccHHHEEEcccccEEEccccccEEcccccEccccccHHHccHHHHHcccEccHHHHHHHHHHHHHHHHcccccccccccHHHHHHHHHcccccccccccHHHHHHHHHHHcccHHHHHccccHHHHHHccccccccHHHHHHcccccccccccccccccccccccccccccccccccccccHHHHHccc
mgcvysracigeictprdaririkepqqttsrttneiavfspassssdgpdaetrdqisqlnpelgitrlsrvssqflppegsrtvkvpsakyELRYSFLsqrgyypdaldkanqdsfcihtpfgtsqddhffgvfdghgefgaqCSQFVKRKLCENLLRnnkfhedavdachssylttnsqlhadvlddsmsgtTAVTVLVRGRTIyvansgdsRAVLAERRGKEIVAvdlsidqtpfreDELERVKLSgarvltldqieglknpdvqcwgteegddgdpprlwvpngmypgtafTRSIGDSIAETIGVVANPEIVVWELtndhpffvlasdgvfeFLSSQAVVDMVAKYKDPRDACAAIVAESYRLWLQYETRTDDITVIVVHINGlkntavnqsippgvflrtpvpqvievtgsespstfgwssrnqRIRHDLSRARLRAIENSLEngqiwvpsssahrkTWEEEAHIERALHDhflfrkltdsQCHVLLDCMQRVEVQAGdivvkqggegdcfyvvgsgefEVMATqeekngevprVLQRYTAEKLSSFGELALMYNKPLQASVRAVTNGMLWALKREDFRGILMSEFSNLSSLKLLRSVDLLSRLTILQLSHLADTLSEVSFSAGQTIVNMNEGVAALYIIQRGQVRITFDAdllsnanvcslksdlhveddgtqsskelsveksegsyfGEWTLLgehmgsltAVAVDDVVCAILTKEkfdlvvgpltkishddqnskdyssdipkkpaksidisslakvsltdmewrkclystdcseIGLVLLRDSENFLSLKRFSKQKVKCLGKEVQVLKEKNlmksvspsacvpqilCTCADSMHAGLLLNTYLacplasilhtpldeqsARFCAASVVAALEDLHKrgvlyrgvspdvlmldksghlqlvdfrfgkglsgnrtfticgmadylapeivqgkghgLAADWWALGVLIYFMLqgempfgswresEIDIVAKIAKgqlslpqnlspEAVDLLTKLLVVdentrlgsqgptsvkthpwfrdvdwkgiaestspvphEIMSRISQHldshfedspvfqaspprdveelnvpewlddw
mgcvysracigeictprdaririkepqqttsrttneiavfspassssdgpdAETRDQISQLNPELGITRLsrvssqflppegsrtvkvpsakYELRYSFLSQRGYYPDALDKANQDSFCIHTPFGTSQDDHFFGVFDGHGEFGAQCSQFVKRKLCENLLRNNKFHEDAVDACHSSYLTTNSQLHADVLDDSMSGTTAVTVLVRGRtiyvansgdsravlaerrgkeivavdlsidqtpfredelervklsgarvltldqieglknpdvqcwgteegddgdpprlWVPNGMYPGTAFTRSIGDSIAETIGVVANPEIVVWELTNDHPFFVLASDGVFEFLSSQAVVDMVAKYKDPRDACAAIVAESYRLWLQYETRTDDITVIVVHINGLKntavnqsippgVFLRTPVPQVIEVTgsespstfgwssrnqriRHDLSRARLRAIEnslengqiwvpsssAHRKTWEEEAHIERALHDHFLFRKLTDSQCHVLLDCMQRVEVQAGDIVVKQGGEGDCFYVVGSGEFEVMAtqeekngevprvLQRYTAEKLSSFGELALMYNKPLQASVRAVTNGMLWALKREDFRGILMSEFSNLSSLKLLRSVDLLSRLTILQLSHLADTLSEVSFSAGQTIVNMNEGVAALYIIQRGQVRITFDADLLSNANVCSLKSdlhveddgtqsskelsveksEGSYFGEWTLLGEHMGSLTAVAVDDVVCAILTKEkfdlvvgpltkishddqnskdyssdipkkpaksidisslakVSLTDMEWRKCLYSTDCSEIGLVLLRDSENFLSLKRFSKQKVKCLGKEVQVLKEKNLMKSVSPSACVPQILCTCADSMHAGLLLNTYLACPLASILHTPLDEQSARFCAASVVAALEDLHKRGVLYRGVSPDVLMLDKSGHLQLVDFRFGKGLSGNRTFTICGMADYLAPEIVQGKGHGLAADWWALGVLIYFMLQGEMPFGSWRESEIDIVAKIAKGqlslpqnlSPEAVDLLTKLLVVDentrlgsqgptsvkthpwfrdVDWKGIAESTSPVPHEIMSRISQHLDSHFEDspvfqaspprdveelnvpewlddw
MGCVYSRACIGEICTPRDARIRIKEPQQTTSRTTNEIAVFspassssdgpdaETRDQISQLNPELGITRLSRVSSQFLPPEGSRTVKVPSAKYELRYSFLSQRGYYPDALDKANQDSFCIHTPFGTSQDDHFFGVFDGHGEFGAQCSQFVKRKLCENLLRNNKFHEDAVDACHSSYLTTNSQLHADVLDDSMSGTTAVTVLVRGRTIYVANSGDSRAVLAERRGKEIVAVDLSIDQTPFREDELERVKLSGARVLTLDQIEGLKNPDVQCWGTEEGDDGDPPRLWVPNGMYPGTAFTRSIGDSIAETIGVVANPEIVVWELTNDHPFFVLASDGVFEFLSSQAVVDMVAKYKDPRDACAAIVAESYRLWLQYETRTDDITVIVVHINGLKNTAVNQSIPPGVFLRTPVPQVIEVTGSESPSTFGWSSRNQRIRHDLSRARLRAIENSLENGQIWVPSSSAHRKTWEEEAHIERALHDHFLFRKLTDSQCHVLLDCMQRVEVQAGDIVVKQGGEGDCFYVVGSGEFEVMATQEEKNGEVPRVLQRYTAEKLSSFGELALMYNKPLQASVRAVTNGMLWALKREDFRGILMSEFSNLSSLKLLRSVDLLSRLTILQLSHLADTLSEVSFSAGQTIVNMNEGVAALYIIQRGQVRITFDADLLSNANVCSLKSDLHVEDDGTQSSKELSVEKSEGSYFGEWTLLGEHMGSLTAVAVDDVVCAILTKEKFDLVVGPLTKISHDDQNSKDYSSDIPKKPAKSIDISSLAKVSLTDMEWRKCLYSTDCSEIGLVLLRDSENFLSLKRFSKQKVKCLGKEVQVLKEKNLMKSVSPSACVPQILCTCADSMHAGLLLNTYLACPLASILHTPLDEQSARFCAASVVAALEDLHKRGVLYRGVSPDVLMLDKSGHLQLVDFRFGKGLSGNRTFTICGMADYLAPEIVQGKGHGLAADWWALGVLIYFMLQGEMPFGSWRESEIDIVAKIAKGQLSLPQNLSPEAVDLLTKLLVVDENTRLGSQGPTSVKTHPWFRDVDWKGIAESTSPVPHEIMSRISQHLDSHFEDSPVFQASPPRDVEELNVPEWLDDW
**CVYSRACIGEICTPRDARI*********************************************************************AKYELRYSFLSQRGYYPDALDKANQDSFCIHTPFGTSQDDHFFGVFDGHGEFGAQCSQFVKRKLCENLLRNNKFHEDAVDACHSSYLTTNSQLHADVLDDSMSGTTAVTVLVRGRTIYVANSGDSRAVLAERRGKEIVAVDLSIDQTPFREDELERVKLSGARVLTLDQIEGLKNPDVQCWGTE*******PRLWVPNGMYPGTAFTRSIGDSIAETIGVVANPEIVVWELTNDHPFFVLASDGVFEFLSSQAVVDMVAKYKDPRDACAAIVAESYRLWLQYETRTDDITVIVVHINGLKNTAVNQSIPPGVFLRTPVPQVIEVT***************************AI***LENGQIWVP*****RKTWEEEAHIERALHDHFLFRKLTDSQCHVLLDCMQRVEVQAGDIVVKQGGEGDCFYVVGSGEFEVMAT*******VPRVLQRYTAEKLSSFGELALMYNKPLQASVRAVTNGMLWALKREDFRGILMSEFSNLSSLKLLRSVDLLSRLTILQLSHLADTLSEVSFSAGQTIVNMNEGVAALYIIQRGQVRITFDADLLSNANVCSLKS**********************SYFGEWTLLGEHMGSLTAVAVDDVVCAILTKEKFDLVVGPLTKI************************SSLAKVSLTDMEWRKCLYSTDCSEIGLVLLRDSENFLSLKRFSKQKVKCLGKEVQVLKEKNLMKSVSPSACVPQILCTCADSMHAGLLLNTYLACPLASILHTPLDEQSARFCAASVVAALEDLHKRGVLYRGVSPDVLMLDKSGHLQLVDFRFGKGLSGNRTFTICGMADYLAPEIVQGKGHGLAADWWALGVLIYFMLQGEMPFGSWRESEIDIVAKIAKGQLSLPQNLSPEAVDLLTKLLVVDENTRLG****TSVKTHPWFRDVDWKGIA************************************************
******************************************************************************************AKYELRYSFLSQRGYYPDALDKANQDSFCIHTPFGTSQDDHFFGVFDGHGEFGAQCSQFVKRKLCENLLRNNKFHEDAVDACHSSYLTTNSQLHADVLDDSMSGTTAVTVLVRGRTIYVANSGDSRAVLAERRGKEIVAVDLSIDQTPFREDELERVKLSGARVLTLDQIEGLKNPDVQCWGTEEGDDGDPPRLWVPNGMYPGTAFTRSIGDSIAETIGVVANPEIVVWELTNDHPFFVLASDGVFEFLSSQAVVDMVAKYKDPRDACAAIVAESYRLWLQYETRTDDITVIVVHI********************************************************************VPSSSAHRKTWEEEAHIERALHDHFLFRKLTDSQCHVLLDCMQRVEVQAGDIVVKQGGEGDCFYVVGSGEFEVMATQEE*****PRVLQRYTAEKLSSFGELALMYNKPLQASVRAVTNGMLWALKREDFRGILMSEFSNLSSLKLLRSVDLLSRLTILQLSHLADTLSEVSFSAGQTIVNMNEGVAALYIIQRGQVRITFDADLLSNANVCSLKSD*****************KSEGSYFGEWTLLGEHMGSLTAVAVDDVVCAILTKEKFDLVVGP**********************************SLTDMEWRKCLYSTDCSEIGLVLLRDSENFLSLKRFSKQKVKCLGKEVQVLKEKNLMKSVSPSACVPQILCTCADSMHAGLLLNTYLACPLASILHTPLDEQSARFCAASVVAALEDLHKRGVLYRGVSPDVLMLDKSGHLQLVDFRFGKGLSGNRTFTICGMADYLAPEIVQGKGHGLAADWWALGVLIYFMLQGEMPFGSWRESEIDIVAKIAKGQLSLPQNLSPEAVDLLTKLLVVDENTRLGSQGPTSVKTHPWFRDVDWKGIAESTSPVPHEIMSRISQHLDSHFEDSPV*************VPEWLDDW
MGCVYSRACIGEICTPRDARIRIKEPQQTTSRTTNEIAVF****************QISQLNPELGITRLSRVSSQFLPPEGSRTVKVPSAKYELRYSFLSQRGYYPDALDKANQDSFCIHTPFGTSQDDHFFGVFDGHGEFGAQCSQFVKRKLCENLLRNNKFHEDAVDACHSSYLTTNSQLHADVLDDSMSGTTAVTVLVRGRTIYVANSGDSRAVLAERRGKEIVAVDLSIDQTPFREDELERVKLSGARVLTLDQIEGLKNPDVQCWGTEEGDDGDPPRLWVPNGMYPGTAFTRSIGDSIAETIGVVANPEIVVWELTNDHPFFVLASDGVFEFLSSQAVVDMVAKYKDPRDACAAIVAESYRLWLQYETRTDDITVIVVHINGLKNTAVNQSIPPGVFLRTPVPQVIEVTG************NQRIRHDLSRARLRAIENSLENGQIWVPSSSAHRKTWEEEAHIERALHDHFLFRKLTDSQCHVLLDCMQRVEVQAGDIVVKQGGEGDCFYVVGSGEFEVMATQEEKNGEVPRVLQRYTAEKLSSFGELALMYNKPLQASVRAVTNGMLWALKREDFRGILMSEFSNLSSLKLLRSVDLLSRLTILQLSHLADTLSEVSFSAGQTIVNMNEGVAALYIIQRGQVRITFDADLLSNANVCSLKSDLHV****************EGSYFGEWTLLGEHMGSLTAVAVDDVVCAILTKEKFDLVVGPLTKISH******************SIDISSLAKVSLTDMEWRKCLYSTDCSEIGLVLLRDSENFLSLKRFSKQKVKCLGKEVQVLKEKNLMKSVSPSACVPQILCTCADSMHAGLLLNTYLACPLASILHTPLDEQSARFCAASVVAALEDLHKRGVLYRGVSPDVLMLDKSGHLQLVDFRFGKGLSGNRTFTICGMADYLAPEIVQGKGHGLAADWWALGVLIYFMLQGEMPFGSWRESEIDIVAKIAKGQLSLPQNLSPEAVDLLTKLLVVDENTRLGSQGPTSVKTHPWFRDVDWKGIAESTSPVPHEIMSRISQHLDSHFEDSPVFQASPPRDVEELNVPEWLDDW
*GCVYSRACIGEICTPRD*******************************************NPELGITRLSRVSSQFLPPEGSRTVKVPSAKYELRYSFLSQRGYYPDALDKANQDSFCIHTPFGTSQDDHFFGVFDGHGEFGAQCSQFVKRKLCENLLRNNKFHEDAVDACHSSYLTTNSQLHADVLDDSMSGTTAVTVLVRGRTIYVANSGDSRAVLAERRGKEIVAVDLSIDQTPFREDELERVKLSGARVLTLDQIEGLKNPDVQCWGTEEGDDGDPPRLWVPNGMYPGTAFTRSIGDSIAETIGVVANPEIVVWELTNDHPFFVLASDGVFEFLSSQAVVDMVAKYKDPRDACAAIVAESYRLWLQYETRTDDITVIVVHINGL*****************************************************AIENSLENGQIWVPSSSAHRKTWEEEAHIERALHDHFLFRKLTDSQCHVLLDCMQRVEVQAGDIVVKQGGEGDCFYVVGSGEFEVMATQEEKNGEVPRVLQRYTAEKLSSFGELALMYNKPLQASVRAVTNGMLWALKREDFRGILMSEFSNLSSLKLLRSVDLLSRLTILQLSHLADTLSEVSFSAGQTIVNMNEGVAALYIIQRGQVRITFDAD********S*K***********SSKELSVEKSEGSYFGEWTLLGEHMGSLTAVAVDDVVCAILTKEKFDLVVGPLTKISHDDQNSKDYSSDIPKKPAKSIDISSLAKVSLTDMEWRKCLYSTDCSEIGLVLLRDSENFLSLKRFSKQKVKCLGKEVQVLKEKNLMKSVSPSACVPQILCTCADSMHAGLLLNTYLACPLASILHTPLDEQSARFCAASVVAALEDLHKRGVLYRGVSPDVLMLDKSGHLQLVDFRFGKGLSGNRTFTICGMADYLAPEIVQGKGHGLAADWWALGVLIYFMLQGEMPFGSWRESEIDIVAKIAKGQLSLPQNLSPEAVDLLTKLLVVDENTRLGSQGPTSVKTHPWFRDVDWKGIAESTSPVPHEIMSRISQHLDSHFEDS**********VEELNVPE***DW
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGCVYSRACIGEICTPRDARIRIKEPQQTTSRTTNEIAVFSPASSSSDGPDAETRDQISQLNPELGITRLSRVSSQFLPPEGSRTVKVPSAKYELRYSFLSQRGYYPDALDKANQDSFCIHTPFGTSQDDHFFGVFDGHGEFGAQCSQFVKRKLCENLLRNNKFHEDAVDACHSSYLTTNSQLHADVLDDSMSGTTAVTVLVRGRTIYVANSGDSRAVLAERRGKEIVAVDLSIDQTPFREDELERVKLSGARVLTLDQIEGLKNPDVQCWGTEEGDDGDPPRLWVPNGMYPGTAFTRSIGDSIAETIGVVANPEIVVWELTNDHPFFVLASDGVFEFLSSQAVVDMVAKYKDPRDACAAIVAESYRLWLQYETRTDDITVIVVHINGLKNTAVNQSIPPGVFLRTPVPQVIEVTGSESPSTFGWSSRNQRIRHDLSRARLRAIENSLENGQIWVPSSSAHRKTWEEEAHIERALHDHFLFRKLTDSQCHVLLDCMQRVEVQAGDIVVKQGGEGDCFYVVGSGEFEVMATQEEKNGEVPRVLQRYTAEKLSSFGELALMYNKPLQASVRAVTNGMLWALKREDFRGILMSEFSNLSSLKLLRSVDLLSRLTILQLSHLADTLSEVSFSAGQTIVNMNEGVAALYIIQRGQVRITFDADLLSNANVCSLKSDLHVEDDGTQSSKELSVEKSEGSYFGEWTLLGEHMGSLTAVAVDDVVCAILTKEKFDLVVGPLTKISHDDQNSKDYSSDIPKKPAKSIDISSLAKVSLTDMEWRKCLYSTDCSEIGLVLLRDSENFLSLKRFSKQKVKCLGKEVQVLKEKNLMKSVSPSACVPQILCTCADSMHAGLLLNTYLACPLASILHTPLDEQSARFCAASVVAALEDLHKRGVLYRGVSPDVLMLDKSGHLQLVDFRFGKGLSGNRTFTICGMADYLAPEIVQGKGHGLAADWWALGVLIYFMLQGEMPFGSWRESEIDIVAKIAKGQLSLPQNLSPEAVDLLTKLLVVDENTRLGSQGPTSVKTHPWFRDVDWKGIAESTSPVPHEIMSRISQHLDSHFEDSPVFQASPPRDVEELNVPEWLDDW
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query1082 2.2.26 [Sep-21-2011]
Q9SL761094 Protein phosphatase 2C an yes no 0.999 0.988 0.699 0.0
Q7XJ53348 Probable protein phosphat no no 0.283 0.882 0.609 1e-109
Q8H2T0399 Probable protein phosphat no no 0.280 0.761 0.501 1e-74
Q64595762 cGMP-dependent protein ki yes no 0.521 0.740 0.279 4e-62
Q13237762 cGMP-dependent protein ki yes no 0.524 0.744 0.274 1e-61
Q61410762 cGMP-dependent protein ki yes no 0.521 0.740 0.278 3e-61
P0C605671 cGMP-dependent protein ki no no 0.517 0.834 0.279 2e-60
P00516671 cGMP-dependent protein ki no no 0.517 0.834 0.277 3e-60
Q13976671 cGMP-dependent protein ki no no 0.517 0.834 0.277 8e-60
Q03042768 cGMP-dependent protein ki yes no 0.521 0.734 0.281 2e-59
>sp|Q9SL76|P2C19_ARATH Protein phosphatase 2C and cyclic nucleotide-binding/kinase domain-containing protein OS=Arabidopsis thaliana GN=At2g20050 PE=1 SV=2 Back     alignment and function desciption
 Score = 1549 bits (4011), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 766/1095 (69%), Positives = 886/1095 (80%), Gaps = 14/1095 (1%)

Query: 1    MGCVYSRACIGEICTPRDARIRIKEPQQTTSRTTNEIAVFSPASS-------SSDGPDAE 53
            MGC YS+ CIG+IC  ++  IR    Q  +   T   A  +           SSD  D  
Sbjct: 1    MGCAYSKTCIGQICATKENSIRQTHQQAPSRGGTRATAAAAAVEEDNPVFNFSSDAVDDV 60

Query: 54   TRDQISQL----NPELGITRLSRVSSQFLPPEGSRTVKVPSAKYELRYSFLSQRGYYPDA 109
              D+I QL    + E GITRLSRVSSQFLPP+GSR VKVPS  YELR SFLSQRGYYPDA
Sbjct: 61   DNDEIHQLGLSRDQEWGITRLSRVSSQFLPPDGSRVVKVPSCNYELRCSFLSQRGYYPDA 120

Query: 110  LDKANQDSFCIHTPFGTSQDDHFFGVFDGHGEFGAQCSQFVKRKLCENLLRNNKFHEDAV 169
            LDKANQDSF IHTPFG++ DDHFFGVFDGHGEFGAQCSQFVKR+LCENLLR+ +F  D  
Sbjct: 121  LDKANQDSFAIHTPFGSNSDDHFFGVFDGHGEFGAQCSQFVKRRLCENLLRHGRFRVDPA 180

Query: 170  DACHSSYLTTNSQLHADVLDDSMSGTTAVTVLVRGRTIYVANSGDSRAVLAERRGKEIVA 229
            +AC+S++LTTNSQLHAD++DDSMSGTTA+TV+VRGRTIYVAN+GDSRAVLAE+R  ++VA
Sbjct: 181  EACNSAFLTTNSQLHADLVDDSMSGTTAITVMVRGRTIYVANAGDSRAVLAEKRDGDLVA 240

Query: 230  VDLSIDQTPFREDELERVKLSGARVLTLDQIEGLKNPDVQCWGTEEGDDGDPPRLWVPNG 289
            VDLSIDQTPFR DELERVKL GARVLTLDQIEGLKNPDVQCWGTEE DDGDPPRLWVPNG
Sbjct: 241  VDLSIDQTPFRPDELERVKLCGARVLTLDQIEGLKNPDVQCWGTEEDDDGDPPRLWVPNG 300

Query: 290  MYPGTAFTRSIGDSIAETIGVVANPEIVVWELTNDHPFFVLASDGVFEFLSSQAVVDMVA 349
            MYPGTAFTRSIGDSIAETIGVVANPEI V ELT D+PFFV+ASDGVFEF+SSQ VVDMVA
Sbjct: 301  MYPGTAFTRSIGDSIAETIGVVANPEIAVVELTPDNPFFVVASDGVFEFISSQTVVDMVA 360

Query: 350  KYKDPRDACAAIVAESYRLWLQYETRTDDITVIVVHINGLKNTAVNQSIPPGVFLRTPVP 409
            K+KDPRDACAAIVAESYRLWLQYETRTDDIT+IVVHI+GLK+ A  Q    G  L+ P+P
Sbjct: 361  KHKDPRDACAAIVAESYRLWLQYETRTDDITIIVVHIDGLKDDAPRQLSSTGTQLQPPIP 420

Query: 410  QVIEVTGSESPSTFGWSSRNQRIRHDLSRARLRAIENSLENGQIWVPSSSAHRKTWEEEA 469
            QV+E+TGSESPSTFGW+S+NQR+RHDLSRAR+RAIENSLENG  WVP S AHRKTWEEEA
Sbjct: 421  QVVELTGSESPSTFGWNSKNQRVRHDLSRARIRAIENSLENGHAWVPPSPAHRKTWEEEA 480

Query: 470  HIERALHDHFLFRKLTDSQCHVLLDCMQRVEVQAGDIVVKQGGEGDCFYVVGSGEFEVMA 529
            HIER L DHFLFRKLTDSQC VLLDCMQR+E   GDIVVKQGGEGDCFYVVGSGEFEV+A
Sbjct: 481  HIERVLRDHFLFRKLTDSQCQVLLDCMQRLEANPGDIVVKQGGEGDCFYVVGSGEFEVLA 540

Query: 530  TQEEKNGEVPRVLQRYTAEKLSSFGELALMYNKPLQASVRAVTNGMLWALKREDFRGILM 589
            TQ+ KNGEVPR+LQRYTAEK SSFGELALM+NKPLQASVRAV +G LWALKREDFRGILM
Sbjct: 541  TQDGKNGEVPRILQRYTAEKQSSFGELALMHNKPLQASVRAVDHGTLWALKREDFRGILM 600

Query: 590  SEFSNLSSLKLLRSVDLLSRLTILQLSHLADTLSEVSFSAGQTIVNMNEGVAALYIIQRG 649
            SEFSNL+SLKLLRSVDLLSRLTILQLSH+A++LSE  FS GQTIV  ++ +  LY+IQ+G
Sbjct: 601  SEFSNLASLKLLRSVDLLSRLTILQLSHVAESLSEACFSDGQTIVTKDQKLQGLYVIQKG 660

Query: 650  QVRITFDADLLSNANVCSLKSDLHVEDDGTQSSKELSVEKSEGSYFGEWTLLGEHMGSLT 709
            +V+I+F  ++L + NV SL + +  E D  +   E+S+EK EGSYFGEW LLGE   SL+
Sbjct: 661  RVKISFCTEVLESQNVSSLTTGITNEYDNLEIGTEVSIEKHEGSYFGEWALLGELKDSLS 720

Query: 710  AVAVDDVVCAILTKEKFDLVVGPLTKISHDDQNSKDYSSDIPKKPAKSIDISSLAKVSLT 769
             VAV +VVC +LTKE F+  VGPLT IS D   ++  S ++ K+ AK  D ++LAK +L 
Sbjct: 721  VVAVGEVVCVVLTKENFESAVGPLTNISDDGPKTRHSSFELSKESAKVTDTTALAKATLA 780

Query: 770  DMEWRKCLYSTDCSEIGLVLLRDSENFLSLKRFSKQKVKCLGKEVQVLKEKNLMKSV-SP 828
            D+EW  CL +TDCSEIGLV L+D EN LSLKRFSKQKVK LGKE QVLKE+NLMK+V  P
Sbjct: 781  DLEWTTCLSTTDCSEIGLVHLKDKENLLSLKRFSKQKVKKLGKEAQVLKERNLMKNVIKP 840

Query: 829  SACVPQILCTCADSMHAGLLLNTYLACPLASILHTPLDEQSARFCAASVVAALEDLHKRG 888
            SA VP+ILCTC D   A +LLNT LACP++S+LH+PLDE S RF   S+V+A+ED+HK  
Sbjct: 841  SAIVPEILCTCVDQTFAAILLNTTLACPISSLLHSPLDESSVRFITGSLVSAIEDIHKNE 900

Query: 889  VLYRGVSPDVLMLDKSGHLQLVDFRFGKGLSGNRTFTICGMADYLAPEIVQGKGHGLAAD 948
            +L+RG SP++LMLD+SG+LQ+VDFRF K LSG RTFTICG ADYLAPEIVQGKGHG AAD
Sbjct: 901  ILFRGSSPELLMLDQSGYLQIVDFRFAKKLSGERTFTICGNADYLAPEIVQGKGHGYAAD 960

Query: 949  WWALGVLIYFMLQGEMPFGSWRESEIDIVAKIAKGQLSLPQNLSPEAVDLLTKLLVVDEN 1008
            WWALGVLIY+ML+GEMPFGSWRESE+D   KIAKGQL+ P+ LS EA DL+TKLL VDEN
Sbjct: 961  WWALGVLIYYMLEGEMPFGSWRESELDTFQKIAKGQLTFPRVLSSEAEDLITKLLEVDEN 1020

Query: 1009 TRLGSQ-GPTSVKTHPWFRDVDWKGIAESTSPVPHEIMSRISQHLDSHFEDSPVFQASPP 1067
             R GSQ GP S+K HPWF  + W+ I+     VP EI+SRI  HL++     P+  +   
Sbjct: 1021 LRFGSQGGPESIKKHPWFNGLKWEAISNREFQVPQEIISRIHHHLEND-NVLPLETSKSL 1079

Query: 1068 RDVEELNVPEWLDDW 1082
               E+ +   WL++W
Sbjct: 1080 DTTEDQDAQNWLEEW 1094

Arabidopsis thaliana (taxid: 3702)
EC: 3EC: .EC: 1EC: .EC: 3EC: .EC: 1EC: 6
>sp|Q7XJ53|P2C35_ARATH Probable protein phosphatase 2C 35 OS=Arabidopsis thaliana GN=At3g06270 PE=2 SV=1 Back     alignment and function description
>sp|Q8H2T0|P2C65_ORYSJ Probable protein phosphatase 2C 65 OS=Oryza sativa subsp. japonica GN=Os07g0646100 PE=2 SV=1 Back     alignment and function description
>sp|Q64595|KGP2_RAT cGMP-dependent protein kinase 2 OS=Rattus norvegicus GN=Prkg2 PE=2 SV=1 Back     alignment and function description
>sp|Q13237|KGP2_HUMAN cGMP-dependent protein kinase 2 OS=Homo sapiens GN=PRKG2 PE=1 SV=1 Back     alignment and function description
>sp|Q61410|KGP2_MOUSE cGMP-dependent protein kinase 2 OS=Mus musculus GN=Prkg2 PE=2 SV=1 Back     alignment and function description
>sp|P0C605|KGP1_MOUSE cGMP-dependent protein kinase 1 OS=Mus musculus GN=Prkg1 PE=1 SV=1 Back     alignment and function description
>sp|P00516|KGP1_BOVIN cGMP-dependent protein kinase 1 OS=Bos taurus GN=PRKG1 PE=1 SV=2 Back     alignment and function description
>sp|Q13976|KGP1_HUMAN cGMP-dependent protein kinase 1 OS=Homo sapiens GN=PRKG1 PE=1 SV=3 Back     alignment and function description
>sp|Q03042|KGP1_DROME cGMP-dependent protein kinase, isozyme 1 OS=Drosophila melanogaster GN=Pkg21D PE=1 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query1082
2977387811083 unnamed protein product [Vitis vinifera] 0.993 0.992 0.797 0.0
3594845571073 PREDICTED: protein phosphatase 2C and cy 0.987 0.996 0.798 0.0
2555463871077 protein phosphatase 2c, putative [Ricinu 0.988 0.993 0.785 0.0
3564952241074 PREDICTED: protein phosphatase 2C and cy 0.987 0.995 0.769 0.0
3565296401074 PREDICTED: protein phosphatase 2C and cy 0.985 0.992 0.766 0.0
4495272761082 PREDICTED: LOW QUALITY PROTEIN: protein 0.993 0.993 0.751 0.0
4494671061082 PREDICTED: protein phosphatase 2C and cy 0.993 0.993 0.750 0.0
1679894271083 putative cyclic nucleotide-dependent hyb 0.993 0.992 0.741 0.0
2402544851094 protein phosphatase 2C and cyclic nucleo 0.999 0.988 0.699 0.0
2978321361093 hypothetical protein ARALYDRAFT_480465 [ 0.991 0.981 0.700 0.0
>gi|297738781|emb|CBI28026.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
 Score = 1793 bits (4643), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 869/1090 (79%), Positives = 955/1090 (87%), Gaps = 15/1090 (1%)

Query: 1    MGCVYSRACIGEICTPRDARIRIKEPQQTTSRTTNEIAVFSPASSSSDGPDAETRDQISQ 60
            MGCVYSR+CIGE+CTPR AR++  E     +R   E+ VFSPASS  DG D E RDQ++Q
Sbjct: 1    MGCVYSRSCIGEVCTPRHARVKETE----NARAGAELPVFSPASS--DGEDGEIRDQLNQ 54

Query: 61   L----NPELGITRLSRVSSQFLPPEGSRTVKVPSAKYELRYSFLSQRGYYPDALDKANQD 116
            L    + E+GITRLSRVSSQFLP +GSRTVK+PS  YELR+SFLSQRGYYPDALDKANQD
Sbjct: 55   LSLTRDSEVGITRLSRVSSQFLPHDGSRTVKIPSGNYELRFSFLSQRGYYPDALDKANQD 114

Query: 117  SFCIHTPFGTSQDDHFFGVFDGHGEFGAQCSQFVKRKLCENLLRNNKFHEDAVDACHSSY 176
            SFCIHTP GT+ DDHFFGVFDGHGEFGAQCSQFVK+KLCENLLRN++FH DA++ACH+++
Sbjct: 115  SFCIHTPLGTNPDDHFFGVFDGHGEFGAQCSQFVKQKLCENLLRNSRFHMDAIEACHAAF 174

Query: 177  LTTNSQLHADVLDDSMSGTTAVTVLVRGRTIYVANSGDSRAVLAERRGKEIVAVDLSIDQ 236
            LTTNSQLHAD LDDSMSGTTA+TVLVRGRTIYVANSGDSRAV+AER+GKEIVAVDLSIDQ
Sbjct: 175  LTTNSQLHADSLDDSMSGTTAITVLVRGRTIYVANSGDSRAVIAERKGKEIVAVDLSIDQ 234

Query: 237  TPFREDELERVKLSGARVLTLDQIEGLKNPDVQCWGTEEGDDGDPPRLWVPNGMYPGTAF 296
            TPFR DELERVKL GARVLTLDQIEGLKNPDVQCWGTEEGDDGDPPRLWVPNGMYPGTAF
Sbjct: 235  TPFRADELERVKLCGARVLTLDQIEGLKNPDVQCWGTEEGDDGDPPRLWVPNGMYPGTAF 294

Query: 297  TRSIGDSIAETIGVVANPEIVVWELTNDHPFFVLASDGVFEFLSSQAVVDMVAKYKDPRD 356
            TRSIGDSIAE+IGVVANPEIVV ELT DHPFFVLASDGVFEFLSSQ VVDMV K+KDPRD
Sbjct: 295  TRSIGDSIAESIGVVANPEIVVLELTPDHPFFVLASDGVFEFLSSQTVVDMVTKFKDPRD 354

Query: 357  ACAAIVAESYRLWLQYETRTDDITVIVVHINGLKNTAVNQSIPPGVFLRTPVPQVIEVTG 416
            ACAAIVAESYRLWLQYETRTDDITVIVVHINGL +  V QS  PG   R PVPQV+EVTG
Sbjct: 355  ACAAIVAESYRLWLQYETRTDDITVIVVHINGLTDPDVGQSANPGAISRPPVPQVVEVTG 414

Query: 417  SESPSTFGWSSRNQRIRHDLSRARLRAIENSLENGQIWVPSSSAHRKTWEEEAHIERALH 476
            SESPST  W+SRN R+RHDLSRARLRAIE+SLENGQIWVP S AHRKTWEEEAHIERALH
Sbjct: 415  SESPSTLSWNSRNHRVRHDLSRARLRAIESSLENGQIWVPPSPAHRKTWEEEAHIERALH 474

Query: 477  DHFLFRKLTDSQCHVLLDCMQRVEVQAGDIVVKQGGEGDCFYVVGSGEFEVMATQEEKNG 536
            DHFLFRKLTDSQCHVLLDCMQRVEVQ+GD+VVKQGGEGDCFYVVGSGEFEV+ATQEEKNG
Sbjct: 475  DHFLFRKLTDSQCHVLLDCMQRVEVQSGDVVVKQGGEGDCFYVVGSGEFEVLATQEEKNG 534

Query: 537  EVPRVLQRYTAEKLSSFGELALMYNKPLQASVRAVTNGMLWALKREDFRGILMSEFSNLS 596
            EV RVLQ+YTAEKLSSFGELALMYNKPLQASVRAVTNG LWALKREDFRGILMSEFSNLS
Sbjct: 535  EVTRVLQQYTAEKLSSFGELALMYNKPLQASVRAVTNGTLWALKREDFRGILMSEFSNLS 594

Query: 597  SLKLLRSVDLLSRLTILQLSHLADTLSEVSFSAGQTIVNMNEGVAALYIIQRGQVRITFD 656
            SLKLLRSVDLLSRLTILQLSH+AD+LSEVSFS GQTIV+ NEG  ALYIIQ+GQVRITFD
Sbjct: 595  SLKLLRSVDLLSRLTILQLSHIADSLSEVSFSDGQTIVDKNEGPVALYIIQKGQVRITFD 654

Query: 657  ADLLSNANVCSLKSDLHVEDDGTQSSKELSVEKSEGSYFGEWTLLGEHMGSLTAVAVDDV 716
             D + + +  SL SD   +DD T+SS E  V K+EGSYFGEW LLGE++GS +AVA+ DV
Sbjct: 655  PDSIRSPSFGSLVSDNQKQDDDTESSTEFVV-KTEGSYFGEWALLGENIGSFSAVAMGDV 713

Query: 717  VCAILTKEKFDLVVGPLTKISHDDQ----NSKDYSSDIPKKPAKSIDISSLAKVSLTDME 772
            VCA+LTKEKFD VVGPL K+S  D+    +S+DYSS +PK+  K+ID S+L KV  +D+E
Sbjct: 714  VCAVLTKEKFDAVVGPLAKLSQGDEKSRDHSRDYSSSLPKESVKNIDPSTLTKVQPSDLE 773

Query: 773  WRKCLYSTDCSEIGLVLLRDSENFLSLKRFSKQKVKCLGKEVQVLKEKNLMKSVSPSACV 832
            WR CLYSTDCSEIGLVLLRDSEN LSLKRFSKQK+K LGKE QVLKEKNLM S++PSACV
Sbjct: 774  WRTCLYSTDCSEIGLVLLRDSENLLSLKRFSKQKIKRLGKEAQVLKEKNLMMSMAPSACV 833

Query: 833  PQILCTCADSMHAGLLLNTYLACPLASILHTPLDEQSARFCAASVVAALEDLHKRGVLYR 892
            PQ+LCT AD  HA +LLNT LACP ASILHTPLDE SARFCAASVV ALE+LHK G+LYR
Sbjct: 834  PQVLCTIADQNHASILLNTCLACPFASILHTPLDEPSARFCAASVVIALENLHKNGILYR 893

Query: 893  GVSPDVLMLDKSGHLQLVDFRFGKGLSGNRTFTICGMADYLAPEIVQGKGHGLAADWWAL 952
            GVSPDVLM D +GHLQLVDFRFGK L+  RTFTICGMAD LAPEIVQGKGHG  ADWWAL
Sbjct: 894  GVSPDVLMFDHTGHLQLVDFRFGKKLADERTFTICGMADSLAPEIVQGKGHGFPADWWAL 953

Query: 953  GVLIYFMLQGEMPFGSWRESEIDIVAKIAKGQLSLPQNLSPEAVDLLTKLLVVDENTRLG 1012
            GVLIYFMLQGEMPFGSWRESE+D  AKIA+GQL+LP   SPEAVDL+TKLL VDE+TRLG
Sbjct: 954  GVLIYFMLQGEMPFGSWRESELDTFAKIARGQLNLPCTFSPEAVDLITKLLEVDESTRLG 1013

Query: 1013 SQGPTSVKTHPWFRDVDWKGIAESTSPVPHEIMSRISQHLDSHFEDSPVFQASPPRDVEE 1072
            SQ P SVK+H WF  +DWK + +S+ PVPHEI SRI+QHL++H ED  +   SP RD EE
Sbjct: 1014 SQNPDSVKSHKWFDGIDWKRLTDSSFPVPHEITSRIAQHLENHTEDYTIHSLSPSRDPEE 1073

Query: 1073 LNVPEWLDDW 1082
            LN PEWL++W
Sbjct: 1074 LNTPEWLEEW 1083

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|359484557|ref|XP_002280650.2| PREDICTED: protein phosphatase 2C and cyclic nucleotide-binding/kinase domain-containing protein [Vitis vinifera] Back     alignment and taxonomy information
>gi|255546387|ref|XP_002514253.1| protein phosphatase 2c, putative [Ricinus communis] gi|223546709|gb|EEF48207.1| protein phosphatase 2c, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|356495224|ref|XP_003516479.1| PREDICTED: protein phosphatase 2C and cyclic nucleotide-binding/kinase domain-containing protein-like [Glycine max] Back     alignment and taxonomy information
>gi|356529640|ref|XP_003533397.1| PREDICTED: protein phosphatase 2C and cyclic nucleotide-binding/kinase domain-containing protein-like [Glycine max] Back     alignment and taxonomy information
>gi|449527276|ref|XP_004170638.1| PREDICTED: LOW QUALITY PROTEIN: protein phosphatase 2C and cyclic nucleotide-binding/kinase domain-containing protein-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|449467106|ref|XP_004151266.1| PREDICTED: protein phosphatase 2C and cyclic nucleotide-binding/kinase domain-containing protein-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|167989427|gb|ACA13523.1| putative cyclic nucleotide-dependent hybrid protein phosphatase 2C/protein kinase isoform A variant 1 [Nicotiana tabacum] Back     alignment and taxonomy information
>gi|240254485|ref|NP_179595.5| protein phosphatase 2C and cyclic nucleotide-binding/kinase domain-containing protein [Arabidopsis thaliana] gi|226739228|sp|Q9SL76.2|P2C19_ARATH RecName: Full=Protein phosphatase 2C and cyclic nucleotide-binding/kinase domain-containing protein; Includes: RecName: Full=Probable protein phosphatase 2C 19; Short=AtPP2C19; Includes: RecName: Full=Probable inactive cyclic nucleotide-dependent protein kinase At2g20050 gi|156505841|gb|ABU68673.1| putative cyclic nucleotide-dependent hybrid protein phosphatase 2C/protein kinase [Arabidopsis thaliana] gi|192759047|gb|ACF05481.1| putative cyclic nucleotide dependent kinase-phosphatase [Arabidopsis thaliana] gi|330251864|gb|AEC06958.1| protein phosphatase 2C and cyclic nucleotide-binding/kinase domain-containing protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|297832136|ref|XP_002883950.1| hypothetical protein ARALYDRAFT_480465 [Arabidopsis lyrata subsp. lyrata] gi|297329790|gb|EFH60209.1| hypothetical protein ARALYDRAFT_480465 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query1082
TAIR|locus:20616731094 AT2G20050 [Arabidopsis thalian 0.998 0.987 0.697 0.0
TAIR|locus:2082465348 AT3G06270 [Arabidopsis thalian 0.286 0.890 0.608 9.1e-100
ZFIN|ZDB-GENE-030131-4745571 si:dkey-121j17.5 "si:dkey-121j 0.298 0.565 0.323 2.1e-61
MGI|MGI:108174671 Prkg1 "protein kinase, cGMP-de 0.377 0.608 0.288 3.8e-58
FB|FBgn0000442768 Pkg21D "cGMP-dependent protein 0.530 0.747 0.289 9e-58
UNIPROTKB|Q5SQU3659 PRKG1 "cGMP-dependent protein 0.377 0.619 0.288 9.1e-58
UNIPROTKB|P00516671 PRKG1 "cGMP-dependent protein 0.377 0.608 0.288 1.4e-57
UNIPROTKB|Q13976671 PRKG1 "cGMP-dependent protein 0.377 0.608 0.288 1.6e-57
UNIPROTKB|F1MY76686 PRKG1 "cGMP-dependent protein 0.377 0.594 0.288 2.3e-57
UNIPROTKB|F1NE85685 F1NE85 "cGMP-dependent protein 0.377 0.595 0.288 2.7e-57
TAIR|locus:2061673 AT2G20050 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 3939 (1391.7 bits), Expect = 0., P = 0.
 Identities = 764/1096 (69%), Positives = 886/1096 (80%)

Query:     1 MGCVYSRACIGEICTPRDARIRI---KEPQQTTSRTTNEIAVFXXXXXXXXXXXXET--- 54
             MGC YS+ CIG+IC  ++  IR    + P +  +R T   A                   
Sbjct:     1 MGCAYSKTCIGQICATKENSIRQTHQQAPSRGGTRATAAAAAVEEDNPVFNFSSDAVDDV 60

Query:    55 -RDQISQL----NPELGITRLSRVSSQFLPPEGSRTVKVPSAKYELRYSFLSQRGYYPDA 109
               D+I QL    + E GITRLSRVSSQFLPP+GSR VKVPS  YELR SFLSQRGYYPDA
Sbjct:    61 DNDEIHQLGLSRDQEWGITRLSRVSSQFLPPDGSRVVKVPSCNYELRCSFLSQRGYYPDA 120

Query:   110 LDKANQDSFCIHTPFGTSQDDHFFGVFDGHGEFGAQCSQFVKRKLCENLLRNNKFHEDAV 169
             LDKANQDSF IHTPFG++ DDHFFGVFDGHGEFGAQCSQFVKR+LCENLLR+ +F  D  
Sbjct:   121 LDKANQDSFAIHTPFGSNSDDHFFGVFDGHGEFGAQCSQFVKRRLCENLLRHGRFRVDPA 180

Query:   170 DACHSSYLTTNSQLHADVLDDSMSGTTAVTVLVRGRTIYVANSGDSRAVLAERRGKEIVA 229
             +AC+S++LTTNSQLHAD++DDSMSGTTA+TV+VRGRTIYVAN+GDSRAVLAE+R  ++VA
Sbjct:   181 EACNSAFLTTNSQLHADLVDDSMSGTTAITVMVRGRTIYVANAGDSRAVLAEKRDGDLVA 240

Query:   230 VDLSIDQTPFREDELERVKLSGARVLTLDQIEGLKNPDVQCWGTEEGDDGDPPRLWVPNG 289
             VDLSIDQTPFR DELERVKL GARVLTLDQIEGLKNPDVQCWGTEE DDGDPPRLWVPNG
Sbjct:   241 VDLSIDQTPFRPDELERVKLCGARVLTLDQIEGLKNPDVQCWGTEEDDDGDPPRLWVPNG 300

Query:   290 MYPGTAFTRSIGDSIAETIGVVANPEIVVWELTNDHPFFVLASDGVFEFLSSQAVVDMVA 349
             MYPGTAFTRSIGDSIAETIGVVANPEI V ELT D+PFFV+ASDGVFEF+SSQ VVDMVA
Sbjct:   301 MYPGTAFTRSIGDSIAETIGVVANPEIAVVELTPDNPFFVVASDGVFEFISSQTVVDMVA 360

Query:   350 KYKDPRDACAAIVAESYRLWLQYETRTDDITVIVVHINGLKNTAVNQSIPPGVFLRTPVP 409
             K+KDPRDACAAIVAESYRLWLQYETRTDDIT+IVVHI+GLK+ A  Q    G  L+ P+P
Sbjct:   361 KHKDPRDACAAIVAESYRLWLQYETRTDDITIIVVHIDGLKDDAPRQLSSTGTQLQPPIP 420

Query:   410 QVIEVTGSESPSTFGWSSRNQRIRHDLSRARLRAIENSLENGQIWVPSSSAHRKTWEEEA 469
             QV+E+TGSESPSTFGW+S+NQR+RHDLSRAR+RAIENSLENG  WVP S AHRKTWEEEA
Sbjct:   421 QVVELTGSESPSTFGWNSKNQRVRHDLSRARIRAIENSLENGHAWVPPSPAHRKTWEEEA 480

Query:   470 HIERALHDHFLFRKLTDSQCHVLLDCMQRVEVQAGDIVVKQGGEGDCFYVVGSGEFEVMA 529
             HIER L DHFLFRKLTDSQC VLLDCMQR+E   GDIVVKQGGEGDCFYVVGSGEFEV+A
Sbjct:   481 HIERVLRDHFLFRKLTDSQCQVLLDCMQRLEANPGDIVVKQGGEGDCFYVVGSGEFEVLA 540

Query:   530 TQEEKNGEVPRVLQRYTAEKLSSFGELALMYNKPLQASVRAVTNGMLWALKREDFRGILM 589
             TQ+ KNGEVPR+LQRYTAEK SSFGELALM+NKPLQASVRAV +G LWALKREDFRGILM
Sbjct:   541 TQDGKNGEVPRILQRYTAEKQSSFGELALMHNKPLQASVRAVDHGTLWALKREDFRGILM 600

Query:   590 SEFSNLSSLKLLRSVDLLSRLTILQLSHLADTLSEVSFSAGQTIVNMNEGVAALYIIQRG 649
             SEFSNL+SLKLLRSVDLLSRLTILQLSH+A++LSE  FS GQTIV  ++ +  LY+IQ+G
Sbjct:   601 SEFSNLASLKLLRSVDLLSRLTILQLSHVAESLSEACFSDGQTIVTKDQKLQGLYVIQKG 660

Query:   650 QVRITFDADLLSNANVCSLKSDLHVEDDGTQSSKELSVEKSEGSYFGEWTLLGEHMGSLT 709
             +V+I+F  ++L + NV SL + +  E D  +   E+S+EK EGSYFGEW LLGE   SL+
Sbjct:   661 RVKISFCTEVLESQNVSSLTTGITNEYDNLEIGTEVSIEKHEGSYFGEWALLGELKDSLS 720

Query:   710 AVAVDDVVCAILTKEKFDLVVGPLTKISHDDQNSKDYSSDIPKKPAKSIDISSLAKVSLT 769
              VAV +VVC +LTKE F+  VGPLT IS D   ++  S ++ K+ AK  D ++LAK +L 
Sbjct:   721 VVAVGEVVCVVLTKENFESAVGPLTNISDDGPKTRHSSFELSKESAKVTDTTALAKATLA 780

Query:   770 DMEWRKCLYSTDCSEIGLVLLRDSENFLSLKRFSKQKVKCLGKEVQVLKEKNLMKSV-SP 828
             D+EW  CL +TDCSEIGLV L+D EN LSLKRFSKQKVK LGKE QVLKE+NLMK+V  P
Sbjct:   781 DLEWTTCLSTTDCSEIGLVHLKDKENLLSLKRFSKQKVKKLGKEAQVLKERNLMKNVIKP 840

Query:   829 SACVPQILCTCADSMHAGLLLNTYLACPLASILHTPLDEQSARFCAASVVAALEDLHKRG 888
             SA VP+ILCTC D   A +LLNT LACP++S+LH+PLDE S RF   S+V+A+ED+HK  
Sbjct:   841 SAIVPEILCTCVDQTFAAILLNTTLACPISSLLHSPLDESSVRFITGSLVSAIEDIHKNE 900

Query:   889 VLYRGVSPDVLMLDKSGHLQLVDFRFGKGLSGNRTFTICGMADYLAPEIVQGKGHGLAAD 948
             +L+RG SP++LMLD+SG+LQ+VDFRF K LSG RTFTICG ADYLAPEIVQGKGHG AAD
Sbjct:   901 ILFRGSSPELLMLDQSGYLQIVDFRFAKKLSGERTFTICGNADYLAPEIVQGKGHGYAAD 960

Query:   949 WWALGVLIYFMLQGEMPFGSWRESEIDIVAKIAKGQLSLPQNLSPEAVDLLTKLLVVDEN 1008
             WWALGVLIY+ML+GEMPFGSWRESE+D   KIAKGQL+ P+ LS EA DL+TKLL VDEN
Sbjct:   961 WWALGVLIYYMLEGEMPFGSWRESELDTFQKIAKGQLTFPRVLSSEAEDLITKLLEVDEN 1020

Query:  1009 TRLGSQG-PTSVKTHPWFRDVDWKGIAESTSPVPHEIMSRISQHLDSHFEDSPVFQASPP 1067
              R GSQG P S+K HPWF  + W+ I+     VP EI+SRI  HL++  ++    + S  
Sbjct:  1021 LRFGSQGGPESIKKHPWFNGLKWEAISNREFQVPQEIISRIHHHLEN--DNVLPLETSKS 1078

Query:  1068 RDV-EELNVPEWLDDW 1082
              D  E+ +   WL++W
Sbjct:  1079 LDTTEDQDAQNWLEEW 1094
GO:0001932 "regulation of protein phosphorylation" evidence=IEA
GO:0003824 "catalytic activity" evidence=IEA
GO:0004672 "protein kinase activity" evidence=IEA
GO:0004722 "protein serine/threonine phosphatase activity" evidence=IEA;ISS
GO:0005524 "ATP binding" evidence=IEA
GO:0005952 "cAMP-dependent protein kinase complex" evidence=IEA
GO:0006468 "protein phosphorylation" evidence=IEA
GO:0006470 "protein dephosphorylation" evidence=IEA
GO:0008287 "protein serine/threonine phosphatase complex" evidence=IEA
GO:0008603 "cAMP-dependent protein kinase regulator activity" evidence=IEA
GO:0016772 "transferase activity, transferring phosphorus-containing groups" evidence=IEA
GO:0005886 "plasma membrane" evidence=IDA
TAIR|locus:2082465 AT3G06270 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-030131-4745 si:dkey-121j17.5 "si:dkey-121j17.5" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
MGI|MGI:108174 Prkg1 "protein kinase, cGMP-dependent, type I" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
FB|FBgn0000442 Pkg21D "cGMP-dependent protein kinase 21D" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
UNIPROTKB|Q5SQU3 PRKG1 "cGMP-dependent protein kinase 1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|P00516 PRKG1 "cGMP-dependent protein kinase 1" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|Q13976 PRKG1 "cGMP-dependent protein kinase 1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F1MY76 PRKG1 "cGMP-dependent protein kinase" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|F1NE85 F1NE85 "cGMP-dependent protein kinase" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q9SL76P2C19_ARATH3, ., 1, ., 3, ., 1, 60.69950.99900.9881yesno

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer3.1.3.16LOW CONFIDENCE prediction!
3rd Layer3.1.3LOW CONFIDENCE prediction!
3rd Layer2.7.11LOW CONFIDENCE prediction!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
GSVIVG00016693001
SubName- Full=Chromosome chr11 scaffold_13, whole genome shotgun sequence; (1049 aa)
(Vitis vinifera)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query1082
cd05580290 cd05580, STKc_PKA, Catalytic domain of the Protein 3e-66
cd05572262 cd05572, STKc_cGK_PKG, Catalytic domain of the Pro 2e-59
cd05123250 cd05123, STKc_AGC, Catalytic domain of AGC family 9e-58
cd05612291 cd05612, STKc_PRKX_like, Catalytic domain of PRKX- 3e-57
cd00143254 cd00143, PP2Cc, Serine/threonine phosphatases, fam 4e-55
cd05579265 cd05579, STKc_MAST_like, Catalytic domain of Micro 4e-53
PTZ00263329 PTZ00263, PTZ00263, protein kinase A catalytic sub 1e-49
smart00332252 smart00332, PP2Cc, Serine/threonine phosphatases, 8e-48
cd05574316 cd05574, STKc_phototropin_like, Catalytic domain o 1e-45
cd05584323 cd05584, STKc_p70S6K, Catalytic domain of the Prot 4e-44
cd05611260 cd05611, STKc_Rim15_like, Catalytic domain of fung 6e-44
cd05570318 cd05570, STKc_PKC, Catalytic domain of the Protein 1e-43
cd05583288 cd05583, STKc_MSK_N, N-terminal catalytic domain o 2e-42
cd05614332 cd05614, STKc_MSK2_N, N-terminal catalytic domain 2e-41
smart00220254 smart00220, S_TKc, Serine/Threonine protein kinase 1e-39
cd05581280 cd05581, STKc_PDK1, Catalytic domain of the Protei 3e-39
cd05582318 cd05582, STKc_RSK_N, N-terminal catalytic domain o 2e-38
cd05571323 cd05571, STKc_PKB, Catalytic domain of the Protein 8e-38
cd05592316 cd05592, STKc_nPKC_theta_delta, Catalytic domain o 9e-38
cd05589324 cd05589, STKc_PKN, Catalytic domain of the Protein 1e-37
cd05573350 cd05573, STKc_ROCK_NDR_like, Catalytic domain of R 1e-37
cd05578258 cd05578, STKc_Yank1, Catalytic domain of the Prote 2e-37
cd05591321 cd05591, STKc_nPKC_epsilon, Catalytic domain of th 3e-37
cd05590320 cd05590, STKc_nPKC_eta, Catalytic domain of the Pr 1e-36
cd05585312 cd05585, STKc_YPK1_like, Catalytic domain of Yeast 1e-36
PTZ00426340 PTZ00426, PTZ00426, cAMP-dependent protein kinase 1e-36
cd05613290 cd05613, STKc_MSK1_N, N-terminal catalytic domain 4e-36
cd05587324 cd05587, STKc_cPKC, Catalytic domain of the Protei 5e-36
pfam00069260 pfam00069, Pkinase, Protein kinase domain 8e-36
cd05595323 cd05595, STKc_PKB_beta, Catalytic domain of the Pr 2e-35
cd05597331 cd05597, STKc_DMPK_like, Catalytic domain of Myoto 1e-34
cd05577277 cd05577, STKc_GRK, Catalytic domain of the Protein 1e-34
cd05599364 cd05599, STKc_NDR_like, Catalytic domain of Nuclea 3e-34
cd05588329 cd05588, STKc_aPKC, Catalytic domain of the Protei 3e-34
cd05617327 cd05617, STKc_aPKC_zeta, Catalytic domain of the P 9e-34
cd05615323 cd05615, STKc_cPKC_alpha, Catalytic domain of the 1e-33
cd05619316 cd05619, STKc_nPKC_theta, Catalytic domain of the 1e-33
cd05600333 cd05600, STKc_Sid2p_Dbf2p, Catalytic domain of Fun 5e-33
cd05606278 cd05606, STKc_beta_ARK, Catalytic domain of the Pr 5e-33
cd05616323 cd05616, STKc_cPKC_beta, Catalytic domain of the P 1e-32
cd05618329 cd05618, STKc_aPKC_iota, Catalytic domain of the P 3e-32
cd05596370 cd05596, STKc_ROCK, Catalytic domain of the Protei 3e-32
pfam00481252 pfam00481, PP2C, Protein phosphatase 2C 3e-32
cd05621370 cd05621, STKc_ROCK2, Catalytic domain of the Prote 4e-32
cd05575323 cd05575, STKc_SGK, Catalytic domain of the Protein 2e-31
cd05609305 cd05609, STKc_MAST, Catalytic domain of the Protei 5e-31
cd05605285 cd05605, STKc_GRK4_like, Catalytic domain of G pro 6e-31
cd05594325 cd05594, STKc_PKB_alpha, Catalytic domain of the P 6e-31
cd05601330 cd05601, STKc_CRIK, Catalytic domain of the Protei 8e-31
cd05631285 cd05631, STKc_GRK4, Catalytic domain of the Protei 2e-30
cd05620316 cd05620, STKc_nPKC_delta, Catalytic domain of the 2e-30
cd05593328 cd05593, STKc_PKB_gamma, Catalytic domain of the P 4e-30
cd05622371 cd05622, STKc_ROCK1, Catalytic domain of the Prote 5e-30
cd05586330 cd05586, STKc_Sck1_like, Catalytic domain of Suppr 5e-30
cd05633279 cd05633, STKc_GRK3, Catalytic domain of the Protei 6e-30
cd05632285 cd05632, STKc_GRK5, Catalytic domain of the Protei 4e-29
COG0631262 COG0631, PTC1, Serine/threonine protein phosphatas 1e-28
cd05630285 cd05630, STKc_GRK6, Catalytic domain of the Protei 3e-28
cd05623332 cd05623, STKc_MRCK_alpha, Catalytic domain of the 2e-27
cd05624331 cd05624, STKc_MRCK_beta, Catalytic domain of the P 3e-27
cd05602325 cd05602, STKc_SGK1, Catalytic domain of the Protei 5e-27
cd05629377 cd05629, STKc_NDR_like_fungal, Catalytic domain of 3e-26
cd05627360 cd05627, STKc_NDR2, Catalytic domain of the Protei 8e-26
cd05626381 cd05626, STKc_LATS2, Catalytic domain of the Prote 1e-25
cd05598376 cd05598, STKc_LATS, Catalytic domain of the Protei 1e-25
cd05603321 cd05603, STKc_SGK2, Catalytic domain of the Protei 5e-25
cd05604325 cd05604, STKc_SGK3, Catalytic domain of the Protei 9e-25
cd06606260 cd06606, STKc_MAPKKK, Catalytic domain of the Prot 3e-24
cd05628363 cd05628, STKc_NDR1, Catalytic domain of the Protei 9e-24
cd05625382 cd05625, STKc_LATS1, Catalytic domain of the Prote 2e-22
COG0515384 COG0515, SPS1, Serine/threonine protein kinase [Ge 3e-22
PLN03145365 PLN03145, PLN03145, Protein phosphatase 2c; Provis 5e-22
cd05608280 cd05608, STKc_GRK1, Catalytic domain of the Protei 1e-21
cd08215258 cd08215, STKc_Nek, Catalytic domain of the Protein 6e-21
cd00038115 cd00038, CAP_ED, effector domain of the CAP family 7e-21
cd06626264 cd06626, STKc_MEKK4, Catalytic domain of the Prote 1e-19
cd05122253 cd05122, PKc_STE, Catalytic domain of STE family P 1e-19
cd00180215 cd00180, PKc, Catalytic domain of Protein Kinases 2e-17
cd05607277 cd05607, STKc_GRK7, Catalytic domain of the Protei 3e-17
smart00100120 smart00100, cNMP, Cyclic nucleotide-monophosphate 1e-16
cd05576237 cd05576, STKc_RPK118_like, Catalytic domain of the 2e-16
pfam0002791 pfam00027, cNMP_binding, Cyclic nucleotide-binding 3e-16
cd08529256 cd08529, STKc_FA2-like, Catalytic domain of the Pr 7e-16
cd06614286 cd06614, STKc_PAK, Catalytic domain of the Protein 1e-15
cd05610669 cd05610, STKc_MASTL, Catalytic domain of the Prote 4e-15
cd06625263 cd06625, STKc_MEKK3_like, Catalytic domain of MAP/ 2e-14
cd06648285 cd06648, STKc_PAK_II, Catalytic domain of the Prot 2e-14
cd06605265 cd06605, PKc_MAPKK, Catalytic domain of the dual-s 9e-14
cd06647293 cd06647, STKc_PAK_I, Catalytic domain of the Prote 1e-13
cd07832286 cd07832, STKc_CCRK, Catalytic domain of the Serine 2e-13
cd06655296 cd06655, STKc_PAK2, Catalytic domain of the Protei 5e-13
cd06657292 cd06657, STKc_PAK4, Catalytic domain of the Protei 7e-13
cd06632258 cd06632, STKc_MEKK1_plant, Catalytic domain of the 7e-13
cd06629272 cd06629, STKc_MAPKKK_Bck1_like, Catalytic domain o 5e-12
cd07829282 cd07829, STKc_CDK_like, Catalytic domain of Cyclin 6e-12
cd08530256 cd08530, STKc_CNK2-like, Catalytic domain of the P 7e-12
PTZ00283 496 PTZ00283, PTZ00283, serine/threonine protein kinas 8e-12
cd06658292 cd06658, STKc_PAK5, Catalytic domain of the Protei 8e-12
cd06659297 cd06659, STKc_PAK6, Catalytic domain of the Protei 8e-12
cd06621287 cd06621, PKc_MAPKK_Pek1_like, Catalytic domain of 1e-11
cd06656297 cd06656, STKc_PAK3, Catalytic domain of the Protei 1e-11
cd00038115 cd00038, CAP_ED, effector domain of the CAP family 2e-11
cd07837295 cd07837, STKc_CdkB_plant, Catalytic domain of the 2e-11
cd07831282 cd07831, STKc_MOK, Catalytic domain of the Serine/ 2e-11
cd06627254 cd06627, STKc_Cdc7_like, Catalytic domain of Cell 2e-11
cd06628267 cd06628, STKc_MAPKKK_Byr2_like, Catalytic domain o 2e-11
cd06631265 cd06631, STKc_YSK4, Catalytic domain of the Protei 2e-11
cd06623264 cd06623, PKc_MAPKK_plant_like, Catalytic domain of 3e-11
COG0664214 COG0664, Crp, cAMP-binding proteins - catabolite g 3e-11
PHA03390267 PHA03390, pk1, serine/threonine-protein kinase 1; 4e-11
cd06630268 cd06630, STKc_MEKK1, Catalytic domain of the Prote 5e-11
cd06654296 cd06654, STKc_PAK1, Catalytic domain of the Protei 6e-11
PTZ00267478 PTZ00267, PTZ00267, NIMA-related protein kinase; P 9e-11
cd08224267 cd08224, STKc_Nek6_Nek7, Catalytic domain of the P 1e-10
cd08220256 cd08220, STKc_Nek8, Catalytic domain of the Protei 2e-10
cd06617283 cd06617, PKc_MKK3_6, Catalytic domain of the dual- 3e-10
cd06624268 cd06624, STKc_ASK, Catalytic domain of the Protein 3e-10
PTZ00224381 PTZ00224, PTZ00224, protein phosphatase 2C; Provis 5e-10
cd06622286 cd06622, PKc_MAPKK_PBS2_like, Catalytic domain of 1e-09
cd07879342 cd07879, STKc_p38delta_MAPK13, Catalytic domain of 1e-09
cd06651266 cd06651, STKc_MEKK3, Catalytic domain of the Prote 3e-09
cd08528269 cd08528, STKc_Nek10, Catalytic domain of the Prote 3e-09
cd05118283 cd05118, STKc_CMGC, Catalytic domain of CMGC famil 3e-09
cd07846286 cd07846, STKc_CDKL2_3, Catalytic domain of the Ser 4e-09
cd06609274 cd06609, STKc_MST3_like, Catalytic domain of Mamma 5e-09
cd08217265 cd08217, STKc_Nek2, Catalytic domain of the Protei 5e-09
cd06612256 cd06612, STKc_MST1_2, Catalytic domain of the Prot 5e-09
cd08229267 cd08229, STKc_Nek7, Catalytic domain of the Protei 9e-09
cd08228267 cd08228, STKc_Nek6, Catalytic domain of the Protei 9e-09
cd07841298 cd07841, STKc_CDK7, Catalytic domain of the Serine 1e-08
cd08218256 cd08218, STKc_Nek1, Catalytic domain of the Protei 2e-08
cd06652265 cd06652, STKc_MEKK2, Catalytic domain of the Prote 2e-08
cd08221256 cd08221, STKc_Nek9, Catalytic domain of the Protei 3e-08
cd06610267 cd06610, STKc_OSR1_SPAK, Catalytic domain of the P 3e-08
pfam0002791 pfam00027, cNMP_binding, Cyclic nucleotide-binding 4e-08
cd06917277 cd06917, STKc_NAK1_like, Catalytic domain of Funga 4e-08
cd07835283 cd07835, STKc_CDK1_like, Catalytic domain of Cycli 4e-08
cd06618296 cd06618, PKc_MKK7, Catalytic domain of the dual-sp 6e-08
cd06616288 cd06616, PKc_MKK4, Catalytic domain of the dual-sp 7e-08
cd06619279 cd06619, PKc_MKK5, Catalytic domain of the dual-sp 8e-08
cd06611280 cd06611, STKc_SLK_like, Catalytic domain of Ste20- 9e-08
cd06643282 cd06643, STKc_SLK, Catalytic domain of the Protein 9e-08
cd07833288 cd07833, STKc_CDKL, Catalytic domain of Cyclin-Dep 9e-08
cd07860284 cd07860, STKc_CDK2_3, Catalytic domain of the Seri 1e-07
PLN00009294 PLN00009, PLN00009, cyclin-dependent kinase A; Pro 1e-07
cd06620284 cd06620, PKc_MAPKK_Byr1_like, Catalytic domain of 1e-07
cd06653264 cd06653, STKc_MEKK3_like_1, Catalytic domain of MA 2e-07
cd07840287 cd07840, STKc_CDK9_like, Catalytic domain of Cycli 2e-07
cd08219255 cd08219, STKc_Nek3, Catalytic domain of the Protei 2e-07
cd07834330 cd07834, STKc_MAPK, Catalytic domain of the Serine 2e-07
cd08223257 cd08223, STKc_Nek4, Catalytic domain of the Protei 7e-07
cd07876359 cd07876, STKc_JNK2, Catalytic domain of the Serine 9e-07
cd07856328 cd07856, STKc_Sty1_Hog1, Catalytic domain of the S 1e-06
cd08225257 cd08225, STKc_Nek5, Catalytic domain of the Protei 1e-06
PLN00034353 PLN00034, PLN00034, mitogen-activated protein kina 2e-06
smart00100120 smart00100, cNMP, Cyclic nucleotide-monophosphate 3e-06
COG0664214 COG0664, Crp, cAMP-binding proteins - catabolite g 3e-06
cd07848287 cd07848, STKc_CDKL5, Catalytic domain of the Serin 3e-06
cd06644292 cd06644, STKc_STK10_LOK, Catalytic domain of the P 3e-06
cd07847286 cd07847, STKc_CDKL1_4, Catalytic domain of the Ser 4e-06
cd05610 669 cd05610, STKc_MASTL, Catalytic domain of the Prote 6e-06
cd06641277 cd06641, STKc_MST3, Catalytic domain of the Protei 7e-06
cd07830283 cd07830, STKc_MAK_like, Catalytic domain of Male g 1e-05
cd06640277 cd06640, STKc_MST4, Catalytic domain of the Protei 1e-05
cd07852337 cd07852, STKc_MAPK15, Catalytic domain of the Seri 2e-05
TIGR03896317 TIGR03896, cyc_nuc_ocin, bacteriocin-type transpor 2e-05
cd06642277 cd06642, STKc_STK25-YSK1, Catalytic domain of the 2e-05
PRK13184 932 PRK13184, pknD, serine/threonine-protein kinase; R 2e-05
cd07873301 cd07873, STKc_PCTAIRE1, Catalytic domain of the Se 2e-05
cd07861285 cd07861, STKc_CDK1_euk, Catalytic domain of the Se 3e-05
cd06649331 cd06649, PKc_MEK2, Catalytic domain of the dual-sp 3e-05
cd07878343 cd07878, STKc_p38beta_MAPK11, Catalytic domain of 3e-05
cd07880343 cd07880, STKc_p38gamma_MAPK12, Catalytic domain of 4e-05
cd06650333 cd06650, PKc_MEK1, Catalytic domain of the dual-sp 4e-05
cd07871288 cd07871, STKc_PCTAIRE3, Catalytic domain of the Se 8e-05
TIGR03896317 TIGR03896, cyc_nuc_ocin, bacteriocin-type transpor 1e-04
cd07875364 cd07875, STKc_JNK1, Catalytic domain of the Serine 1e-04
cd08222260 cd08222, STKc_Nek11, Catalytic domain of the Prote 1e-04
cd07866311 cd07866, STKc_BUR1, Catalytic domain of the Serine 1e-04
cd07877345 cd07877, STKc_p38alpha_MAPK14, Catalytic domain of 1e-04
cd07874355 cd07874, STKc_JNK3, Catalytic domain of the Serine 1e-04
cd07872309 cd07872, STKc_PCTAIRE2, Catalytic domain of the Se 2e-04
cd07857332 cd07857, STKc_MPK1, Catalytic domain of the Serine 3e-04
cd07836284 cd07836, STKc_Pho85, Catalytic domain of the Serin 4e-04
cd07845309 cd07845, STKc_CDK10, Catalytic domain of the Serin 4e-04
cd06645267 cd06645, STKc_MAP4K3, Catalytic domain of the Prot 5e-04
cd06613262 cd06613, STKc_MAP4K3_like, Catalytic domain of Mit 7e-04
cd07851343 cd07851, STKc_p38, Catalytic domain of the Serine/ 7e-04
cd07858337 cd07858, STKc_TEY_MAPK_plant, Catalytic domain of 8e-04
cd07855334 cd07855, STKc_ERK5, Catalytic domain of the Serine 0.001
cd07869303 cd07869, STKc_PFTAIRE1, Catalytic domain of the Se 0.001
cd06637272 cd06637, STKc_TNIK, Catalytic domain of the Protei 0.001
cd07839284 cd07839, STKc_CDK5, Catalytic domain of the Serine 0.002
cd06615308 cd06615, PKc_MEK, Catalytic domain of the dual-spe 0.002
TIGR03903 1266 TIGR03903, TOMM_kin_cyc, TOMM system kinase/cyclas 0.002
>gnl|CDD|173671 cd05580, STKc_PKA, Catalytic domain of the Protein Serine/Threonine Kinase, cAMP-dependent protein kinase Back     alignment and domain information 
 Score =  224 bits (573), Expect = 3e-66
 Identities = 105/277 (37%), Positives = 153/277 (55%), Gaps = 11/277 (3%)

Query: 787  LVLLRDSENFLSLKRFSKQKVKCLGKEVQVLKEKNLMKSVSPSACVPQILCTCADSMHAG 846
            LV  + S  + +LK  SK K+  L +   VL EK +++S+     V  +  +  D  +  
Sbjct: 19   LVRHKGSGKYYALKILSKAKIVKLKQVEHVLNEKRILQSIRHPFLV-NLYGSFQDDSNLY 77

Query: 847  LLLNTYLACPLASILHTP--LDEQSARFCAASVVAALEDLHKRGVLYRGVSPDVLMLDKS 904
            L++       L S L       E  ARF AA VV ALE LH   ++YR + P+ L+LD  
Sbjct: 78   LVMEYVPGGELFSHLRKSGRFPEPVARFYAAQVVLALEYLHSLDIVYRDLKPENLLLDSD 137

Query: 905  GHLQLVDFRFGKGLSGNRTFTICGMADYLAPEIVQGKGHGLAADWWALGVLIYFMLQGEM 964
            G++++ DF F K + G RT+T+CG  +YLAPEI+  KG+G A DWWALG+LIY ML G  
Sbjct: 138  GYIKITDFGFAKRVKG-RTYTLCGTPEYLAPEIILSKGYGKAVDWWALGILIYEMLAGYP 196

Query: 965  PFGSWRESEIDIVAKIAKGQLSLPQNLSPEAVDLLTKLLVVDENTRLGS--QGPTSVKTH 1022
            PF  + ++ I I  KI +G++  P   SP+A DL+  LL VD   RLG+   G   +K H
Sbjct: 197  PF--FDDNPIQIYEKILEGKVRFPSFFSPDAKDLIRNLLQVDLTKRLGNLKNGVNDIKNH 254

Query: 1023 PWFRDVDWKGIAESTSPVPHEIMSRISQHLD-SHFED 1058
            PWF  +DW  + +     P   + ++    D S+F+D
Sbjct: 255  PWFAGIDWIALLQRKIEAP--FIPKVKGPGDTSNFDD 289

Serine/Threonine Kinases (STKs), cAMP-dependent protein kinase (PKA) subfamily, catalytic (c) subunit. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The PKA subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase (PI3K). This subfamily is composed of the cAMP-dependent proteins kinases, PKA and PRKX. The inactive PKA holoenzyme is a heterotetramer composed of two phosphorylated and active catalytic (C) subunits with a dimer of regulatory (R) subunits. Activation is achieved through the binding of the important second messenger cAMP to the R subunits, which leads to the dissociation of PKA into the R dimer and two active C subunits. PKA is present ubiquitously in cells and interacts with many different downstream targets. It plays a role in the regulation of diverse processes such as growth, development, memory, metabolism, gene expression, immunity, and lipolysis. Length = 290
>gnl|CDD|173663 cd05572, STKc_cGK_PKG, Catalytic domain of the Protein Serine/Threonine Kinase, cGMP-dependent protein kinase Back     alignment and domain information
>gnl|CDD|173660 cd05123, STKc_AGC, Catalytic domain of AGC family Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173703 cd05612, STKc_PRKX_like, Catalytic domain of PRKX-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|238083 cd00143, PP2Cc, Serine/threonine phosphatases, family 2C, catalytic domain; The protein architecture and deduced catalytic mechanism of PP2C phosphatases are similar to the PP1, PP2A, PP2B family of protein Ser/Thr phosphatases, with which PP2C shares no sequence similarity Back     alignment and domain information
>gnl|CDD|173670 cd05579, STKc_MAST_like, Catalytic domain of Microtubule-associated serine/threonine kinase-like proteins Back     alignment and domain information
>gnl|CDD|140289 PTZ00263, PTZ00263, protein kinase A catalytic subunit; Provisional Back     alignment and domain information
>gnl|CDD|214625 smart00332, PP2Cc, Serine/threonine phosphatases, family 2C, catalytic domain Back     alignment and domain information
>gnl|CDD|173665 cd05574, STKc_phototropin_like, Catalytic domain of Phototropin-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173675 cd05584, STKc_p70S6K, Catalytic domain of the Protein Serine/Threonine Kinase, 70 kDa ribosomal protein S6 kinase Back     alignment and domain information
>gnl|CDD|173702 cd05611, STKc_Rim15_like, Catalytic domain of fungal Rim15-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173661 cd05570, STKc_PKC, Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase C Back     alignment and domain information
>gnl|CDD|173674 cd05583, STKc_MSK_N, N-terminal catalytic domain of the Protein Serine/Threonine Kinase, Mitogen and stress-activated kinase Back     alignment and domain information
>gnl|CDD|173705 cd05614, STKc_MSK2_N, N-terminal catalytic domain of the Protein Serine/Threonine Kinase, Mitogen and stress-activated kinase 2 Back     alignment and domain information
>gnl|CDD|214567 smart00220, S_TKc, Serine/Threonine protein kinases, catalytic domain Back     alignment and domain information
>gnl|CDD|173672 cd05581, STKc_PDK1, Catalytic domain of the Protein Serine/Threonine Kinase, Phosphoinositide-dependent kinase 1 Back     alignment and domain information
>gnl|CDD|173673 cd05582, STKc_RSK_N, N-terminal catalytic domain of the Protein Serine/Threonine Kinase, 90 kDa ribosomal protein S6 kinase Back     alignment and domain information
>gnl|CDD|173662 cd05571, STKc_PKB, Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B Back     alignment and domain information
>gnl|CDD|173683 cd05592, STKc_nPKC_theta_delta, Catalytic domain of the Protein Serine/Threonine Kinases, Novel Protein Kinase C theta and delta Back     alignment and domain information
>gnl|CDD|173680 cd05589, STKc_PKN, Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase N Back     alignment and domain information
>gnl|CDD|173664 cd05573, STKc_ROCK_NDR_like, Catalytic domain of ROCK- and NDR kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173669 cd05578, STKc_Yank1, Catalytic domain of the Protein Serine/Threonine Kinase, Yank1 Back     alignment and domain information
>gnl|CDD|173682 cd05591, STKc_nPKC_epsilon, Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C epsilon Back     alignment and domain information
>gnl|CDD|173681 cd05590, STKc_nPKC_eta, Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C eta Back     alignment and domain information
>gnl|CDD|173676 cd05585, STKc_YPK1_like, Catalytic domain of Yeast Protein Kinase 1-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173616 PTZ00426, PTZ00426, cAMP-dependent protein kinase catalytic subunit; Provisional Back     alignment and domain information
>gnl|CDD|173704 cd05613, STKc_MSK1_N, N-terminal catalytic domain of the Protein Serine/Threonine Kinase, Mitogen and stress-activated kinase 1 Back     alignment and domain information
>gnl|CDD|173678 cd05587, STKc_cPKC, Catalytic domain of the Protein Serine/Threonine Kinase, Classical Protein Kinase C Back     alignment and domain information
>gnl|CDD|215690 pfam00069, Pkinase, Protein kinase domain Back     alignment and domain information
>gnl|CDD|173686 cd05595, STKc_PKB_beta, Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B beta Back     alignment and domain information
>gnl|CDD|173688 cd05597, STKc_DMPK_like, Catalytic domain of Myotonic Dystrophy protein kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173668 cd05577, STKc_GRK, Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase Back     alignment and domain information
>gnl|CDD|173690 cd05599, STKc_NDR_like, Catalytic domain of Nuclear Dbf2-Related kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173679 cd05588, STKc_aPKC, Catalytic domain of the Protein Serine/Threonine Kinase, Atypical Protein Kinase C Back     alignment and domain information
>gnl|CDD|173708 cd05617, STKc_aPKC_zeta, Catalytic domain of the Protein Serine/Threonine Kinase, Atypical Protein Kinase C zeta Back     alignment and domain information
>gnl|CDD|173706 cd05615, STKc_cPKC_alpha, Catalytic domain of the Protein Serine/Threonine Kinase, Classical Protein Kinase C alpha Back     alignment and domain information
>gnl|CDD|173709 cd05619, STKc_nPKC_theta, Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C theta Back     alignment and domain information
>gnl|CDD|173691 cd05600, STKc_Sid2p_Dbf2p, Catalytic domain of Fungal Sid2p- and Dbf2p-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173697 cd05606, STKc_beta_ARK, Catalytic domain of the Protein Serine/Threonine Kinase, beta-adrenergic receptor kinase Back     alignment and domain information
>gnl|CDD|173707 cd05616, STKc_cPKC_beta, Catalytic domain of the Protein Serine/Threonine Kinase, Classical Protein Kinase C beta Back     alignment and domain information
>gnl|CDD|88519 cd05618, STKc_aPKC_iota, Catalytic domain of the Protein Serine/Threonine Kinase, Atypical Protein Kinase C iota Back     alignment and domain information
>gnl|CDD|173687 cd05596, STKc_ROCK, Catalytic domain of the Protein Serine/Threonine Kinase, Rho-associated coiled-coil containing protein kinase Back     alignment and domain information
>gnl|CDD|215938 pfam00481, PP2C, Protein phosphatase 2C Back     alignment and domain information
>gnl|CDD|173711 cd05621, STKc_ROCK2, Catalytic domain of the Protein Serine/Threonine Kinase, Rho-associated coiled-coil containing protein kinase 2 Back     alignment and domain information
>gnl|CDD|173666 cd05575, STKc_SGK, Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase Back     alignment and domain information
>gnl|CDD|173700 cd05609, STKc_MAST, Catalytic domain of the Protein Serine/Threonine Kinase, Microtubule-associated serine/threonine kinase Back     alignment and domain information
>gnl|CDD|173696 cd05605, STKc_GRK4_like, Catalytic domain of G protein-coupled Receptor Kinase 4-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173685 cd05594, STKc_PKB_alpha, Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B alpha Back     alignment and domain information
>gnl|CDD|173692 cd05601, STKc_CRIK, Catalytic domain of the Protein Serine/Threonine Kinase, Citron Rho-interacting kinase Back     alignment and domain information
>gnl|CDD|173720 cd05631, STKc_GRK4, Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 4 Back     alignment and domain information
>gnl|CDD|173710 cd05620, STKc_nPKC_delta, Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C delta Back     alignment and domain information
>gnl|CDD|173684 cd05593, STKc_PKB_gamma, Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B gamma Back     alignment and domain information
>gnl|CDD|173712 cd05622, STKc_ROCK1, Catalytic domain of the Protein Serine/Threonine Kinase, Rho-associated coiled-coil containing protein kinase 1 Back     alignment and domain information
>gnl|CDD|173677 cd05586, STKc_Sck1_like, Catalytic domain of Suppressor of loss of cAMP-dependent protein kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173722 cd05633, STKc_GRK3, Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 3 Back     alignment and domain information
>gnl|CDD|173721 cd05632, STKc_GRK5, Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 5 Back     alignment and domain information
>gnl|CDD|223704 COG0631, PTC1, Serine/threonine protein phosphatase [Signal transduction mechanisms] Back     alignment and domain information
>gnl|CDD|173719 cd05630, STKc_GRK6, Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 6 Back     alignment and domain information
>gnl|CDD|88524 cd05623, STKc_MRCK_alpha, Catalytic domain of the Protein Serine/Threonine Kinase, DMPK-related cell division control protein 42 binding kinase alpha Back     alignment and domain information
>gnl|CDD|173713 cd05624, STKc_MRCK_beta, Catalytic domain of the Protein Serine/Threonine Kinase, DMPK-related cell division control protein 42 binding kinase beta Back     alignment and domain information
>gnl|CDD|173693 cd05602, STKc_SGK1, Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase 1 Back     alignment and domain information
>gnl|CDD|173718 cd05629, STKc_NDR_like_fungal, Catalytic domain of Fungal Nuclear Dbf2-Related kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173716 cd05627, STKc_NDR2, Catalytic domain of the Protein Serine/Threonine Kinase, Nuclear Dbf2-Related kinase 2 Back     alignment and domain information
>gnl|CDD|173715 cd05626, STKc_LATS2, Catalytic domain of the Protein Serine/Threonine Kinase, Large Tumor Suppressor 2 Back     alignment and domain information
>gnl|CDD|173689 cd05598, STKc_LATS, Catalytic domain of the Protein Serine/Threonine Kinase, Large Tumor Suppressor Back     alignment and domain information
>gnl|CDD|173694 cd05603, STKc_SGK2, Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase 2 Back     alignment and domain information
>gnl|CDD|173695 cd05604, STKc_SGK3, Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase 3 Back     alignment and domain information
>gnl|CDD|173724 cd06606, STKc_MAPKKK, Catalytic domain of the Protein Serine/Threonine Kinase, Mitogen-Activated Protein Kinase Kinase Kinase Back     alignment and domain information
>gnl|CDD|173717 cd05628, STKc_NDR1, Catalytic domain of the Protein Serine/Threonine Kinase, Nuclear Dbf2-Related kinase 1 Back     alignment and domain information
>gnl|CDD|173714 cd05625, STKc_LATS1, Catalytic domain of the Protein Serine/Threonine Kinase, Large Tumor Suppressor 1 Back     alignment and domain information
>gnl|CDD|223589 COG0515, SPS1, Serine/threonine protein kinase [General function prediction only / Signal transduction mechanisms / Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|215603 PLN03145, PLN03145, Protein phosphatase 2c; Provisional Back     alignment and domain information
>gnl|CDD|173699 cd05608, STKc_GRK1, Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 1 Back     alignment and domain information
>gnl|CDD|173755 cd08215, STKc_Nek, Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase Back     alignment and domain information
>gnl|CDD|237999 cd00038, CAP_ED, effector domain of the CAP family of transcription factors; members include CAP (or cAMP receptor protein (CRP)), which binds cAMP, FNR (fumarate and nitrate reduction), which uses an iron-sulfur cluster to sense oxygen) and CooA, a heme containing CO sensor Back     alignment and domain information
>gnl|CDD|132957 cd06626, STKc_MEKK4, Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 4 Back     alignment and domain information
>gnl|CDD|173659 cd05122, PKc_STE, Catalytic domain of STE family Protein Kinases Back     alignment and domain information
>gnl|CDD|173623 cd00180, PKc, Catalytic domain of Protein Kinases Back     alignment and domain information
>gnl|CDD|173698 cd05607, STKc_GRK7, Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 7 Back     alignment and domain information
>gnl|CDD|197516 smart00100, cNMP, Cyclic nucleotide-monophosphate binding domain Back     alignment and domain information
>gnl|CDD|173667 cd05576, STKc_RPK118_like, Catalytic domain of the Protein Serine/Threonine Kinases, RPK118 and similar proteins Back     alignment and domain information
>gnl|CDD|215664 pfam00027, cNMP_binding, Cyclic nucleotide-binding domain Back     alignment and domain information
>gnl|CDD|173771 cd08529, STKc_FA2-like, Catalytic domain of the Protein Serine/Threonine Kinase, Chlamydomonas reinhardtii FA2 and similar domains Back     alignment and domain information
>gnl|CDD|173728 cd06614, STKc_PAK, Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase Back     alignment and domain information
>gnl|CDD|173701 cd05610, STKc_MASTL, Catalytic domain of the Protein Serine/Threonine Kinase, Microtubule-associated serine/threonine-like kinase Back     alignment and domain information
>gnl|CDD|132956 cd06625, STKc_MEKK3_like, Catalytic domain of MAP/ERK kinase kinase 3-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|132979 cd06648, STKc_PAK_II, Catalytic domain of the Protein Serine/Threonine Kinase, Group II p21-activated kinase Back     alignment and domain information
>gnl|CDD|173723 cd06605, PKc_MAPKK, Catalytic domain of the dual-specificity Protein Kinase, Mitogen-Activated Protein Kinase Kinase Back     alignment and domain information
>gnl|CDD|132978 cd06647, STKc_PAK_I, Catalytic domain of the Protein Serine/Threonine Kinase, Group I p21-activated kinase Back     alignment and domain information
>gnl|CDD|173736 cd07832, STKc_CCRK, Catalytic domain of the Serine/Threonine Kinase, Cell Cycle-Related Kinase Back     alignment and domain information
>gnl|CDD|132986 cd06655, STKc_PAK2, Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 2 Back     alignment and domain information
>gnl|CDD|132988 cd06657, STKc_PAK4, Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 4 Back     alignment and domain information
>gnl|CDD|132963 cd06632, STKc_MEKK1_plant, Catalytic domain of the Protein Serine/Threonine Kinase, Plant MAP/ERK kinase kinase 1 Back     alignment and domain information
>gnl|CDD|132960 cd06629, STKc_MAPKKK_Bck1_like, Catalytic domain of fungal Bck1-like MAP Kinase Kinase Kinases Back     alignment and domain information
>gnl|CDD|173733 cd07829, STKc_CDK_like, Catalytic domain of Cyclin-Dependent protein Kinase-like Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173772 cd08530, STKc_CNK2-like, Catalytic domain of the Protein Serine/Threonine Kinase, Chlamydomonas reinhardtii CNK2, and similar domains Back     alignment and domain information
>gnl|CDD|240344 PTZ00283, PTZ00283, serine/threonine protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|132989 cd06658, STKc_PAK5, Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 5 Back     alignment and domain information
>gnl|CDD|132990 cd06659, STKc_PAK6, Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 6 Back     alignment and domain information
>gnl|CDD|132952 cd06621, PKc_MAPKK_Pek1_like, Catalytic domain of fungal Pek1-like dual-specificity MAP kinase kinases Back     alignment and domain information
>gnl|CDD|132987 cd06656, STKc_PAK3, Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 3 Back     alignment and domain information
>gnl|CDD|237999 cd00038, CAP_ED, effector domain of the CAP family of transcription factors; members include CAP (or cAMP receptor protein (CRP)), which binds cAMP, FNR (fumarate and nitrate reduction), which uses an iron-sulfur cluster to sense oxygen) and CooA, a heme containing CO sensor Back     alignment and domain information
>gnl|CDD|143342 cd07837, STKc_CdkB_plant, Catalytic domain of the Serine/Threonine Kinase, Plant B-type Cyclin-Dependent protein Kinase Back     alignment and domain information
>gnl|CDD|173735 cd07831, STKc_MOK, Catalytic domain of the Serine/Threonine Kinase, MAPK/MAK/MRK Overlapping Kinase Back     alignment and domain information
>gnl|CDD|173731 cd06627, STKc_Cdc7_like, Catalytic domain of Cell division control protein 7-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173732 cd06628, STKc_MAPKKK_Byr2_like, Catalytic domain of fungal Byr2-like MAP Kinase Kinase Kinases Back     alignment and domain information
>gnl|CDD|132962 cd06631, STKc_YSK4, Catalytic domain of the Protein Serine/Threonine Kinase, Yeast Sps1/Ste20-related kinase 4 Back     alignment and domain information
>gnl|CDD|132954 cd06623, PKc_MAPKK_plant_like, Catalytic domain of Plant dual-specificity MAP kinase kinases and similar proteins Back     alignment and domain information
>gnl|CDD|223736 COG0664, Crp, cAMP-binding proteins - catabolite gene activator and regulatory subunit of cAMP-dependent protein kinases [Signal transduction mechanisms] Back     alignment and domain information
>gnl|CDD|223069 PHA03390, pk1, serine/threonine-protein kinase 1; Provisional Back     alignment and domain information
>gnl|CDD|132961 cd06630, STKc_MEKK1, Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 1 Back     alignment and domain information
>gnl|CDD|132985 cd06654, STKc_PAK1, Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 1 Back     alignment and domain information
>gnl|CDD|140293 PTZ00267, PTZ00267, NIMA-related protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|173764 cd08224, STKc_Nek6_Nek7, Catalytic domain of the Protein Serine/Threonine Kinases, Never In Mitosis gene A-related kinase 6 and 7 Back     alignment and domain information
>gnl|CDD|173760 cd08220, STKc_Nek8, Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 8 Back     alignment and domain information
>gnl|CDD|173729 cd06617, PKc_MKK3_6, Catalytic domain of the dual-specificity Protein Kinases, MAP kinase kinases 3 and 6 Back     alignment and domain information
>gnl|CDD|173730 cd06624, STKc_ASK, Catalytic domain of the Protein Serine/Threonine Kinase, Apoptosis signal-regulating kinase Back     alignment and domain information
>gnl|CDD|240318 PTZ00224, PTZ00224, protein phosphatase 2C; Provisional Back     alignment and domain information
>gnl|CDD|132953 cd06622, PKc_MAPKK_PBS2_like, Catalytic domain of fungal PBS2-like dual-specificity MAP kinase kinases Back     alignment and domain information
>gnl|CDD|143384 cd07879, STKc_p38delta_MAPK13, Catalytic domain of the Serine/Threonine Kinase, p38delta Mitogen-Activated Protein Kinase Back     alignment and domain information
>gnl|CDD|132982 cd06651, STKc_MEKK3, Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 3 Back     alignment and domain information
>gnl|CDD|173770 cd08528, STKc_Nek10, Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 10 Back     alignment and domain information
>gnl|CDD|143333 cd05118, STKc_CMGC, Catalytic domain of CMGC family Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173743 cd07846, STKc_CDKL2_3, Catalytic domain of the Serine/Threonine Kinases, Cyclin-Dependent protein Kinase Like 2 and 3 Back     alignment and domain information
>gnl|CDD|132940 cd06609, STKc_MST3_like, Catalytic domain of Mammalian Ste20-like protein kinase 3-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173757 cd08217, STKc_Nek2, Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 2 Back     alignment and domain information
>gnl|CDD|132943 cd06612, STKc_MST1_2, Catalytic domain of the Protein Serine/Threonine Kinases, Mammalian Ste20-like protein kinase 1 and 2 Back     alignment and domain information
>gnl|CDD|173769 cd08229, STKc_Nek7, Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 7 Back     alignment and domain information
>gnl|CDD|173768 cd08228, STKc_Nek6, Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 6 Back     alignment and domain information
>gnl|CDD|143346 cd07841, STKc_CDK7, Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 7 Back     alignment and domain information
>gnl|CDD|173758 cd08218, STKc_Nek1, Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 1 Back     alignment and domain information
>gnl|CDD|132983 cd06652, STKc_MEKK2, Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 2 Back     alignment and domain information
>gnl|CDD|173761 cd08221, STKc_Nek9, Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 9 Back     alignment and domain information
>gnl|CDD|173726 cd06610, STKc_OSR1_SPAK, Catalytic domain of the Protein Serine/Threonine Kinases, Oxidative stress response kinase and Ste20-related proline alanine-rich kinase Back     alignment and domain information
>gnl|CDD|215664 pfam00027, cNMP_binding, Cyclic nucleotide-binding domain Back     alignment and domain information
>gnl|CDD|132991 cd06917, STKc_NAK1_like, Catalytic domain of Fungal Nak1-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173738 cd07835, STKc_CDK1_like, Catalytic domain of Cyclin-Dependent protein Kinase 1-like Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|132949 cd06618, PKc_MKK7, Catalytic domain of the dual-specificity Protein Kinase, MAP kinase kinase 7 Back     alignment and domain information
>gnl|CDD|132947 cd06616, PKc_MKK4, Catalytic domain of the dual-specificity Protein Kinase, MAP kinase kinase 4 Back     alignment and domain information
>gnl|CDD|132950 cd06619, PKc_MKK5, Catalytic domain of the dual-specificity Protein Kinase, MAP kinase kinase 5 Back     alignment and domain information
>gnl|CDD|132942 cd06611, STKc_SLK_like, Catalytic domain of Ste20-like kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|132974 cd06643, STKc_SLK, Catalytic domain of the Protein Serine/Threonine Kinase, Ste20-like kinase Back     alignment and domain information
>gnl|CDD|143338 cd07833, STKc_CDKL, Catalytic domain of Cyclin-Dependent protein Kinase Like Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173751 cd07860, STKc_CDK2_3, Catalytic domain of the Serine/Threonine Kinases, Cyclin-Dependent protein Kinase 2 and 3 Back     alignment and domain information
>gnl|CDD|177649 PLN00009, PLN00009, cyclin-dependent kinase A; Provisional Back     alignment and domain information
>gnl|CDD|132951 cd06620, PKc_MAPKK_Byr1_like, Catalytic domain of fungal Byr1-like dual-specificity MAP kinase kinases Back     alignment and domain information
>gnl|CDD|132984 cd06653, STKc_MEKK3_like_1, Catalytic domain of MAP/ERK kinase kinase 3-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|143345 cd07840, STKc_CDK9_like, Catalytic domain of Cyclin-Dependent protein Kinase 9-like Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173759 cd08219, STKc_Nek3, Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 3 Back     alignment and domain information
>gnl|CDD|173737 cd07834, STKc_MAPK, Catalytic domain of the Serine/Threonine Kinase, Mitogen-Activated Protein Kinase Back     alignment and domain information
>gnl|CDD|173763 cd08223, STKc_Nek4, Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 4 Back     alignment and domain information
>gnl|CDD|143381 cd07876, STKc_JNK2, Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase 2 Back     alignment and domain information
>gnl|CDD|143361 cd07856, STKc_Sty1_Hog1, Catalytic domain of the Serine/Threonine Kinases, Fungal Mitogen-Activated Protein Kinases Sty1 and Hog1 Back     alignment and domain information
>gnl|CDD|173765 cd08225, STKc_Nek5, Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 5 Back     alignment and domain information
>gnl|CDD|215036 PLN00034, PLN00034, mitogen-activated protein kinase kinase; Provisional Back     alignment and domain information
>gnl|CDD|197516 smart00100, cNMP, Cyclic nucleotide-monophosphate binding domain Back     alignment and domain information
>gnl|CDD|223736 COG0664, Crp, cAMP-binding proteins - catabolite gene activator and regulatory subunit of cAMP-dependent protein kinases [Signal transduction mechanisms] Back     alignment and domain information
>gnl|CDD|173745 cd07848, STKc_CDKL5, Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase Like 5 Back     alignment and domain information
>gnl|CDD|132975 cd06644, STKc_STK10_LOK, Catalytic domain of the Protein Serine/Threonine Kinase, STK10 or Lymphocyte-oriented kinase Back     alignment and domain information
>gnl|CDD|173744 cd07847, STKc_CDKL1_4, Catalytic domain of the Serine/Threonine Kinases, Cyclin-Dependent protein Kinase Like 1 and 4 Back     alignment and domain information
>gnl|CDD|173701 cd05610, STKc_MASTL, Catalytic domain of the Protein Serine/Threonine Kinase, Microtubule-associated serine/threonine-like kinase Back     alignment and domain information
>gnl|CDD|132972 cd06641, STKc_MST3, Catalytic domain of the Protein Serine/Threonine Kinase, Mammalian Ste20-like protein kinase 3 Back     alignment and domain information
>gnl|CDD|173734 cd07830, STKc_MAK_like, Catalytic domain of Male germ cell-Associated Kinase-like Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|132971 cd06640, STKc_MST4, Catalytic domain of the Protein Serine/Threonine Kinase, Mammalian Ste20-like protein kinase 4 Back     alignment and domain information
>gnl|CDD|173747 cd07852, STKc_MAPK15, Catalytic domain of the Serine/Threonine Kinase, Mitogen-Activated Protein Kinase 15 Back     alignment and domain information
>gnl|CDD|234384 TIGR03896, cyc_nuc_ocin, bacteriocin-type transport-associated protein Back     alignment and domain information
>gnl|CDD|132973 cd06642, STKc_STK25-YSK1, Catalytic domain of the Protein Serine/Threonine Kinase, STK25 or Yeast Sps1/Ste20-related kinase 1 Back     alignment and domain information
>gnl|CDD|183880 PRK13184, pknD, serine/threonine-protein kinase; Reviewed Back     alignment and domain information
>gnl|CDD|143378 cd07873, STKc_PCTAIRE1, Catalytic domain of the Serine/Threonine Kinase, PCTAIRE-1 kinase Back     alignment and domain information
>gnl|CDD|173752 cd07861, STKc_CDK1_euk, Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 1 from higher eukaryotes-like Back     alignment and domain information
>gnl|CDD|132980 cd06649, PKc_MEK2, Catalytic domain of the dual-specificity Protein Kinase, MAP/ERK Kinase 2 Back     alignment and domain information
>gnl|CDD|143383 cd07878, STKc_p38beta_MAPK11, Catalytic domain of the Serine/Threonine Kinase, p38beta Mitogen-Activated Protein Kinase Back     alignment and domain information
>gnl|CDD|143385 cd07880, STKc_p38gamma_MAPK12, Catalytic domain of the Serine/Threonine Kinase, p38gamma Mitogen-Activated Protein Kinase Back     alignment and domain information
>gnl|CDD|132981 cd06650, PKc_MEK1, Catalytic domain of the dual-specificity Protein Kinase, MAP/ERK Kinase 1 Back     alignment and domain information
>gnl|CDD|143376 cd07871, STKc_PCTAIRE3, Catalytic domain of the Serine/Threonine Kinase, PCTAIRE-3 kinase Back     alignment and domain information
>gnl|CDD|234384 TIGR03896, cyc_nuc_ocin, bacteriocin-type transport-associated protein Back     alignment and domain information
>gnl|CDD|143380 cd07875, STKc_JNK1, Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase 1 Back     alignment and domain information
>gnl|CDD|173762 cd08222, STKc_Nek11, Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 11 Back     alignment and domain information
>gnl|CDD|143371 cd07866, STKc_BUR1, Catalytic domain of the Serine/Threonine Kinase, Fungal Cyclin-Dependent protein Kinase Bypass UAS Requirement 1 and similar proteins Back     alignment and domain information
>gnl|CDD|143382 cd07877, STKc_p38alpha_MAPK14, Catalytic domain of the Serine/Threonine Kinase, p38alpha Mitogen-Activated Protein Kinase Back     alignment and domain information
>gnl|CDD|143379 cd07874, STKc_JNK3, Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase 3 Back     alignment and domain information
>gnl|CDD|143377 cd07872, STKc_PCTAIRE2, Catalytic domain of the Serine/Threonine Kinase, PCTAIRE-2 kinase Back     alignment and domain information
>gnl|CDD|173750 cd07857, STKc_MPK1, Catalytic domain of the Serine/Threonine Kinase, Fungal Mitogen-Activated Protein Kinase MPK1 Back     alignment and domain information
>gnl|CDD|143341 cd07836, STKc_Pho85, Catalytic domain of the Serine/Threonine Kinase, Fungal Cyclin-Dependent protein Kinase Pho85 Back     alignment and domain information
>gnl|CDD|173742 cd07845, STKc_CDK10, Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 10 Back     alignment and domain information
>gnl|CDD|132976 cd06645, STKc_MAP4K3, Catalytic domain of the Protein Serine/Threonine Kinase, Mitogen-activated protein kinase kinase kinase kinase 3 Back     alignment and domain information
>gnl|CDD|173727 cd06613, STKc_MAP4K3_like, Catalytic domain of Mitogen-activated protein kinase kinase kinase kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|143356 cd07851, STKc_p38, Catalytic domain of the Serine/Threonine Kinase, p38 Mitogen-Activated Protein Kinase Back     alignment and domain information
>gnl|CDD|143363 cd07858, STKc_TEY_MAPK_plant, Catalytic domain of the Serine/Threonine Kinases, TEY Mitogen-Activated Protein Kinases from Plants Back     alignment and domain information
>gnl|CDD|173749 cd07855, STKc_ERK5, Catalytic domain of the Serine/Threonine Kinase, Extracellular signal-Regulated Kinase 5 Back     alignment and domain information
>gnl|CDD|143374 cd07869, STKc_PFTAIRE1, Catalytic domain of the Serine/Threonine Kinase, PFTAIRE-1 kinase Back     alignment and domain information
>gnl|CDD|132968 cd06637, STKc_TNIK, Catalytic domain of the Protein Serine/Threonine Kinase, Traf2- and Nck-interacting kinase Back     alignment and domain information
>gnl|CDD|143344 cd07839, STKc_CDK5, Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 5 Back     alignment and domain information
>gnl|CDD|132946 cd06615, PKc_MEK, Catalytic domain of the dual-specificity Protein Kinase, MAP/ERK Kinase Back     alignment and domain information
>gnl|CDD|234389 TIGR03903, TOMM_kin_cyc, TOMM system kinase/cyclase fusion protein Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 1082
KOG0614732 consensus cGMP-dependent protein kinase [Signal tr 100.0
KOG0616355 consensus cAMP-dependent protein kinase catalytic 100.0
KOG0598357 consensus Ribosomal protein S6 kinase and related 100.0
KOG0605550 consensus NDR and related serine/threonine kinases 100.0
KOG0694694 consensus Serine/threonine protein kinase [Signal 100.0
KOG0592 604 consensus 3-phosphoinositide-dependent protein kin 100.0
KOG0697379 consensus Protein phosphatase 1B (formerly 2C) [Si 100.0
KOG0615475 consensus Serine/threonine protein kinase Chk2 and 100.0
KOG0610459 consensus Putative serine/threonine protein kinase 100.0
KOG0690516 consensus Serine/threonine protein kinase [Signal 100.0
KOG0575 592 consensus Polo-like serine/threonine protein kinas 100.0
KOG0696683 consensus Serine/threonine protein kinase [Signal 100.0
KOG0581364 consensus Mitogen-activated protein kinase kinase 100.0
KOG0612 1317 consensus Rho-associated, coiled-coil containing p 100.0
PLN03145365 Protein phosphatase 2c; Provisional 100.0
KOG0588 786 consensus Serine/threonine protein kinase [Cell cy 100.0
KOG0986591 consensus G protein-coupled receptor kinase [Signa 100.0
KOG0695593 consensus Serine/threonine protein kinase [Signal 100.0
KOG0583370 consensus Serine/threonine protein kinase [Signal 100.0
KOG0698330 consensus Serine/threonine protein phosphatase [Si 100.0
KOG0595 429 consensus Serine/threonine-protein kinase involved 100.0
KOG0580281 consensus Serine/threonine protein kinase [Cell cy 100.0
KOG0593396 consensus Predicted protein kinase KKIAMRE [Genera 100.0
KOG06081034 consensus Warts/lats-like serine threonine kinases 100.0
PTZ00263329 protein kinase A catalytic subunit; Provisional 100.0
PTZ00426340 cAMP-dependent protein kinase catalytic subunit; P 100.0
cd05587324 STKc_cPKC Catalytic domain of the Protein Serine/T 100.0
cd05628363 STKc_NDR1 Catalytic domain of the Protein Serine/T 100.0
cd05616323 STKc_cPKC_beta Catalytic domain of the Protein Ser 100.0
KOG0591375 consensus NIMA (never in mitosis)-related G2-speci 100.0
cd05627360 STKc_NDR2 Catalytic domain of the Protein Serine/T 100.0
cd05571323 STKc_PKB Catalytic domain of the Protein Serine/Th 100.0
cd05615323 STKc_cPKC_alpha Catalytic domain of the Protein Se 100.0
KOG0597 808 consensus Serine-threonine protein kinase FUSED [G 100.0
cd05612291 STKc_PRKX_like Catalytic domain of PRKX-like Prote 100.0
cd05585312 STKc_YPK1_like Catalytic domain of Yeast Protein K 100.0
KOG0585 576 consensus Ca2+/calmodulin-dependent protein kinase 100.0
cd05590320 STKc_nPKC_eta Catalytic domain of the Protein Seri 100.0
cd05625382 STKc_LATS1 Catalytic domain of the Protein Serine/ 100.0
KOG0033355 consensus Ca2+/calmodulin-dependent protein kinase 100.0
KOG0611 668 consensus Predicted serine/threonine protein kinas 100.0
cd05589324 STKc_PKN Catalytic domain of the Protein Serine/Th 100.0
PTZ00224381 protein phosphatase 2C; Provisional 100.0
cd05591321 STKc_nPKC_epsilon Catalytic domain of the Protein 100.0
KOG0661 538 consensus MAPK related serine/threonine protein ki 100.0
cd05599364 STKc_NDR_like Catalytic domain of Nuclear Dbf2-Rel 100.0
cd05631285 STKc_GRK4 Catalytic domain of the Protein Serine/T 100.0
cd05617327 STKc_aPKC_zeta Catalytic domain of the Protein Ser 100.0
cd05588329 STKc_aPKC Catalytic domain of the Protein Serine/T 100.0
KOG0198313 consensus MEKK and related serine/threonine protei 100.0
cd05618329 STKc_aPKC_iota Catalytic domain of the Protein Ser 100.0
cd05620316 STKc_nPKC_delta Catalytic domain of the Protein Se 100.0
cd05592316 STKc_nPKC_theta_delta Catalytic domain of the Prot 100.0
cd05570318 STKc_PKC Catalytic domain of the Protein Serine/Th 100.0
cd05614332 STKc_MSK2_N N-terminal catalytic domain of the Pro 100.0
cd05629377 STKc_NDR_like_fungal Catalytic domain of Fungal Nu 100.0
cd05593328 STKc_PKB_gamma Catalytic domain of the Protein Ser 100.0
cd05595323 STKc_PKB_beta Catalytic domain of the Protein Seri 100.0
cd05575323 STKc_SGK Catalytic domain of the Protein Serine/Th 100.0
KOG0659318 consensus Cdk activating kinase (CAK)/RNA polymera 100.0
KOG0578550 consensus p21-activated serine/threonine protein k 100.0
cd05619316 STKc_nPKC_theta Catalytic domain of the Protein Se 100.0
KOG0600560 consensus Cdc2-related protein kinase [Cell cycle 100.0
cd05582318 STKc_RSK_N N-terminal catalytic domain of the Prot 100.0
KOG0599411 consensus Phosphorylase kinase gamma subunit [Carb 100.0
cd05626381 STKc_LATS2 Catalytic domain of the Protein Serine/ 100.0
cd05604325 STKc_SGK3 Catalytic domain of the Protein Serine/T 100.0
cd05602325 STKc_SGK1 Catalytic domain of the Protein Serine/T 100.0
KOG0663419 consensus Protein kinase PITSLRE and related kinas 100.0
cd05573350 STKc_ROCK_NDR_like Catalytic domain of ROCK- and N 100.0
cd05596370 STKc_ROCK Catalytic domain of the Protein Serine/T 100.0
cd05594325 STKc_PKB_alpha Catalytic domain of the Protein Ser 100.0
cd05586330 STKc_Sck1_like Catalytic domain of Suppressor of l 100.0
cd05600333 STKc_Sid2p_Dbf2p Catalytic domain of Fungal Sid2p- 100.0
KOG0032382 consensus Ca2+/calmodulin-dependent protein kinase 100.0
cd05598376 STKc_LATS Catalytic domain of the Protein Serine/T 100.0
cd05603321 STKc_SGK2 Catalytic domain of the Protein Serine/T 100.0
cd05584323 STKc_p70S6K Catalytic domain of the Protein Serine 100.0
PF00481254 PP2C: Protein phosphatase 2C; InterPro: IPR001932 100.0
cd05622371 STKc_ROCK1 Catalytic domain of the Protein Serine/ 100.0
cd05621370 STKc_ROCK2 Catalytic domain of the Protein Serine/ 100.0
cd05608280 STKc_GRK1 Catalytic domain of the Protein Serine/T 100.0
KOG0582 516 consensus Ste20-like serine/threonine protein kina 100.0
cd05601330 STKc_CRIK Catalytic domain of the Protein Serine/T 100.0
KOG0607463 consensus MAP kinase-interacting kinase and relate 100.0
KOG4717 864 consensus Serine/threonine protein kinase [Signal 100.0
cd05605285 STKc_GRK4_like Catalytic domain of G protein-coupl 100.0
cd05624331 STKc_MRCK_beta Catalytic domain of the Protein Ser 100.0
cd05597331 STKc_DMPK_like Catalytic domain of Myotonic Dystro 100.0
cd05623332 STKc_MRCK_alpha Catalytic domain of the Protein Se 100.0
KOG0660359 consensus Mitogen-activated protein kinase [Signal 100.0
cd05580290 STKc_PKA Catalytic domain of the Protein Serine/Th 100.0
cd05607277 STKc_GRK7 Catalytic domain of the Protein Serine/T 100.0
KOG0699542 consensus Serine/threonine protein phosphatase [Si 100.0
COG0631262 PTC1 Serine/threonine protein phosphatase [Signal 100.0
KOG0604400 consensus MAP kinase-activated protein kinase 2 [S 100.0
KOG0667586 consensus Dual-specificity tyrosine-phosphorylatio 100.0
cd05630285 STKc_GRK6 Catalytic domain of the Protein Serine/T 100.0
KOG0201 467 consensus Serine/threonine protein kinase [Signal 100.0
KOG0594323 consensus Protein kinase PCTAIRE and related kinas 100.0
cd07848287 STKc_CDKL5 Catalytic domain of the Serine/Threonin 100.0
KOG0658364 consensus Glycogen synthase kinase-3 [Carbohydrate 100.0
cd07871288 STKc_PCTAIRE3 Catalytic domain of the Serine/Threo 100.0
cd05632285 STKc_GRK5 Catalytic domain of the Protein Serine/T 100.0
cd07869303 STKc_PFTAIRE1 Catalytic domain of the Serine/Threo 100.0
KOG0579 1187 consensus Ste20-like serine/threonine protein kina 100.0
cd06649331 PKc_MEK2 Catalytic domain of the dual-specificity 100.0
cd05574316 STKc_phototropin_like Catalytic domain of Phototro 100.0
KOG0192362 consensus Tyrosine kinase specific for activated ( 100.0
KOG0589 426 consensus Serine/threonine protein kinase [General 100.0
KOG0700390 consensus Protein phosphatase 2C/pyruvate dehydrog 100.0
cd07862290 STKc_CDK6 Catalytic domain of the Serine/Threonine 100.0
cd05633279 STKc_GRK3 Catalytic domain of the Protein Serine/T 100.0
cd07859338 STKc_TDY_MAPK_plant Catalytic domain of the Serine 100.0
KOG4279 1226 consensus Serine/threonine protein kinase [Signal 100.0
KOG4236888 consensus Serine/threonine protein kinase PKC mu/P 100.0
PTZ00036440 glycogen synthase kinase; Provisional 100.0
PHA03212391 serine/threonine kinase US3; Provisional 100.0
cd07876359 STKc_JNK2 Catalytic domain of the Serine/Threonine 100.0
KOG0586 596 consensus Serine/threonine protein kinase [General 100.0
PLN00034353 mitogen-activated protein kinase kinase; Provision 100.0
cd05611260 STKc_Rim15_like Catalytic domain of fungal Rim15-l 100.0
cd05606278 STKc_beta_ARK Catalytic domain of the Protein Seri 100.0
cd05572262 STKc_cGK_PKG Catalytic domain of the Protein Serin 100.0
KOG1113368 consensus cAMP-dependent protein kinase types I an 100.0
KOG0983391 consensus Mitogen-activated protein kinase (MAPK) 100.0
cd07875364 STKc_JNK1 Catalytic domain of the Serine/Threonine 100.0
cd05609305 STKc_MAST Catalytic domain of the Protein Serine/T 100.0
cd06650333 PKc_MEK1 Catalytic domain of the dual-specificity 100.0
cd05577277 STKc_GRK Catalytic domain of the Protein Serine/Th 100.0
PTZ00283 496 serine/threonine protein kinase; Provisional 100.0
PTZ00284467 protein kinase; Provisional 100.0
cd07863288 STKc_CDK4 Catalytic domain of the Serine/Threonine 100.0
cd05583288 STKc_MSK_N N-terminal catalytic domain of the Prot 100.0
cd07872309 STKc_PCTAIRE2 Catalytic domain of the Serine/Threo 100.0
cd07874355 STKc_JNK3 Catalytic domain of the Serine/Threonine 100.0
cd05579265 STKc_MAST_like Catalytic domain of Microtubule-ass 100.0
cd07853372 STKc_NLK Catalytic domain of the Serine/Threonine 100.0
cd05613290 STKc_MSK1_N N-terminal catalytic domain of the Pro 100.0
PTZ00267478 NIMA-related protein kinase; Provisional 100.0
KOG0596677 consensus Dual specificity; serine/threonine and t 100.0
cd07878343 STKc_p38beta_MAPK11 Catalytic domain of the Serine 100.0
cd05102338 PTKc_VEGFR3 Catalytic domain of the Protein Tyrosi 100.0
cd05578258 STKc_Yank1 Catalytic domain of the Protein Serine/ 100.0
cd06619279 PKc_MKK5 Catalytic domain of the dual-specificity 100.0
cd06625263 STKc_MEKK3_like Catalytic domain of MAP/ERK kinase 100.0
KOG0197468 consensus Tyrosine kinases [Signal transduction me 100.0
KOG0574 502 consensus STE20-like serine/threonine kinase MST [ 100.0
PF00069260 Pkinase: Protein kinase domain Protein kinase; unc 100.0
cd07873301 STKc_PCTAIRE1 Catalytic domain of the Serine/Threo 100.0
PHA03207392 serine/threonine kinase US3; Provisional 100.0
PTZ00266 1021 NIMA-related protein kinase; Provisional 100.0
cd06615308 PKc_MEK Catalytic domain of the dual-specificity P 100.0
cd08223257 STKc_Nek4 Catalytic domain of the Protein Serine/T 100.0
KOG0603612 consensus Ribosomal protein S6 kinase [Signal tran 100.0
cd06617283 PKc_MKK3_6 Catalytic domain of the dual-specificit 100.0
PHA03209357 serine/threonine kinase US3; Provisional 100.0
cd08529256 STKc_FA2-like Catalytic domain of the Protein Seri 100.0
cd05581280 STKc_PDK1 Catalytic domain of the Protein Serine/T 100.0
cd06637272 STKc_TNIK Catalytic domain of the Protein Serine/T 100.0
cd06644292 STKc_STK10_LOK Catalytic domain of the Protein Ser 100.0
cd06622286 PKc_MAPKK_PBS2_like Catalytic domain of fungal PBS 100.0
PHA03211461 serine/threonine kinase US3; Provisional 100.0
KOG0577 948 consensus Serine/threonine protein kinase [Signal 100.0
cd06611280 STKc_SLK_like Catalytic domain of Ste20-like kinas 100.0
PHA02988283 hypothetical protein; Provisional 100.0
cd06628267 STKc_MAPKKK_Byr2_like Catalytic domain of fungal B 100.0
cd06655296 STKc_PAK2 Catalytic domain of the Protein Serine/T 100.0
PHA03390267 pk1 serine/threonine-protein kinase 1; Provisional 100.0
cd06654296 STKc_PAK1 Catalytic domain of the Protein Serine/T 100.0
KOG4721 904 consensus Serine/threonine protein kinase, contain 100.0
cd06643282 STKc_SLK Catalytic domain of the Protein Serine/Th 100.0
cd06609274 STKc_MST3_like Catalytic domain of Mammalian Ste20 100.0
cd07832286 STKc_CCRK Catalytic domain of the Serine/Threonine 100.0
cd08227327 PK_STRAD_alpha Pseudokinase domain of STE20-relate 100.0
cd06656297 STKc_PAK3 Catalytic domain of the Protein Serine/T 100.0
cd07861285 STKc_CDK1_euk Catalytic domain of the Serine/Threo 100.0
PRK14559645 putative protein serine/threonine phosphatase; Pro 100.0
cd07847286 STKc_CDKL1_4 Catalytic domain of the Serine/Threon 100.0
cd06645267 STKc_MAP4K3 Catalytic domain of the Protein Serine 100.0
cd06651266 STKc_MEKK3 Catalytic domain of the Protein Serine/ 100.0
cd07837295 STKc_CdkB_plant Catalytic domain of the Serine/Thr 100.0
cd08218256 STKc_Nek1 Catalytic domain of the Protein Serine/T 100.0
KOG46451509 consensus MAPKKK (MAP kinase kinase kinase) SSK2 a 100.0
cd05106374 PTKc_CSF-1R Catalytic domain of the Protein Tyrosi 100.0
cd05610 669 STKc_MASTL Catalytic domain of the Protein Serine/ 100.0
cd06605265 PKc_MAPKK Catalytic domain of the dual-specificity 100.0
cd06639291 STKc_myosinIIIB Catalytic domain of the Protein Se 100.0
cd06636282 STKc_MAP4K4_6 Catalytic domain of the Protein Seri 100.0
cd07839284 STKc_CDK5 Catalytic domain of the Serine/Threonine 100.0
cd06646267 STKc_MAP4K5 Catalytic domain of the Protein Serine 100.0
cd06610267 STKc_OSR1_SPAK Catalytic domain of the Protein Ser 100.0
cd05088303 PTKc_Tie2 Catalytic domain of the Protein Tyrosine 100.0
cd07868317 STKc_CDK8 Catalytic domain of the Serine/Threonine 100.0
cd05061288 PTKc_InsR Catalytic domain of the Protein Tyrosine 100.0
cd06612256 STKc_MST1_2 Catalytic domain of the Protein Serine 100.0
cd06638286 STKc_myosinIIIA Catalytic domain of the Protein Se 100.0
cd06631265 STKc_YSK4 Catalytic domain of the Protein Serine/T 100.0
cd06630268 STKc_MEKK1 Catalytic domain of the Protein Serine/ 100.0
cd05104375 PTKc_Kit Catalytic domain of the Protein Tyrosine 100.0
cd06613262 STKc_MAP4K3_like Catalytic domain of Mitogen-activ 100.0
cd05064266 PTKc_EphR_A10 Catalytic domain of the Protein Tyro 100.0
cd06623264 PKc_MAPKK_plant_like Catalytic domain of Plant dua 100.0
cd06652265 STKc_MEKK2 Catalytic domain of the Protein Serine/ 100.0
KOG1989 738 consensus ARK protein kinase family [Signal transd 100.0
KOG2345302 consensus Serine/threonine protein kinase/TGF-beta 100.0
cd07850353 STKc_JNK Catalytic domain of the Serine/Threonine 100.0
cd06620284 PKc_MAPKK_Byr1_like Catalytic domain of fungal Byr 100.0
cd05123250 STKc_AGC Catalytic domain of AGC family Protein Se 100.0
cd07845309 STKc_CDK10 Catalytic domain of the Serine/Threonin 100.0
cd08220256 STKc_Nek8 Catalytic domain of the Protein Serine/T 100.0
cd07831282 STKc_MOK Catalytic domain of the Serine/Threonine 100.0
cd08217265 STKc_Nek2 Catalytic domain of the Protein Serine/T 100.0
cd08219255 STKc_Nek3 Catalytic domain of the Protein Serine/T 100.0
cd06658292 STKc_PAK5 Catalytic domain of the Protein Serine/T 100.0
cd07846286 STKc_CDKL2_3 Catalytic domain of the Serine/Threon 100.0
cd06608275 STKc_myosinIII_like Catalytic domain of Class III 100.0
cd06616288 PKc_MKK4 Catalytic domain of the dual-specificity 100.0
cd05096304 PTKc_DDR1 Catalytic domain of the Protein Tyrosine 100.0
cd05052263 PTKc_Abl Catalytic domain of the Protein Tyrosine 100.0
cd08221256 STKc_Nek9 Catalytic domain of the Protein Serine/T 100.0
cd05048283 PTKc_Ror Catalytic Domain of the Protein Tyrosine 100.0
cd06629272 STKc_MAPKKK_Bck1_like Catalytic domain of fungal B 100.0
KOG0666438 consensus Cyclin C-dependent kinase CDK8 [Transcri 100.0
cd07833288 STKc_CDKL Catalytic domain of Cyclin-Dependent pro 100.0
cd06626264 STKc_MEKK4 Catalytic domain of the Protein Serine/ 100.0
cd07843293 STKc_CDC2L1 Catalytic domain of the Serine/Threoni 100.0
cd07860284 STKc_CDK2_3 Catalytic domain of the Serine/Threoni 100.0
cd07844291 STKc_PCTAIRE_like Catalytic domain of PCTAIRE-like 100.0
cd08228267 STKc_Nek6 Catalytic domain of the Protein Serine/T 100.0
cd06640277 STKc_MST4 Catalytic domain of the Protein Serine/T 100.0
cd06632258 STKc_MEKK1_plant Catalytic domain of the Protein S 100.0
cd06659297 STKc_PAK6 Catalytic domain of the Protein Serine/T 100.0
cd06624268 STKc_ASK Catalytic domain of the Protein Serine/Th 100.0
cd07841298 STKc_CDK7 Catalytic domain of the Serine/Threonine 100.0
PHA03210501 serine/threonine kinase US3; Provisional 100.0
cd06648285 STKc_PAK_II Catalytic domain of the Protein Serine 100.0
PRK13184 932 pknD serine/threonine-protein kinase; Reviewed 100.0
KOG0662292 consensus Cyclin-dependent kinase CDK5 [Intracellu 100.0
cd05105400 PTKc_PDGFR_alpha Catalytic domain of the Protein T 100.0
cd08224267 STKc_Nek6_Nek7 Catalytic domain of the Protein Ser 100.0
cd05114256 PTKc_Tec_Rlk Catalytic domain of the Protein Tyros 100.0
cd06621287 PKc_MAPKK_Pek1_like Catalytic domain of fungal Pek 100.0
cd08229267 STKc_Nek7 Catalytic domain of the Protein Serine/T 100.0
cd05090283 PTKc_Ror1 Catalytic domain of the Protein Tyrosine 100.0
cd07865310 STKc_CDK9 Catalytic domain of the Serine/Threonine 100.0
cd06627254 STKc_Cdc7_like Catalytic domain of Cell division c 100.0
cd06917277 STKc_NAK1_like Catalytic domain of Fungal Nak1-lik 100.0
cd06641277 STKc_MST3 Catalytic domain of the Protein Serine/T 100.0
cd07849336 STKc_ERK1_2_like Catalytic domain of Extracellular 100.0
KOG0671415 consensus LAMMER dual specificity kinases [Signal 100.0
cd05093288 PTKc_TrkB Catalytic domain of the Protein Tyrosine 100.0
cd07867317 STKc_CDC2L6 Catalytic domain of Serine/Threonine K 100.0
cd06642277 STKc_STK25-YSK1 Catalytic domain of the Protein Se 100.0
cd05089297 PTKc_Tie1 Catalytic domain of the Protein Tyrosine 100.0
PLN00009294 cyclin-dependent kinase A; Provisional 100.0
cd05072261 PTKc_Lyn Catalytic domain of the Protein Tyrosine 100.0
cd07870291 STKc_PFTAIRE2 Catalytic domain of the Serine/Threo 100.0
cd06653264 STKc_MEKK3_like_1 Catalytic domain of MAP/ERK kina 100.0
cd06647293 STKc_PAK_I Catalytic domain of the Protein Serine/ 100.0
cd05059256 PTKc_Tec_like Catalytic domain of Tec-like Protein 100.0
cd06618296 PKc_MKK7 Catalytic domain of the dual-specificity 100.0
cd08215258 STKc_Nek Catalytic domain of the Protein Serine/Th 100.0
cd07855334 STKc_ERK5 Catalytic domain of the Serine/Threonine 100.0
KOG0193678 consensus Serine/threonine protein kinase RAF [Sig 100.0
cd07842316 STKc_CDK8_like Catalytic domain of Cyclin-Dependen 100.0
cd07880343 STKc_p38gamma_MAPK12 Catalytic domain of the Serin 100.0
cd08225257 STKc_Nek5 Catalytic domain of the Protein Serine/T 100.0
cd05054337 PTKc_VEGFR Catalytic domain of the Protein Tyrosin 100.0
cd07879342 STKc_p38delta_MAPK13 Catalytic domain of the Serin 100.0
cd05049280 PTKc_Trk Catalytic domain of the Protein Tyrosine 100.0
cd05108316 PTKc_EGFR Catalytic domain of the Protein Tyrosine 100.0
cd05122253 PKc_STE Catalytic domain of STE family Protein Kin 100.0
cd06607307 STKc_TAO Catalytic domain of the Protein Serine/Th 100.0
cd07836284 STKc_Pho85 Catalytic domain of the Serine/Threonin 100.0
cd05036277 PTKc_ALK_LTK Catalytic domain of the Protein Tyros 100.0
cd05053293 PTKc_FGFR Catalytic domain of the Protein Tyrosine 100.0
cd06606260 STKc_MAPKKK Catalytic domain of the Protein Serine 100.0
cd05113256 PTKc_Btk_Bmx Catalytic domain of the Protein Tyros 100.0
cd07854342 STKc_MAPK4_6 Catalytic domain of the Serine/Threon 100.0
cd05084252 PTKc_Fes Catalytic domain of the Protein Tyrosine 100.0
cd07851343 STKc_p38 Catalytic domain of the Serine/Threonine 100.0
cd05068261 PTKc_Frk_like Catalytic domain of Fyn-related kina 100.0
cd08530256 STKc_CNK2-like Catalytic domain of the Protein Ser 100.0
cd05033266 PTKc_EphR Catalytic domain of Ephrin Receptor Prot 100.0
cd05032277 PTKc_InsR_like Catalytic domain of Insulin Recepto 100.0
cd05082256 PTKc_Csk Catalytic domain of the Protein Tyrosine 100.0
KOG0669376 consensus Cyclin T-dependent kinase CDK9 [Cell cyc 100.0
KOG1006361 consensus Mitogen-activated protein kinase (MAPK) 100.0
cd05109279 PTKc_HER2 Catalytic domain of the Protein Tyrosine 100.0
cd05098307 PTKc_FGFR1 Catalytic domain of the Protein Tyrosin 100.0
cd05099314 PTKc_FGFR4 Catalytic domain of the Protein Tyrosin 100.0
cd05148261 PTKc_Srm_Brk Catalytic domain of the Protein Tyros 100.0
cd07877345 STKc_p38alpha_MAPK14 Catalytic domain of the Serin 100.0
cd07835283 STKc_CDK1_like Catalytic domain of Cyclin-Dependen 100.0
cd07858337 STKc_TEY_MAPK_plant Catalytic domain of the Serine 100.0
cd05116257 PTKc_Syk Catalytic domain of the Protein Tyrosine 100.0
cd07857332 STKc_MPK1 Catalytic domain of the Serine/Threonine 100.0
cd06633313 STKc_TAO3 Catalytic domain of the Protein Serine/T 100.0
cd05062277 PTKc_IGF-1R Catalytic domain of the Protein Tyrosi 100.0
cd06614286 STKc_PAK Catalytic domain of the Protein Serine/Th 100.0
cd07838287 STKc_CDK4_6_like Catalytic domain of Cyclin-Depend 100.0
cd07834330 STKc_MAPK Catalytic domain of the Serine/Threonine 100.0
cd05091283 PTKc_Ror2 Catalytic domain of the Protein Tyrosine 100.0
cd05092280 PTKc_TrkA Catalytic domain of the Protein Tyrosine 100.0
cd06657292 STKc_PAK4 Catalytic domain of the Protein Serine/T 100.0
KOG0584 632 consensus Serine/threonine protein kinase [General 100.0
cd05070260 PTKc_Fyn_Yrk Catalytic domain of the Protein Tyros 100.0
cd05035273 PTKc_Axl_like Catalytic Domain of Axl-like Protein 100.0
cd00192262 PTKc Catalytic domain of Protein Tyrosine Kinases. 100.0
cd05103343 PTKc_VEGFR2 Catalytic domain of the Protein Tyrosi 100.0
cd05039256 PTKc_Csk_like Catalytic domain of C-terminal Src k 100.0
cd06635317 STKc_TAO1 Catalytic domain of the Protein Serine/T 100.0
cd05107401 PTKc_PDGFR_beta Catalytic domain of the Protein Ty 100.0
cd05055302 PTKc_PDGFR Catalytic domain of the Protein Tyrosin 100.0
cd05071262 PTKc_Src Catalytic domain of the Protein Tyrosine 100.0
cd05066267 PTKc_EphR_A Catalytic domain of the Protein Tyrosi 100.0
cd07856328 STKc_Sty1_Hog1 Catalytic domain of the Serine/Thre 100.0
cd05094291 PTKc_TrkC Catalytic domain of the Protein Tyrosine 100.0
cd05115257 PTKc_Zap-70 Catalytic domain of the Protein Tyrosi 100.0
cd05034261 PTKc_Src_like Catalytic domain of Src kinase-like 100.0
cd05576237 STKc_RPK118_like Catalytic domain of the Protein S 100.0
cd05051296 PTKc_DDR Catalytic domain of the Protein Tyrosine 100.0
PTZ00024335 cyclin-dependent protein kinase; Provisional 100.0
cd05069260 PTKc_Yes Catalytic domain of the Protein Tyrosine 100.0
cd07840287 STKc_CDK9_like Catalytic domain of Cyclin-Dependen 100.0
cd05067260 PTKc_Lck_Blk Catalytic domain of the Protein Tyros 100.0
cd05063268 PTKc_EphR_A2 Catalytic domain of the Protein Tyros 100.0
smart00332255 PP2Cc Serine/threonine phosphatases, family 2C, ca 100.0
cd05101304 PTKc_FGFR2 Catalytic domain of the Protein Tyrosin 100.0
cd07852337 STKc_MAPK15 Catalytic domain of the Serine/Threoni 100.0
cd07866311 STKc_BUR1 Catalytic domain of the Serine/Threonine 100.0
cd08226328 PK_STRAD_beta Pseudokinase domain of STE20-related 100.0
KOG1026774 consensus Nerve growth factor receptor TRKA and re 100.0
cd05065269 PTKc_EphR_B Catalytic domain of the Protein Tyrosi 100.0
cd05080283 PTKc_Tyk2_rpt2 Catalytic (repeat 2) domain of the 100.0
cd00143254 PP2Cc Serine/threonine phosphatases, family 2C, ca 100.0
cd07864302 STKc_CDK12 Catalytic domain of the Serine/Threonin 100.0
cd05075272 PTKc_Axl Catalytic domain of the Protein Tyrosine 100.0
cd05060257 PTKc_Syk_like Catalytic domain of Spleen Tyrosine 100.0
cd05118283 STKc_CMGC Catalytic domain of CMGC family Serine/T 100.0
cd08222260 STKc_Nek11 Catalytic domain of the Protein Serine/ 100.0
cd06634308 STKc_TAO2 Catalytic domain of the Protein Serine/T 100.0
cd05095296 PTKc_DDR2 Catalytic domain of the Protein Tyrosine 100.0
cd05050288 PTKc_Musk Catalytic domain of the Protein Tyrosine 100.0
cd05112256 PTKc_Itk Catalytic domain of the Protein Tyrosine 100.0
cd05045290 PTKc_RET Catalytic domain of the Protein Tyrosine 100.0
cd08216314 PK_STRAD Pseudokinase domain of STE20-related kina 100.0
cd05047270 PTKc_Tie Catalytic domain of Tie Protein Tyrosine 100.0
cd05097295 PTKc_DDR_like Catalytic domain of Discoidin Domain 100.0
cd05100334 PTKc_FGFR3 Catalytic domain of the Protein Tyrosin 100.0
KOG1035 1351 consensus eIF-2alpha kinase GCN2 [Translation, rib 100.0
KOG10951025 consensus Protein tyrosine kinase [Signal transduc 100.0
cd05073260 PTKc_Hck Catalytic domain of the Protein Tyrosine 100.0
KOG0668338 consensus Casein kinase II, alpha subunit [Signal 100.0
cd07830283 STKc_MAK_like Catalytic domain of Male germ cell-A 100.0
cd05111279 PTK_HER3 Pseudokinase domain of the Protein Tyrosi 100.0
cd05046275 PTK_CCK4 Pseudokinase domain of the Protein Tyrosi 100.0
KOG1187361 consensus Serine/threonine protein kinase [Signal 100.0
KOG0587 953 consensus Traf2- and Nck-interacting kinase and re 100.0
cd07829282 STKc_CDK_like Catalytic domain of Cyclin-Dependent 100.0
smart00219258 TyrKc Tyrosine kinase, catalytic domain. Phosphotr 100.0
cd05083254 PTKc_Chk Catalytic domain of the Protein Tyrosine 100.0
cd05057279 PTKc_EGFR_like Catalytic domain of Epidermal Growt 100.0
cd05085250 PTKc_Fer Catalytic domain of the Protein Tyrosine 100.0
cd05041251 PTKc_Fes_like Catalytic domain of Fes-like Protein 100.0
KOG0670752 consensus U4/U6-associated splicing factor PRP4 [R 100.0
cd05056270 PTKc_FAK Catalytic domain of the Protein Tyrosine 100.0
cd05079284 PTKc_Jak1_rpt2 Catalytic (repeat 2) domain of the 100.0
cd05043280 PTK_Ryk Pseudokinase domain of Ryk (Receptor relat 100.0
cd05040257 PTKc_Ack_like Catalytic domain of the Protein Tyro 100.0
PF07714259 Pkinase_Tyr: Protein tyrosine kinase Protein kinas 100.0
cd05078258 PTK_Jak2_Jak3_rpt1 Pseudokinase (repeat 1) domain 100.0
cd05081284 PTKc_Jak2_Jak3_rpt2 Catalytic (repeat 2) domain of 100.0
PLN03225566 Serine/threonine-protein kinase SNT7; Provisional 100.0
KOG0194474 consensus Protein tyrosine kinase [Signal transduc 100.0
KOG4250 732 consensus TANK binding protein kinase TBK1 [Signal 99.98
cd05042269 PTKc_Aatyk Catalytic domain of the Protein Tyrosin 99.98
cd08528269 STKc_Nek10 Catalytic domain of the Protein Serine/ 99.98
KOG1151775 consensus Tousled-like protein kinase [Signal tran 99.98
cd05077262 PTK_Jak1_rpt1 Pseudokinase (repeat 1) domain of th 99.98
cd05058262 PTKc_Met_Ron Catalytic domain of the Protein Tyros 99.98
cd05044269 PTKc_c-ros Catalytic domain of the Protein Tyrosin 99.98
PHA02882294 putative serine/threonine kinase; Provisional 99.98
cd05038284 PTKc_Jak_rpt2 Catalytic (repeat 2) domain of the P 99.98
KOG0665369 consensus Jun-N-terminal kinase (JNK) [Signal tran 99.98
cd05087269 PTKc_Aatyk1_Aatyk3 Catalytic domain of the Protein 99.98
cd05110303 PTKc_HER4 Catalytic domain of the Protein Tyrosine 99.98
cd05076274 PTK_Tyk2_rpt1 Pseudokinase (repeat 1) domain of th 99.97
cd05074273 PTKc_Tyro3 Catalytic domain of the Protein Tyrosin 99.97
cd05037259 PTK_Jak_rpt1 Pseudokinase (repeat 1) domain of the 99.97
cd05086268 PTKc_Aatyk2 Catalytic domain of the Protein Tyrosi 99.97
KOG0984282 consensus Mitogen-activated protein kinase (MAPK) 99.97
PLN03224507 probable serine/threonine protein kinase; Provisio 99.97
KOG0196996 consensus Tyrosine kinase, EPH (ephrin) receptor f 99.97
KOG0603 612 consensus Ribosomal protein S6 kinase [Signal tran 99.97
KOG1152772 consensus Signal transduction serine/threonine kin 99.97
smart00220244 S_TKc Serine/Threonine protein kinases, catalytic 99.96
KOG0576 829 consensus Mitogen-activated protein kinase kinase 99.96
KOG4257 974 consensus Focal adhesion tyrosine kinase FAK, cont 99.96
KOG4278 1157 consensus Protein tyrosine kinase [Signal transduc 99.96
KOG0199 1039 consensus ACK and related non-receptor tyrosine ki 99.96
KOG0664449 consensus Nemo-like MAPK-related serine/threonine 99.96
KOG1094807 consensus Discoidin domain receptor DDR1 [Signal t 99.96
KOG1027903 consensus Serine/threonine protein kinase and endo 99.96
KOG1290 590 consensus Serine/threonine protein kinase [Signal 99.96
KOG1345378 consensus Serine/threonine kinase [Signal transduc 99.95
KOG0200609 consensus Fibroblast/platelet-derived growth facto 99.95
KOG1167418 consensus Serine/threonine protein kinase of the C 99.95
PLN00113968 leucine-rich repeat receptor-like protein kinase; 99.95
KOG1323493 consensus Serine/threonine phosphatase [Signal tra 99.94
KOG3653534 consensus Transforming growth factor beta/activin 99.94
KOG1025 1177 consensus Epidermal growth factor receptor EGFR an 99.94
KOG0606 1205 consensus Microtubule-associated serine/threonine 99.94
cd00180215 PKc Catalytic domain of Protein Kinases. Protein K 99.93
smart00221225 STYKc Protein kinase; unclassified specificity. Ph 99.93
PLN00181 793 protein SPA1-RELATED; Provisional 99.93
KOG2052513 consensus Activin A type IB receptor, serine/threo 99.93
KOG1163341 consensus Casein kinase (serine/threonine/tyrosine 99.91
smart00750176 KIND kinase non-catalytic C-lobe domain. It is an 99.9
KOG1024563 consensus Receptor-like protein tyrosine kinase RY 99.9
KOG1165449 consensus Casein kinase (serine/threonine/tyrosine 99.89
COG0515384 SPS1 Serine/threonine protein kinase [General func 99.88
KOG0590601 consensus Checkpoint kinase and related serine/thr 99.87
PRK09188365 serine/threonine protein kinase; Provisional 99.87
KOG1164322 consensus Casein kinase (serine/threonine/tyrosine 99.87
PF14531288 Kinase-like: Kinase-like; PDB: 3DZO_A 2W1Z_A 3BYV_ 99.81
PRK10359232 lipopolysaccharide core biosynthesis protein; Prov 99.81
PRK12274218 serine/threonine protein kinase; Provisional 99.8
KOG0195448 consensus Integrin-linked kinase [Signal transduct 99.8
KOG1240 1431 consensus Protein kinase containing WD40 repeats [ 99.79
KOG4158598 consensus BRPK/PTEN-induced protein kinase [Signal 99.79
cd05147190 RIO1_euk RIO kinase family; eukaryotic RIO1, catal 99.79
KOG06061205 consensus Microtubule-associated serine/threonine 99.78
cd05145190 RIO1_like RIO kinase family; RIO1, RIO3 and simila 99.76
KOG1379330 consensus Serine/threonine protein phosphatase [Si 99.72
PRK10345210 hypothetical protein; Provisional 99.71
KOG06181081 consensus Serine/threonine phosphatase 2C containi 99.71
KOG0590 601 consensus Checkpoint kinase and related serine/thr 99.69
PF13672212 PP2C_2: Protein phosphatase 2C; PDB: 2JFT_A 2JFS_A 99.69
KOG1166974 consensus Mitotic checkpoint serine/threonine prot 99.69
smart00090237 RIO RIO-like kinase. 99.68
KOG1033516 consensus eIF-2alpha kinase PEK/EIF2AK3 [Translati 99.68
KOG1113368 consensus cAMP-dependent protein kinase types I an 99.66
KOG0614732 consensus cGMP-dependent protein kinase [Signal tr 99.64
PRK14879211 serine/threonine protein kinase; Provisional 99.59
cd05144198 RIO2_C RIO kinase family; RIO2, C-terminal catalyt 99.58
TIGR03724199 arch_bud32 Kae1-associated kinase Bud32. Members o 99.55
cd05119187 RIO RIO kinase family, catalytic domain. The RIO k 99.54
PRK09605535 bifunctional UGMP family protein/serine/threonine 99.53
smart00331193 PP2C_SIG Sigma factor PP2C-like phosphatases. 99.53
PRK01723239 3-deoxy-D-manno-octulosonic-acid kinase; Reviewed 99.51
KOG1023 484 consensus Natriuretic peptide receptor, guanylate 99.49
cd05120155 APH_ChoK_like Aminoglycoside 3'-phosphotransferase 99.47
PRK09392236 ftrB transcriptional activator FtrB; Provisional 99.45
KOG2968 1158 consensus Predicted esterase of the alpha-beta hyd 99.37
cd00038115 CAP_ED effector domain of the CAP family of transc 99.37
TIGR02865764 spore_II_E stage II sporulation protein E. Stage I 99.34
PLN03192823 Voltage-dependent potassium channel; Provisional 99.34
PRK11753211 DNA-binding transcriptional dual regulator Crp; Pr 99.34
PF0002791 cNMP_binding: Cyclic nucleotide-binding domain; In 99.3
PLN02868413 acyl-CoA thioesterase family protein 99.3
smart00100120 cNMP Cyclic nucleotide-monophosphate binding domai 99.28
COG0664214 Crp cAMP-binding proteins - catabolite gene activa 99.27
KOG0601524 consensus Cyclin-dependent kinase WEE1 [Cell cycle 99.27
KOG0601524 consensus Cyclin-dependent kinase WEE1 [Cell cycle 99.25
cd05151170 ChoK Choline Kinase (ChoK). The ChoK subfamily is 99.22
PRK10402226 DNA-binding transcriptional activator YeiL; Provis 99.21
PRK11161235 fumarate/nitrate reduction transcriptional regulat 99.2
KOG0498727 consensus K+-channel ERG and related proteins, con 99.18
TIGR01982437 UbiB 2-polyprenylphenol 6-hydroxylase. This model 99.17
PRK04750537 ubiB putative ubiquinone biosynthesis protein UbiB 99.17
PRK09392236 ftrB transcriptional activator FtrB; Provisional 99.15
cd05146197 RIO3_euk RIO kinase family; eukaryotic RIO3, catal 99.15
PF07228193 SpoIIE: Stage II sporulation protein E (SpoIIE); I 99.06
KOG1266458 consensus Protein kinase [Signal transduction mech 99.04
PF0002791 cNMP_binding: Cyclic nucleotide-binding domain; In 99.03
cd00038115 CAP_ED effector domain of the CAP family of transc 99.03
KOG0500536 consensus Cyclic nucleotide-gated cation channel C 99.0
KOG1243 690 consensus Protein kinase [General function predict 98.99
KOG0499815 consensus Cyclic nucleotide-gated cation channel C 98.99
PLN03192823 Voltage-dependent potassium channel; Provisional 98.99
PRK11753211 DNA-binding transcriptional dual regulator Crp; Pr 98.98
PRK13918202 CRP/FNR family transcriptional regulator; Provisio 98.96
KOG0498727 consensus K+-channel ERG and related proteins, con 98.95
PRK09391230 fixK transcriptional regulator FixK; Provisional 98.95
PLN02868413 acyl-CoA thioesterase family protein 98.94
TIGR03697193 NtcA_cyano global nitrogen regulator NtcA, cyanoba 98.94
cd05154223 ACAD10_11_like Acyl-CoA dehydrogenase (ACAD) 10 an 98.94
COG3642204 Mn2+-dependent serine/threonine protein kinase [Si 98.93
COG0664214 Crp cAMP-binding proteins - catabolite gene activa 98.93
KOG3087229 consensus Serine/threonine protein kinase [General 98.9
KOG0500536 consensus Cyclic nucleotide-gated cation channel C 98.88
smart00100120 cNMP Cyclic nucleotide-monophosphate binding domai 98.87
COG2905610 Predicted signal-transduction protein containing c 98.84
PRK10402226 DNA-binding transcriptional activator YeiL; Provis 98.82
KOG2137 700 consensus Protein kinase [Signal transduction mech 98.78
PRK11161235 fumarate/nitrate reduction transcriptional regulat 98.73
PF01163188 RIO1: RIO1 family; InterPro: IPR018934 Protein pho 98.7
KOG0499815 consensus Cyclic nucleotide-gated cation channel C 98.67
>KOG0614 consensus cGMP-dependent protein kinase [Signal transduction mechanisms] Back     alignment and domain information 
Probab=100.00  E-value=2.8e-102  Score=840.05  Aligned_cols=584  Identities=32%  Similarity=0.536  Sum_probs=523.4

Q ss_pred             HHhHHHHhhcccCCcc---cccCcccccCCHHHHHHHHHHHhcChhccCCCHHHHHHHhhcceEEEecCCCEEEeccCCC
Q 001412          438 RARLRAIENSLENGQI---WVPSSSAHRKTWEEEAHIERALHDHFLFRKLTDSQCHVLLDCMQRVEVQAGDIVVKQGGEG  514 (1082)
Q Consensus       438 ~~~r~a~~~~~~~~~~---~~~~~~~~~k~~~~~~~i~~~l~~~~lf~~L~~~~~~~l~~~~~~~~~~~ge~I~~qGd~~  514 (1082)
                      +....++++....-.+   +..+.+.+.|+...+++|.++|.+++|+++|+..|+.+|+++|+.++|++|++||+|||+|
T Consensus       116 ~~kkq~vsae~t~~~~~~s~~~~l~~~~Kd~~~k~lI~dAi~~NdFLknLd~~Qi~e~v~~Myp~~~~~gs~IIrege~G  195 (732)
T KOG0614|consen  116 RAKKQAVSAEPTNFTIDPSSSITLPRYNKDVGAKQLIRDAIQKNDFLKNLDASQIKELVDCMYPVEYRAGSWIIREGEPG  195 (732)
T ss_pred             HHHHhhccccccccccccccccccccccCCccHHHHHHHHHHhhHHHHhhhHHHHHHHHHhhCcccccCCcEEEecCCCC
Confidence            3344444444333233   4467778899999999999999999999999999999999999999999999999999999


Q ss_pred             CeEEEEEEeEEEEEEEecCCCcccceEeeeeccCCCCeeechhhccCCCceeEEEEcccceeeeecHHHHHHhhhhhhhH
Q 001412          515 DCFYVVGSGEFEVMATQEEKNGEVPRVLQRYTAEKLSSFGELALMYNKPLQASVRAVTNGMLWALKREDFRGILMSEFSN  594 (1082)
Q Consensus       515 ~~~yiI~~G~v~v~~~~~~~~~~~~~~~~~~~~~~G~~fGE~al~~~~~r~atv~A~~~~~l~~l~~~~f~~il~~~~~~  594 (1082)
                      +.+|++.+|+++|.+..     .   .+  .++++|..|||+|++++++|+|||+|++++++|+|+|+.|+.|++.....
T Consensus       196 s~~yV~aeG~~~V~~~g-----~---ll--~~m~~gtvFGELAILynctRtAsV~alt~~~lWaidR~vFq~IM~~tg~~  265 (732)
T KOG0614|consen  196 SHLYVSAEGELQVSREG-----K---LL--GKMGAGTVFGELAILYNCTRTASVRALTDVRLWAIDREVFQAIMMRTGLE  265 (732)
T ss_pred             ceEEEeecceEEEeeCC-----e---ee--eccCCchhhhHHHHHhCCcchhhhhhhhhhhHHHHHHHHHHHHHHHHHHH
Confidence            99999999999999743     1   22  35589999999999999999999999999999999999999999986554


Q ss_pred             --HHHHHHhhhhhhhccCCHHHHHHHHhhcceeeecCCCEEEecCCcCCeEEEEEeeEEEEEEeccccccccccccccCC
Q 001412          595 --LSSLKLLRSVDLLSRLTILQLSHLADTLSEVSFSAGQTIVNMNEGVAALYIIQRGQVRITFDADLLSNANVCSLKSDL  672 (1082)
Q Consensus       595 --~~~l~~L~~v~lf~~Ls~~~l~~la~~l~~~~~~~ge~Ii~~G~~~~~~yiI~~G~v~v~~~~~~~~n~~l~~~~~~~  672 (1082)
                        ..+++||+++|+|.+|+++.|.++++.|+...|..|++|++||+.|++||||.+|.|+|++.+.              
T Consensus       266 r~~~~~~fLrsv~~~q~l~Ee~L~KiaD~le~~~Yd~g~yIirqge~G~~ffii~~G~V~vtq~~e--------------  331 (732)
T KOG0614|consen  266 RHEQYMNFLRSVPLFQNLPEELLLKIADVLEEEYYDAGEYIIRQGEKGDTFFIISKGTVKVTQQDE--------------  331 (732)
T ss_pred             HHHHHHHHHHhhhhhccCCHHHHHHHHHHHHHHhhcCCceEEeecCCCCeEEEEecceEEEeecCC--------------
Confidence              3578999999999999999999999999999999999999999999999999999999998765              


Q ss_pred             ccccCCCCcccceeEEecCCccccceeccccCcccceEEeccC-eeEeeechhhhhcccCCcccccccccCCCCCCCCCC
Q 001412          673 HVEDDGTQSSKELSVEKSEGSYFGEWTLLGEHMGSLTAVAVDD-VVCAILTKEKFDLVVGPLTKISHDDQNSKDYSSDIP  751 (1082)
Q Consensus       673 ~~~~~~~~~~~~~i~~l~~G~~FGe~all~~~~r~~tv~a~~~-~~~~~l~~~~f~~l~g~~~~i~~~~~~~~~~~~~~~  751 (1082)
                            ..+.+..++.+++||||||.+|+++..|+|+++|..+ +.|+.|+++.|.+++|.+.++..+++......   +
T Consensus       332 ------~~~q~~~lr~l~kGd~FGE~al~~edvRtAniia~~~gv~cl~lDresF~~liG~l~~l~ek~~~D~~r~---A  402 (732)
T KOG0614|consen  332 ------GSTQPQELRTLNKGDYFGERALLGEDVRTANIIAQAPGVECLTLDRESFKKLIGDLEELKEKDYGDEERR---A  402 (732)
T ss_pred             ------CCCchhHHhhccccchhhHHHhhccCccchhhhccCCCceEEEecHHHHHHhcccHHHhhhhhccchhhh---h
Confidence                  2356778999999999999999999999999999986 99999999999999999998876555333221   0


Q ss_pred             CCCCCCcccccccccCcCCeEEEEEecCCCcEEEEEEEEcCCCcEEEEEEeechhhhccchHHHHHHHHhhhccCCCccc
Q 001412          752 KKPAKSIDISSLAKVSLTDMEWRKCLYSTDCSEIGLVLLRDSENFLSLKRFSKQKVKCLGKEVQVLKEKNLMKSVSPSAC  831 (1082)
Q Consensus       752 ~~~~~~~~~~~~~~~~~~~y~i~~~LG~G~~g~V~~~~~~~~~~~~aiK~l~k~~~~~~~~~~~~~~E~~il~~l~~~~~  831 (1082)
                      +......-...++.+.+++++++.+||-||||.|-+++.+.....||+|+++|..++...+++++..|.+||..+. +++
T Consensus       403 ~~~~~~~~~~e~a~v~l~dl~~iaTLGvGgFGRVELV~~~~~~~~fAlKilkK~hIVdtkQqeHv~sEr~Im~~~~-s~f  481 (732)
T KOG0614|consen  403 SVVIKEDFAEEFAQVKLSDLKRIATLGVGGFGRVELVKVNSQKATFALKILKKKHIVDTKQQEHVFSERNIMMECR-SDF  481 (732)
T ss_pred             hhHHHHHHHhhhcccchhhhhhhhhcccCccceEEEEEecccchHHHHHHHhHhhccchhHHHHHHhHHHHHHhcC-chH
Confidence            0100112234678899999999999999999999999987776679999999999999999999999999999985 899


Q ss_pred             ccceeEEEeeCCeEEEEEeccCCCCHHHHhc--CCCCHHHHHHHHHHHHHHHHHHHHCCCEecccCCCcEEEcCCCcEEE
Q 001412          832 VPQILCTCADSMHAGLLLNTYLACPLASILH--TPLDEQSARFCAASVVAALEDLHKRGVLYRGVSPDVLMLDKSGHLQL  909 (1082)
Q Consensus       832 I~~l~~~~~~~~~~~lv~e~~~gg~L~~~l~--~~l~~~~~~~i~~qi~~aL~~LH~~~ivHrDlkp~NIll~~~g~vkL  909 (1082)
                      |+++|.+|.++.++||+||-|.||+||++|+  +.|++..+++|+.++++|++|||.+|||||||||+|+|+|.+|++||
T Consensus       482 IvrLYrTfrd~kyvYmLmEaClGGElWTiLrdRg~Fdd~tarF~~acv~EAfeYLH~k~iIYRDLKPENllLd~~Gy~KL  561 (732)
T KOG0614|consen  482 IVRLYRTFRDSKYVYMLMEACLGGELWTILRDRGSFDDYTARFYVACVLEAFEYLHRKGIIYRDLKPENLLLDNRGYLKL  561 (732)
T ss_pred             HHHHHHHhccchhhhhhHHhhcCchhhhhhhhcCCcccchhhhhHHHHHHHHHHHHhcCceeccCChhheeeccCCceEE
Confidence            9999999999999999999999999999998  89999999999999999999999999999999999999999999999


Q ss_pred             EecCCCccCC-CCCceeEeeccCCCChhhhcCCCCCCcccccchhHHHhhhccCCCCCCCCCCCHHHHHHHHhhC--CCC
Q 001412          910 VDFRFGKGLS-GNRTFTICGMADYLAPEIVQGKGHGLAADWWALGVLIYFMLQGEMPFGSWRESEIDIVAKIAKG--QLS  986 (1082)
Q Consensus       910 ~DFg~a~~~~-~~~~~~~~gt~~Y~aPE~~~~~~~~~~~DiwslGvil~elltg~~pf~~~~~~~~~~~~~i~~~--~~~  986 (1082)
                      .|||+|+.+. +.+++|+||||.|.|||++++++|+.++|+||||+++||||+|.+||.+  .+.+.+|+.|+++  .+.
T Consensus       562 VDFGFAKki~~g~KTwTFcGTpEYVAPEIILnKGHD~avDyWaLGIli~ELL~G~pPFs~--~dpmktYn~ILkGid~i~  639 (732)
T KOG0614|consen  562 VDFGFAKKIGSGRKTWTFCGTPEYVAPEIILNKGHDRAVDYWALGILIYELLTGSPPFSG--VDPMKTYNLILKGIDKIE  639 (732)
T ss_pred             eehhhHHHhccCCceeeecCCcccccchhhhccCcchhhHHHHHHHHHHHHHcCCCCCCC--CchHHHHHHHHhhhhhhh
Confidence            9999999985 5678999999999999999999999999999999999999999999999  8889999999996  679


Q ss_pred             CCCCCCHHHHHHHHHhcccCccccCCCC--ChhHHhcCCCCCCCCccccccCCCCCCcccccccccccCCCCCCC
Q 001412          987 LPQNLSPEAVDLLTKLLVVDENTRLGSQ--GPTSVKTHPWFRDVDWKGIAESTSPVPHEIMSRISQHLDSHFEDS 1059 (1082)
Q Consensus       987 ~p~~~s~~~~~li~~lL~~dp~~R~~~~--~~~~il~h~~f~~~~~~~~~~~~~~~p~~~~~~~~~~~~~~~~~~ 1059 (1082)
                      +|..++..+.+||++++..+|.+|++..  ++.+|.+|.||.++||+++..+.+++|  +.+.+....+.++++.
T Consensus       640 ~Pr~I~k~a~~Lik~LCr~~P~ERLG~~~~gI~DIkkH~Wf~gfdweglr~~~L~pP--i~~~va~ptD~s~Fd~  712 (732)
T KOG0614|consen  640 FPRRITKTATDLIKKLCRDNPTERLGYQKGGINDIKKHRWFEGFDWEGLRSRTLPPP--IIPSVANPTDVSNFDN  712 (732)
T ss_pred             cccccchhHHHHHHHHHhcCcHhhhccccCChHHHHhhhhhhcCChhhhhhccCCCC--ccccCCCcccchhccC
Confidence            9999999999999999999999999965  899999999999999999999999998  5666766666555544

>KOG0616 consensus cAMP-dependent protein kinase catalytic subunit (PKA) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0598 consensus Ribosomal protein S6 kinase and related proteins [General function prediction only; Signal transduction mechanisms] Back     alignment and domain information
>KOG0605 consensus NDR and related serine/threonine kinases [General function prediction only] Back     alignment and domain information
>KOG0694 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0592 consensus 3-phosphoinositide-dependent protein kinase (PDK1) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0697 consensus Protein phosphatase 1B (formerly 2C) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0615 consensus Serine/threonine protein kinase Chk2 and related proteins [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0610 consensus Putative serine/threonine protein kinase [General function prediction only] Back     alignment and domain information
>KOG0690 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0575 consensus Polo-like serine/threonine protein kinase [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0696 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0581 consensus Mitogen-activated protein kinase kinase (MAP2K) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0612 consensus Rho-associated, coiled-coil containing protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>PLN03145 Protein phosphatase 2c; Provisional Back     alignment and domain information
>KOG0588 consensus Serine/threonine protein kinase [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0986 consensus G protein-coupled receptor kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0695 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0583 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0698 consensus Serine/threonine protein phosphatase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0595 consensus Serine/threonine-protein kinase involved in autophagy [Posttranslational modification, protein turnover, chaperones; Intracellular trafficking, secretion, and vesicular transport; Signal transduction mechanisms] Back     alignment and domain information
>KOG0580 consensus Serine/threonine protein kinase [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0593 consensus Predicted protein kinase KKIAMRE [General function prediction only] Back     alignment and domain information
>KOG0608 consensus Warts/lats-like serine threonine kinases [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PTZ00263 protein kinase A catalytic subunit; Provisional Back     alignment and domain information
>PTZ00426 cAMP-dependent protein kinase catalytic subunit; Provisional Back     alignment and domain information
>cd05587 STKc_cPKC Catalytic domain of the Protein Serine/Threonine Kinase, Classical Protein Kinase C Back     alignment and domain information
>cd05628 STKc_NDR1 Catalytic domain of the Protein Serine/Threonine Kinase, Nuclear Dbf2-Related kinase 1 Back     alignment and domain information
>cd05616 STKc_cPKC_beta Catalytic domain of the Protein Serine/Threonine Kinase, Classical Protein Kinase C beta Back     alignment and domain information
>KOG0591 consensus NIMA (never in mitosis)-related G2-specific serine/threonine protein kinase [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>cd05627 STKc_NDR2 Catalytic domain of the Protein Serine/Threonine Kinase, Nuclear Dbf2-Related kinase 2 Back     alignment and domain information
>cd05571 STKc_PKB Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B Back     alignment and domain information
>cd05615 STKc_cPKC_alpha Catalytic domain of the Protein Serine/Threonine Kinase, Classical Protein Kinase C alpha Back     alignment and domain information
>KOG0597 consensus Serine-threonine protein kinase FUSED [General function prediction only] Back     alignment and domain information
>cd05612 STKc_PRKX_like Catalytic domain of PRKX-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05585 STKc_YPK1_like Catalytic domain of Yeast Protein Kinase 1-like Protein Serine/Threonine Kinases Back     alignment and domain information
>KOG0585 consensus Ca2+/calmodulin-dependent protein kinase kinase beta and related serine/threonine protein kinases [Signal transduction mechanisms] Back     alignment and domain information
>cd05590 STKc_nPKC_eta Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C eta Back     alignment and domain information
>cd05625 STKc_LATS1 Catalytic domain of the Protein Serine/Threonine Kinase, Large Tumor Suppressor 1 Back     alignment and domain information
>KOG0033 consensus Ca2+/calmodulin-dependent protein kinase, EF-Hand protein superfamily [Signal transduction mechanisms] Back     alignment and domain information
>KOG0611 consensus Predicted serine/threonine protein kinase [General function prediction only] Back     alignment and domain information
>cd05589 STKc_PKN Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase N Back     alignment and domain information
>PTZ00224 protein phosphatase 2C; Provisional Back     alignment and domain information
>cd05591 STKc_nPKC_epsilon Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C epsilon Back     alignment and domain information
>KOG0661 consensus MAPK related serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd05599 STKc_NDR_like Catalytic domain of Nuclear Dbf2-Related kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05631 STKc_GRK4 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 4 Back     alignment and domain information
>cd05617 STKc_aPKC_zeta Catalytic domain of the Protein Serine/Threonine Kinase, Atypical Protein Kinase C zeta Back     alignment and domain information
>cd05588 STKc_aPKC Catalytic domain of the Protein Serine/Threonine Kinase, Atypical Protein Kinase C Back     alignment and domain information
>KOG0198 consensus MEKK and related serine/threonine protein kinases [Signal transduction mechanisms] Back     alignment and domain information
>cd05618 STKc_aPKC_iota Catalytic domain of the Protein Serine/Threonine Kinase, Atypical Protein Kinase C iota Back     alignment and domain information
>cd05620 STKc_nPKC_delta Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C delta Back     alignment and domain information
>cd05592 STKc_nPKC_theta_delta Catalytic domain of the Protein Serine/Threonine Kinases, Novel Protein Kinase C theta and delta Back     alignment and domain information
>cd05570 STKc_PKC Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase C Back     alignment and domain information
>cd05614 STKc_MSK2_N N-terminal catalytic domain of the Protein Serine/Threonine Kinase, Mitogen and stress-activated kinase 2 Back     alignment and domain information
>cd05629 STKc_NDR_like_fungal Catalytic domain of Fungal Nuclear Dbf2-Related kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05593 STKc_PKB_gamma Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B gamma Back     alignment and domain information
>cd05595 STKc_PKB_beta Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B beta Back     alignment and domain information
>cd05575 STKc_SGK Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase Back     alignment and domain information
>KOG0659 consensus Cdk activating kinase (CAK)/RNA polymerase II transcription initiation/nucleotide excision repair factor TFIIH/TFIIK, kinase subunit CDK7 [Cell cycle control, cell division, chromosome partitioning; Transcription; Replication, recombination and repair] Back     alignment and domain information
>KOG0578 consensus p21-activated serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd05619 STKc_nPKC_theta Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C theta Back     alignment and domain information
>KOG0600 consensus Cdc2-related protein kinase [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>cd05582 STKc_RSK_N N-terminal catalytic domain of the Protein Serine/Threonine Kinase, 90 kDa ribosomal protein S6 kinase Back     alignment and domain information
>KOG0599 consensus Phosphorylase kinase gamma subunit [Carbohydrate transport and metabolism] Back     alignment and domain information
>cd05626 STKc_LATS2 Catalytic domain of the Protein Serine/Threonine Kinase, Large Tumor Suppressor 2 Back     alignment and domain information
>cd05604 STKc_SGK3 Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase 3 Back     alignment and domain information
>cd05602 STKc_SGK1 Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase 1 Back     alignment and domain information
>KOG0663 consensus Protein kinase PITSLRE and related kinases [General function prediction only] Back     alignment and domain information
>cd05573 STKc_ROCK_NDR_like Catalytic domain of ROCK- and NDR kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05596 STKc_ROCK Catalytic domain of the Protein Serine/Threonine Kinase, Rho-associated coiled-coil containing protein kinase Back     alignment and domain information
>cd05594 STKc_PKB_alpha Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B alpha Back     alignment and domain information
>cd05586 STKc_Sck1_like Catalytic domain of Suppressor of loss of cAMP-dependent protein kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05600 STKc_Sid2p_Dbf2p Catalytic domain of Fungal Sid2p- and Dbf2p-like Protein Serine/Threonine Kinases Back     alignment and domain information
>KOG0032 consensus Ca2+/calmodulin-dependent protein kinase, EF-Hand protein superfamily [Signal transduction mechanisms] Back     alignment and domain information
>cd05598 STKc_LATS Catalytic domain of the Protein Serine/Threonine Kinase, Large Tumor Suppressor Back     alignment and domain information
>cd05603 STKc_SGK2 Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase 2 Back     alignment and domain information
>cd05584 STKc_p70S6K Catalytic domain of the Protein Serine/Threonine Kinase, 70 kDa ribosomal protein S6 kinase Back     alignment and domain information
>PF00481 PP2C: Protein phosphatase 2C; InterPro: IPR001932 This domain is found in protein phosphatase 2C, as well as other proteins eg Back     alignment and domain information
>cd05622 STKc_ROCK1 Catalytic domain of the Protein Serine/Threonine Kinase, Rho-associated coiled-coil containing protein kinase 1 Back     alignment and domain information
>cd05621 STKc_ROCK2 Catalytic domain of the Protein Serine/Threonine Kinase, Rho-associated coiled-coil containing protein kinase 2 Back     alignment and domain information
>cd05608 STKc_GRK1 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 1 Back     alignment and domain information
>KOG0582 consensus Ste20-like serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd05601 STKc_CRIK Catalytic domain of the Protein Serine/Threonine Kinase, Citron Rho-interacting kinase Back     alignment and domain information
>KOG0607 consensus MAP kinase-interacting kinase and related serine/threonine protein kinases [Signal transduction mechanisms] Back     alignment and domain information
>KOG4717 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd05605 STKc_GRK4_like Catalytic domain of G protein-coupled Receptor Kinase 4-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05624 STKc_MRCK_beta Catalytic domain of the Protein Serine/Threonine Kinase, DMPK-related cell division control protein 42 binding kinase beta Back     alignment and domain information
>cd05597 STKc_DMPK_like Catalytic domain of Myotonic Dystrophy protein kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05623 STKc_MRCK_alpha Catalytic domain of the Protein Serine/Threonine Kinase, DMPK-related cell division control protein 42 binding kinase alpha Back     alignment and domain information
>KOG0660 consensus Mitogen-activated protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd05580 STKc_PKA Catalytic domain of the Protein Serine/Threonine Kinase, cAMP-dependent protein kinase Back     alignment and domain information
>cd05607 STKc_GRK7 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 7 Back     alignment and domain information
>KOG0699 consensus Serine/threonine protein phosphatase [Signal transduction mechanisms] Back     alignment and domain information
>COG0631 PTC1 Serine/threonine protein phosphatase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0604 consensus MAP kinase-activated protein kinase 2 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0667 consensus Dual-specificity tyrosine-phosphorylation regulated kinase [General function prediction only] Back     alignment and domain information
>cd05630 STKc_GRK6 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 6 Back     alignment and domain information
>KOG0201 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0594 consensus Protein kinase PCTAIRE and related kinases [General function prediction only] Back     alignment and domain information
>cd07848 STKc_CDKL5 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase Like 5 Back     alignment and domain information
>KOG0658 consensus Glycogen synthase kinase-3 [Carbohydrate transport and metabolism] Back     alignment and domain information
>cd07871 STKc_PCTAIRE3 Catalytic domain of the Serine/Threonine Kinase, PCTAIRE-3 kinase Back     alignment and domain information
>cd05632 STKc_GRK5 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 5 Back     alignment and domain information
>cd07869 STKc_PFTAIRE1 Catalytic domain of the Serine/Threonine Kinase, PFTAIRE-1 kinase Back     alignment and domain information
>KOG0579 consensus Ste20-like serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd06649 PKc_MEK2 Catalytic domain of the dual-specificity Protein Kinase, MAP/ERK Kinase 2 Back     alignment and domain information
>cd05574 STKc_phototropin_like Catalytic domain of Phototropin-like Protein Serine/Threonine Kinases Back     alignment and domain information
>KOG0192 consensus Tyrosine kinase specific for activated (GTP-bound) p21cdc42Hs [Signal transduction mechanisms] Back     alignment and domain information
>KOG0589 consensus Serine/threonine protein kinase [General function prediction only] Back     alignment and domain information
>KOG0700 consensus Protein phosphatase 2C/pyruvate dehydrogenase (lipoamide) phosphatase [Signal transduction mechanisms] Back     alignment and domain information
>cd07862 STKc_CDK6 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 6 Back     alignment and domain information
>cd05633 STKc_GRK3 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 3 Back     alignment and domain information
>cd07859 STKc_TDY_MAPK_plant Catalytic domain of the Serine/Threonine Kinases, TDY Mitogen-Activated Protein Kinases from Plants Back     alignment and domain information
>KOG4279 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG4236 consensus Serine/threonine protein kinase PKC mu/PKD and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>PTZ00036 glycogen synthase kinase; Provisional Back     alignment and domain information
>PHA03212 serine/threonine kinase US3; Provisional Back     alignment and domain information
>cd07876 STKc_JNK2 Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase 2 Back     alignment and domain information
>KOG0586 consensus Serine/threonine protein kinase [General function prediction only] Back     alignment and domain information
>PLN00034 mitogen-activated protein kinase kinase; Provisional Back     alignment and domain information
>cd05611 STKc_Rim15_like Catalytic domain of fungal Rim15-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05606 STKc_beta_ARK Catalytic domain of the Protein Serine/Threonine Kinase, beta-adrenergic receptor kinase Back     alignment and domain information
>cd05572 STKc_cGK_PKG Catalytic domain of the Protein Serine/Threonine Kinase, cGMP-dependent protein kinase Back     alignment and domain information
>KOG1113 consensus cAMP-dependent protein kinase types I and II, regulatory subunit [Signal transduction mechanisms] Back     alignment and domain information
>KOG0983 consensus Mitogen-activated protein kinase (MAPK) kinase MKK7/JNKK2 [Signal transduction mechanisms] Back     alignment and domain information
>cd07875 STKc_JNK1 Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase 1 Back     alignment and domain information
>cd05609 STKc_MAST Catalytic domain of the Protein Serine/Threonine Kinase, Microtubule-associated serine/threonine kinase Back     alignment and domain information
>cd06650 PKc_MEK1 Catalytic domain of the dual-specificity Protein Kinase, MAP/ERK Kinase 1 Back     alignment and domain information
>cd05577 STKc_GRK Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase Back     alignment and domain information
>PTZ00283 serine/threonine protein kinase; Provisional Back     alignment and domain information
>PTZ00284 protein kinase; Provisional Back     alignment and domain information
>cd07863 STKc_CDK4 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 4 Back     alignment and domain information
>cd05583 STKc_MSK_N N-terminal catalytic domain of the Protein Serine/Threonine Kinase, Mitogen and stress-activated kinase Back     alignment and domain information
>cd07872 STKc_PCTAIRE2 Catalytic domain of the Serine/Threonine Kinase, PCTAIRE-2 kinase Back     alignment and domain information
>cd07874 STKc_JNK3 Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase 3 Back     alignment and domain information
>cd05579 STKc_MAST_like Catalytic domain of Microtubule-associated serine/threonine kinase-like proteins Back     alignment and domain information
>cd07853 STKc_NLK Catalytic domain of the Serine/Threonine Kinase, Nemo-Like Kinase Back     alignment and domain information
>cd05613 STKc_MSK1_N N-terminal catalytic domain of the Protein Serine/Threonine Kinase, Mitogen and stress-activated kinase 1 Back     alignment and domain information
>PTZ00267 NIMA-related protein kinase; Provisional Back     alignment and domain information
>KOG0596 consensus Dual specificity; serine/threonine and tyrosine kinase [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>cd07878 STKc_p38beta_MAPK11 Catalytic domain of the Serine/Threonine Kinase, p38beta Mitogen-Activated Protein Kinase Back     alignment and domain information
>cd05102 PTKc_VEGFR3 Catalytic domain of the Protein Tyrosine Kinase, Vascular Endothelial Growth Factor Receptor 3 Back     alignment and domain information
>cd05578 STKc_Yank1 Catalytic domain of the Protein Serine/Threonine Kinase, Yank1 Back     alignment and domain information
>cd06619 PKc_MKK5 Catalytic domain of the dual-specificity Protein Kinase, MAP kinase kinase 5 Back     alignment and domain information
>cd06625 STKc_MEKK3_like Catalytic domain of MAP/ERK kinase kinase 3-like Protein Serine/Threonine Kinases Back     alignment and domain information
>KOG0197 consensus Tyrosine kinases [Signal transduction mechanisms] Back     alignment and domain information
>KOG0574 consensus STE20-like serine/threonine kinase MST [Signal transduction mechanisms] Back     alignment and domain information
>PF00069 Pkinase: Protein kinase domain Protein kinase; unclassified specificity Back     alignment and domain information
>cd07873 STKc_PCTAIRE1 Catalytic domain of the Serine/Threonine Kinase, PCTAIRE-1 kinase Back     alignment and domain information
>PHA03207 serine/threonine kinase US3; Provisional Back     alignment and domain information
>PTZ00266 NIMA-related protein kinase; Provisional Back     alignment and domain information
>cd06615 PKc_MEK Catalytic domain of the dual-specificity Protein Kinase, MAP/ERK Kinase Back     alignment and domain information
>cd08223 STKc_Nek4 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 4 Back     alignment and domain information
>KOG0603 consensus Ribosomal protein S6 kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd06617 PKc_MKK3_6 Catalytic domain of the dual-specificity Protein Kinases, MAP kinase kinases 3 and 6 Back     alignment and domain information
>PHA03209 serine/threonine kinase US3; Provisional Back     alignment and domain information
>cd08529 STKc_FA2-like Catalytic domain of the Protein Serine/Threonine Kinase, Chlamydomonas reinhardtii FA2 and similar domains Back     alignment and domain information
>cd05581 STKc_PDK1 Catalytic domain of the Protein Serine/Threonine Kinase, Phosphoinositide-dependent kinase 1 Back     alignment and domain information
>cd06637 STKc_TNIK Catalytic domain of the Protein Serine/Threonine Kinase, Traf2- and Nck-interacting kinase Back     alignment and domain information
>cd06644 STKc_STK10_LOK Catalytic domain of the Protein Serine/Threonine Kinase, STK10 or Lymphocyte-oriented kinase Back     alignment and domain information
>cd06622 PKc_MAPKK_PBS2_like Catalytic domain of fungal PBS2-like dual-specificity MAP kinase kinases Back     alignment and domain information
>PHA03211 serine/threonine kinase US3; Provisional Back     alignment and domain information
>KOG0577 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd06611 STKc_SLK_like Catalytic domain of Ste20-like kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>PHA02988 hypothetical protein; Provisional Back     alignment and domain information
>cd06628 STKc_MAPKKK_Byr2_like Catalytic domain of fungal Byr2-like MAP Kinase Kinase Kinases Back     alignment and domain information
>cd06655 STKc_PAK2 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 2 Back     alignment and domain information
>PHA03390 pk1 serine/threonine-protein kinase 1; Provisional Back     alignment and domain information
>cd06654 STKc_PAK1 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 1 Back     alignment and domain information
>KOG4721 consensus Serine/threonine protein kinase, contains leucine zipper domain [Signal transduction mechanisms] Back     alignment and domain information
>cd06643 STKc_SLK Catalytic domain of the Protein Serine/Threonine Kinase, Ste20-like kinase Back     alignment and domain information
>cd06609 STKc_MST3_like Catalytic domain of Mammalian Ste20-like protein kinase 3-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd07832 STKc_CCRK Catalytic domain of the Serine/Threonine Kinase, Cell Cycle-Related Kinase Back     alignment and domain information
>cd08227 PK_STRAD_alpha Pseudokinase domain of STE20-related kinase adapter protein alpha Back     alignment and domain information
>cd06656 STKc_PAK3 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 3 Back     alignment and domain information
>cd07861 STKc_CDK1_euk Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 1 from higher eukaryotes-like Back     alignment and domain information
>PRK14559 putative protein serine/threonine phosphatase; Provisional Back     alignment and domain information
>cd07847 STKc_CDKL1_4 Catalytic domain of the Serine/Threonine Kinases, Cyclin-Dependent protein Kinase Like 1 and 4 Back     alignment and domain information
>cd06645 STKc_MAP4K3 Catalytic domain of the Protein Serine/Threonine Kinase, Mitogen-activated protein kinase kinase kinase kinase 3 Back     alignment and domain information
>cd06651 STKc_MEKK3 Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 3 Back     alignment and domain information
>cd07837 STKc_CdkB_plant Catalytic domain of the Serine/Threonine Kinase, Plant B-type Cyclin-Dependent protein Kinase Back     alignment and domain information
>cd08218 STKc_Nek1 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 1 Back     alignment and domain information
>KOG4645 consensus MAPKKK (MAP kinase kinase kinase) SSK2 and related serine/threonine protein kinases [Signal transduction mechanisms] Back     alignment and domain information
>cd05106 PTKc_CSF-1R Catalytic domain of the Protein Tyrosine Kinase, Colony-Stimulating Factor-1 Receptor Back     alignment and domain information
>cd05610 STKc_MASTL Catalytic domain of the Protein Serine/Threonine Kinase, Microtubule-associated serine/threonine-like kinase Back     alignment and domain information
>cd06605 PKc_MAPKK Catalytic domain of the dual-specificity Protein Kinase, Mitogen-Activated Protein Kinase Kinase Back     alignment and domain information
>cd06639 STKc_myosinIIIB Catalytic domain of the Protein Serine/Threonine Kinase, Class IIIB myosin Back     alignment and domain information
>cd06636 STKc_MAP4K4_6 Catalytic domain of the Protein Serine/Threonine Kinases, Mitogen-Activated Protein Kinase Kinase Kinase Kinase 4 and 6 Back     alignment and domain information
>cd07839 STKc_CDK5 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 5 Back     alignment and domain information
>cd06646 STKc_MAP4K5 Catalytic domain of the Protein Serine/Threonine Kinase, Mitogen-activated protein kinase kinase kinase kinase 5 Back     alignment and domain information
>cd06610 STKc_OSR1_SPAK Catalytic domain of the Protein Serine/Threonine Kinases, Oxidative stress response kinase and Ste20-related proline alanine-rich kinase Back     alignment and domain information
>cd05088 PTKc_Tie2 Catalytic domain of the Protein Tyrosine Kinase, Tie2 Back     alignment and domain information
>cd07868 STKc_CDK8 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 8 Back     alignment and domain information
>cd05061 PTKc_InsR Catalytic domain of the Protein Tyrosine Kinase, Insulin Receptor Back     alignment and domain information
>cd06612 STKc_MST1_2 Catalytic domain of the Protein Serine/Threonine Kinases, Mammalian Ste20-like protein kinase 1 and 2 Back     alignment and domain information
>cd06638 STKc_myosinIIIA Catalytic domain of the Protein Serine/Threonine Kinase, Class IIIA myosin Back     alignment and domain information
>cd06631 STKc_YSK4 Catalytic domain of the Protein Serine/Threonine Kinase, Yeast Sps1/Ste20-related kinase 4 Back     alignment and domain information
>cd06630 STKc_MEKK1 Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 1 Back     alignment and domain information
>cd05104 PTKc_Kit Catalytic domain of the Protein Tyrosine Kinase, Kit Back     alignment and domain information
>cd06613 STKc_MAP4K3_like Catalytic domain of Mitogen-activated protein kinase kinase kinase kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05064 PTKc_EphR_A10 Catalytic domain of the Protein Tyrosine Kinase, Ephrin Receptor A10 Back     alignment and domain information
>cd06623 PKc_MAPKK_plant_like Catalytic domain of Plant dual-specificity MAP kinase kinases and similar proteins Back     alignment and domain information
>cd06652 STKc_MEKK2 Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 2 Back     alignment and domain information
>KOG1989 consensus ARK protein kinase family [Signal transduction mechanisms] Back     alignment and domain information
>KOG2345 consensus Serine/threonine protein kinase/TGF-beta stimulated factor [Transcription; Lipid transport and metabolism; Signal transduction mechanisms] Back     alignment and domain information
>cd07850 STKc_JNK Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase Back     alignment and domain information
>cd06620 PKc_MAPKK_Byr1_like Catalytic domain of fungal Byr1-like dual-specificity MAP kinase kinases Back     alignment and domain information
>cd05123 STKc_AGC Catalytic domain of AGC family Protein Serine/Threonine Kinases Back     alignment and domain information
>cd07845 STKc_CDK10 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 10 Back     alignment and domain information
>cd08220 STKc_Nek8 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 8 Back     alignment and domain information
>cd07831 STKc_MOK Catalytic domain of the Serine/Threonine Kinase, MAPK/MAK/MRK Overlapping Kinase Back     alignment and domain information
>cd08217 STKc_Nek2 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 2 Back     alignment and domain information
>cd08219 STKc_Nek3 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 3 Back     alignment and domain information
>cd06658 STKc_PAK5 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 5 Back     alignment and domain information
>cd07846 STKc_CDKL2_3 Catalytic domain of the Serine/Threonine Kinases, Cyclin-Dependent protein Kinase Like 2 and 3 Back     alignment and domain information
>cd06608 STKc_myosinIII_like Catalytic domain of Class III myosin-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd06616 PKc_MKK4 Catalytic domain of the dual-specificity Protein Kinase, MAP kinase kinase 4 Back     alignment and domain information
>cd05096 PTKc_DDR1 Catalytic domain of the Protein Tyrosine Kinase, Discoidin Domain Receptor 1 Back     alignment and domain information
>cd05052 PTKc_Abl Catalytic domain of the Protein Tyrosine Kinase, Abelson kinase Back     alignment and domain information
>cd08221 STKc_Nek9 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 9 Back     alignment and domain information
>cd05048 PTKc_Ror Catalytic Domain of the Protein Tyrosine Kinases, Receptor tyrosine kinase-like Orphan Receptors Back     alignment and domain information
>cd06629 STKc_MAPKKK_Bck1_like Catalytic domain of fungal Bck1-like MAP Kinase Kinase Kinases Back     alignment and domain information
>KOG0666 consensus Cyclin C-dependent kinase CDK8 [Transcription] Back     alignment and domain information
>cd07833 STKc_CDKL Catalytic domain of Cyclin-Dependent protein Kinase Like Serine/Threonine Kinases Back     alignment and domain information
>cd06626 STKc_MEKK4 Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 4 Back     alignment and domain information
>cd07843 STKc_CDC2L1 Catalytic domain of the Serine/Threonine Kinase, Cell Division Cycle 2-like 1 Back     alignment and domain information
>cd07860 STKc_CDK2_3 Catalytic domain of the Serine/Threonine Kinases, Cyclin-Dependent protein Kinase 2 and 3 Back     alignment and domain information
>cd07844 STKc_PCTAIRE_like Catalytic domain of PCTAIRE-like Serine/Threonine Kinases Back     alignment and domain information
>cd08228 STKc_Nek6 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 6 Back     alignment and domain information
>cd06640 STKc_MST4 Catalytic domain of the Protein Serine/Threonine Kinase, Mammalian Ste20-like protein kinase 4 Back     alignment and domain information
>cd06632 STKc_MEKK1_plant Catalytic domain of the Protein Serine/Threonine Kinase, Plant MAP/ERK kinase kinase 1 Back     alignment and domain information
>cd06659 STKc_PAK6 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 6 Back     alignment and domain information
>cd06624 STKc_ASK Catalytic domain of the Protein Serine/Threonine Kinase, Apoptosis signal-regulating kinase Back     alignment and domain information
>cd07841 STKc_CDK7 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 7 Back     alignment and domain information
>PHA03210 serine/threonine kinase US3; Provisional Back     alignment and domain information
>cd06648 STKc_PAK_II Catalytic domain of the Protein Serine/Threonine Kinase, Group II p21-activated kinase Back     alignment and domain information
>PRK13184 pknD serine/threonine-protein kinase; Reviewed Back     alignment and domain information
>KOG0662 consensus Cyclin-dependent kinase CDK5 [Intracellular trafficking, secretion, and vesicular transport; Signal transduction mechanisms] Back     alignment and domain information
>cd05105 PTKc_PDGFR_alpha Catalytic domain of the Protein Tyrosine Kinase, Platelet Derived Growth Factor Receptor alpha Back     alignment and domain information
>cd08224 STKc_Nek6_Nek7 Catalytic domain of the Protein Serine/Threonine Kinases, Never In Mitosis gene A-related kinase 6 and 7 Back     alignment and domain information
>cd05114 PTKc_Tec_Rlk Catalytic domain of the Protein Tyrosine Kinases, Tyrosine kinase expressed in hepatocellular carcinoma and Resting lymphocyte kinase Back     alignment and domain information
>cd06621 PKc_MAPKK_Pek1_like Catalytic domain of fungal Pek1-like dual-specificity MAP kinase kinases Back     alignment and domain information
>cd08229 STKc_Nek7 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 7 Back     alignment and domain information
>cd05090 PTKc_Ror1 Catalytic domain of the Protein Tyrosine Kinase, Receptor tyrosine kinase-like Orphan Receptor 1 Back     alignment and domain information
>cd07865 STKc_CDK9 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 9 Back     alignment and domain information
>cd06627 STKc_Cdc7_like Catalytic domain of Cell division control protein 7-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd06917 STKc_NAK1_like Catalytic domain of Fungal Nak1-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd06641 STKc_MST3 Catalytic domain of the Protein Serine/Threonine Kinase, Mammalian Ste20-like protein kinase 3 Back     alignment and domain information
>cd07849 STKc_ERK1_2_like Catalytic domain of Extracellular signal-Regulated Kinase 1 and 2-like Serine/Threonine Kinases Back     alignment and domain information
>KOG0671 consensus LAMMER dual specificity kinases [Signal transduction mechanisms] Back     alignment and domain information
>cd05093 PTKc_TrkB Catalytic domain of the Protein Tyrosine Kinase, Tropomyosin Related Kinase B Back     alignment and domain information
>cd07867 STKc_CDC2L6 Catalytic domain of Serine/Threonine Kinase, Cell Division Cycle 2-like 6 Back     alignment and domain information
>cd06642 STKc_STK25-YSK1 Catalytic domain of the Protein Serine/Threonine Kinase, STK25 or Yeast Sps1/Ste20-related kinase 1 Back     alignment and domain information
>cd05089 PTKc_Tie1 Catalytic domain of the Protein Tyrosine Kinase, Tie1 Back     alignment and domain information
>PLN00009 cyclin-dependent kinase A; Provisional Back     alignment and domain information
>cd05072 PTKc_Lyn Catalytic domain of the Protein Tyrosine Kinase, Lyn Back     alignment and domain information
>cd07870 STKc_PFTAIRE2 Catalytic domain of the Serine/Threonine Kinase, PFTAIRE-2 kinase Back     alignment and domain information
>cd06653 STKc_MEKK3_like_1 Catalytic domain of MAP/ERK kinase kinase 3-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd06647 STKc_PAK_I Catalytic domain of the Protein Serine/Threonine Kinase, Group I p21-activated kinase Back     alignment and domain information
>cd05059 PTKc_Tec_like Catalytic domain of Tec-like Protein Tyrosine Kinases Back     alignment and domain information
>cd06618 PKc_MKK7 Catalytic domain of the dual-specificity Protein Kinase, MAP kinase kinase 7 Back     alignment and domain information
>cd08215 STKc_Nek Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase Back     alignment and domain information
>cd07855 STKc_ERK5 Catalytic domain of the Serine/Threonine Kinase, Extracellular signal-Regulated Kinase 5 Back     alignment and domain information
>KOG0193 consensus Serine/threonine protein kinase RAF [Signal transduction mechanisms] Back     alignment and domain information
>cd07842 STKc_CDK8_like Catalytic domain of Cyclin-Dependent protein Kinase 8-like Serine/Threonine Kinases Back     alignment and domain information
>cd07880 STKc_p38gamma_MAPK12 Catalytic domain of the Serine/Threonine Kinase, p38gamma Mitogen-Activated Protein Kinase Back     alignment and domain information
>cd08225 STKc_Nek5 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 5 Back     alignment and domain information
>cd05054 PTKc_VEGFR Catalytic domain of the Protein Tyrosine Kinases, Vascular Endothelial Growth Factor Receptors Back     alignment and domain information
>cd07879 STKc_p38delta_MAPK13 Catalytic domain of the Serine/Threonine Kinase, p38delta Mitogen-Activated Protein Kinase Back     alignment and domain information
>cd05049 PTKc_Trk Catalytic domain of the Protein Tyrosine Kinases, Tropomyosin Related Kinases Back     alignment and domain information
>cd05108 PTKc_EGFR Catalytic domain of the Protein Tyrosine Kinase, Epidermal Growth Factor Receptor Back     alignment and domain information
>cd05122 PKc_STE Catalytic domain of STE family Protein Kinases Back     alignment and domain information
>cd06607 STKc_TAO Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids proteins Back     alignment and domain information
>cd07836 STKc_Pho85 Catalytic domain of the Serine/Threonine Kinase, Fungal Cyclin-Dependent protein Kinase Pho85 Back     alignment and domain information
>cd05036 PTKc_ALK_LTK Catalytic domain of the Protein Tyrosine Kinases, Anaplastic Lymphoma Kinase and Leukocyte Tyrosine Kinase Back     alignment and domain information
>cd05053 PTKc_FGFR Catalytic domain of the Protein Tyrosine Kinases, Fibroblast Growth Factor Receptors Back     alignment and domain information
>cd06606 STKc_MAPKKK Catalytic domain of the Protein Serine/Threonine Kinase, Mitogen-Activated Protein Kinase Kinase Kinase Back     alignment and domain information
>cd05113 PTKc_Btk_Bmx Catalytic domain of the Protein Tyrosine Kinases, Bruton's tyrosine kinase and Bone marrow kinase on the X chromosome Back     alignment and domain information
>cd07854 STKc_MAPK4_6 Catalytic domain of the Serine/Threonine Kinases, Mitogen-Activated Protein Kinases 4 and 6 Back     alignment and domain information
>cd05084 PTKc_Fes Catalytic domain of the Protein Tyrosine Kinase, Fes Back     alignment and domain information
>cd07851 STKc_p38 Catalytic domain of the Serine/Threonine Kinase, p38 Mitogen-Activated Protein Kinase Back     alignment and domain information
>cd05068 PTKc_Frk_like Catalytic domain of Fyn-related kinase-like Protein Tyrosine Kinases Back     alignment and domain information
>cd08530 STKc_CNK2-like Catalytic domain of the Protein Serine/Threonine Kinase, Chlamydomonas reinhardtii CNK2, and similar domains Back     alignment and domain information
>cd05033 PTKc_EphR Catalytic domain of Ephrin Receptor Protein Tyrosine Kinases Back     alignment and domain information
>cd05032 PTKc_InsR_like Catalytic domain of Insulin Receptor-like Protein Tyrosine Kinases Back     alignment and domain information
>cd05082 PTKc_Csk Catalytic domain of the Protein Tyrosine Kinase, C-terminal Src kinase Back     alignment and domain information
>KOG0669 consensus Cyclin T-dependent kinase CDK9 [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG1006 consensus Mitogen-activated protein kinase (MAPK) kinase MKK4 [Signal transduction mechanisms] Back     alignment and domain information
>cd05109 PTKc_HER2 Catalytic domain of the Protein Tyrosine Kinase, HER2 Back     alignment and domain information
>cd05098 PTKc_FGFR1 Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 1 Back     alignment and domain information
>cd05099 PTKc_FGFR4 Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 4 Back     alignment and domain information
>cd05148 PTKc_Srm_Brk Catalytic domain of the Protein Tyrosine Kinases, Srm and Brk Back     alignment and domain information
>cd07877 STKc_p38alpha_MAPK14 Catalytic domain of the Serine/Threonine Kinase, p38alpha Mitogen-Activated Protein Kinase Back     alignment and domain information
>cd07835 STKc_CDK1_like Catalytic domain of Cyclin-Dependent protein Kinase 1-like Serine/Threonine Kinases Back     alignment and domain information
>cd07858 STKc_TEY_MAPK_plant Catalytic domain of the Serine/Threonine Kinases, TEY Mitogen-Activated Protein Kinases from Plants Back     alignment and domain information
>cd05116 PTKc_Syk Catalytic domain of the Protein Tyrosine Kinase, Spleen tyrosine kinase Back     alignment and domain information
>cd07857 STKc_MPK1 Catalytic domain of the Serine/Threonine Kinase, Fungal Mitogen-Activated Protein Kinase MPK1 Back     alignment and domain information
>cd06633 STKc_TAO3 Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids 3 Back     alignment and domain information
>cd05062 PTKc_IGF-1R Catalytic domain of the Protein Tyrosine Kinase, Insulin-like Growth Factor-1 Receptor Back     alignment and domain information
>cd06614 STKc_PAK Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase Back     alignment and domain information
>cd07838 STKc_CDK4_6_like Catalytic domain of Cyclin-Dependent protein Kinase 4 and 6-like Serine/Threonine Kinases Back     alignment and domain information
>cd07834 STKc_MAPK Catalytic domain of the Serine/Threonine Kinase, Mitogen-Activated Protein Kinase Back     alignment and domain information
>cd05091 PTKc_Ror2 Catalytic domain of the Protein Tyrosine Kinase, Receptor tyrosine kinase-like Orphan Receptor 2 Back     alignment and domain information
>cd05092 PTKc_TrkA Catalytic domain of the Protein Tyrosine Kinase, Tropomyosin Related Kinase A Back     alignment and domain information
>cd06657 STKc_PAK4 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 4 Back     alignment and domain information
>KOG0584 consensus Serine/threonine protein kinase [General function prediction only] Back     alignment and domain information
>cd05070 PTKc_Fyn_Yrk Catalytic domain of the Protein Tyrosine Kinases, Fyn and Yrk Back     alignment and domain information
>cd05035 PTKc_Axl_like Catalytic Domain of Axl-like Protein Tyrosine Kinases Back     alignment and domain information
>cd00192 PTKc Catalytic domain of Protein Tyrosine Kinases Back     alignment and domain information
>cd05103 PTKc_VEGFR2 Catalytic domain of the Protein Tyrosine Kinase, Vascular Endothelial Growth Factor Receptor 2 Back     alignment and domain information
>cd05039 PTKc_Csk_like Catalytic domain of C-terminal Src kinase-like Protein Tyrosine Kinases Back     alignment and domain information
>cd06635 STKc_TAO1 Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids 1 Back     alignment and domain information
>cd05107 PTKc_PDGFR_beta Catalytic domain of the Protein Tyrosine Kinase, Platelet Derived Growth Factor Receptor beta Back     alignment and domain information
>cd05055 PTKc_PDGFR Catalytic domain of the Protein Tyrosine Kinases, Platelet Derived Growth Factor Receptors Back     alignment and domain information
>cd05071 PTKc_Src Catalytic domain of the Protein Tyrosine Kinase, Src Back     alignment and domain information
>cd05066 PTKc_EphR_A Catalytic domain of the Protein Tyrosine Kinases, Class EphA Ephrin Receptors Back     alignment and domain information
>cd07856 STKc_Sty1_Hog1 Catalytic domain of the Serine/Threonine Kinases, Fungal Mitogen-Activated Protein Kinases Sty1 and Hog1 Back     alignment and domain information
>cd05094 PTKc_TrkC Catalytic domain of the Protein Tyrosine Kinase, Tropomyosin Related Kinase C Back     alignment and domain information
>cd05115 PTKc_Zap-70 Catalytic domain of the Protein Tyrosine Kinase, Zeta-chain-associated protein of 70kDa Back     alignment and domain information
>cd05034 PTKc_Src_like Catalytic domain of Src kinase-like Protein Tyrosine Kinases Back     alignment and domain information
>cd05576 STKc_RPK118_like Catalytic domain of the Protein Serine/Threonine Kinases, RPK118 and similar proteins Back     alignment and domain information
>cd05051 PTKc_DDR Catalytic domain of the Protein Tyrosine Kinases, Discoidin Domain Receptors Back     alignment and domain information
>PTZ00024 cyclin-dependent protein kinase; Provisional Back     alignment and domain information
>cd05069 PTKc_Yes Catalytic domain of the Protein Tyrosine Kinase, Yes Back     alignment and domain information
>cd07840 STKc_CDK9_like Catalytic domain of Cyclin-Dependent protein Kinase 9-like Serine/Threonine Kinases Back     alignment and domain information
>cd05067 PTKc_Lck_Blk Catalytic domain of the Protein Tyrosine Kinases, Lymphocyte-specific kinase and Blk Back     alignment and domain information
>cd05063 PTKc_EphR_A2 Catalytic domain of the Protein Tyrosine Kinase, Ephrin Receptor A2 Back     alignment and domain information
>smart00332 PP2Cc Serine/threonine phosphatases, family 2C, catalytic domain Back     alignment and domain information
>cd05101 PTKc_FGFR2 Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 2 Back     alignment and domain information
>cd07852 STKc_MAPK15 Catalytic domain of the Serine/Threonine Kinase, Mitogen-Activated Protein Kinase 15 Back     alignment and domain information
>cd07866 STKc_BUR1 Catalytic domain of the Serine/Threonine Kinase, Fungal Cyclin-Dependent protein Kinase Bypass UAS Requirement 1 and similar proteins Back     alignment and domain information
>cd08226 PK_STRAD_beta Pseudokinase domain of STE20-related kinase adapter protein beta Back     alignment and domain information
>KOG1026 consensus Nerve growth factor receptor TRKA and related tyrosine kinases [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>cd05065 PTKc_EphR_B Catalytic domain of the Protein Tyrosine Kinases, Class EphB Ephrin Receptors Back     alignment and domain information
>cd05080 PTKc_Tyk2_rpt2 Catalytic (repeat 2) domain of the Protein Tyrosine Kinase, Tyrosine kinase 2 Back     alignment and domain information
>cd00143 PP2Cc Serine/threonine phosphatases, family 2C, catalytic domain; The protein architecture and deduced catalytic mechanism of PP2C phosphatases are similar to the PP1, PP2A, PP2B family of protein Ser/Thr phosphatases, with which PP2C shares no sequence similarity Back     alignment and domain information
>cd07864 STKc_CDK12 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 12 Back     alignment and domain information
>cd05075 PTKc_Axl Catalytic domain of the Protein Tyrosine Kinase, Axl Back     alignment and domain information
>cd05060 PTKc_Syk_like Catalytic domain of Spleen Tyrosine Kinase-like Protein Tyrosine Kinases Back     alignment and domain information
>cd05118 STKc_CMGC Catalytic domain of CMGC family Serine/Threonine Kinases Back     alignment and domain information
>cd08222 STKc_Nek11 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 11 Back     alignment and domain information
>cd06634 STKc_TAO2 Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids 2 Back     alignment and domain information
>cd05095 PTKc_DDR2 Catalytic domain of the Protein Tyrosine Kinase, Discoidin Domain Receptor 2 Back     alignment and domain information
>cd05050 PTKc_Musk Catalytic domain of the Protein Tyrosine Kinase, Muscle-specific kinase Back     alignment and domain information
>cd05112 PTKc_Itk Catalytic domain of the Protein Tyrosine Kinase, Interleukin-2-inducible T-cell Kinase Back     alignment and domain information
>cd05045 PTKc_RET Catalytic domain of the Protein Tyrosine Kinase, REarranged during Transfection protein Back     alignment and domain information
>cd08216 PK_STRAD Pseudokinase domain of STE20-related kinase adapter protein Back     alignment and domain information
>cd05047 PTKc_Tie Catalytic domain of Tie Protein Tyrosine Kinases Back     alignment and domain information
>cd05097 PTKc_DDR_like Catalytic domain of Discoidin Domain Receptor-like Protein Tyrosine Kinases Back     alignment and domain information
>cd05100 PTKc_FGFR3 Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 3 Back     alignment and domain information
>KOG1035 consensus eIF-2alpha kinase GCN2 [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG1095 consensus Protein tyrosine kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd05073 PTKc_Hck Catalytic domain of the Protein Tyrosine Kinase, Hematopoietic cell kinase Back     alignment and domain information
>KOG0668 consensus Casein kinase II, alpha subunit [Signal transduction mechanisms; Cell cycle control, cell division, chromosome partitioning; Transcription] Back     alignment and domain information
>cd07830 STKc_MAK_like Catalytic domain of Male germ cell-Associated Kinase-like Serine/Threonine Kinases Back     alignment and domain information
>cd05111 PTK_HER3 Pseudokinase domain of the Protein Tyrosine Kinase, HER3 Back     alignment and domain information
>cd05046 PTK_CCK4 Pseudokinase domain of the Protein Tyrosine Kinase, Colon Carcinoma Kinase 4 Back     alignment and domain information
>KOG1187 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0587 consensus Traf2- and Nck-interacting kinase and related germinal center kinase (GCK) family protein kinases [Signal transduction mechanisms] Back     alignment and domain information
>cd07829 STKc_CDK_like Catalytic domain of Cyclin-Dependent protein Kinase-like Serine/Threonine Kinases Back     alignment and domain information
>smart00219 TyrKc Tyrosine kinase, catalytic domain Back     alignment and domain information
>cd05083 PTKc_Chk Catalytic domain of the Protein Tyrosine Kinase, Csk homologous kinase Back     alignment and domain information
>cd05057 PTKc_EGFR_like Catalytic domain of Epidermal Growth Factor Receptor-like Protein Tyrosine Kinases Back     alignment and domain information
>cd05085 PTKc_Fer Catalytic domain of the Protein Tyrosine Kinase, Fer Back     alignment and domain information
>cd05041 PTKc_Fes_like Catalytic domain of Fes-like Protein Tyrosine Kinases Back     alignment and domain information
>KOG0670 consensus U4/U6-associated splicing factor PRP4 [RNA processing and modification] Back     alignment and domain information
>cd05056 PTKc_FAK Catalytic domain of the Protein Tyrosine Kinase, Focal Adhesion Kinase Back     alignment and domain information
>cd05079 PTKc_Jak1_rpt2 Catalytic (repeat 2) domain of the Protein Tyrosine Kinase, Janus kinase 1 Back     alignment and domain information
>cd05043 PTK_Ryk Pseudokinase domain of Ryk (Receptor related to tyrosine kinase) Back     alignment and domain information
>cd05040 PTKc_Ack_like Catalytic domain of the Protein Tyrosine Kinase, Activated Cdc42-associated kinase Back     alignment and domain information
>PF07714 Pkinase_Tyr: Protein tyrosine kinase Protein kinase; unclassified specificity Back     alignment and domain information
>cd05078 PTK_Jak2_Jak3_rpt1 Pseudokinase (repeat 1) domain of the Protein Tyrosine Kinases, Janus kinases 2 and 3 Back     alignment and domain information
>cd05081 PTKc_Jak2_Jak3_rpt2 Catalytic (repeat 2) domain of the Protein Tyrosine Kinases, Janus kinases 2 and 3 Back     alignment and domain information
>PLN03225 Serine/threonine-protein kinase SNT7; Provisional Back     alignment and domain information
>KOG0194 consensus Protein tyrosine kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG4250 consensus TANK binding protein kinase TBK1 [Signal transduction mechanisms] Back     alignment and domain information
>cd05042 PTKc_Aatyk Catalytic domain of the Protein Tyrosine Kinases, Apoptosis-associated tyrosine kinases Back     alignment and domain information
>cd08528 STKc_Nek10 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 10 Back     alignment and domain information
>KOG1151 consensus Tousled-like protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd05077 PTK_Jak1_rpt1 Pseudokinase (repeat 1) domain of the Protein Tyrosine Kinase, Janus kinase 1 Back     alignment and domain information
>cd05058 PTKc_Met_Ron Catalytic domain of the Protein Tyrosine Kinases, Met and Ron Back     alignment and domain information
>cd05044 PTKc_c-ros Catalytic domain of the Protein Tyrosine Kinase, C-ros Back     alignment and domain information
>PHA02882 putative serine/threonine kinase; Provisional Back     alignment and domain information
>cd05038 PTKc_Jak_rpt2 Catalytic (repeat 2) domain of the Protein Tyrosine Kinases, Janus kinases Back     alignment and domain information
>KOG0665 consensus Jun-N-terminal kinase (JNK) [Signal transduction mechanisms] Back     alignment and domain information
>cd05087 PTKc_Aatyk1_Aatyk3 Catalytic domain of the Protein Tyrosine Kinases, Apoptosis-associated tyrosine kinases 1 and 3 Back     alignment and domain information
>cd05110 PTKc_HER4 Catalytic domain of the Protein Tyrosine Kinase, HER4 Back     alignment and domain information
>cd05076 PTK_Tyk2_rpt1 Pseudokinase (repeat 1) domain of the Protein Tyrosine Kinase, Tyrosine kinase 2 Back     alignment and domain information
>cd05074 PTKc_Tyro3 Catalytic domain of the Protein Tyrosine Kinase, Tyro3 Back     alignment and domain information
>cd05037 PTK_Jak_rpt1 Pseudokinase (repeat 1) domain of the Protein Tyrosine Kinases, Janus kinases Back     alignment and domain information
>cd05086 PTKc_Aatyk2 Catalytic domain of the Protein Tyrosine Kinase, Apoptosis-associated tyrosine kinase 2 Back     alignment and domain information
>KOG0984 consensus Mitogen-activated protein kinase (MAPK) kinase MKK3/MKK6 [Signal transduction mechanisms] Back     alignment and domain information
>PLN03224 probable serine/threonine protein kinase; Provisional Back     alignment and domain information
>KOG0196 consensus Tyrosine kinase, EPH (ephrin) receptor family [Signal transduction mechanisms] Back     alignment and domain information
>KOG0603 consensus Ribosomal protein S6 kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG1152 consensus Signal transduction serine/threonine kinase with PAS/PAC sensor domain [Signal transduction mechanisms] Back     alignment and domain information
>smart00220 S_TKc Serine/Threonine protein kinases, catalytic domain Back     alignment and domain information
>KOG0576 consensus Mitogen-activated protein kinase kinase kinase kinase (MAP4K), germinal center kinase family [Signal transduction mechanisms] Back     alignment and domain information
>KOG4257 consensus Focal adhesion tyrosine kinase FAK, contains FERM domain [Signal transduction mechanisms] Back     alignment and domain information
>KOG4278 consensus Protein tyrosine kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0199 consensus ACK and related non-receptor tyrosine kinases [Signal transduction mechanisms] Back     alignment and domain information
>KOG0664 consensus Nemo-like MAPK-related serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG1094 consensus Discoidin domain receptor DDR1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG1027 consensus Serine/threonine protein kinase and endoribonuclease ERN1/IRE1, sensor of the unfolded protein response pathway [Signal transduction mechanisms] Back     alignment and domain information
>KOG1290 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG1345 consensus Serine/threonine kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0200 consensus Fibroblast/platelet-derived growth factor receptor and related receptor tyrosine kinases [Signal transduction mechanisms] Back     alignment and domain information
>KOG1167 consensus Serine/threonine protein kinase of the CDC7 subfamily involved in DNA synthesis, repair and recombination [Replication, recombination and repair] Back     alignment and domain information
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>KOG1323 consensus Serine/threonine phosphatase [Signal transduction mechanisms] Back     alignment and domain information
>KOG3653 consensus Transforming growth factor beta/activin receptor subfamily of serine/threonine kinases [Signal transduction mechanisms] Back     alignment and domain information
>KOG1025 consensus Epidermal growth factor receptor EGFR and related tyrosine kinases [Signal transduction mechanisms] Back     alignment and domain information
>KOG0606 consensus Microtubule-associated serine/threonine kinase and related proteins [Signal transduction mechanisms; General function prediction only] Back     alignment and domain information
>cd00180 PKc Catalytic domain of Protein Kinases Back     alignment and domain information
>smart00221 STYKc Protein kinase; unclassified specificity Back     alignment and domain information
>PLN00181 protein SPA1-RELATED; Provisional Back     alignment and domain information
>KOG2052 consensus Activin A type IB receptor, serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG1163 consensus Casein kinase (serine/threonine/tyrosine protein kinase) [Signal transduction mechanisms] Back     alignment and domain information
>smart00750 KIND kinase non-catalytic C-lobe domain Back     alignment and domain information
>KOG1024 consensus Receptor-like protein tyrosine kinase RYK/derailed [Signal transduction mechanisms] Back     alignment and domain information
>KOG1165 consensus Casein kinase (serine/threonine/tyrosine protein kinase) [Signal transduction mechanisms] Back     alignment and domain information
>COG0515 SPS1 Serine/threonine protein kinase [General function prediction only / Signal transduction mechanisms / Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>KOG0590 consensus Checkpoint kinase and related serine/threonine protein kinases [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PRK09188 serine/threonine protein kinase; Provisional Back     alignment and domain information
>KOG1164 consensus Casein kinase (serine/threonine/tyrosine protein kinase) [Signal transduction mechanisms] Back     alignment and domain information
>PF14531 Kinase-like: Kinase-like; PDB: 3DZO_A 2W1Z_A 3BYV_A 3Q5Z_A 3Q60_A Back     alignment and domain information
>PRK10359 lipopolysaccharide core biosynthesis protein; Provisional Back     alignment and domain information
>PRK12274 serine/threonine protein kinase; Provisional Back     alignment and domain information
>KOG0195 consensus Integrin-linked kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG1240 consensus Protein kinase containing WD40 repeats [Signal transduction mechanisms] Back     alignment and domain information
>KOG4158 consensus BRPK/PTEN-induced protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd05147 RIO1_euk RIO kinase family; eukaryotic RIO1, catalytic domain Back     alignment and domain information
>KOG0606 consensus Microtubule-associated serine/threonine kinase and related proteins [Signal transduction mechanisms; General function prediction only] Back     alignment and domain information
>cd05145 RIO1_like RIO kinase family; RIO1, RIO3 and similar proteins, catalytic domain Back     alignment and domain information
>KOG1379 consensus Serine/threonine protein phosphatase [Signal transduction mechanisms] Back     alignment and domain information
>PRK10345 hypothetical protein; Provisional Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0590 consensus Checkpoint kinase and related serine/threonine protein kinases [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PF13672 PP2C_2: Protein phosphatase 2C; PDB: 2JFT_A 2JFS_A 2V06_A 2JFR_A 2J86_A 2J82_A 2Y09_A 2XZV_A 2CM1_A 1TXO_B Back     alignment and domain information
>KOG1166 consensus Mitotic checkpoint serine/threonine protein kinase [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>smart00090 RIO RIO-like kinase Back     alignment and domain information
>KOG1033 consensus eIF-2alpha kinase PEK/EIF2AK3 [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG1113 consensus cAMP-dependent protein kinase types I and II, regulatory subunit [Signal transduction mechanisms] Back     alignment and domain information
>KOG0614 consensus cGMP-dependent protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>PRK14879 serine/threonine protein kinase; Provisional Back     alignment and domain information
>cd05144 RIO2_C RIO kinase family; RIO2, C-terminal catalytic domain Back     alignment and domain information
>TIGR03724 arch_bud32 Kae1-associated kinase Bud32 Back     alignment and domain information
>cd05119 RIO RIO kinase family, catalytic domain Back     alignment and domain information
>PRK09605 bifunctional UGMP family protein/serine/threonine protein kinase; Validated Back     alignment and domain information
>smart00331 PP2C_SIG Sigma factor PP2C-like phosphatases Back     alignment and domain information
>PRK01723 3-deoxy-D-manno-octulosonic-acid kinase; Reviewed Back     alignment and domain information
>KOG1023 consensus Natriuretic peptide receptor, guanylate cyclase [Signal transduction mechanisms] Back     alignment and domain information
>cd05120 APH_ChoK_like Aminoglycoside 3'-phosphotransferase (APH) and Choline Kinase (ChoK) family Back     alignment and domain information
>PRK09392 ftrB transcriptional activator FtrB; Provisional Back     alignment and domain information
>KOG2968 consensus Predicted esterase of the alpha-beta hydrolase superfamily (Neuropathy target esterase), contains cAMP-binding domains [General function prediction only] Back     alignment and domain information
>cd00038 CAP_ED effector domain of the CAP family of transcription factors; members include CAP (or cAMP receptor protein (CRP)), which binds cAMP, FNR (fumarate and nitrate reduction), which uses an iron-sulfur cluster to sense oxygen) and CooA, a heme containing CO sensor Back     alignment and domain information
>TIGR02865 spore_II_E stage II sporulation protein E Back     alignment and domain information
>PLN03192 Voltage-dependent potassium channel; Provisional Back     alignment and domain information
>PRK11753 DNA-binding transcriptional dual regulator Crp; Provisional Back     alignment and domain information
>PF00027 cNMP_binding: Cyclic nucleotide-binding domain; InterPro: IPR000595 Proteins that bind cyclic nucleotides (cAMP or cGMP) share a structural domain of about 120 residues [, , ] Back     alignment and domain information
>PLN02868 acyl-CoA thioesterase family protein Back     alignment and domain information
>smart00100 cNMP Cyclic nucleotide-monophosphate binding domain Back     alignment and domain information
>COG0664 Crp cAMP-binding proteins - catabolite gene activator and regulatory subunit of cAMP-dependent protein kinases [Signal transduction mechanisms] Back     alignment and domain information
>KOG0601 consensus Cyclin-dependent kinase WEE1 [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0601 consensus Cyclin-dependent kinase WEE1 [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>cd05151 ChoK Choline Kinase (ChoK) Back     alignment and domain information
>PRK10402 DNA-binding transcriptional activator YeiL; Provisional Back     alignment and domain information
>PRK11161 fumarate/nitrate reduction transcriptional regulator; Provisional Back     alignment and domain information
>KOG0498 consensus K+-channel ERG and related proteins, contain PAS/PAC sensor domain [Inorganic ion transport and metabolism; Signal transduction mechanisms] Back     alignment and domain information
>TIGR01982 UbiB 2-polyprenylphenol 6-hydroxylase Back     alignment and domain information
>PRK04750 ubiB putative ubiquinone biosynthesis protein UbiB; Reviewed Back     alignment and domain information
>PRK09392 ftrB transcriptional activator FtrB; Provisional Back     alignment and domain information
>cd05146 RIO3_euk RIO kinase family; eukaryotic RIO3, catalytic domain Back     alignment and domain information
>PF07228 SpoIIE: Stage II sporulation protein E (SpoIIE); InterPro: IPR001932 This domain is found in protein phosphatase 2C, as well as other proteins eg Back     alignment and domain information
>KOG1266 consensus Protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>PF00027 cNMP_binding: Cyclic nucleotide-binding domain; InterPro: IPR000595 Proteins that bind cyclic nucleotides (cAMP or cGMP) share a structural domain of about 120 residues [, , ] Back     alignment and domain information
>cd00038 CAP_ED effector domain of the CAP family of transcription factors; members include CAP (or cAMP receptor protein (CRP)), which binds cAMP, FNR (fumarate and nitrate reduction), which uses an iron-sulfur cluster to sense oxygen) and CooA, a heme containing CO sensor Back     alignment and domain information
>KOG0500 consensus Cyclic nucleotide-gated cation channel CNGA1-3 and related proteins [Inorganic ion transport and metabolism; Signal transduction mechanisms] Back     alignment and domain information
>KOG1243 consensus Protein kinase [General function prediction only] Back     alignment and domain information
>KOG0499 consensus Cyclic nucleotide-gated cation channel CNCG4 [Inorganic ion transport and metabolism; Signal transduction mechanisms] Back     alignment and domain information
>PLN03192 Voltage-dependent potassium channel; Provisional Back     alignment and domain information
>PRK11753 DNA-binding transcriptional dual regulator Crp; Provisional Back     alignment and domain information
>PRK13918 CRP/FNR family transcriptional regulator; Provisional Back     alignment and domain information
>KOG0498 consensus K+-channel ERG and related proteins, contain PAS/PAC sensor domain [Inorganic ion transport and metabolism; Signal transduction mechanisms] Back     alignment and domain information
>PRK09391 fixK transcriptional regulator FixK; Provisional Back     alignment and domain information
>PLN02868 acyl-CoA thioesterase family protein Back     alignment and domain information
>TIGR03697 NtcA_cyano global nitrogen regulator NtcA, cyanobacterial Back     alignment and domain information
>cd05154 ACAD10_11_like Acyl-CoA dehydrogenase (ACAD) 10 and 11, N-terminal domain, and similar proteins Back     alignment and domain information
>COG3642 Mn2+-dependent serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>COG0664 Crp cAMP-binding proteins - catabolite gene activator and regulatory subunit of cAMP-dependent protein kinases [Signal transduction mechanisms] Back     alignment and domain information
>KOG3087 consensus Serine/threonine protein kinase [General function prediction only] Back     alignment and domain information
>KOG0500 consensus Cyclic nucleotide-gated cation channel CNGA1-3 and related proteins [Inorganic ion transport and metabolism; Signal transduction mechanisms] Back     alignment and domain information
>smart00100 cNMP Cyclic nucleotide-monophosphate binding domain Back     alignment and domain information
>COG2905 Predicted signal-transduction protein containing cAMP-binding and CBS domains [Signal transduction mechanisms] Back     alignment and domain information
>PRK10402 DNA-binding transcriptional activator YeiL; Provisional Back     alignment and domain information
>KOG2137 consensus Protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>PRK11161 fumarate/nitrate reduction transcriptional regulator; Provisional Back     alignment and domain information
>PF01163 RIO1: RIO1 family; InterPro: IPR018934 Protein phosphorylation, which plays a key role in most cellular activities, is a reversible process mediated by protein kinases and phosphoprotein phosphatases Back     alignment and domain information
>KOG0499 consensus Cyclic nucleotide-gated cation channel CNCG4 [Inorganic ion transport and metabolism; Signal transduction mechanisms] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query1082
1fot_A318 Structure Of The Unliganded Camp-Dependent Protein 1e-38
1bkx_A350 A Binary Complex Of The Catalytic Subunit Of Camp-D 1e-38
1syk_A350 Crystal Structure Of E230q Mutant Of Camp-Dependent 1e-38
2qur_A350 Crystal Structure Of F327aK285P MUTANT OF CAMP-Depe 1e-38
1jbp_E350 Crystal Structure Of The Catalytic Subunit Of Camp- 2e-38
1fmo_E350 Crystal Structure Of A Polyhistidine-Tagged Recombi 2e-38
2erz_E351 Crystal Structure Of C-amp Dependent Kinase (pka) B 2e-38
3pvb_A345 Crystal Structure Of (73-244)ria:c Holoenzyme Of Ca 2e-38
1l3r_E350 Crystal Structure Of A Transition State Mimic Of Th 2e-38
2gu8_A337 Discovery Of 2-pyrimidyl-5-amidothiophenes As Novel 2e-38
2qcs_A350 A Complex Structure Between The Catalytic And Regul 2e-38
1ctp_E350 Structure Of The Mammalian Catalytic Subunit Of Cam 2e-38
3o7l_B350 Crystal Structure Of Phospholamban (1-19):pka C-Sub 2e-38
2f7e_E351 Pka Complexed With (S)-2-(1h-Indol-3-Yl)-1-(5-Isoqu 2e-38
1apm_E350 2.0 Angstrom Refined Crystal Structure Of The Catal 2e-38
2uzt_A336 Pka Structures Of Akt, Indazole-Pyridine Inhibitors 2e-38
4dg3_E371 Crystal Structure Of R336a Mutant Of Camp-dependent 2e-38
1cdk_A350 Camp-Dependent Protein Kinase Catalytic Subunit (E. 2e-38
4dfx_E350 Crystal Structure Of Myristoylated K7c Catalytic Su 2e-38
1cmk_E350 Crystal Structures Of The Myristylated Catalytic Su 2e-38
4ae6_A343 Structure And Function Of The Human Sperm-specific 3e-38
1q24_A350 Pka Double Mutant Model Of Pkb In Complex With Mgat 3e-38
4dfy_A371 Crystal Structure Of R194a Mutant Of Camp-Dependent 3e-38
3agm_A351 Complex Of Pka With The Bisubstrate Protein Kinase 3e-38
3mvj_A371 Human Cyclic Amp-Dependent Protein Kinase Pka Inhib 3e-38
3agl_A351 Complex Of Pka With The Bisubstrate Protein Kinase 4e-38
4ae9_A343 Structure And Function Of The Human Sperm-specific 4e-38
3l9m_A351 Crystal Structure Of Pkab3 (Pka Triple Mutant V123a 4e-38
1ydt_E350 Structure Of Camp-Dependent Protein Kinase, Alpha-C 7e-38
3qam_E350 Crystal Structure Of Glu208ala Mutant Of Catalytic 8e-38
1svh_A350 Crystal Structure Of Protein Kinase A In Complex Wi 8e-38
1stc_E350 Camp-Dependent Protein Kinase, Alpha-Catalytic Subu 9e-38
2c1a_A351 Structure Of Camp-Dependent Protein Kinase Complexe 9e-38
1q61_A350 Pka Triple Mutant Model Of Pkb Length = 350 1e-37
1xh7_A350 Crystal Structures Of Protein Kinase B Selective In 1e-37
1q8w_A350 The Catalytic Subunit Of Camp-Dependent Protein Kin 1e-37
2jds_A351 Structure Of Camp-Dependent Protein Kinase Complexe 1e-37
3dnd_A350 Camp-Dependent Protein Kinase Pka Catalytic Subunit 1e-37
3qal_E350 Crystal Structure Of Arg280ala Mutant Of Catalytic 1e-37
3fhi_A350 Crystal Structure Of A Complex Between The Catalyti 1e-37
1szm_A350 Dual Binding Mode Of Bisindolylmaleimide 2 To Prote 1e-37
3nx8_A351 Human Camp Dependent Protein Kinase In Complex With 2e-37
2jdt_A351 Structure Of Pka-Pkb Chimera Complexed With Isoquin 2e-37
2vo0_A351 Structure Of Pka-Pkb Chimera Complexed With C-(4-(4 2e-37
1j3h_A350 Crystal Structure Of Apoenzyme Camp-Dependent Prote 2e-37
1rdq_E350 Hydrolysis Of Atp In The Crystal Of Y204a Mutant Of 2e-37
2uvy_A351 Structure Of Pka-pkb Chimera Complexed With Methyl- 2e-37
1smh_A350 Protein Kinase A Variant Complex With Completely Or 2e-37
3ama_A351 Protein Kinase A Sixfold Mutant Model Of Aurora B W 2e-37
2gnj_A350 Pka Three Fold Mutant Model Of Rho-Kinase With Y-27 4e-37
2gng_A350 Protein Kinase A Fivefold Mutant Model Of Rho-Kinas 5e-37
2gnf_A350 Protein Kinase A Fivefold Mutant Model Of Rho-Kinas 5e-37
1xh9_A350 Crystal Structures Of Protein Kinase B Selective In 8e-37
1mrv_A339 Crystal Structure Of An Inactive Akt2 Kinase Domain 5e-32
3a60_A327 Crystal Structure Of Unphosphorylated P70s6k1 (Form 1e-31
4dc2_A396 Structure Of Pkc In Complex With A Substrate Peptid 2e-31
1gzn_A335 Structure Of Pkb Kinase Domain Length = 335 2e-31
1gzk_A315 Molecular Mechanism For The Regulation Of Protein K 3e-31
3a62_A327 Crystal Structure Of Phosphorylated P70s6k1 Length 6e-31
1o6l_A337 Crystal Structure Of An Activated Akt/protein Kinas 7e-31
1o6k_A336 Structure Of Activated Form Of Pkb Kinase Domain S4 9e-31
2jdo_A342 Structure Of Pkb-Beta (Akt2) Complexed With Isoquin 9e-31
3zh8_A349 A Novel Small Molecule Apkc Inhibitor Length = 349 1e-30
3e87_A335 Crystal Structures Of The Kinase Domain Of Akt2 In 1e-30
3a8w_A345 Crystal Structure Of Pkciota Kinase Domain Length = 2e-30
3txo_A353 Pkc Eta Kinase In Complex With A Naphthyridine Leng 3e-30
2jed_A352 The Crystal Structure Of The Kinase Domain Of The P 9e-30
3g51_A325 Structural Diversity Of The Active Conformation Of 1e-29
1zrz_A364 Crystal Structure Of The Catalytic Domain Of Atypic 1e-29
2qvs_B310 Crystal Structure Of Type Iia Holoenzyme Of Camp-De 1e-29
3ubd_A304 Structure Of N-Terminal Domain Of Rsk2 Kinase In Co 1e-29
4el9_A305 Structure Of N-Terminal Kinase Domain Of Rsk2 With 2e-29
2f2u_A402 Crystal Structure Of The Rho-Kinase Kinase Domain L 2e-29
3iw4_A360 Crystal Structure Of Pkc Alpha In Complex With Nvp- 3e-29
1vzo_A355 The Structure Of The N-Terminal Kinase Domain Of Ms 5e-29
1xjd_A345 Crystal Structure Of Pkc-Theta Complexed With Staur 7e-29
3v8s_A410 Human Rho-Associated Protein Kinase 1 (Rock 1) In C 3e-28
2esm_A415 Crystal Structure Of Rock 1 Bound To Fasudil Length 3e-28
2v55_A406 Mechanism Of Multi-site Phosphorylation From A Rock 3e-28
2z7q_A321 Crystal Structure Of The N-Terminal Kinase Domain O 5e-28
4a07_A311 Human Pdk1 Kinase Domain In Complex With Allosteric 5e-28
3ocb_A341 Akt1 Kinase Domain With Pyrrolopyrimidine Inhibitor 6e-28
2i0e_A353 Structure Of Catalytic Domain Of Human Protein Kina 7e-28
3pfq_A674 Crystal Structure And Allosteric Activation Of Prot 7e-28
3pwy_A311 Crystal Structure Of An Extender (Spd28345)-Modifie 7e-28
3hrc_A311 Crystal Structure Of A Mutant Of Human Pdk1 Kinase 7e-28
3o96_A446 Crystal Structure Of Human Akt1 With An Allosteric 8e-28
3nax_A311 Pdk1 In Complex With Inhibitor Mp7 Length = 311 9e-28
1z5m_A286 Crystal Structure Of N1-[3-[[5-bromo-2-[[3-[(1-pyrr 1e-27
1uu9_A286 Structure Of Human Pdk1 Kinase Domain In Complex Wi 1e-27
3nus_A286 Phosphoinositide-Dependent Kinase-1 (Pdk1) With Fra 1e-27
1h1w_A289 High Resolution Crystal Structure Of The Human Pdk1 1e-27
2r7b_A312 Crystal Structure Of The Phosphoinositide-Dependent 1e-27
2vd5_A412 Structure Of Human Myotonic Dystrophy Protein Kinas 1e-27
3nun_A292 Phosphoinositide-Dependent Kinase-1 (Pdk1) With Lea 1e-27
3nay_A311 Pdk1 In Complex With Inhibitor Mp6 Length = 311 2e-27
2biy_A310 Structure Of Pdk1-S241a Mutant Kinase Domain Length 2e-27
4ejn_A446 Crystal Structure Of Autoinhibited Form Of Akt1 In 2e-27
1uu3_A310 Structure Of Human Pdk1 Kinase Domain In Complex Wi 2e-27
2xck_A309 Crystal Structure Of Pdk1 In Complex With A Pyrazol 2e-27
3h9o_A311 Phosphoinositide-Dependent Protein Kinase 1 (Pdk-1) 2e-27
2xch_A309 Crystal Structure Of Pdk1 In Complex With A Pyrazol 2e-27
3rwp_A311 Discovery Of A Novel, Potent And Selective Inhibito 2e-27
3sc1_A311 Novel Isoquinolone Pdk1 Inhibitors Discovered Throu 2e-27
3iop_A312 Pdk-1 In Complex With The Inhibitor Compound-8i Len 2e-27
3orx_A316 Pdk1 Mutant Bound To Allosteric Disulfide Fragment 2e-27
4gv1_A340 Pkb Alpha In Complex With Azd5363 Length = 340 3e-27
3cqu_A342 Crystal Structure Of Akt-1 Complexed With Substrate 5e-27
3cik_A 689 Human Grk2 In Complex With Gbetagamma Subunits Leng 6e-27
3krw_A 688 Human Grk2 In Complex With Gbetgamma Subunits And B 6e-27
4aw2_A437 Crystal Structure Of Cdc42 Binding Protein Kinase A 7e-27
1omw_A 689 Crystal Structure Of The Complex Between G Protein- 7e-27
3psc_A 695 Bovine Grk2 In Complex With Gbetagamma Subunits Len 7e-27
3qc4_A314 Pdk1 In Complex With Dfg-Out Inhibitor Xxx Length = 8e-27
1cx4_A305 Crystal Structure Of A Deletion Mutant Of The Type 4e-26
3tku_A433 Mrck Beta In Complex With Fasudil Length = 433 8e-26
3qfv_A415 Mrck Beta In Complex With Tpca-1 Length = 415 9e-26
3of1_A246 Crystal Structure Of Bcy1, The Yeast Regulatory Sub 2e-25
3tnp_B416 Structure And Allostery Of The Pka Riib Tetrameric 2e-25
3tnq_A416 Structure And Allostery Of The Pka Riib Tetrameric 2e-25
2qcs_B291 A Complex Structure Between The Catalytic And Regul 2e-24
1rl3_A288 Crystal Structure Of Camp-free R1a Subunit Of Pka L 2e-24
1ne4_A283 Crystal Structure Of Rp-Camp Binding R1a Subunit Of 2e-24
2r5t_A373 Crystal Structure Of Inactive Serum And Glucocortic 3e-24
4din_B381 Novel Localization And Quaternary Structure Of The 9e-23
3nyn_A576 Crystal Structure Of G Protein-Coupled Receptor Kin 1e-22
2acx_A576 Crystal Structure Of G Protein Coupled Receptor Kin 1e-22
3zgw_A347 Crystal Structure Of Maternal Embryonic Leucine Zip 5e-22
4fr4_A384 Crystal Structure Of Human SerineTHREONINE-Protein 5e-21
3shr_A299 Crystal Structure Of Cgmp-Dependent Protein Kinase 3e-20
3coh_A268 Crystal Structure Of Aurora-A In Complex With A Pen 4e-20
3d14_A272 Crystal Structure Of Mouse Aurora A (Asn186->gly, L 5e-20
3daj_A272 Crystal Structure Of Aurora A Complexed With An Inh 7e-20
3t8o_A543 Rhodopsin Kinase (grk1) L166k Mutant At 2.5a Resolu 9e-20
3c4x_A543 Crystal Structure Of G Protein Coupled Receptor Kin 9e-20
1muo_A297 Crystal Structure Of Aurora-2, An Oncogenic Serine- 9e-20
3c4w_A543 Crystal Structure Of G Protein Coupled Receptor Kin 1e-19
3qc9_A543 Crystal Structure Of Cross-Linked Bovine Grk1 T8cN4 1e-19
2j4z_A306 Structure Of Aurora-2 In Complex With Pha-680626 Le 1e-19
2j50_A280 Structure Of Aurora-2 In Complex With Pha-739358 Le 1e-19
3o50_A267 Crystal Structure Of Benzamide 9 Bound To Auroraa L 1e-19
2w1d_A275 Structure Determination Of Aurora Kinase In Complex 1e-19
2dwb_A285 Aurora-A Kinase Complexed With Amppnp Length = 285 1e-19
2xng_A283 Structure Of Aurora-A Bound To A Selective Imidazop 2e-19
2x6d_A285 Aurora-A Bound To An Inhibitor Length = 285 2e-19
1mq4_A272 Crystal Structure Of Aurora-A Protein Kinase Length 2e-19
3unz_A279 Aurora A In Complex With Rpm1679 Length = 279 2e-19
2wnt_A330 Crystal Structure Of The Human Ribosomal Protein S6 3e-19
3rny_A346 Crystal Structure Of Human Rsk1 C-Terminal Kinase D 4e-19
1ol5_A282 Structure Of Aurora-A 122-403, Phosphorylated On Th 4e-19
2qr8_A342 2.0a X-ray Structure Of C-terminal Kinase Domain Of 4e-19
2xne_A272 Structure Of Aurora-A Bound To An Imidazopyrazine I 4e-19
2wqe_A262 Structure Of S155r Aurora-A Somatic Mutant Length = 5e-19
1ol6_A282 Structure Of Unphosphorylated D274n Mutant Of Auror 5e-19
3ha6_A268 Crystal Structure Of Aurora A In Complex With Tpx2 5e-19
2w1c_A275 Structure Determination Of Aurora Kinase In Complex 5e-19
2xru_A280 Aurora-A T288e Complexed With Pha-828300 Length = 2 6e-19
3e5a_A268 Crystal Structure Of Aurora A In Complex With Vx-68 6e-19
3h0y_A268 Aurora A In Complex With A Bisanilinopyrimidine Len 6e-19
2bfx_B284 Mechanism Of Aurora-B Activation By Incenp And Inhi 7e-19
2vrx_A285 Structure Of Aurora B Kinase In Complex With Zm4474 7e-19
3fdn_A279 Structure-Based Drug Design Of Novel Aurora Kinase 7e-19
2c6d_A275 Aurora A Kinase Activated Mutant (T287d) In Complex 7e-19
2bfy_A284 Complex Of Aurora-B With Incenp And Hesperidin. Len 7e-19
3nrm_A283 Imidazo[1,2-A]pyrazine-Based Aurora Kinase Inhibito 8e-19
2bmc_A306 Aurora-2 T287d T288d Complexed With Pha-680632 Leng 8e-19
3lau_A287 Crystal Structure Of Aurora2 Kinase In Complex With 9e-19
2c6e_A283 Aurora A Kinase Activated Mutant (T287d) In Complex 9e-19
2wtw_A285 Aurora-A Inhibitor Structure (2nd Crystal Form) Len 1e-18
3r21_A271 Design, Synthesis, And Biological Evaluation Of Pyr 1e-18
4da1_A389 Crystal Structure Of Branched-Chain Alpha-Ketoacid 2e-18
3qbn_A281 Structure Of Human Aurora A In Complex With A Diami 2e-18
2iq1_A274 Crystal Structure Of Human Ppm1k Length = 274 3e-18
3nmv_B324 Crystal Structure Of Pyrabactin-Bound Abscisic Acid 4e-18
2qr7_A342 2.0a X-Ray Structure Of C-Terminal Kinase Domain Of 6e-18
3kn5_A325 Crystal Structure Of The C-Terminal Kinase Domain O 7e-18
3dae_A283 Crystal Structure Of Phosphorylated Snf1 Kinase Dom 1e-17
3hyh_A275 Crystal Structure Of The Protein Kinase Domain Of Y 1e-17
3mn3_A271 An Inhibited Conformation For The Protein Kinase Do 1e-17
2fh9_A274 Structure And Dimerization Of The Kinase Domain Fro 1e-17
3cok_A278 Crystal Structure Of Plk4 Kinase Length = 278 2e-17
1ql6_A298 The Catalytic Mechanism Of Phosphorylase Kinase Pro 2e-17
3kdj_B316 Complex Structure Of (+)-Aba-Bound Pyl1 And Abi1 Le 2e-17
1zmu_A327 Catalytic And Ubiqutin-Associated Domains Of Mark2P 3e-17
2r0i_A327 Crystal Structure Of A Kinase Mark2PAR-1 Mutant Len 3e-17
1zmv_A327 Catalytic And Ubiqutin-Associated Domains Of Mark2P 3e-17
2xk9_A322 Structural Analysis Of Checkpoint Kinase 2 (Chk2) I 3e-17
2ycr_A323 Crystal Structure Of Checkpoint Kinase 2 In Complex 3e-17
1phk_A298 Two Structures Of The Catalytic Domain Of Phosphory 3e-17
2w0j_A323 Crystal Structure Of Chk2 In Complex With Nsc 10955 3e-17
2ycf_A322 Crystal Structure Of Checkpoint Kinase 2 In Complex 4e-17
3jrq_A326 Crystal Structure Of (+)-aba-bound Pyl1 In Complex 4e-17
3nmn_B319 Crystal Structure Of Pyrabactin-Bound Abscisic Acid 4e-17
2cn5_A329 Crystal Structure Of Human Chk2 In Complex With Adp 4e-17
2v5q_A315 Crystal Structure Of Wild-type Plk-1 Kinase Domain 4e-17
2yac_A311 Crystal Structure Of Polo-Like Kinase 1 In Complex 5e-17
3kb7_A311 Crystal Structure Of Polo-Like Kinase 1 In Complex 5e-17
3h4j_B336 Crystal Structure Of Pombe Ampk Kdaid Fragment Leng 5e-17
2phk_A277 The Crystal Structure Of A Phosphorylase Kinase Pep 5e-17
2wtv_A285 Aurora-A Inhibitor Structure Length = 285 6e-17
3iec_A319 Helicobacter Pylori Caga Inhibits Par1MARK FAMILY K 8e-17
2y7j_A365 Structure Of Human Phosphorylase Kinase, Gamma 2 Le 9e-17
1zmw_A327 Catalytic And Ubiqutin-Associated Domains Of Mark2P 1e-16
3i6w_A443 Structure And Activation Mechanism Of The Chk2 Dna- 1e-16
3i6u_A419 Structure And Activation Mechanism Of The Chk2 Dna- 1e-16
2wzj_A327 Catalytic And Uba Domain Of Kinase Mark2(PAR-1) K82 1e-16
3thb_A333 Structure Of Plk1 Kinase Domain In Complex With A B 2e-16
2ou7_A335 Structure Of The Catalytic Domain Of Human Polo-Lik 2e-16
3idb_B161 Crystal Structure Of (108-268)riib:c Holoenzyme Of 2e-16
2hw6_A307 Crystal Structure Of Mnk1 Catalytic Domain Length = 2e-16
2rku_A294 Structure Of Plk1 In Complex With Bi2536 Length = 2 2e-16
3soa_A 444 Full-Length Human Camkii Length = 444 3e-16
3idc_B164 Crystal Structure Of (102-265)riib:c Holoenzyme Of 3e-16
1y8g_A327 Catalytic And Ubiqutin-Associated Domains Of Mark2P 3e-16
4af3_A292 Human Aurora B Kinase In Complex With Incenp And Vx 4e-16
2wel_A327 Crystal Structure Of Su6656-Bound CalciumCALMODULIN 5e-16
2vz6_A313 Structure Of Human Calcium Calmodulin Dependent Pro 5e-16
2vn9_A301 Crystal Structure Of Human Calcium Calmodulin Depen 6e-16
2qnj_A328 Kinase And Ubiquitin-Associated Domains Of Mark3PAR 8e-16
3bhh_A295 Crystal Structure Of Human Calcium/calmodulin-depen 1e-15
3fhi_B154 Crystal Structure Of A Complex Between The Catalyti 1e-15
2y94_A 476 Structure Of An Active Form Of Mammalian Ampk Lengt 1e-15
3pvb_B160 Crystal Structure Of (73-244)ria:c Holoenzyme Of Ca 2e-15
3d5u_A317 Crystal Structure Of A Wildtype Polo-Like Kinase 1 2e-15
3fe3_A328 Crystal Structure Of The Kinase Mark3PAR-1: T211a-S 2e-15
2jam_A304 Crystal Structure Of Human Calmodulin-Dependent Pro 5e-15
3d5w_A317 Crystal Structure Of A Phosphorylated Polo-Like Kin 8e-15
3d5v_A317 Crystal Structure Of An Activated (Thr->asp) Polo-L 1e-14
3db6_A301 Crystal Structure Of An Activated (Thr->asp) Polo-L 1e-14
3qn1_B337 Crystal Structure Of The Pyr1 Abscisic Acid Recepto 2e-14
4ds8_B343 Complex Structure Of Abscisic Acid Receptor Pyl3-(+ 2e-14
3kb3_B321 Crystal Structure Of Abscisic Acid-Bound Pyl2 In Co 2e-14
2hak_A328 Catalytic And Ubiqutin-Associated Domains Of Mark1P 2e-14
3nmt_B341 Crystal Structure Of Pyrabactin Bound Abscisic Acid 2e-14
3ujg_B350 Crystal Structure Of Snrk2.6 In Complex With Hab1 L 2e-14
2v7o_A336 Crystal Structure Of Human Calcium-Calmodulin-Depen 2e-14
2h6d_A276 Protein Kinase Domain Of The Human 5'-Amp-Activated 3e-14
2ac3_A316 Structure Of Human Mnk2 Kinase Domain Length = 316 3e-14
3lij_A 494 Crystal Structure Of Full Length Cpcdpk3 (Cgd5_820) 3e-14
2ac5_A316 Structure Of Human Mnk2 Kinase Domain Mutant D228g 4e-14
3rt0_A340 Crystal Structure Of Pyl10-Hab1 Complex In The Abse 7e-14
2yza_A276 Crystal Structure Of Kinase Domain Of Human 5'-Amp- 1e-13
2i0o_A304 Crystal Structure Of Anopheles Gambiae SerTHR PHOSP 2e-13
3uto_A 573 Twitchin Kinase Region From C.Elegans (Fn31-Nl-Kin- 6e-13
2zv2_A298 Crystal Structure Of Human CalciumCALMODULIN-Depend 6e-13
2ya9_A361 Crystal Structure Of The Autoinhibited Form Of Mous 7e-13
1koa_A 491 Twitchin Kinase Fragment (C.Elegans), Autoregulated 7e-13
3igo_A 486 Crystal Structure Of Cryptosporidium Parvum Cdpk1, 8e-13
3q5i_A 504 Crystal Structure Of Pbanka_031420 Length = 504 9e-13
2a27_A321 Human Drp-1 Kinase, W305s S308a D40 Mutant, Crystal 1e-12
1wmk_A321 Human Death-Associated Kinase Drp-1, Mutant S308d D 1e-12
3kk9_A282 Camkii Substrate Complex B Length = 282 2e-12
3kk8_A284 Camkii Substrate Complex A Length = 284 2e-12
1z9x_A321 Human Drp-1 Kinase, W305s S308a D40 Mutant, Crystal 2e-12
2bdw_A362 Crystal Structure Of The Auto-Inhibited Kinase Doma 2e-12
3kl8_A269 Camkiintide Inhibitor Complex Length = 269 2e-12
2a2a_A321 High-resolution Crystallographic Analysis Of The Au 2e-12
2wei_A287 Crystal Structure Of The Kinase Domain Of Cryptospo 2e-12
1zws_A288 Crystal Structure Of The Catalytic Domain Of Human 2e-12
3dfa_A286 Crystal Structure Of Kinase Domain Of Calcium-depen 2e-12
3r1n_A317 Mk3 Kinase Bound To Compound 5b Length = 317 3e-12
3i79_A 484 Calcium-Dependent Protein Kinase 1 From Toxoplasma 3e-12
3fhr_A336 High Resolution Crystal Structure Of Mitogen-Activa 3e-12
2c30_A321 Crystal Structure Of The Human P21-Activated Kinase 5e-12
3ku2_A 507 Crystal Structure Of Inactivated Form Of Cdpk1 From 5e-12
3hx4_A 508 Crystal Structure Of Cdpk1 Of Toxoplasma Gondii, Tg 6e-12
3ma6_A298 Crystal Structure Of Kinase Domain Of Tgcdpk1 In Pr 6e-12
2jc6_A334 Crystal Structure Of Human Calmodulin-Dependent Pro 8e-12
4fie_A423 Full-Length Human Pak4 Length = 423 8e-12
1yhs_A273 Crystal Structure Of Pim-1 Bound To Staurosporine L 9e-12
3hzt_A 467 Crystal Structure Of Toxoplasma Gondii Cdpk3, Tgme4 1e-11
4dtk_A276 Novel And Selective Pan-Pim Kinase Inhibitor Length 1e-11
1yxs_A293 Crystal Structure Of Kinase Pim1 With P123m Mutatio 1e-11
4alu_A328 Benzofuropyrimidinone Inhibitors Of Pim-1 Length = 1e-11
3jxw_A294 Discovery Of 3h-Benzo[4,5]thieno[3,2-D]pyrimidin-4- 1e-11
3uix_A298 Crystal Structure Of Pim1 Kinase In Complex With Sm 1e-11
1kob_A387 Twitchin Kinase Fragment (Aplysia), Autoregulated P 1e-11
1ywv_A293 Crystal Structures Of Proto-Oncogene Kinase Pim1: A 1e-11
3r00_A299 The Discovery Of Novel Benzofuran-2-Carboxylic Acid 1e-11
1xqz_A300 Crystal Structure Of Hpim-1 Kinase At 2.1 A Resolut 1e-11
3c4e_A273 Pim-1 Kinase Domain In Complex With 3-Aminophenyl-7 1e-11
1xws_A313 Crystal Structure Of The Human Pim1 Kinase Domain L 1e-11
2xj0_A301 Protein Kinase Pim-1 In Complex With Fragment-4 Fro 1e-11
3f2a_A300 Crystal Structure Of Human Pim-1 In Complex With Da 1e-11
4alv_A328 Benzofuropyrimidinone Inhibitors Of Pim-1 Length = 2e-11
3uc3_A361 The Crystal Structure Of Snf1-Related Kinase 2.3 Le 2e-11
3i7c_A 484 Calcium-Dependent Protein Kinase 1 From Toxoplasma 2e-11
2q0n_A301 Structure Of Human P21 Activating Kinase 4 (Pak4) I 2e-11
3q4z_A306 Structure Of Unphosphorylated Pak1 Kinase Domain Le 2e-11
2iwi_A312 Crystal Structure Of The Human Pim2 In Complex With 2e-11
2cdz_A303 Crystal Structure Of The Human P21-Activated Kinase 2e-11
3a99_A320 Structure Of Pim-1 Kinase Crystallized In The Prese 2e-11
2xiy_A301 Protein Kinase Pim-1 In Complex With Fragment-2 Fro 2e-11
4fif_A346 Catalytic Domain Of Human Pak4 With Rpkplvdp Peptid 2e-11
3dxn_A287 Crystal Structure Of The Calcium-dependent Kinase F 2e-11
3dcv_A328 Crystal Structure Of Human Pim1 Kinase Complexed Wi 2e-11
4a7c_A308 Crystal Structure Of Pim1 Kinase With Etp46546 Leng 2e-11
2obj_A333 Crystal Structure Of Human Pim-1 Kinase In Complex 2e-11
2x4z_A296 Crystal Structure Of The Human P21-Activated Kinase 2e-11
2bva_A292 Crystal Structure Of The Human P21-Activated Kinase 2e-11
2x0g_A334 X-ray Structure Of A Dap-kinase Calmodulin Complex 2e-11
2w4k_A302 X-Ray Structure Of A Dap-Kinase 2-302 Length = 302 2e-11
2xix_A301 Protein Kinase Pim-1 In Complex With Fragment-1 Fro 2e-11
2clq_A295 Structure Of Mitogen-Activated Protein Kinase Kinas 2e-11
1p4f_A293 Death Associated Protein Kinase Catalytic Domain Wi 2e-11
1f3m_C297 Crystal Structure Of Human SerineTHREONINE KINASE P 2e-11
3dfc_B295 Crystal Structure Of A Glycine-Rich Loop Mutant Of 3e-11
1ig1_A294 1.8a X-Ray Structure Of Ternary Complex Of A Cataly 3e-11
2yak_A285 Structure Of Death-Associated Protein Kinase 1 (Dap 3e-11
3jpv_A313 Crystal Structure Of Human Proto-Oncogene Serine Th 3e-11
3f5u_A295 Crystal Structure Of The Death Associated Protein K 3e-11
3gu4_A295 Crystal Structure Of Dapkq23v-Amppnp Length = 295 3e-11
3cxw_A314 Crystal Structure Of Human Proto-Oncogene Serine Th 3e-11
2j2i_B312 Crystal Structure Of The Humab Pim1 In Complex With 3e-11
2bil_B313 The Human Protein Kinase Pim1 In Complex With Its C 3e-11
4as0_A273 Cyclometalated Phthalimides As Protein Kinase Inhib 3e-11
3ma3_A313 Crystal Structure Of Human Proto-Oncogene Serine Th 3e-11
2bik_B313 Human Pim1 Phosphorylated On Ser261 Length = 313 3e-11
3cy3_A314 Crystal Structure Of Human Proto-Oncogene Serine Th 3e-11
3gu8_A295 Crystal Structure Of Dapkl93g With N6-Cyclopentylad 3e-11
2xzs_A312 Death Associated Protein Kinase 1 Residues 1-312 Le 3e-11
2y0a_A326 Structure Of Dapk1 Construct Residues 1-304 Length 4e-11
4fg9_A320 Crystal Structure Of Human Calcium/calmodulin-depen 4e-11
4fg8_A315 Crystal Structure Of Human Calcium/calmodulin-depen 4e-11
3vw6_A269 Crystal Structure Of Human Apoptosis Signal-Regulat 4e-11
1wvw_A278 Crystal Structures Of Kinase Domain Of Dap Kinase I 4e-11
2w4j_A277 X-Ray Structure Of A Dap-Kinase 2-277 Length = 277 4e-11
1a06_A332 Calmodulin-Dependent Protein Kinase From Rat Length 5e-11
2f57_A317 Crystal Structure Of The Human P21-activated Kinase 5e-11
2xuu_A334 Crystal Structure Of A Dap-Kinase 1 Mutant Length = 6e-11
4fg7_A293 Crystal Structure Of Human Calcium/calmodulin-depen 6e-11
2wtk_C305 Structure Of The Heterotrimeric Lkb1-Stradalpha-Mo2 7e-11
1kwp_A400 Crystal Structure Of Mapkap2 Length = 400 8e-11
2w4o_A349 Crystal Structure Of Human Camk4 In Complex With 4- 8e-11
2oza_A356 Structure Of P38alpha Complex Length = 356 9e-11
3fxz_A297 Crystal Structure Of Pak1 Kinase Domain With Ruthen 9e-11
2p3g_X327 Crystal Structure Of A Pyrrolopyridine Inhibitor Bo 9e-11
2pzy_A324 Structure Of Mk2 Complexed With Compound 76 Length 9e-11
3r2b_A318 Mk2 Kinase Bound To Compound 5b Length = 318 9e-11
3r2y_A319 Mk2 Kinase Bound To Compound 1 Length = 319 1e-10
3uc4_A362 The Crystal Structure Of Snf1-Related Kinase 2.6 Le 1e-10
3q52_A306 Structure Of Phosphorylated Pak1 Kinase Domain Leng 1e-10
3udb_A317 Crystal Structure Of Snrk2.6 Length = 317 1e-10
3fpm_A325 Crystal Structure Of A Squarate Inhibitor Bound To 1e-10
2jbo_A326 Protein Kinase Mk2 In Complex With An Inhibitor (Cr 1e-10
3ujg_A361 Crystal Structure Of Snrk2.6 In Complex With Hab1 L 1e-10
2onl_C406 Crystal Structure Of The P38a-Mapkap Kinase 2 Heter 1e-10
1yhv_A297 Crystal Structure Of Pak1 Kinase Domain With Two Po 1e-10
3gok_A334 Binding Site Mapping Of Protein Ligands Length = 33 2e-10
3ka0_A320 Mk2 Complex With Inhibitor 6-(5-(2-Aminopyrimidin-4 2e-10
3ori_A311 Mycobacterium Tuberculosis Pknb Kinase Domain L33d 2e-10
3f61_A311 Crystal Structure Of M. Tuberculosis Pknb Leu33aspV 2e-10
1mru_A311 Intracellular SerTHR PROTEIN KINASE DOMAIN OF Mycob 2e-10
3is5_A285 Crystal Structure Of Cdpk Kinase Domain From Toxopl 2e-10
3f69_A311 Crystal Structure Of The Mycobacterium Tuberculosis 2e-10
3f3z_A277 Crystal Structure Of Cryptosporidium Parvum Calcium 3e-10
1nxk_A400 Crystal Structure Of Staurosporine Bound To Map Kap 3e-10
2qg5_A294 Cryptosporidium Parvum Calcium Dependent Protein Ki 3e-10
2hog_A322 Crystal Structure Of Chek1 In Complex With Inhibito 3e-10
1o6y_A299 Catalytic Domain Of Pknb Kinase From Mycobacterium 3e-10
3hko_A345 Crystal Structure Of A Cdpk Kinase Domain From Cryp 3e-10
2r0u_A323 Crystal Structure Of Chek1 In Complex With Inhibito 3e-10
3aln_A327 Crystal Structure Of Human Non-Phosphorylated Mkk4 4e-10
1yrp_A278 Catalytic Domain Of Human Zip Kinase Phosphorylated 4e-10
3orm_A311 Mycobacterium Tuberculosis Pknb Kinase Domain D76a 4e-10
3bhy_A283 Crystal Structure Of Human Death Associated Protein 5e-10
1tki_A321 Autoinhibited Serine Kinase Domain Of The Giant Mus 5e-10
2j90_A304 Crystal Structure Of Human Zip Kinase In Complex Wi 5e-10
3zut_A362 The Structure Of Ost1 (D160a) Kinase Length = 362 6e-10
2pnq_A467 Crystal Structure Of Pyruvate Dehydrogenase Phospha 6e-10
3mfr_A351 Cask-4m Cam Kinase Domain, Native Length = 351 7e-10
3mq3_A467 Crystal Structure Of Native Bovine Pdp1c Length = 4 8e-10
3zuu_A362 The Structure Of Ost1 (D160a, S175d) Kinase In Comp 1e-09
3ocp_A139 Crystal Structure Of Camp Bound Cgmp-Dependent Prot 2e-09
4eqm_A294 Structural Analysis Of Staphylococcus Aureus Serine 2e-09
2w5a_A279 Human Nek2 Kinase Adp-Bound Length = 279 3e-09
3c0g_A351 Cask Cam-kinase Domain- 3'-amp Complex, P1 Form Len 5e-09
3tac_A361 Crystal Structure Of The Liprin-AlphaCASK COMPLEX L 5e-09
3vn9_A340 Rifined Crystal Structure Of Non-Phosphorylated Map 9e-09
2jav_A279 Human Kinase With Pyrrole-Indolinone Ligand Length 1e-08
3fxj_A390 Crystal Structure Of Human Protein Phosphatase 1a ( 1e-08
2wqm_A310 Structure Of Apo Human Nek7 Length = 310 1e-08
1a6q_A382 Crystal Structure Of The Protein SerineTHREONINE PH 1e-08
3dls_A335 Crystal Structure Of Human Pas Kinase Bound To Adp 1e-08
4a4x_A279 Nek2-Ede Bound To Cct248662 Length = 279 1e-08
2p8e_A307 Crystal Structure Of The SerineTHREONINE PHOSPHATAS 2e-08
3fme_A290 Crystal Structure Of Human Mitogen-Activated Protei 7e-08
4fsu_A279 Crystal Structure Of The Chk1 Length = 279 8e-08
4fsm_A279 Crystal Structure Of The Chk1 Length = 279 8e-08
4fsn_A278 Crystal Structure Of The Chk1 Length = 278 8e-08
4fsy_A279 Crystal Structure Of The Chk1 Length = 279 8e-08
2ghg_A269 H-Chk1 Complexed With A431994 Length = 269 9e-08
3e7o_A360 Crystal Structure Of Jnk2 Length = 360 9e-08
2x8e_A276 Discovery Of A Novel Class Of Triazolones As Checkp 9e-08
2e9v_A268 Structure Of H-Chk1 Complexed With A859017 Length = 9e-08
2br1_A297 Structure-Based Design Of Novel Chk1 Inhibitors: In 9e-08
1ia8_A289 The 1.7 A Crystal Structure Of Human Cell Cycle Che 9e-08
1zlt_A295 Crystal Structure Of Chk1 Complexed With A Hymenald 9e-08
3jvr_A271 Characterization Of The Chk1 Allosteric Inhibitor B 9e-08
3ot3_A273 X-Ray Crystal Structure Of Compound 22k Bound To Hu 9e-08
1zys_A273 Co-Crystal Structure Of Checkpoint Kinase Chk1 With 1e-07
2ayp_A269 Crystal Structure Of Chk1 With An Indol Inhibitor L 1e-07
2x4f_A373 The Crystal Structure Of The Human Myosin Light Cha 1e-07
3npc_A364 Crystal Structure Of Jnk2 Complexed With Birb796 Le 2e-07
3coi_A353 Crystal Structure Of P38delta Kinase Length = 353 3e-07
3com_A314 Crystal Structure Of Mst1 Kinase Length = 314 3e-07
4exu_A371 Mapk13, Inactive Form Length = 371 3e-07
2qc6_A332 Protein Kinase Ck2 In Complex With Dbc Length = 332 3e-07
1daw_A327 Crystal Structure Of A Binary Complex Of Protein Ki 3e-07
1m2p_A325 Crystal Structure Of 1,8-Di-Hydroxy-4-Nitro- Anthra 3e-07
3pvg_A331 Crystal Structure Of Z. Mays Ck2 Alpha Subunit In C 3e-07
1ds5_A332 Dimeric Crystal Structure Of The Alpha Subunit In C 3e-07
4anm_A335 Complex Of Ck2 With A Cdc7 Inhibitor Length = 335 3e-07
4dgn_A326 Crystal Structure Of Maize Ck2 In Complex With The 3e-07
3kxg_A327 Crystal Structure Of Z. Mays Ck2 Kinase Alpha Subun 3e-07
2pvh_A352 Structure-Based Design Of Pyrazolo[1,5-A][1,3,5]tri 3e-07
4dgm_A326 Crystal Structure Of Maize Ck2 In Complex With The 4e-07
3enm_A316 The Structure Of The Map2k Mek6 Reveals An Autoinhi 4e-07
3vul_A370 Crystal Structure Of A Cysteine-deficient Mutant M1 6e-07
3vum_A370 Crystal Structure Of A Cysteine-deficient Mutant M7 6e-07
2dyl_A318 Crystal Structure Of Human Mitogen-Activated Protei 7e-07
3ofm_A350 Structure Of A Human Ck2alpha Prime, The Paralog Is 7e-07
3u87_A349 Structure Of A Chimeric Construct Of Human Ck2alpha 1e-06
1vyw_A309 Structure Of Cdk2CYCLIN A WITH PNU-292137 Length = 1e-06
4ft3_A279 Crystal Structure Of The Chk1 Length = 279 1e-06
2r7i_A335 Crystal Structure Of Catalytic Subunit Of Protein K 1e-06
3h30_A334 Crystal Structure Of The Catalytic Subunit Of Human 1e-06
3q04_A328 Crystal Structure Of The Apo-Form Of Human Ck2 Alph 1e-06
3nsz_A330 Human Ck2 Catalytic Domain In Complex With Amppn Le 1e-06
3mb6_A331 Human Ck2 Catalytic Domain In Complex With A Difura 1e-06
3rzf_A 677 Crystal Structure Of Inhibitor Of Kappab Kinase Bet 1e-06
3nga_A333 Human Ck2 Catalytic Domain In Complex With Cx-4945 1e-06
3e3b_X339 Crystal Structure Of Catalytic Subunit Of Human Pro 1e-06
1jwh_A337 Crystal Structure Of Human Protein Kinase Ck2 Holoe 1e-06
3q9w_A336 Crystal Structure Of Human Ck2 Alpha In Complex Wit 1e-06
3qa8_A 676 Crystal Structure Of Inhibitor Of Kappa B Kinase Be 1e-06
1na7_A329 Crystal Structure Of The Catalytic Subunit Of Human 1e-06
4apc_A350 Crystal Structure Of Human Nima-Related Kinase 1 (N 1e-06
3bqc_A335 High Ph-Value Crystal Structure Of Emodin In Comple 1e-06
1pjk_A334 Crystal Structure Of A C-terminal Deletion Mutant O 1e-06
4fsz_A279 Crystal Structure Of The Chk1 Length = 279 2e-06
1oit_A299 Imidazopyridines: A Potent And Selective Class Of C 2e-06
1pf8_A298 Crystal Structure Of Human Cyclin-dependent Kinase 2e-06
1gii_A298 Human Cyclin Dependent Kinase 2 Complexed With The 2e-06
4fsw_A279 Crystal Structure Of The Chk1 Length = 279 2e-06
2w17_A299 Cdk2 In Complex With The Imidazole Pyrimidine Amide 2e-06
1fin_A298 Cyclin A-Cyclin-Dependent Kinase 2 Complex Length = 2e-06
1oir_A299 Imidazopyridines: A Potent And Selective Class Of C 2e-06
1h01_A298 Cdk2 In Complex With A Disubstituted 2, 4-Bis Anili 2e-06
4fst_A269 Crystal Structure Of The Chk1 Length = 269 2e-06
3pj8_A299 Structure Of Cdk2 In Complex With A Pyrazolo[4,3-D] 2e-06
2zjw_A340 Crystal Structure Of Human Ck2 Alpha Complexed With 2e-06
2ydj_A276 Discovery Of Checkpoint Kinase Inhibitor Azd7762 By 2e-06
2vwi_A303 Structure Of The Osr1 Kinase, A Hypertension Drug T 2e-06
3ezr_A300 Cdk-2 With Indazole Inhibitor 17 Bound At Its Activ 2e-06
1gz8_A299 Human Cyclin Dependent Kinase 2 Complexed With The 2e-06
2qkr_A313 Cryptosporidium Parvum Cyclin-Dependent Kinase Cgd5 2e-06
3niz_A311 Cryptosporidium Parvum Cyclin-Dependent Kinase Cgd5 2e-06
3vuk_A370 Crystal Structure Of A Cysteine-deficient Mutant M5 3e-06
3pxf_A306 Cdk2 In Complex With Two Molecules Of 8-Anilino-1-N 3e-06
4erw_A306 Cdk2 In Complex With Staurosporine Length = 306 3e-06
3dak_A290 Crystal Structure Of Domain-Swapped Osr1 Kinase Dom 3e-06
2j51_A325 Crystal Structure Of Human Ste20-Like Kinase Bound 3e-06
3vuh_A370 Crystal Structure Of A Cysteine-deficient Mutant M3 3e-06
3vui_A370 Crystal Structure Of A Cysteine-deficient Mutant M2 3e-06
4dgl_C335 Crystal Structure Of The Ck2 Tetrameric Holoenzyme 3e-06
1ua2_A346 Crystal Structure Of Human Cdk7 Length = 346 3e-06
2pml_X348 Crystal Structure Of Pfpk7 In Complex With An Atp A 3e-06
4eoi_A299 Thr 160 Phosphorylated Cdk2 K89d, Q131e - Human Cyc 4e-06
3sls_A304 Crystal Structure Of Human Mek-1 Kinase In Complex 4e-06
3p86_A309 Crystal Structure Of Ctr1 Kinase Domain Mutant D676 4e-06
3juh_A335 Crystal Structure Of A Mutant Of Human Protein Kina 4e-06
4eon_A300 Thr 160 Phosphorylated Cdk2 H84s, Q85m, Q131e - Hum 4e-06
4eoo_A299 Thr 160 Phosphorylated Cdk2 Q131e - Human Cyclin A3 4e-06
4eom_A301 Thr 160 Phosphorylated Cdk2 H84s, Q85m, Q131e - Hum 5e-06
4eop_A300 Thr 160 Phosphorylated Cdk2 Q131e - Human Cyclin A3 5e-06
3vug_A370 Crystal Structure Of A Cysteine-deficient Mutant M2 5e-06
4aaa_A331 Crystal Structure Of The Human Cdkl2 Kinase Domain 6e-06
3ckw_A304 Crystal Structure Of Sterile 20-Like Kinase 3 (Mst3 6e-06
1zyc_A303 Crystal Structure Of Eif2alpha Protein Kinase Gcn2: 6e-06
4eut_A396 Structure Of Bx-795 Complexed With Unphosphorylated 6e-06
1qmz_A299 Phosphorylated Cdk2-Cyclyin A-Substrate Peptide Com 6e-06
4eok_A300 Thr 160 Phosphorylated Cdk2 H84s, Q85m, K89d - Huma 7e-06
1zy4_A303 Crystal Structure Of Eif2alpha Protein Kinase Gcn2: 7e-06
3zhp_C294 Human Mst3 (stk24) In Complex With Mo25beta Length 7e-06
1w98_A298 The Structural Basis Of Cdk2 Activation By Cyclin E 7e-06
1jst_A298 Phosphorylated Cyclin-Dependent Kinase-2 Bound To C 7e-06
4i3z_A296 Structure Of Pcdk2CYCLINA BOUND TO ADP AND 2 MAGNES 7e-06
1e9h_A297 Thr 160 Phosphorylated Cdk2-Human Cyclin A3 Complex 7e-06
2xrw_A371 Linear Binding Motifs For Jnk And For Calcineurin A 7e-06
3vud_A370 Crystal Structure Of A Cysteine-deficient Mutant M1 7e-06
3bht_A300 Structure Of Phosphorylated Thr160 Cdk2CYCLIN A IN 7e-06
1ukh_A369 Structural Basis For The Selective Inhibition Of Jn 8e-06
2xs0_A386 Linear Binding Motifs For Jnk And For Calcineurin A 8e-06
3a7f_A303 Human Mst3 Kinase Length = 303 8e-06
2iw8_A302 Structure Of Human Thr160-Phospho Cdk2-Cyclin A F82 8e-06
4eos_A300 Thr 160 Phosphorylated Cdk2 Wt - Human Cyclin A3 Co 8e-06
4eoj_A302 Thr 160 Phosphorylated Cdk2 H84s, Q85m, K89d - Huma 8e-06
4eoq_A301 Thr 160 Phosphorylated Cdk2 Wt - Human Cyclin A3 Co 9e-06
4bcq_A301 Structure Of Cdk2 In Complex With Cyclin A And A 2- 9e-06
3qhr_A298 Structure Of A Pcdk2CYCLINA TRANSITION-State Mimic 9e-06
3ckx_A304 Crystal Structure Of Sterile 20-Like Kinase 3 (Mst3 9e-06
2iw6_A302 Structure Of Human Thr160-Phospho Cdk2-Cyclin A Com 1e-05
1ogu_A302 Structure Of Human Thr160-phospho Cdk2/cyclin A Com 1e-05
3ggf_A301 Crystal Structure Of Human SerineTHREONINE-Protein 1e-05
1h1p_A303 Structure Of Human Thr160-Phospho Cdk2CYCLIN A COMP 1e-05
2jfm_A325 Crystal Structure Of Human Ste20-Like Kinase (Unlig 1e-05
1zxe_A303 Crystal Structure Of Eif2alpha Protein Kinase Gcn2: 1e-05
2jfl_A325 Crystal Structure Of Human Ste20-Like Kinase ( Diph 1e-05
3kga_A299 Crystal Structure Of Mapkap Kinase 2 (Mk2) Complexe 1e-05
2y4i_C395 Ksr2-Mek1 Heterodimer Length = 395 1e-05
3gc9_A370 The Structure Of P38beta C119s, C162s In Complex Wi 1e-05
3v3v_A379 Structural And Functional Analysis Of Quercetagetin 1e-05
1cm8_A367 Phosphorylated Map Kinase P38-Gamma Length = 367 1e-05
3oht_A389 Crystal Structure Of Salmo Salar P38alpha Length = 1e-05
4euu_A319 Structure Of Bx-795 Complexed With Human Tbk1 Kinas 1e-05
3gc8_A370 The Structure Of P38beta C162s In Complex With A Di 2e-05
3mtl_A324 Crystal Structure Of The Pctaire1 Kinase In Complex 2e-05
3lm0_A327 Crystal Structure Of Human SerineTHREONINE KINASE 1 2e-05
2xik_A294 Structure Of Human Ysk1 (Yeast Sps1-Ste20-Related K 2e-05
2uv2_A287 Crystal Structure Of Human Ste20-Like Kinase Bound 2e-05
1s9i_A354 X-Ray Structure Of The Human Mitogen-Activated Prot 2e-05
3eqc_A360 X-Ray Structure Of The Human Mitogen-Activated Prot 2e-05
3ppz_A309 Crystal Structure Of Ctr1 Kinase Domain In Complex 2e-05
1s9j_A341 X-Ray Structure Of The Human Mitogen-Activated Prot 2e-05
2p55_A333 X-Ray Structure Of The Human Mitogen-Activated Prot 2e-05
3ttj_A464 Crystal Structure Of Jnk3 Complexed With Cc-359, A 3e-05
2o0u_A364 Crystal Structure Of Human Jnk3 Complexed With N-{3 3e-05
3fi2_A353 Crystal Structure Of Jnk3 With Amino-Pyrazole Inhib 3e-05
3kvx_A364 Jnk3 Bound To Aminopyrimidine Inhibitor, Sr-3562 Le 3e-05
3fi3_A364 Crystal Structure Of Jnk3 With Indazole Inhibitor, 3e-05
3fv8_A355 Jnk3 Bound To Piperazine Amide Inhibitor, Sr2774 Le 3e-05
3oxi_A362 Design And Synthesis Of Disubstituted Thiophene And 3e-05
2ok1_A365 Crystal Structure Of Jnk3 Bound To N-Benzyl-4-(4-(3 3e-05
3orn_A307 Mitogen-Activated Protein Kinase Kinase 1 (Mek1) In 3e-05
3ptg_A363 Design And Synthesis Of A Novel, Orally Efficacious 3e-05
1jnk_A423 The C-Jun N-Terminal Kinase (Jnk3s) Complexed With 3e-05
1pmn_A364 Crystal Structure Of Jnk3 In Complex With An Imidaz 3e-05
3gp0_A348 Crystal Structure Of Human Mitogen Activated Protei 3e-05
4h36_A356 Crystal Structure Of Jnk3 In Complex With Atf2 Pept 3e-05
2exc_X356 Inhibitor Complex Of Jnk3 Length = 356 3e-05
2b1p_A355 Inhibitor Complex Of Jnk3 Length = 355 3e-05
3mbl_A328 Crystal Structure Of The Human Mitogen-Activated Pr 3e-05
3dv3_A322 Mek1 With Pf-04622664 Bound Length = 322 3e-05
2r9s_A356 C-Jun N-Terminal Kinase 3 With 3,5-Disubstituted Qu 3e-05
3kvw_A429 Crystal Structure Of Dual-Specificity Tyrosine Phos 4e-05
4azf_A417 Human Dyrk2 In Complex With Leucettine L41 Length = 5e-05
3pze_A358 Jnk1 In Complex With Inhibitor Length = 358 5e-05
3uib_A362 Map Kinase Lmampk10 From Leishmania Major In Comple 5e-05
3elj_A369 Jnk1 Complexed With A Bis-Anilino-Pyrrolopyrimidine 5e-05
3pg1_A362 Map Kinase Lmampk10 From Leishmania Major (1.95 Ang 6e-05
4an2_A301 Crystal Structures Of Human Mek1 With Carboxamide-B 1e-04
3hmn_A342 Crystal Structure Of Human Mps1 Catalytic Domain In 1e-04
2jkm_A276 Focal Adhesion Kinase Catalytic Domain In Complex W 1e-04
2zmc_A390 Crystal Structure Of Human Mitotic Checkpoint Kinas 1e-04
2j0k_A656 Crystal Structure Of A Fragment Of Focal Adhesion K 1e-04
2g01_A370 Pyrazoloquinolones As Novel, Selective Jnk1 Inhibit 1e-04
2pop_A353 The Crystal Structure Of Tab1 And Bir1 Complex Leng 1e-04
2j0m_B276 Crystal Structure A Two-Chain Complex Between The F 1e-04
4ec8_A373 Structure Of Full Length Cdk9 In Complex With Cycli 1e-04
3bz3_A276 Crystal Structure Analysis Of Focal Adhesion Kinase 1e-04
2zmd_A390 Crystal Structure Of Human Mps1 Catalytic Domain T6 1e-04
4ebw_A304 Structure Of Focal Adhesion Kinase Catalytic Domain 1e-04
2jkk_A276 Focal Adhesion Kinase Catalytic Domain In Complex W 1e-04
2etm_A281 Crystal Structure Of Focal Adhesion Kinase Domain C 1e-04
1bi8_A326 Mechanism Of G1 Cyclin Dependent Kinase Inhibition 1e-04
2j0j_A656 Crystal Structure Of A Fragment Of Focal Adhesion K 1e-04
3pxk_A282 Focal Adhesion Kinase Catalytic Domain In Complex W 1e-04
1mp8_A281 Crystal Structure Of Focal Adhesion Kinase (Fak) Le 1e-04
3o17_A370 Crystal Structure Of Jnk1-Alpha1 Isoform Length = 3 2e-04
2buj_A317 Crystal Structure Of The Human Serine-Threonine Kin 2e-04
3k2l_A429 Crystal Structure Of Dual-Specificity Tyrosine Phos 2e-04
3mi9_A351 Crystal Structure Of Hiv-1 Tat Complexed With Human 2e-04
3vqu_A320 Crystal Structure Of Human Mps1 Catalytic Domain In 2e-04
2fst_X367 Mitogen Activated Protein Kinase P38alpha (d176a+f3 3e-04
4e5a_X360 The W197a Mutant Of P38a Map Kinase Length = 360 3e-04
2j0l_A276 Crystal Structure Of A The Active Conformation Of T 4e-04
3gi3_A360 Crystal Structure Of A N-Phenyl-N'-Naphthylurea Ana 4e-04
2y8o_A362 Crystal Structure Of Human P38alpha Complexed With 5e-04
2jgz_A289 Crystal Structure Of Phospho-Cdk2 In Complex With C 5e-04
1ove_A366 The Structure Of P38 Alpha In Complex With A Dihydr 5e-04
1jow_B308 Crystal Structure Of A Complex Of Human Cdk6 And A 5e-04
2fso_X367 Mitogen Activated Protein Kinase P38alpha (D176a) A 5e-04
3od6_X360 Crystal Structure Of P38alpha Y323t Active Mutant L 6e-04
2bal_A365 P38alpha Map Kinase Bound To Pyrazoloamine Length = 6e-04
3oef_X360 Crystal Structure Of Y323f Inactive Mutant Of P38al 6e-04
2x7f_A326 Crystal Structure Of The Kinase Domain Of Human Tra 6e-04
1lew_A360 Crystal Structure Of Map Kinase P38 Complexed To Th 7e-04
2j7t_A302 Crystal Structure Of Human Serine Threonine Kinase- 7e-04
2baj_A365 P38alpha Bound To Pyrazolourea Length = 365 7e-04
3hrb_A359 P38 Kinase Crystal Structure In Complex With Small 7e-04
1m7q_A366 Crystal Structure Of P38 Map Kinase In Complex With 7e-04
3e92_A371 Crystal Structure Of P38 Kinase In Complex With A B 7e-04
1di9_A360 The Structure Of P38 Mitogen-Activated Protein Kina 7e-04
2baq_A365 P38alpha Bound To Ro3201195 Length = 365 7e-04
3zsg_A362 X-Ray Structure Of P38alpha Bound To Tak-715 Length 7e-04
3gcu_A360 Human P38 Map Kinase In Complex With Rl48 Length = 7e-04
3gcp_A360 Human P38 Map Kinase In Complex With Sb203580 Lengt 7e-04
3p4k_A370 The Third Conformation Of P38a Map Kinase Observed 7e-04
3k3j_A362 P38alpha Bound To Novel Dfg-Out Compound Pf-0041612 8e-04
2npq_A367 A Novel Lipid Binding Site In The P38 Alpha Map Kin 8e-04
3d83_A360 Crystal Structure Of P38 Kinase In Complex With A B 8e-04
3mpt_A371 Crystal Structure Of P38 Kinase In Complex With A P 8e-04
1ywr_A360 Crystal Structure Analysis Of Inactive P38 Kinase D 8e-04
2oza_B366 Structure Of P38alpha Complex Length = 366 8e-04
1ob3_A288 Structure Of P. Falciparum Pfpk5 Length = 288 8e-04
3d7z_A360 Crystal Structure Of P38 Kinase In Complex With A B 8e-04
1oz1_A372 P38 Mitogen-Activated Kinase In Complex With 4-Azai 8e-04
1ian_A366 Human P38 Map Kinase Inhibitor Complex Length = 366 8e-04
2x9e_A317 Human Mps1 In Complex With Nms-P715 Length = 317 8e-04
3fi4_A372 P38 Kinase Crystal Structure In Complex With Ro4499 8e-04
2gfs_A372 P38 Kinase Crystal Structure In Complex With Ro3201 8e-04
1yw2_A360 Mutated Mus Musculus P38 Kinase (Mp38) Length = 360 9e-04
3dbq_A343 Crystal Structure Of Ttk Kinase Domain Length = 343 9e-04
3hvc_A362 Crystal Structure Of Human P38alpha Map Kinase Leng 9e-04
3cek_A313 Crystal Structure Of Human Dual Specificity Protein 9e-04
3tg1_A380 Crystal Structure Of P38alpha In Complex With A Map 9e-04
>pdb|1FOT|A Chain A, Structure Of The Unliganded Camp-Dependent Protein Kinase Catalytic Subunit From Saccharomyces Cerevisiae Length = 318 Back     alignment and structure 
Iteration: 1

 Score =  159 bits (401), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 92/300 (30%), Positives = 156/300 (52%), Gaps = 8/300 (2%)
Query: 765  KVSLTDMEWRKCLYSTDCSEIGLVLLRDSENFLSLKRFSKQKVKCLGKEVQVLKEKNLMK 824
            K SL D +  + L +     + L+  R +  + ++K   K+ V  L K+V+   ++ LM 
Sbjct: 2    KYSLQDFQILRTLGTGSFGRVHLIRSRHNGRYYAMKVLKKEIVVRL-KQVEHTNDERLML 60
Query: 825  SVSPSACVPQILCTCADSMHAGLLLNTYLACPLASILHTP--LDEQSARFCAASVVAALE 882
            S+     + ++  T  D+    ++++      L S+L          A+F AA V  ALE
Sbjct: 61   SIVTHPFIIRMWGTFQDAQQIFMIMDYIEGGELFSLLRKSQRFPNPVAKFYAAEVCLALE 120
Query: 883  DLHKRGVLYRGVSPDVLMLDKSGHLQLVDFRFGKGLSGNRTFTICGMADYLAPEIVQGKG 942
             LH + ++YR + P+ ++LDK+GH+++ DF F K +  + T+ +CG  DY+APE+V  K 
Sbjct: 121  YLHSKDIIYRDLKPENILLDKNGHIKITDFGFAKYVP-DVTYXLCGTPDYIAPEVVSTKP 179
Query: 943  HGLAADWWALGVLIYFMLQGEMPFGSWRESEIDIVAKIAKGQLSLPQNLSPEAVDLLTKL 1002
            +  + DWW+ G+LIY ML G  PF  +  + +    KI   +L  P   + +  DLL++L
Sbjct: 180  YNKSIDWWSFGILIYEMLAGYTPF--YDSNTMKTYEKILNAELRFPPFFNEDVKDLLSRL 237
Query: 1003 LVVDENTRLGS--QGPTSVKTHPWFRDVDWKGIAESTSPVPHEIMSRISQHLDSHFEDSP 1060
            +  D + RLG+   G   VK HPWF++V W+ +       P+E   +  Q   S F+  P
Sbjct: 238  ITRDLSQRLGNLQNGTEDVKNHPWFKEVVWEKLLSRNIETPYEPPIQQGQGDTSQFDKYP 297
>pdb|1BKX|A Chain A, A Binary Complex Of The Catalytic Subunit Of Camp-Dependent Protein Kinase And Adenosine Further Defines Conformational Flexibility Length = 350 Back     alignment and structure
>pdb|1SYK|A Chain A, Crystal Structure Of E230q Mutant Of Camp-Dependent Protein Kinase Reveals Unexpected Apoenzyme Conformation Length = 350 Back     alignment and structure
>pdb|2QUR|A Chain A, Crystal Structure Of F327aK285P MUTANT OF CAMP-Dependent Protein Kinase Length = 350 Back     alignment and structure
>pdb|1JBP|E Chain E, Crystal Structure Of The Catalytic Subunit Of Camp- Dependent Protein Kinase Complexed With A Substrate Peptide, Adp And Detergent Length = 350 Back     alignment and structure
>pdb|1FMO|E Chain E, Crystal Structure Of A Polyhistidine-Tagged Recombinant Catalytic Subunit Of Camp-Dependent Protein Kinase Complexed With The Peptide Inhibitor Pki(5-24) And Adenosine Length = 350 Back     alignment and structure
>pdb|2ERZ|E Chain E, Crystal Structure Of C-amp Dependent Kinase (pka) Bound To Hydroxyfasudil Length = 351 Back     alignment and structure
>pdb|3PVB|A Chain A, Crystal Structure Of (73-244)ria:c Holoenzyme Of Camp-Dependent Protein Kinase Length = 345 Back     alignment and structure
>pdb|1L3R|E Chain E, Crystal Structure Of A Transition State Mimic Of The Catalytic Subunit Of Camp-Dependent Protein Kinase Length = 350 Back     alignment and structure
>pdb|2GU8|A Chain A, Discovery Of 2-pyrimidyl-5-amidothiophenes As Novel And Potent Inhibitors For Akt: Synthesis And Sar Studies Length = 337 Back     alignment and structure
>pdb|2QCS|A Chain A, A Complex Structure Between The Catalytic And Regulatory Subunit Of Protein Kinase A That Represents The Inhibited State Length = 350 Back     alignment and structure
>pdb|1CTP|E Chain E, Structure Of The Mammalian Catalytic Subunit Of Camp-Dependent Protein Kinase And An Inhibitor Peptide Displays An Open Conformation Length = 350 Back     alignment and structure
>pdb|3O7L|B Chain B, Crystal Structure Of Phospholamban (1-19):pka C-Subunit:amp-Pnp:mg2+ Complex Length = 350 Back     alignment and structure
>pdb|2F7E|E Chain E, Pka Complexed With (S)-2-(1h-Indol-3-Yl)-1-(5-Isoquinolin-6- Yl-Pyridin-3-Yloxymethyl-Etylamine Length = 351 Back     alignment and structure
>pdb|1APM|E Chain E, 2.0 Angstrom Refined Crystal Structure Of The Catalytic Subunit Of Camp-Dependent Protein Kinase Complexed With A Peptide Inhibitor And Detergent Length = 350 Back     alignment and structure
>pdb|2UZT|A Chain A, Pka Structures Of Akt, Indazole-Pyridine Inhibitors Length = 336 Back     alignment and structure
>pdb|4DG3|E Chain E, Crystal Structure Of R336a Mutant Of Camp-dependent Protein Kinase With Unphosphorylated Turn Motif Length = 371 Back     alignment and structure
>pdb|1CDK|A Chain A, Camp-Dependent Protein Kinase Catalytic Subunit (E.C.2.7.1.37) (Protein Kinase A) Complexed With Protein Kinase Inhibitor Peptide Fragment 5-24 (Pki(5-24) Isoelectric Variant Ca) And Mn2+ Adenylyl Imidodiphosphate (Mnamp-Pnp) At Ph 5.6 And 7c And 4c Length = 350 Back     alignment and structure
>pdb|4DFX|E Chain E, Crystal Structure Of Myristoylated K7c Catalytic Subunit Of Camp- Dependent Protein Kinase In Complex With Sp20 And Amp-Pnp Length = 350 Back     alignment and structure
>pdb|1CMK|E Chain E, Crystal Structures Of The Myristylated Catalytic Subunit Of Camp- Dependent Protein Kinase Reveal Open And Closed Conformations Length = 350 Back     alignment and structure
>pdb|4AE6|A Chain A, Structure And Function Of The Human Sperm-specific Isoform Of Protein Kinase A (pka) Catalytic Subunit Calpha 2 Length = 343 Back     alignment and structure
>pdb|1Q24|A Chain A, Pka Double Mutant Model Of Pkb In Complex With Mgatp Length = 350 Back     alignment and structure
>pdb|4DFY|A Chain A, Crystal Structure Of R194a Mutant Of Camp-Dependent Protein Kinase With Unphosphorylated Activation Loop Length = 371 Back     alignment and structure
>pdb|3AGM|A Chain A, Complex Of Pka With The Bisubstrate Protein Kinase Inhibitor Arc-670 Length = 351 Back     alignment and structure
>pdb|3MVJ|A Chain A, Human Cyclic Amp-Dependent Protein Kinase Pka Inhibitor Complex Length = 371 Back     alignment and structure
>pdb|3AGL|A Chain A, Complex Of Pka With The Bisubstrate Protein Kinase Inhibitor Arc-1039 Length = 351 Back     alignment and structure
>pdb|4AE9|A Chain A, Structure And Function Of The Human Sperm-specific Isoform Of Protein Kinase A (pka) Catalytic Subunit C Alpha 2 Length = 343 Back     alignment and structure
>pdb|3L9M|A Chain A, Crystal Structure Of Pkab3 (Pka Triple Mutant V123a, L173m, Q181k) With Compound 18 Length = 351 Back     alignment and structure
>pdb|1YDT|E Chain E, Structure Of Camp-Dependent Protein Kinase, Alpha-Catalytic Subunit In Complex With H89 Protein Kinase Inhibitor N-[2- (4-Bromocinnamylamino)ethyl]-5-Isoquinoline Length = 350 Back     alignment and structure
>pdb|3QAM|E Chain E, Crystal Structure Of Glu208ala Mutant Of Catalytic Subunit Of Camp- Dependent Protein Kinase Length = 350 Back     alignment and structure
>pdb|1SVH|A Chain A, Crystal Structure Of Protein Kinase A In Complex With Azepane Derivative 8 Length = 350 Back     alignment and structure
>pdb|1STC|E Chain E, Camp-Dependent Protein Kinase, Alpha-Catalytic Subunit In Complex With Staurosporine Length = 350 Back     alignment and structure
>pdb|2C1A|A Chain A, Structure Of Camp-Dependent Protein Kinase Complexed With Isoquinoline-5-Sulfonic Acid (2-(2-(4-Chlorobenzyloxy) Ethylamino)ethyl)amide Length = 351 Back     alignment and structure
>pdb|1Q61|A Chain A, Pka Triple Mutant Model Of Pkb Length = 350 Back     alignment and structure
>pdb|1XH7|A Chain A, Crystal Structures Of Protein Kinase B Selective Inhibitors In Complex With Protein Kinase A And Mutants Length = 350 Back     alignment and structure
>pdb|1Q8W|A Chain A, The Catalytic Subunit Of Camp-Dependent Protein Kinase In Complex With Rho-Kinase Inhibitor Fasudil (Ha-1077) Length = 350 Back     alignment and structure
>pdb|2JDS|A Chain A, Structure Of Camp-Dependent Protein Kinase Complexed With A- 443654 Length = 351 Back     alignment and structure
>pdb|3DND|A Chain A, Camp-Dependent Protein Kinase Pka Catalytic Subunit With Pki-5-24 Length = 350 Back     alignment and structure
>pdb|3QAL|E Chain E, Crystal Structure Of Arg280ala Mutant Of Catalytic Subunit Of Camp- Dependent Protein Kinase Length = 350 Back     alignment and structure
>pdb|3FHI|A Chain A, Crystal Structure Of A Complex Between The Catalytic And Regulatory (Ri{alpha}) Subunits Of Pka Length = 350 Back     alignment and structure
>pdb|1SZM|A Chain A, Dual Binding Mode Of Bisindolylmaleimide 2 To Protein Kinase A (Pka) Length = 350 Back     alignment and structure
>pdb|3NX8|A Chain A, Human Camp Dependent Protein Kinase In Complex With Phenol Length = 351 Back     alignment and structure
>pdb|2JDT|A Chain A, Structure Of Pka-Pkb Chimera Complexed With Isoquinoline-5- Sulfonic Acid (2-(2-(4-Chlorobenzyloxy) Ethylamino)ethyl) Amide Length = 351 Back     alignment and structure
>pdb|2VO0|A Chain A, Structure Of Pka-Pkb Chimera Complexed With C-(4-(4- Chlorophenyl)-1-(7h-Pyrrolo(2, 3-D)pyrimidin-4-Yl)piperidin- 4-Yl)methylamine Length = 351 Back     alignment and structure
>pdb|1J3H|A Chain A, Crystal Structure Of Apoenzyme Camp-Dependent Protein Kinase Catalytic Subunit Length = 350 Back     alignment and structure
>pdb|1RDQ|E Chain E, Hydrolysis Of Atp In The Crystal Of Y204a Mutant Of Camp-Dependent Protein Kinase Length = 350 Back     alignment and structure
>pdb|2UVY|A Chain A, Structure Of Pka-pkb Chimera Complexed With Methyl-(4-(9h- Purin-6-yl)-benzyl)-amine Length = 351 Back     alignment and structure
>pdb|1SMH|A Chain A, Protein Kinase A Variant Complex With Completely Ordered N- Terminal Helix Length = 350 Back     alignment and structure
>pdb|3AMA|A Chain A, Protein Kinase A Sixfold Mutant Model Of Aurora B With Inhibitor Jnj- 7706621 Length = 351 Back     alignment and structure
>pdb|2GNJ|A Chain A, Pka Three Fold Mutant Model Of Rho-Kinase With Y-27632 Length = 350 Back     alignment and structure
>pdb|2GNG|A Chain A, Protein Kinase A Fivefold Mutant Model Of Rho-Kinase Length = 350 Back     alignment and structure
>pdb|2GNF|A Chain A, Protein Kinase A Fivefold Mutant Model Of Rho-Kinase With Y- 27632 Length = 350 Back     alignment and structure
>pdb|1XH9|A Chain A, Crystal Structures Of Protein Kinase B Selective Inhibitors In Complex With Protein Kinase A And Mutants Length = 350 Back     alignment and structure
>pdb|1MRV|A Chain A, Crystal Structure Of An Inactive Akt2 Kinase Domain Length = 339 Back     alignment and structure
>pdb|3A60|A Chain A, Crystal Structure Of Unphosphorylated P70s6k1 (Form I) Length = 327 Back     alignment and structure
>pdb|4DC2|A Chain A, Structure Of Pkc In Complex With A Substrate Peptide From Par-3 Length = 396 Back     alignment and structure
>pdb|1GZN|A Chain A, Structure Of Pkb Kinase Domain Length = 335 Back     alignment and structure
>pdb|1GZK|A Chain A, Molecular Mechanism For The Regulation Of Protein Kinase B Akt By Hydrophobic Motif Phosphorylation Length = 315 Back     alignment and structure
>pdb|3A62|A Chain A, Crystal Structure Of Phosphorylated P70s6k1 Length = 327 Back     alignment and structure
>pdb|1O6L|A Chain A, Crystal Structure Of An Activated Akt/protein Kinase B (pkb-pif Chimera) Ternary Complex With Amp-pnp And Gsk3 Peptide Length = 337 Back     alignment and structure
>pdb|1O6K|A Chain A, Structure Of Activated Form Of Pkb Kinase Domain S474d With Gsk3 Peptide And Amp-Pnp Length = 336 Back     alignment and structure
>pdb|2JDO|A Chain A, Structure Of Pkb-Beta (Akt2) Complexed With Isoquinoline-5- Sulfonic Acid (2-(2-(4-Chlorobenzyloxy) Ethylamino)ethyl) Amide Length = 342 Back     alignment and structure
>pdb|3ZH8|A Chain A, A Novel Small Molecule Apkc Inhibitor Length = 349 Back     alignment and structure
>pdb|3E87|A Chain A, Crystal Structures Of The Kinase Domain Of Akt2 In Complex With Atp- Competitive Inhibitors Length = 335 Back     alignment and structure
>pdb|3A8W|A Chain A, Crystal Structure Of Pkciota Kinase Domain Length = 345 Back     alignment and structure
>pdb|3TXO|A Chain A, Pkc Eta Kinase In Complex With A Naphthyridine Length = 353 Back     alignment and structure
>pdb|2JED|A Chain A, The Crystal Structure Of The Kinase Domain Of The Protein Kinase C Theta In Complex With Nvp-Xaa228 At 2.32a Resolution. Length = 352 Back     alignment and structure
>pdb|3G51|A Chain A, Structural Diversity Of The Active Conformation Of The N- Terminal Kinase Domain Of P90 Ribosomal S6 Kinase 2 Length = 325 Back     alignment and structure
>pdb|1ZRZ|A Chain A, Crystal Structure Of The Catalytic Domain Of Atypical Protein Kinase C-Iota Length = 364 Back     alignment and structure
>pdb|2QVS|B Chain B, Crystal Structure Of Type Iia Holoenzyme Of Camp-Dependent Protein Kinase Length = 310 Back     alignment and structure
>pdb|3UBD|A Chain A, Structure Of N-Terminal Domain Of Rsk2 Kinase In Complex With Flavonoid Glycoside Sl0101 Length = 304 Back     alignment and structure
>pdb|4EL9|A Chain A, Structure Of N-Terminal Kinase Domain Of Rsk2 With Afzelin Length = 305 Back     alignment and structure
>pdb|2F2U|A Chain A, Crystal Structure Of The Rho-Kinase Kinase Domain Length = 402 Back     alignment and structure
>pdb|3IW4|A Chain A, Crystal Structure Of Pkc Alpha In Complex With Nvp-Aeb071 Length = 360 Back     alignment and structure
>pdb|1VZO|A Chain A, The Structure Of The N-Terminal Kinase Domain Of Msk1 Reveals A Novel Autoinhibitory Conformation For A Dual Kinase Protein Length = 355 Back     alignment and structure
>pdb|1XJD|A Chain A, Crystal Structure Of Pkc-Theta Complexed With Staurosporine At 2a Resolution Length = 345 Back     alignment and structure
>pdb|3V8S|A Chain A, Human Rho-Associated Protein Kinase 1 (Rock 1) In Complex With Indazole Derivative (Compound 18) Length = 410 Back     alignment and structure
>pdb|2ESM|A Chain A, Crystal Structure Of Rock 1 Bound To Fasudil Length = 415 Back     alignment and structure
>pdb|2V55|A Chain A, Mechanism Of Multi-site Phosphorylation From A Rock-i:rhoe Complex Structure Length = 406 Back     alignment and structure
>pdb|2Z7Q|A Chain A, Crystal Structure Of The N-Terminal Kinase Domain Of Human Rsk-1 Bound To Amp-Pcp Length = 321 Back     alignment and structure
>pdb|4A07|A Chain A, Human Pdk1 Kinase Domain In Complex With Allosteric Activator Ps171 Bound To The Pif-Pocket Length = 311 Back     alignment and structure
>pdb|3OCB|A Chain A, Akt1 Kinase Domain With Pyrrolopyrimidine Inhibitor Length = 341 Back     alignment and structure
>pdb|2I0E|A Chain A, Structure Of Catalytic Domain Of Human Protein Kinase C Beta Ii Complexed With A Bisindolylmaleimide Inhibitor Length = 353 Back     alignment and structure
>pdb|3PFQ|A Chain A, Crystal Structure And Allosteric Activation Of Protein Kinase C Beta Ii Length = 674 Back     alignment and structure
>pdb|3PWY|A Chain A, Crystal Structure Of An Extender (Spd28345)-Modified Human Pdk1 Complex 2 Length = 311 Back     alignment and structure
>pdb|3HRC|A Chain A, Crystal Structure Of A Mutant Of Human Pdk1 Kinase Domain In Complex With Atp Length = 311 Back     alignment and structure
>pdb|3O96|A Chain A, Crystal Structure Of Human Akt1 With An Allosteric Inhibitor Length = 446 Back     alignment and structure
>pdb|3NAX|A Chain A, Pdk1 In Complex With Inhibitor Mp7 Length = 311 Back     alignment and structure
>pdb|1Z5M|A Chain A, Crystal Structure Of N1-[3-[[5-bromo-2-[[3-[(1-pyrrolidinylcarbonyl) Amino]phenyl]amino]-4-pyrimidinyl]amino]propyl]-2,2- Dimethylpropanediamide Complexed With Human Pdk1 Length = 286 Back     alignment and structure
>pdb|1UU9|A Chain A, Structure Of Human Pdk1 Kinase Domain In Complex With Bim-3 Length = 286 Back     alignment and structure
>pdb|3NUS|A Chain A, Phosphoinositide-Dependent Kinase-1 (Pdk1) With Fragment8 Length = 286 Back     alignment and structure
>pdb|1H1W|A Chain A, High Resolution Crystal Structure Of The Human Pdk1 Catalytic Domain Length = 289 Back     alignment and structure
>pdb|2R7B|A Chain A, Crystal Structure Of The Phosphoinositide-Dependent Kinase- 1 (Pdk-1)catalytic Domain Bound To A Dibenzonaphthyridine Inhibitor Length = 312 Back     alignment and structure
>pdb|2VD5|A Chain A, Structure Of Human Myotonic Dystrophy Protein Kinase In Complex With The Bisindoylmaleide Inhibitor Bim Viii Length = 412 Back     alignment and structure
>pdb|3NUN|A Chain A, Phosphoinositide-Dependent Kinase-1 (Pdk1) With Lead Compound Length = 292 Back     alignment and structure
>pdb|3NAY|A Chain A, Pdk1 In Complex With Inhibitor Mp6 Length = 311 Back     alignment and structure
>pdb|2BIY|A Chain A, Structure Of Pdk1-S241a Mutant Kinase Domain Length = 310 Back     alignment and structure
>pdb|4EJN|A Chain A, Crystal Structure Of Autoinhibited Form Of Akt1 In Complex With N-(4- (5-(3-Acetamidophenyl)-2-(2-Aminopyridin-3-Yl)-3h- Imidazo[4,5- B]pyridin-3-Yl)benzyl)-3-Fluorobenzamide Length = 446 Back     alignment and structure
>pdb|1UU3|A Chain A, Structure Of Human Pdk1 Kinase Domain In Complex With Ly333531 Length = 310 Back     alignment and structure
>pdb|2XCK|A Chain A, Crystal Structure Of Pdk1 In Complex With A Pyrazoloquinazoline Inhibitor Length = 309 Back     alignment and structure
>pdb|3H9O|A Chain A, Phosphoinositide-Dependent Protein Kinase 1 (Pdk-1) In Complex With Compound 9 Length = 311 Back     alignment and structure
>pdb|2XCH|A Chain A, Crystal Structure Of Pdk1 In Complex With A Pyrazoloquinazoline Inhibitor Length = 309 Back     alignment and structure
>pdb|3RWP|A Chain A, Discovery Of A Novel, Potent And Selective Inhibitor Of 3- Phosphoinositide Dependent Kinase (Pdk1) Length = 311 Back     alignment and structure
>pdb|3SC1|A Chain A, Novel Isoquinolone Pdk1 Inhibitors Discovered Through Fragment-Based Lead Discovery Length = 311 Back     alignment and structure
>pdb|3IOP|A Chain A, Pdk-1 In Complex With The Inhibitor Compound-8i Length = 312 Back     alignment and structure
>pdb|3ORX|A Chain A, Pdk1 Mutant Bound To Allosteric Disulfide Fragment Inhibitor 1f8 Length = 316 Back     alignment and structure
>pdb|4GV1|A Chain A, Pkb Alpha In Complex With Azd5363 Length = 340 Back     alignment and structure
>pdb|3CQU|A Chain A, Crystal Structure Of Akt-1 Complexed With Substrate Peptide And Inhibitor Length = 342 Back     alignment and structure
>pdb|3CIK|A Chain A, Human Grk2 In Complex With Gbetagamma Subunits Length = 689 Back     alignment and structure
>pdb|3KRW|A Chain A, Human Grk2 In Complex With Gbetgamma Subunits And Balanol (Soak) Length = 688 Back     alignment and structure
>pdb|4AW2|A Chain A, Crystal Structure Of Cdc42 Binding Protein Kinase Alpha (Mrck Alpha) Length = 437 Back     alignment and structure
>pdb|1OMW|A Chain A, Crystal Structure Of The Complex Between G Protein-Coupled Receptor Kinase 2 And Heterotrimeric G Protein Beta 1 And Gamma 2 Subunits Length = 689 Back     alignment and structure
>pdb|3PSC|A Chain A, Bovine Grk2 In Complex With Gbetagamma Subunits Length = 695 Back     alignment and structure
>pdb|3QC4|A Chain A, Pdk1 In Complex With Dfg-Out Inhibitor Xxx Length = 314 Back     alignment and structure
>pdb|1CX4|A Chain A, Crystal Structure Of A Deletion Mutant Of The Type Ii Beta Regulatory Subunit Of Camp-Dependent Protein Kinase Length = 305 Back     alignment and structure
>pdb|3TKU|A Chain A, Mrck Beta In Complex With Fasudil Length = 433 Back     alignment and structure
>pdb|3QFV|A Chain A, Mrck Beta In Complex With Tpca-1 Length = 415 Back     alignment and structure
>pdb|3OF1|A Chain A, Crystal Structure Of Bcy1, The Yeast Regulatory Subunit Of Pka Length = 246 Back     alignment and structure
>pdb|3TNP|B Chain B, Structure And Allostery Of The Pka Riib Tetrameric Holoenzyme Length = 416 Back     alignment and structure
>pdb|3TNQ|A Chain A, Structure And Allostery Of The Pka Riib Tetrameric Holoenzyme Length = 416 Back     alignment and structure
>pdb|2QCS|B Chain B, A Complex Structure Between The Catalytic And Regulatory Subunit Of Protein Kinase A That Represents The Inhibited State Length = 291 Back     alignment and structure
>pdb|1RL3|A Chain A, Crystal Structure Of Camp-free R1a Subunit Of Pka Length = 288 Back     alignment and structure
>pdb|1NE4|A Chain A, Crystal Structure Of Rp-Camp Binding R1a Subunit Of Camp- Dependent Protein Kinase Length = 283 Back     alignment and structure
>pdb|2R5T|A Chain A, Crystal Structure Of Inactive Serum And Glucocorticoid- Regulated Kinase 1 In Complex With Amp-Pnp Length = 373 Back     alignment and structure
>pdb|4DIN|B Chain B, Novel Localization And Quaternary Structure Of The Pka Ri Beta Holoenzyme Length = 381 Back     alignment and structure
>pdb|3NYN|A Chain A, Crystal Structure Of G Protein-Coupled Receptor Kinase 6 In Complex With Sangivamycin Length = 576 Back     alignment and structure
>pdb|2ACX|A Chain A, Crystal Structure Of G Protein Coupled Receptor Kinase 6 Bound To Amppnp Length = 576 Back     alignment and structure
>pdb|4FR4|A Chain A, Crystal Structure Of Human SerineTHREONINE-Protein Kinase 32a (Yank1) Length = 384 Back     alignment and structure
>pdb|3SHR|A Chain A, Crystal Structure Of Cgmp-Dependent Protein Kinase Reveals Novel Site Of Interchain Communication Length = 299 Back     alignment and structure
>pdb|3COH|A Chain A, Crystal Structure Of Aurora-A In Complex With A Pentacyclic Inhibitor Length = 268 Back     alignment and structure
>pdb|3D14|A Chain A, Crystal Structure Of Mouse Aurora A (Asn186->gly, Lys240->arg, Met302- >leu) In Complex With 1-{5-[2-(Thieno[3,2-D]pyrimidin-4-Ylamino)- Ethyl]- Thiazol-2-Yl}-3-(3-Trifluoromethyl-Phenyl)-Urea Length = 272 Back     alignment and structure
>pdb|3DAJ|A Chain A, Crystal Structure Of Aurora A Complexed With An Inhibitor Discovered Through Site-Directed Dynamic Tethering Length = 272 Back     alignment and structure
>pdb|3T8O|A Chain A, Rhodopsin Kinase (grk1) L166k Mutant At 2.5a Resolution Length = 543 Back     alignment and structure
>pdb|3C4X|A Chain A, Crystal Structure Of G Protein Coupled Receptor Kinase 1 Bound To Atp And Magnesium Chloride At 2.9a Length = 543 Back     alignment and structure
>pdb|1MUO|A Chain A, Crystal Structure Of Aurora-2, An Oncogenic Serine- Threonine Kinase Length = 297 Back     alignment and structure
>pdb|3C4W|A Chain A, Crystal Structure Of G Protein Coupled Receptor Kinase 1 Bound To Atp And Magnesium Chloride At 2.7a Length = 543 Back     alignment and structure
>pdb|3QC9|A Chain A, Crystal Structure Of Cross-Linked Bovine Grk1 T8cN480C DOUBLE MUTANT Complexed With Adp And Mg Length = 543 Back     alignment and structure
>pdb|2J4Z|A Chain A, Structure Of Aurora-2 In Complex With Pha-680626 Length = 306 Back     alignment and structure
>pdb|2J50|A Chain A, Structure Of Aurora-2 In Complex With Pha-739358 Length = 280 Back     alignment and structure
>pdb|3O50|A Chain A, Crystal Structure Of Benzamide 9 Bound To Auroraa Length = 267 Back     alignment and structure
>pdb|2W1D|A Chain A, Structure Determination Of Aurora Kinase In Complex With Inhibitor Length = 275 Back     alignment and structure
>pdb|2DWB|A Chain A, Aurora-A Kinase Complexed With Amppnp Length = 285 Back     alignment and structure
>pdb|2XNG|A Chain A, Structure Of Aurora-A Bound To A Selective Imidazopyrazine Inhibitor Length = 283 Back     alignment and structure
>pdb|2X6D|A Chain A, Aurora-A Bound To An Inhibitor Length = 285 Back     alignment and structure
>pdb|1MQ4|A Chain A, Crystal Structure Of Aurora-A Protein Kinase Length = 272 Back     alignment and structure
>pdb|3UNZ|A Chain A, Aurora A In Complex With Rpm1679 Length = 279 Back     alignment and structure
>pdb|2WNT|A Chain A, Crystal Structure Of The Human Ribosomal Protein S6 Kinase Length = 330 Back     alignment and structure
>pdb|3RNY|A Chain A, Crystal Structure Of Human Rsk1 C-Terminal Kinase Domain Length = 346 Back     alignment and structure
>pdb|1OL5|A Chain A, Structure Of Aurora-A 122-403, Phosphorylated On Thr287, Thr288 And Bound To Tpx2 1-43 Length = 282 Back     alignment and structure
>pdb|2QR8|A Chain A, 2.0a X-ray Structure Of C-terminal Kinase Domain Of P90 Ribosomal S6 Kinase 2 (rsk2) Length = 342 Back     alignment and structure
>pdb|2XNE|A Chain A, Structure Of Aurora-A Bound To An Imidazopyrazine Inhibitor Length = 272 Back     alignment and structure
>pdb|2WQE|A Chain A, Structure Of S155r Aurora-A Somatic Mutant Length = 262 Back     alignment and structure
>pdb|1OL6|A Chain A, Structure Of Unphosphorylated D274n Mutant Of Aurora-a Length = 282 Back     alignment and structure
>pdb|3HA6|A Chain A, Crystal Structure Of Aurora A In Complex With Tpx2 And Compound 10 Length = 268 Back     alignment and structure
>pdb|2W1C|A Chain A, Structure Determination Of Aurora Kinase In Complex With Inhibitor Length = 275 Back     alignment and structure
>pdb|2XRU|A Chain A, Aurora-A T288e Complexed With Pha-828300 Length = 280 Back     alignment and structure
>pdb|3E5A|A Chain A, Crystal Structure Of Aurora A In Complex With Vx-680 And Tpx2 Length = 268 Back     alignment and structure
>pdb|3H0Y|A Chain A, Aurora A In Complex With A Bisanilinopyrimidine Length = 268 Back     alignment and structure
>pdb|2VRX|A Chain A, Structure Of Aurora B Kinase In Complex With Zm447439 Length = 285 Back     alignment and structure
>pdb|3FDN|A Chain A, Structure-Based Drug Design Of Novel Aurora Kinase A Inhibitors: Structure Basis For Potency And Specificity Length = 279 Back     alignment and structure
>pdb|2C6D|A Chain A, Aurora A Kinase Activated Mutant (T287d) In Complex With Adpnp Length = 275 Back     alignment and structure
>pdb|2BFY|A Chain A, Complex Of Aurora-B With Incenp And Hesperidin. Length = 284 Back     alignment and structure
>pdb|3NRM|A Chain A, Imidazo[1,2-A]pyrazine-Based Aurora Kinase Inhibitors Length = 283 Back     alignment and structure
>pdb|2BMC|A Chain A, Aurora-2 T287d T288d Complexed With Pha-680632 Length = 306 Back     alignment and structure
>pdb|3LAU|A Chain A, Crystal Structure Of Aurora2 Kinase In Complex With A Gsk3beta Inhibitor Length = 287 Back     alignment and structure
>pdb|2C6E|A Chain A, Aurora A Kinase Activated Mutant (T287d) In Complex With A 5-Aminopyrimidinyl Quinazoline Inhibitor Length = 283 Back     alignment and structure
>pdb|2WTW|A Chain A, Aurora-A Inhibitor Structure (2nd Crystal Form) Length = 285 Back     alignment and structure
>pdb|3R21|A Chain A, Design, Synthesis, And Biological Evaluation Of Pyrazolopyridine- Sulfonamides As Potent Multiple-Mitotic Kinase (Mmk) Inhibitors (Part I) Length = 271 Back     alignment and structure
>pdb|4DA1|A Chain A, Crystal Structure Of Branched-Chain Alpha-Ketoacid Dehydrogenase Phosphatase With Mg (Ii) Ions At The Active Site Length = 389 Back     alignment and structure
>pdb|3QBN|A Chain A, Structure Of Human Aurora A In Complex With A Diaminopyrimidine Length = 281 Back     alignment and structure
>pdb|2IQ1|A Chain A, Crystal Structure Of Human Ppm1k Length = 274 Back     alignment and structure
>pdb|3NMV|B Chain B, Crystal Structure Of Pyrabactin-Bound Abscisic Acid Receptor Pyl2 Mutant A93f In Complex With Type 2c Protein Phosphatase Abi2 Length = 324 Back     alignment and structure
>pdb|2QR7|A Chain A, 2.0a X-Ray Structure Of C-Terminal Kinase Domain Of P90 Ribosomal S6 Kinase 2: Se-Met Derivative Length = 342 Back     alignment and structure
>pdb|3KN5|A Chain A, Crystal Structure Of The C-Terminal Kinase Domain Of Msk1 In With Amp-Pnp Length = 325 Back     alignment and structure
>pdb|3DAE|A Chain A, Crystal Structure Of Phosphorylated Snf1 Kinase Domain Length = 283 Back     alignment and structure
>pdb|3HYH|A Chain A, Crystal Structure Of The Protein Kinase Domain Of Yeast Amp-Activated Protein Kinase Snf1 Length = 275 Back     alignment and structure
>pdb|3MN3|A Chain A, An Inhibited Conformation For The Protein Kinase Domain Of The Saccharomyces Cerevisiae Ampk Homolog Snf1 Length = 271 Back     alignment and structure
>pdb|2FH9|A Chain A, Structure And Dimerization Of The Kinase Domain From Yeast Snf1 Length = 274 Back     alignment and structure
>pdb|3COK|A Chain A, Crystal Structure Of Plk4 Kinase Length = 278 Back     alignment and structure
>pdb|1QL6|A Chain A, The Catalytic Mechanism Of Phosphorylase Kinase Probed By Mutational Studies Length = 298 Back     alignment and structure
>pdb|3KDJ|B Chain B, Complex Structure Of (+)-Aba-Bound Pyl1 And Abi1 Length = 316 Back     alignment and structure
>pdb|1ZMU|A Chain A, Catalytic And Ubiqutin-Associated Domains Of Mark2PAR-1: Wild Type Length = 327 Back     alignment and structure
>pdb|2R0I|A Chain A, Crystal Structure Of A Kinase Mark2PAR-1 Mutant Length = 327 Back     alignment and structure
>pdb|1ZMV|A Chain A, Catalytic And Ubiqutin-Associated Domains Of Mark2PAR-1: K82r Mutant Length = 327 Back     alignment and structure
>pdb|2XK9|A Chain A, Structural Analysis Of Checkpoint Kinase 2 (Chk2) In Complex With Inhibitor Pv1533 Length = 322 Back     alignment and structure
>pdb|2YCR|A Chain A, Crystal Structure Of Checkpoint Kinase 2 In Complex With Inhibitor Pv976 Length = 323 Back     alignment and structure
>pdb|1PHK|A Chain A, Two Structures Of The Catalytic Domain Of Phosphorylase, Kinase: An Active Protein Kinase Complexed With Nucleotide, Substrate-Analogue And Product Length = 298 Back     alignment and structure
>pdb|2W0J|A Chain A, Crystal Structure Of Chk2 In Complex With Nsc 109555, A Specific Inhibitor Length = 323 Back     alignment and structure
>pdb|2YCF|A Chain A, Crystal Structure Of Checkpoint Kinase 2 In Complex With Inhibitor Pv1531 Length = 322 Back     alignment and structure
>pdb|3JRQ|A Chain A, Crystal Structure Of (+)-aba-bound Pyl1 In Complex With Abi1 Length = 326 Back     alignment and structure
>pdb|3NMN|B Chain B, Crystal Structure Of Pyrabactin-Bound Abscisic Acid Receptor Pyl1 In Complex With Type 2c Protein Phosphatase Abi1 Length = 319 Back     alignment and structure
>pdb|2CN5|A Chain A, Crystal Structure Of Human Chk2 In Complex With Adp Length = 329 Back     alignment and structure
>pdb|2V5Q|A Chain A, Crystal Structure Of Wild-type Plk-1 Kinase Domain In Complex With A Selective Darpin Length = 315 Back     alignment and structure
>pdb|2YAC|A Chain A, Crystal Structure Of Polo-Like Kinase 1 In Complex With Nms-P937 Length = 311 Back     alignment and structure
>pdb|3KB7|A Chain A, Crystal Structure Of Polo-Like Kinase 1 In Complex With A Pyrazoloquinazoline Inhibitor Length = 311 Back     alignment and structure
>pdb|3H4J|B Chain B, Crystal Structure Of Pombe Ampk Kdaid Fragment Length = 336 Back     alignment and structure
>pdb|2PHK|A Chain A, The Crystal Structure Of A Phosphorylase Kinase Peptide Substrate Complex: Kinase Substrate Recognition Length = 277 Back     alignment and structure
>pdb|2WTV|A Chain A, Aurora-A Inhibitor Structure Length = 285 Back     alignment and structure
>pdb|3IEC|A Chain A, Helicobacter Pylori Caga Inhibits Par1MARK FAMILY KINASES BY Mimicking Host Substrates Length = 319 Back     alignment and structure
>pdb|2Y7J|A Chain A, Structure Of Human Phosphorylase Kinase, Gamma 2 Length = 365 Back     alignment and structure
>pdb|1ZMW|A Chain A, Catalytic And Ubiqutin-Associated Domains Of Mark2PAR-1: T208aS212A INACTIVE DOUBLE MUTANT Length = 327 Back     alignment and structure
>pdb|3I6W|A Chain A, Structure And Activation Mechanism Of The Chk2 Dna-Damage Checkpoint Kinase Length = 443 Back     alignment and structure
>pdb|3I6U|A Chain A, Structure And Activation Mechanism Of The Chk2 Dna-Damage Checkpoint Kinase Length = 419 Back     alignment and structure
>pdb|2WZJ|A Chain A, Catalytic And Uba Domain Of Kinase Mark2(PAR-1) K82r, T208e Double Mutant Length = 327 Back     alignment and structure
>pdb|3THB|A Chain A, Structure Of Plk1 Kinase Domain In Complex With A Benzolactam-Derived Inhibitor Length = 333 Back     alignment and structure
>pdb|2OU7|A Chain A, Structure Of The Catalytic Domain Of Human Polo-Like Kinase 1 Length = 335 Back     alignment and structure
>pdb|3IDB|B Chain B, Crystal Structure Of (108-268)riib:c Holoenzyme Of Camp- Dependent Protein Kinase Length = 161 Back     alignment and structure
>pdb|2HW6|A Chain A, Crystal Structure Of Mnk1 Catalytic Domain Length = 307 Back     alignment and structure
>pdb|2RKU|A Chain A, Structure Of Plk1 In Complex With Bi2536 Length = 294 Back     alignment and structure
>pdb|3SOA|A Chain A, Full-Length Human Camkii Length = 444 Back     alignment and structure
>pdb|3IDC|B Chain B, Crystal Structure Of (102-265)riib:c Holoenzyme Of Camp- Dependent Protein Kinase Length = 164 Back     alignment and structure
>pdb|1Y8G|A Chain A, Catalytic And Ubiqutin-Associated Domains Of Mark2PAR-1: Inactive Double Mutant With Selenomethionine Length = 327 Back     alignment and structure
>pdb|4AF3|A Chain A, Human Aurora B Kinase In Complex With Incenp And Vx-680 Length = 292 Back     alignment and structure
>pdb|2WEL|A Chain A, Crystal Structure Of Su6656-Bound CalciumCALMODULIN- Dependent Protein Kinase Ii Delta In Complex With Calmodulin Length = 327 Back     alignment and structure
>pdb|2VZ6|A Chain A, Structure Of Human Calcium Calmodulin Dependent Protein Kinase Type Ii Alpha (Camk2a) In Complex With Indirubin E804 Length = 313 Back     alignment and structure
>pdb|2VN9|A Chain A, Crystal Structure Of Human Calcium Calmodulin Dependent Protein Kinase Ii Delta Isoform 1, Camkd Length = 301 Back     alignment and structure
>pdb|2QNJ|A Chain A, Kinase And Ubiquitin-Associated Domains Of Mark3PAR-1 Length = 328 Back     alignment and structure
>pdb|3BHH|A Chain A, Crystal Structure Of Human Calcium/calmodulin-dependent Protein Kinase Iib Isoform 1 (camk2b) Length = 295 Back     alignment and structure
>pdb|3FHI|B Chain B, Crystal Structure Of A Complex Between The Catalytic And Regulatory (Ri{alpha}) Subunits Of Pka Length = 154 Back     alignment and structure
>pdb|2Y94|A Chain A, Structure Of An Active Form Of Mammalian Ampk Length = 476 Back     alignment and structure
>pdb|3PVB|B Chain B, Crystal Structure Of (73-244)ria:c Holoenzyme Of Camp-Dependent Protein Kinase Length = 160 Back     alignment and structure
>pdb|3D5U|A Chain A, Crystal Structure Of A Wildtype Polo-Like Kinase 1 (Plk1) Catalytic Domain Length = 317 Back     alignment and structure
>pdb|3FE3|A Chain A, Crystal Structure Of The Kinase Mark3PAR-1: T211a-S215a Double Mutant Length = 328 Back     alignment and structure
>pdb|2JAM|A Chain A, Crystal Structure Of Human Calmodulin-Dependent Protein Kinase I G Length = 304 Back     alignment and structure
>pdb|3D5W|A Chain A, Crystal Structure Of A Phosphorylated Polo-Like Kinase 1 (Plk1) Catalytic Domain In Complex With Adp Length = 317 Back     alignment and structure
>pdb|3D5V|A Chain A, Crystal Structure Of An Activated (Thr->asp) Polo-Like Kinase 1 (Plk1) Catalytic Domain. Length = 317 Back     alignment and structure
>pdb|3DB6|A Chain A, Crystal Structure Of An Activated (Thr->asp) Polo-Like Kinase 1 (Plk1) Catalytic Domain In Complex With Compound 902 Length = 301 Back     alignment and structure
>pdb|3QN1|B Chain B, Crystal Structure Of The Pyr1 Abscisic Acid Receptor In Complex With The Hab1 Type 2c Phosphatase Catalytic Domain Length = 337 Back     alignment and structure
>pdb|4DS8|B Chain B, Complex Structure Of Abscisic Acid Receptor Pyl3-(+)-Aba-Hab1 In The Presence Of Mn2+ Length = 343 Back     alignment and structure
>pdb|3KB3|B Chain B, Crystal Structure Of Abscisic Acid-Bound Pyl2 In Complex With Hab1 Length = 321 Back     alignment and structure
>pdb|2HAK|A Chain A, Catalytic And Ubiqutin-Associated Domains Of Mark1PAR-1 Length = 328 Back     alignment and structure
>pdb|3NMT|B Chain B, Crystal Structure Of Pyrabactin Bound Abscisic Acid Receptor Pyl2 Mutant A93f In Complex With Type 2c Protein Phosphatase Hab1 Length = 341 Back     alignment and structure
>pdb|3UJG|B Chain B, Crystal Structure Of Snrk2.6 In Complex With Hab1 Length = 350 Back     alignment and structure
>pdb|2V7O|A Chain A, Crystal Structure Of Human Calcium-Calmodulin-Dependent Protein Kinase Ii Gamma Length = 336 Back     alignment and structure
>pdb|2H6D|A Chain A, Protein Kinase Domain Of The Human 5'-Amp-Activated Protein Kinase Catalytic Subunit Alpha-2 (Ampk Alpha-2 Chain) Length = 276 Back     alignment and structure
>pdb|2AC3|A Chain A, Structure Of Human Mnk2 Kinase Domain Length = 316 Back     alignment and structure
>pdb|3LIJ|A Chain A, Crystal Structure Of Full Length Cpcdpk3 (Cgd5_820) In Complex With Ca2+ And Amppnp Length = 494 Back     alignment and structure
>pdb|2AC5|A Chain A, Structure Of Human Mnk2 Kinase Domain Mutant D228g Length = 316 Back     alignment and structure
>pdb|3RT0|A Chain A, Crystal Structure Of Pyl10-Hab1 Complex In The Absence Of Abscisic Acid (Aba) Length = 340 Back     alignment and structure
>pdb|2YZA|A Chain A, Crystal Structure Of Kinase Domain Of Human 5'-Amp-Activated Protein Kinase Alpha-2 Subunit Mutant (T172d) Length = 276 Back     alignment and structure
>pdb|2I0O|A Chain A, Crystal Structure Of Anopheles Gambiae SerTHR PHOSPHATASE COMPLEXED With Zn2+ Length = 304 Back     alignment and structure
>pdb|3UTO|A Chain A, Twitchin Kinase Region From C.Elegans (Fn31-Nl-Kin-Crd-Ig26) Length = 573 Back     alignment and structure
>pdb|2ZV2|A Chain A, Crystal Structure Of Human CalciumCALMODULIN-Dependent Protein Kinase Kinase 2, Beta, Camkk2 Kinase Domain In Complex With Sto-609 Length = 298 Back     alignment and structure
>pdb|2YA9|A Chain A, Crystal Structure Of The Autoinhibited Form Of Mouse Dapk2 Length = 361 Back     alignment and structure
>pdb|1KOA|A Chain A, Twitchin Kinase Fragment (C.Elegans), Autoregulated Protein Kinase And Immunoglobulin Domains Length = 491 Back     alignment and structure
>pdb|3IGO|A Chain A, Crystal Structure Of Cryptosporidium Parvum Cdpk1, Cgd3_920 Length = 486 Back     alignment and structure
>pdb|3Q5I|A Chain A, Crystal Structure Of Pbanka_031420 Length = 504 Back     alignment and structure
>pdb|2A27|A Chain A, Human Drp-1 Kinase, W305s S308a D40 Mutant, Crystal Form With 8 Monomers In The Asymmetric Unit Length = 321 Back     alignment and structure
>pdb|1WMK|A Chain A, Human Death-Associated Kinase Drp-1, Mutant S308d D40 Length = 321 Back     alignment and structure
>pdb|3KK9|A Chain A, Camkii Substrate Complex B Length = 282 Back     alignment and structure
>pdb|3KK8|A Chain A, Camkii Substrate Complex A Length = 284 Back     alignment and structure
>pdb|1Z9X|A Chain A, Human Drp-1 Kinase, W305s S308a D40 Mutant, Crystal Form With 3 Monomers In The Asymmetric Unit Length = 321 Back     alignment and structure
>pdb|2BDW|A Chain A, Crystal Structure Of The Auto-Inhibited Kinase Domain Of CalciumCALMODULIN ACTIVATED KINASE II Length = 362 Back     alignment and structure
>pdb|3KL8|A Chain A, Camkiintide Inhibitor Complex Length = 269 Back     alignment and structure
>pdb|2A2A|A Chain A, High-resolution Crystallographic Analysis Of The Autoinhibited Conformation Of A Human Death-associated Protein Kinase Length = 321 Back     alignment and structure
>pdb|2WEI|A Chain A, Crystal Structure Of The Kinase Domain Of Cryptosporidium Parvum Calcium Dependent Protein Kinase In Complex With 3- Mb-Pp1 Length = 287 Back     alignment and structure
>pdb|1ZWS|A Chain A, Crystal Structure Of The Catalytic Domain Of Human Drp-1 Kinase Length = 288 Back     alignment and structure
>pdb|3DFA|A Chain A, Crystal Structure Of Kinase Domain Of Calcium-dependent Protein Kinase Cgd3_920 From Cryptosporidium Parvum Length = 286 Back     alignment and structure
>pdb|3R1N|A Chain A, Mk3 Kinase Bound To Compound 5b Length = 317 Back     alignment and structure
>pdb|3I79|A Chain A, Calcium-Dependent Protein Kinase 1 From Toxoplasma Gondii (Tgcdpk1) Length = 484 Back     alignment and structure
>pdb|3FHR|A Chain A, High Resolution Crystal Structure Of Mitogen-Activated Protein Kinase-Activated Protein Kinase 3 (Mk3)-Inhibitor Complex Length = 336 Back     alignment and structure
>pdb|2C30|A Chain A, Crystal Structure Of The Human P21-Activated Kinase 6 Length = 321 Back     alignment and structure
>pdb|3KU2|A Chain A, Crystal Structure Of Inactivated Form Of Cdpk1 From Toxoplasma Gondii, Tgme49.101440 Length = 507 Back     alignment and structure
>pdb|3HX4|A Chain A, Crystal Structure Of Cdpk1 Of Toxoplasma Gondii, Tgme49_101440, In Presence Of Calcium Length = 508 Back     alignment and structure
>pdb|3MA6|A Chain A, Crystal Structure Of Kinase Domain Of Tgcdpk1 In Presence Of 3brb-Pp1 Length = 298 Back     alignment and structure
>pdb|2JC6|A Chain A, Crystal Structure Of Human Calmodulin-Dependent Protein Kinase 1d Length = 334 Back     alignment and structure
>pdb|4FIE|A Chain A, Full-Length Human Pak4 Length = 423 Back     alignment and structure
>pdb|1YHS|A Chain A, Crystal Structure Of Pim-1 Bound To Staurosporine Length = 273 Back     alignment and structure
>pdb|3HZT|A Chain A, Crystal Structure Of Toxoplasma Gondii Cdpk3, Tgme49_105860 Length = 467 Back     alignment and structure
>pdb|4DTK|A Chain A, Novel And Selective Pan-Pim Kinase Inhibitor Length = 276 Back     alignment and structure
>pdb|1YXS|A Chain A, Crystal Structure Of Kinase Pim1 With P123m Mutation Length = 293 Back     alignment and structure
>pdb|4ALU|A Chain A, Benzofuropyrimidinone Inhibitors Of Pim-1 Length = 328 Back     alignment and structure
>pdb|3JXW|A Chain A, Discovery Of 3h-Benzo[4,5]thieno[3,2-D]pyrimidin-4-Ones As Potent, Highly Selective And Orally Bioavailable Pim Kinases Inhibitors Length = 294 Back     alignment and structure
>pdb|3UIX|A Chain A, Crystal Structure Of Pim1 Kinase In Complex With Small Molecule Inhibitor Length = 298 Back     alignment and structure
>pdb|1KOB|A Chain A, Twitchin Kinase Fragment (Aplysia), Autoregulated Protein Kinase Domain Length = 387 Back     alignment and structure
>pdb|1YWV|A Chain A, Crystal Structures Of Proto-Oncogene Kinase Pim1: A Target Of Aberrant Somatic Hypermutations In Diffuse Large Cell Lymphoma Length = 293 Back     alignment and structure
>pdb|3R00|A Chain A, The Discovery Of Novel Benzofuran-2-Carboxylic Acids As Potent Pim-1 Inhibitors Length = 299 Back     alignment and structure
>pdb|1XQZ|A Chain A, Crystal Structure Of Hpim-1 Kinase At 2.1 A Resolution Length = 300 Back     alignment and structure
>pdb|3C4E|A Chain A, Pim-1 Kinase Domain In Complex With 3-Aminophenyl-7- Azaindole Length = 273 Back     alignment and structure
>pdb|1XWS|A Chain A, Crystal Structure Of The Human Pim1 Kinase Domain Length = 313 Back     alignment and structure
>pdb|2XJ0|A Chain A, Protein Kinase Pim-1 In Complex With Fragment-4 From Crystallographic Fragment Screen Length = 301 Back     alignment and structure
>pdb|3F2A|A Chain A, Crystal Structure Of Human Pim-1 In Complex With Dappa Length = 300 Back     alignment and structure
>pdb|4ALV|A Chain A, Benzofuropyrimidinone Inhibitors Of Pim-1 Length = 328 Back     alignment and structure
>pdb|3UC3|A Chain A, The Crystal Structure Of Snf1-Related Kinase 2.3 Length = 361 Back     alignment and structure
>pdb|3I7C|A Chain A, Calcium-Dependent Protein Kinase 1 From Toxoplasma Gondii (Tgcdpk1) In Complex With Bumped Kinase Inhibitor Na-Pp2 Length = 484 Back     alignment and structure
>pdb|2Q0N|A Chain A, Structure Of Human P21 Activating Kinase 4 (Pak4) In Complex With A Consensus Peptide Length = 301 Back     alignment and structure
>pdb|3Q4Z|A Chain A, Structure Of Unphosphorylated Pak1 Kinase Domain Length = 306 Back     alignment and structure
>pdb|2IWI|A Chain A, Crystal Structure Of The Human Pim2 In Complex With A Ruthenium Organometallic Ligand Ru1 Length = 312 Back     alignment and structure
>pdb|2CDZ|A Chain A, Crystal Structure Of The Human P21-Activated Kinase 4 In Complex With Cgp74514a Length = 303 Back     alignment and structure
>pdb|3A99|A Chain A, Structure Of Pim-1 Kinase Crystallized In The Presence Of P27kip1 Carboxy-Terminal Peptide Length = 320 Back     alignment and structure
>pdb|2XIY|A Chain A, Protein Kinase Pim-1 In Complex With Fragment-2 From Crystallographic Fragment Screen Length = 301 Back     alignment and structure
>pdb|4FIF|A Chain A, Catalytic Domain Of Human Pak4 With Rpkplvdp Peptide Length = 346 Back     alignment and structure
>pdb|3DXN|A Chain A, Crystal Structure Of The Calcium-dependent Kinase From Toxoplasma Gondii, 541.m00134, Kinase Domain Length = 287 Back     alignment and structure
>pdb|3DCV|A Chain A, Crystal Structure Of Human Pim1 Kinase Complexed With 4-(4- Hydroxy-3-Methyl-Phenyl)-6-Phenylpyrimidin-2(1h)-One Length = 328 Back     alignment and structure
>pdb|4A7C|A Chain A, Crystal Structure Of Pim1 Kinase With Etp46546 Length = 308 Back     alignment and structure
>pdb|2OBJ|A Chain A, Crystal Structure Of Human Pim-1 Kinase In Complex With Inhibitor Length = 333 Back     alignment and structure
>pdb|2X4Z|A Chain A, Crystal Structure Of The Human P21-Activated Kinase 4 In Complex With Pf-03758309 Length = 296 Back     alignment and structure
>pdb|2BVA|A Chain A, Crystal Structure Of The Human P21-Activated Kinase 4 Length = 292 Back     alignment and structure
>pdb|2X0G|A Chain A, X-ray Structure Of A Dap-kinase Calmodulin Complex Length = 334 Back     alignment and structure
>pdb|2W4K|A Chain A, X-Ray Structure Of A Dap-Kinase 2-302 Length = 302 Back     alignment and structure
>pdb|2XIX|A Chain A, Protein Kinase Pim-1 In Complex With Fragment-1 From Crystallographic Fragment Screen Length = 301 Back     alignment and structure
>pdb|2CLQ|A Chain A, Structure Of Mitogen-Activated Protein Kinase Kinase Kinase 5 Length = 295 Back     alignment and structure
>pdb|1P4F|A Chain A, Death Associated Protein Kinase Catalytic Domain With Bound Inhibitor Fragment Length = 293 Back     alignment and structure
>pdb|1F3M|C Chain C, Crystal Structure Of Human SerineTHREONINE KINASE PAK1 Length = 297 Back     alignment and structure
>pdb|3DFC|B Chain B, Crystal Structure Of A Glycine-Rich Loop Mutant Of The Death Associated Protein Kinase Catalytic Domain With Amppnp Length = 295 Back     alignment and structure
>pdb|1IG1|A Chain A, 1.8a X-Ray Structure Of Ternary Complex Of A Catalytic Domain Of Death-Associated Protein Kinase With Atp Analogue And Mn. Length = 294 Back     alignment and structure
>pdb|2YAK|A Chain A, Structure Of Death-Associated Protein Kinase 1 (Dapk1) In Complex With A Ruthenium Octasporine Ligand (Osv) Length = 285 Back     alignment and structure
>pdb|3JPV|A Chain A, Crystal Structure Of Human Proto-Oncogene Serine Threonine Kinase (Pim1) In Complex With A Consensus Peptide And A Pyrrolo[2,3- A]carbazole Ligand Length = 313 Back     alignment and structure
>pdb|3F5U|A Chain A, Crystal Structure Of The Death Associated Protein Kinase In Complex With Amppnp And Mg2+ Length = 295 Back     alignment and structure
>pdb|3GU4|A Chain A, Crystal Structure Of Dapkq23v-Amppnp Length = 295 Back     alignment and structure
>pdb|3CXW|A Chain A, Crystal Structure Of Human Proto-Oncogene Serine Threonine Kinase (Pim1) In Complex With A Consensus Peptide And A Beta Carboline Ligand I Length = 314 Back     alignment and structure
>pdb|2J2I|B Chain B, Crystal Structure Of The Humab Pim1 In Complex With Ly333531 Length = 312 Back     alignment and structure
>pdb|2BIL|B Chain B, The Human Protein Kinase Pim1 In Complex With Its Consensus Peptide Pimtide Length = 313 Back     alignment and structure
>pdb|4AS0|A Chain A, Cyclometalated Phthalimides As Protein Kinase Inhibitors Length = 273 Back     alignment and structure
>pdb|3MA3|A Chain A, Crystal Structure Of Human Proto-Oncogene Serine Threonine Kinase (Pim1) In Complex With A Consensus Peptide And A Naphtho-Difuran Ligand Length = 313 Back     alignment and structure
>pdb|2BIK|B Chain B, Human Pim1 Phosphorylated On Ser261 Length = 313 Back     alignment and structure
>pdb|3CY3|A Chain A, Crystal Structure Of Human Proto-Oncogene Serine Threonine Kinase (Pim1) In Complex With A Consensus Peptide And The Jnk Inhibitor V Length = 314 Back     alignment and structure
>pdb|3GU8|A Chain A, Crystal Structure Of Dapkl93g With N6-Cyclopentyladenosine Length = 295 Back     alignment and structure
>pdb|2XZS|A Chain A, Death Associated Protein Kinase 1 Residues 1-312 Length = 312 Back     alignment and structure
>pdb|2Y0A|A Chain A, Structure Of Dapk1 Construct Residues 1-304 Length = 326 Back     alignment and structure
>pdb|4FG9|A Chain A, Crystal Structure Of Human Calcium/calmodulin-dependent Protein Kinase I 1-320 In Complex With Atp Length = 320 Back     alignment and structure
>pdb|4FG8|A Chain A, Crystal Structure Of Human Calcium/calmodulin-dependent Protein Kinase I 1-315 In Complex With Atp Length = 315 Back     alignment and structure
>pdb|3VW6|A Chain A, Crystal Structure Of Human Apoptosis Signal-Regulating Kinase 1 (Ask1) With Imidazopyridine Inhibitor Length = 269 Back     alignment and structure
>pdb|1WVW|A Chain A, Crystal Structures Of Kinase Domain Of Dap Kinase In Complex With Small Molecular Inhibitors Length = 278 Back     alignment and structure
>pdb|2W4J|A Chain A, X-Ray Structure Of A Dap-Kinase 2-277 Length = 277 Back     alignment and structure
>pdb|1A06|A Chain A, Calmodulin-Dependent Protein Kinase From Rat Length = 332 Back     alignment and structure
>pdb|2F57|A Chain A, Crystal Structure Of The Human P21-activated Kinase 5 Length = 317 Back     alignment and structure
>pdb|2XUU|A Chain A, Crystal Structure Of A Dap-Kinase 1 Mutant Length = 334 Back     alignment and structure
>pdb|4FG7|A Chain A, Crystal Structure Of Human Calcium/calmodulin-dependent Protein Kinase I 1-293 In Complex With Atp Length = 293 Back     alignment and structure
>pdb|2WTK|C Chain C, Structure Of The Heterotrimeric Lkb1-Stradalpha-Mo25alpha Complex Length = 305 Back     alignment and structure
>pdb|1KWP|A Chain A, Crystal Structure Of Mapkap2 Length = 400 Back     alignment and structure
>pdb|2W4O|A Chain A, Crystal Structure Of Human Camk4 In Complex With 4-Amino( Sulfamoyl-Phenylamino)-Triazole-Carbothioic Acid (2,6- Difluoro-Phenyl)-Amide) Length = 349 Back     alignment and structure
>pdb|2OZA|A Chain A, Structure Of P38alpha Complex Length = 356 Back     alignment and structure
>pdb|3FXZ|A Chain A, Crystal Structure Of Pak1 Kinase Domain With Ruthenium Complex Lambda-Fl172 Length = 297 Back     alignment and structure
>pdb|2P3G|X Chain X, Crystal Structure Of A Pyrrolopyridine Inhibitor Bound To Mapkap Kinase-2 Length = 327 Back     alignment and structure
>pdb|2PZY|A Chain A, Structure Of Mk2 Complexed With Compound 76 Length = 324 Back     alignment and structure
>pdb|3R2B|A Chain A, Mk2 Kinase Bound To Compound 5b Length = 318 Back     alignment and structure
>pdb|3R2Y|A Chain A, Mk2 Kinase Bound To Compound 1 Length = 319 Back     alignment and structure
>pdb|3UC4|A Chain A, The Crystal Structure Of Snf1-Related Kinase 2.6 Length = 362 Back     alignment and structure
>pdb|3Q52|A Chain A, Structure Of Phosphorylated Pak1 Kinase Domain Length = 306 Back     alignment and structure
>pdb|3UDB|A Chain A, Crystal Structure Of Snrk2.6 Length = 317 Back     alignment and structure
>pdb|3FPM|A Chain A, Crystal Structure Of A Squarate Inhibitor Bound To Mapkap Kinase-2 Length = 325 Back     alignment and structure
>pdb|2JBO|A Chain A, Protein Kinase Mk2 In Complex With An Inhibitor (Crystal Form-1, Soaking) Length = 326 Back     alignment and structure
>pdb|3UJG|A Chain A, Crystal Structure Of Snrk2.6 In Complex With Hab1 Length = 361 Back     alignment and structure
>pdb|2ONL|C Chain C, Crystal Structure Of The P38a-Mapkap Kinase 2 Heterodimer Length = 406 Back     alignment and structure
>pdb|1YHV|A Chain A, Crystal Structure Of Pak1 Kinase Domain With Two Point Mutations (K299r, T423e) Length = 297 Back     alignment and structure
>pdb|3GOK|A Chain A, Binding Site Mapping Of Protein Ligands Length = 334 Back     alignment and structure
>pdb|3KA0|A Chain A, Mk2 Complex With Inhibitor 6-(5-(2-Aminopyrimidin-4-Ylamino)-2- Hydroxyphenyl)-N-Methylbenzo[b]thiophene-2-Carboxamide Length = 320 Back     alignment and structure
>pdb|3ORI|A Chain A, Mycobacterium Tuberculosis Pknb Kinase Domain L33d Mutant (Crystal Form 1) Length = 311 Back     alignment and structure
>pdb|3F61|A Chain A, Crystal Structure Of M. Tuberculosis Pknb Leu33aspVAL222ASP DOUBLE MUTANT IN COMPLEX WITH ADP Length = 311 Back     alignment and structure
>pdb|1MRU|A Chain A, Intracellular SerTHR PROTEIN KINASE DOMAIN OF Mycobacterium Tuberculosis Pknb. Length = 311 Back     alignment and structure
>pdb|3IS5|A Chain A, Crystal Structure Of Cdpk Kinase Domain From Toxoplasma Gondii, Tgme49_018720 Length = 285 Back     alignment and structure
>pdb|3F69|A Chain A, Crystal Structure Of The Mycobacterium Tuberculosis Pknb Mutant Kinase Domain In Complex With Kt5720 Length = 311 Back     alignment and structure
>pdb|3F3Z|A Chain A, Crystal Structure Of Cryptosporidium Parvum Calcium Dependent Protein Kinase Cgd7_1840 In Presence Of Indirubin E804 Length = 277 Back     alignment and structure
>pdb|1NXK|A Chain A, Crystal Structure Of Staurosporine Bound To Map Kap Kinase 2 Length = 400 Back     alignment and structure
>pdb|2QG5|A Chain A, Cryptosporidium Parvum Calcium Dependent Protein Kinase Cgd7_1840 Length = 294 Back     alignment and structure
>pdb|2HOG|A Chain A, Crystal Structure Of Chek1 In Complex With Inhibitor 20 Length = 322 Back     alignment and structure
>pdb|1O6Y|A Chain A, Catalytic Domain Of Pknb Kinase From Mycobacterium Tuberculosis Length = 299 Back     alignment and structure
>pdb|3HKO|A Chain A, Crystal Structure Of A Cdpk Kinase Domain From Cryptosporidium Parvum, Cgd7_40 Length = 345 Back     alignment and structure
>pdb|2R0U|A Chain A, Crystal Structure Of Chek1 In Complex With Inhibitor 54 Length = 323 Back     alignment and structure
>pdb|3ALN|A Chain A, Crystal Structure Of Human Non-Phosphorylated Mkk4 Kinase Domain Complexed With Amp-Pnp Length = 327 Back     alignment and structure
>pdb|1YRP|A Chain A, Catalytic Domain Of Human Zip Kinase Phosphorylated At Thr265 Length = 278 Back     alignment and structure
>pdb|3ORM|A Chain A, Mycobacterium Tuberculosis Pknb Kinase Domain D76a Mutant Length = 311 Back     alignment and structure
>pdb|3BHY|A Chain A, Crystal Structure Of Human Death Associated Protein Kinase 3 (Dapk3) In Complex With A Beta-Carboline Ligand Length = 283 Back     alignment and structure
>pdb|1TKI|A Chain A, Autoinhibited Serine Kinase Domain Of The Giant Muscle Protein Titin Length = 321 Back     alignment and structure
>pdb|2J90|A Chain A, Crystal Structure Of Human Zip Kinase In Complex With A Tetracyclic Pyridone Inhibitor (pyridone 6) Length = 304 Back     alignment and structure
>pdb|3ZUT|A Chain A, The Structure Of Ost1 (D160a) Kinase Length = 362 Back     alignment and structure
>pdb|2PNQ|A Chain A, Crystal Structure Of Pyruvate Dehydrogenase Phosphatase 1 (Pdp1) Length = 467 Back     alignment and structure
>pdb|3MFR|A Chain A, Cask-4m Cam Kinase Domain, Native Length = 351 Back     alignment and structure
>pdb|3MQ3|A Chain A, Crystal Structure Of Native Bovine Pdp1c Length = 467 Back     alignment and structure
>pdb|3ZUU|A Chain A, The Structure Of Ost1 (D160a, S175d) Kinase In Complex With Gold Length = 362 Back     alignment and structure
>pdb|3OCP|A Chain A, Crystal Structure Of Camp Bound Cgmp-Dependent Protein Kinase(92-227) Length = 139 Back     alignment and structure
>pdb|4EQM|A Chain A, Structural Analysis Of Staphylococcus Aureus SerineTHREONINE KINASE Pknb Length = 294 Back     alignment and structure
>pdb|2W5A|A Chain A, Human Nek2 Kinase Adp-Bound Length = 279 Back     alignment and structure
>pdb|3C0G|A Chain A, Cask Cam-kinase Domain- 3'-amp Complex, P1 Form Length = 351 Back     alignment and structure
>pdb|3TAC|A Chain A, Crystal Structure Of The Liprin-AlphaCASK COMPLEX Length = 361 Back     alignment and structure
>pdb|3VN9|A Chain A, Rifined Crystal Structure Of Non-Phosphorylated Map2k6 In A Putative Auto-Inhibition State Length = 340 Back     alignment and structure
>pdb|2JAV|A Chain A, Human Kinase With Pyrrole-Indolinone Ligand Length = 279 Back     alignment and structure
>pdb|3FXJ|A Chain A, Crystal Structure Of Human Protein Phosphatase 1a (Ppm1a) Bound With Phosphate At 3 Mm Of Mn2+ Length = 390 Back     alignment and structure
>pdb|2WQM|A Chain A, Structure Of Apo Human Nek7 Length = 310 Back     alignment and structure
>pdb|1A6Q|A Chain A, Crystal Structure Of The Protein SerineTHREONINE PHOSPHATASE 2C AT 2 A Resolution Length = 382 Back     alignment and structure
>pdb|3DLS|A Chain A, Crystal Structure Of Human Pas Kinase Bound To Adp Length = 335 Back     alignment and structure
>pdb|4A4X|A Chain A, Nek2-Ede Bound To Cct248662 Length = 279 Back     alignment and structure
>pdb|2P8E|A Chain A, Crystal Structure Of The SerineTHREONINE PHOSPHATASE Domain Of Human Ppm1b Length = 307 Back     alignment and structure
>pdb|3FME|A Chain A, Crystal Structure Of Human Mitogen-Activated Protein Kinase Kinase 6 (Mek6) Activated Mutant (S207d, T211d) Length = 290 Back     alignment and structure
>pdb|4FSU|A Chain A, Crystal Structure Of The Chk1 Length = 279 Back     alignment and structure
>pdb|4FSM|A Chain A, Crystal Structure Of The Chk1 Length = 279 Back     alignment and structure
>pdb|4FSN|A Chain A, Crystal Structure Of The Chk1 Length = 278 Back     alignment and structure
>pdb|4FSY|A Chain A, Crystal Structure Of The Chk1 Length = 279 Back     alignment and structure
>pdb|2GHG|A Chain A, H-Chk1 Complexed With A431994 Length = 269 Back     alignment and structure
>pdb|3E7O|A Chain A, Crystal Structure Of Jnk2 Length = 360 Back     alignment and structure
>pdb|2X8E|A Chain A, Discovery Of A Novel Class Of Triazolones As Checkpoint Kinase Inhibitors - Hit To Lead Exploration Length = 276 Back     alignment and structure
>pdb|2E9V|A Chain A, Structure Of H-Chk1 Complexed With A859017 Length = 268 Back     alignment and structure
>pdb|2BR1|A Chain A, Structure-Based Design Of Novel Chk1 Inhibitors: Insights Into Hydrogen Bonding And Protein-Ligand Affinity Length = 297 Back     alignment and structure
>pdb|1IA8|A Chain A, The 1.7 A Crystal Structure Of Human Cell Cycle Checkpoint Kinase Chk1 Length = 289 Back     alignment and structure
>pdb|1ZLT|A Chain A, Crystal Structure Of Chk1 Complexed With A Hymenaldisine Analog Length = 295 Back     alignment and structure
>pdb|3JVR|A Chain A, Characterization Of The Chk1 Allosteric Inhibitor Binding Site Length = 271 Back     alignment and structure
>pdb|3OT3|A Chain A, X-Ray Crystal Structure Of Compound 22k Bound To Human Chk1 Kinase Domain Length = 273 Back     alignment and structure
>pdb|1ZYS|A Chain A, Co-Crystal Structure Of Checkpoint Kinase Chk1 With A Pyrrolo-Pyridine Inhibitor Length = 273 Back     alignment and structure
>pdb|2AYP|A Chain A, Crystal Structure Of Chk1 With An Indol Inhibitor Length = 269 Back     alignment and structure
>pdb|2X4F|A Chain A, The Crystal Structure Of The Human Myosin Light Chain Kinase Loc340156. Length = 373 Back     alignment and structure
>pdb|3NPC|A Chain A, Crystal Structure Of Jnk2 Complexed With Birb796 Length = 364 Back     alignment and structure
>pdb|3COI|A Chain A, Crystal Structure Of P38delta Kinase Length = 353 Back     alignment and structure
>pdb|3COM|A Chain A, Crystal Structure Of Mst1 Kinase Length = 314 Back     alignment and structure
>pdb|4EXU|A Chain A, Mapk13, Inactive Form Length = 371 Back     alignment and structure
>pdb|2QC6|A Chain A, Protein Kinase Ck2 In Complex With Dbc Length = 332 Back     alignment and structure
>pdb|1DAW|A Chain A, Crystal Structure Of A Binary Complex Of Protein Kinase Ck2 (Alpha-Subunit) And Mg-Amppnp Length = 327 Back     alignment and structure
>pdb|1M2P|A Chain A, Crystal Structure Of 1,8-Di-Hydroxy-4-Nitro- AnthraquinoneCK2 KINASE COMPLEX Length = 325 Back     alignment and structure
>pdb|3PVG|A Chain A, Crystal Structure Of Z. Mays Ck2 Alpha Subunit In Complex With The Inhibitor 4,5,6,7-Tetrabromo-1-Carboxymethylbenzimidazole (K68) Length = 331 Back     alignment and structure
>pdb|1DS5|A Chain A, Dimeric Crystal Structure Of The Alpha Subunit In Complex With Two Beta Peptides Mimicking The Architecture Of The Tetrameric Protein Kinase Ck2 Holoenzyme. Length = 332 Back     alignment and structure
>pdb|4ANM|A Chain A, Complex Of Ck2 With A Cdc7 Inhibitor Length = 335 Back     alignment and structure
>pdb|4DGN|A Chain A, Crystal Structure Of Maize Ck2 In Complex With The Inhibitor Luteolin Length = 326 Back     alignment and structure
>pdb|3KXG|A Chain A, Crystal Structure Of Z. Mays Ck2 Kinase Alpha Subunit In Complex With The Inhibitor 3,4,5,6,7-Pentabromo-1h-Indazole (K64) Length = 327 Back     alignment and structure
>pdb|2PVH|A Chain A, Structure-Based Design Of Pyrazolo[1,5-A][1,3,5]triazine Derivatives As Potent Inhibitors Of Protein Kinase Ck2 Length = 352 Back     alignment and structure
>pdb|4DGM|A Chain A, Crystal Structure Of Maize Ck2 In Complex With The Inhibitor Apigenin Length = 326 Back     alignment and structure
>pdb|3ENM|A Chain A, The Structure Of The Map2k Mek6 Reveals An Autoinhibitory Dimer Length = 316 Back     alignment and structure
>pdb|3VUL|A Chain A, Crystal Structure Of A Cysteine-deficient Mutant M1 In Map Kinase Jnk1 Length = 370 Back     alignment and structure
>pdb|3VUM|A Chain A, Crystal Structure Of A Cysteine-deficient Mutant M7 In Map Kinase Jnk1 Length = 370 Back     alignment and structure
>pdb|2DYL|A Chain A, Crystal Structure Of Human Mitogen-Activated Protein Kinase Kinase 7 Activated Mutant (S287d, T291d) Length = 318 Back     alignment and structure
>pdb|3OFM|A Chain A, Structure Of A Human Ck2alpha Prime, The Paralog Isoform Of The Catalytic Subunit Of Protein Kinase Ck2 From Homo Sapiens Length = 350 Back     alignment and structure
>pdb|3U87|A Chain A, Structure Of A Chimeric Construct Of Human Ck2alpha And Human Ck2alpha' In Complex With A Non-hydrolysable Atp-analogue Length = 349 Back     alignment and structure
>pdb|1VYW|A Chain A, Structure Of Cdk2CYCLIN A WITH PNU-292137 Length = 309 Back     alignment and structure
>pdb|4FT3|A Chain A, Crystal Structure Of The Chk1 Length = 279 Back     alignment and structure
>pdb|2R7I|A Chain A, Crystal Structure Of Catalytic Subunit Of Protein Kinase Ck2 Length = 335 Back     alignment and structure
>pdb|3H30|A Chain A, Crystal Structure Of The Catalytic Subunit Of Human Protein Kinase Ck2 With 5,6-Dichloro-1-Beta-D- Ribofuranosylbenzimidazole Length = 334 Back     alignment and structure
>pdb|3Q04|A Chain A, Crystal Structure Of The Apo-Form Of Human Ck2 Alpha At Ph 8.5 Length = 328 Back     alignment and structure
>pdb|3NSZ|A Chain A, Human Ck2 Catalytic Domain In Complex With Amppn Length = 330 Back     alignment and structure
>pdb|3MB6|A Chain A, Human Ck2 Catalytic Domain In Complex With A Difurane Derivative Inhibitor (Cpa) Length = 331 Back     alignment and structure
>pdb|3RZF|A Chain A, Crystal Structure Of Inhibitor Of Kappab Kinase Beta (I4122) Length = 677 Back     alignment and structure
>pdb|3NGA|A Chain A, Human Ck2 Catalytic Domain In Complex With Cx-4945 Length = 333 Back     alignment and structure
>pdb|3E3B|X Chain X, Crystal Structure Of Catalytic Subunit Of Human Protein Kinase Ck2alpha Prime With A Potent Indazole-Derivative Inhibitor Length = 339 Back     alignment and structure
>pdb|1JWH|A Chain A, Crystal Structure Of Human Protein Kinase Ck2 Holoenzyme Length = 337 Back     alignment and structure
>pdb|3Q9W|A Chain A, Crystal Structure Of Human Ck2 Alpha In Complex With Emodin At Ph 8.5 Length = 336 Back     alignment and structure
>pdb|3QA8|A Chain A, Crystal Structure Of Inhibitor Of Kappa B Kinase Beta Length = 676 Back     alignment and structure
>pdb|1NA7|A Chain A, Crystal Structure Of The Catalytic Subunit Of Human Protein Kinase Ck2 Length = 329 Back     alignment and structure
>pdb|4APC|A Chain A, Crystal Structure Of Human Nima-Related Kinase 1 (Nek1) Length = 350 Back     alignment and structure
>pdb|3BQC|A Chain A, High Ph-Value Crystal Structure Of Emodin In Complex With The Catalytic Subunit Of Protein Kinase Ck2 Length = 335 Back     alignment and structure
>pdb|1PJK|A Chain A, Crystal Structure Of A C-terminal Deletion Mutant Of Human Protein Kinase Ck2 Catalytic Subunit Length = 334 Back     alignment and structure
>pdb|4FSZ|A Chain A, Crystal Structure Of The Chk1 Length = 279 Back     alignment and structure
>pdb|1OIT|A Chain A, Imidazopyridines: A Potent And Selective Class Of Cyclin-dependent Kinase Inhibitors Identified Through Structure-based Hybridisation Length = 299 Back     alignment and structure
>pdb|1PF8|A Chain A, Crystal Structure Of Human Cyclin-dependent Kinase 2 Complexed With A Nucleoside Inhibitor Length = 298 Back     alignment and structure
>pdb|1GII|A Chain A, Human Cyclin Dependent Kinase 2 Complexed With The Cdk4 Inhibitor Length = 298 Back     alignment and structure
>pdb|4FSW|A Chain A, Crystal Structure Of The Chk1 Length = 279 Back     alignment and structure
>pdb|2W17|A Chain A, Cdk2 In Complex With The Imidazole Pyrimidine Amide, Compound (S)-8b Length = 299 Back     alignment and structure
>pdb|1FIN|A Chain A, Cyclin A-Cyclin-Dependent Kinase 2 Complex Length = 298 Back     alignment and structure
>pdb|1OIR|A Chain A, Imidazopyridines: A Potent And Selective Class Of Cyclin-Dependent Kinase Inhibitors Identified Through Structure-Based Hybridisation Length = 299 Back     alignment and structure
>pdb|1H01|A Chain A, Cdk2 In Complex With A Disubstituted 2, 4-Bis Anilino Pyrimidine Cdk4 Inhibitor Length = 298 Back     alignment and structure
>pdb|4FST|A Chain A, Crystal Structure Of The Chk1 Length = 269 Back     alignment and structure
>pdb|3PJ8|A Chain A, Structure Of Cdk2 In Complex With A Pyrazolo[4,3-D]pyrimidine Bioisostere Of Roscovitine Length = 299 Back     alignment and structure
>pdb|2ZJW|A Chain A, Crystal Structure Of Human Ck2 Alpha Complexed With Ellagic Acid Length = 340 Back     alignment and structure
>pdb|2YDJ|A Chain A, Discovery Of Checkpoint Kinase Inhibitor Azd7762 By Structure Based Design And Optimization Of Thiophene Carboxamide Ureas Length = 276 Back     alignment and structure
>pdb|2VWI|A Chain A, Structure Of The Osr1 Kinase, A Hypertension Drug Target Length = 303 Back     alignment and structure
>pdb|3EZR|A Chain A, Cdk-2 With Indazole Inhibitor 17 Bound At Its Active Site Length = 300 Back     alignment and structure
>pdb|1GZ8|A Chain A, Human Cyclin Dependent Kinase 2 Complexed With The Inhibitor 2-Amino-6-(3'-Methyl-2'-Oxo)butoxypurine Length = 299 Back     alignment and structure
>pdb|2QKR|A Chain A, Cryptosporidium Parvum Cyclin-Dependent Kinase Cgd5_2510 With Indirubin 3'-Monoxime Bound Length = 313 Back     alignment and structure
>pdb|3NIZ|A Chain A, Cryptosporidium Parvum Cyclin-Dependent Kinase Cgd5_2510 With Adp Bound Length = 311 Back     alignment and structure
>pdb|3VUK|A Chain A, Crystal Structure Of A Cysteine-deficient Mutant M5 In Map Kinase Jnk1 Length = 370 Back     alignment and structure
>pdb|3PXF|A Chain A, Cdk2 In Complex With Two Molecules Of 8-Anilino-1-Naphthalene Sulfonate Length = 306 Back     alignment and structure
>pdb|4ERW|A Chain A, Cdk2 In Complex With Staurosporine Length = 306 Back     alignment and structure
>pdb|3DAK|A Chain A, Crystal Structure Of Domain-Swapped Osr1 Kinase Domain Length = 290 Back     alignment and structure
>pdb|2J51|A Chain A, Crystal Structure Of Human Ste20-Like Kinase Bound To 5- Amino-3-((4-(Aminosulfonyl)phenyl)amino)-N-(2,6- Difluorophenyl)-1h-1,2,4-Triazole-1-Carbothioamide Length = 325 Back     alignment and structure
>pdb|3VUH|A Chain A, Crystal Structure Of A Cysteine-deficient Mutant M3 In Map Kinase Jnk1 Length = 370 Back     alignment and structure
>pdb|3VUI|A Chain A, Crystal Structure Of A Cysteine-deficient Mutant M2 In Map Kinase Jnk1 Length = 370 Back     alignment and structure
>pdb|4DGL|C Chain C, Crystal Structure Of The Ck2 Tetrameric Holoenzyme Length = 335 Back     alignment and structure
>pdb|1UA2|A Chain A, Crystal Structure Of Human Cdk7 Length = 346 Back     alignment and structure
>pdb|2PML|X Chain X, Crystal Structure Of Pfpk7 In Complex With An Atp Analogue Length = 348 Back     alignment and structure
>pdb|4EOI|A Chain A, Thr 160 Phosphorylated Cdk2 K89d, Q131e - Human Cyclin A3 Complex With The Inhibitor Ro3306 Length = 299 Back     alignment and structure
>pdb|3SLS|A Chain A, Crystal Structure Of Human Mek-1 Kinase In Complex With Ucb1353770 And Amppnp Length = 304 Back     alignment and structure
>pdb|3P86|A Chain A, Crystal Structure Of Ctr1 Kinase Domain Mutant D676n In Complex With Staurosporine Length = 309 Back     alignment and structure
>pdb|3JUH|A Chain A, Crystal Structure Of A Mutant Of Human Protein Kinase Ck2alpha With Altered Cosubstrate Specificity Length = 335 Back     alignment and structure
>pdb|4EON|A Chain A, Thr 160 Phosphorylated Cdk2 H84s, Q85m, Q131e - Human Cyclin A3 Complex With The Inhibitor Ro3306 Length = 300 Back     alignment and structure
>pdb|4EOO|A Chain A, Thr 160 Phosphorylated Cdk2 Q131e - Human Cyclin A3 Complex With Atp Length = 299 Back     alignment and structure
>pdb|4EOM|A Chain A, Thr 160 Phosphorylated Cdk2 H84s, Q85m, Q131e - Human Cyclin A3 Complex With Atp Length = 301 Back     alignment and structure
>pdb|4EOP|A Chain A, Thr 160 Phosphorylated Cdk2 Q131e - Human Cyclin A3 Complex With The Inhibitor Ro3306 Length = 300 Back     alignment and structure
>pdb|3VUG|A Chain A, Crystal Structure Of A Cysteine-deficient Mutant M2 In Map Kinase Jnk1 Length = 370 Back     alignment and structure
>pdb|4AAA|A Chain A, Crystal Structure Of The Human Cdkl2 Kinase Domain Length = 331 Back     alignment and structure
>pdb|3CKW|A Chain A, Crystal Structure Of Sterile 20-Like Kinase 3 (Mst3, Stk24) Length = 304 Back     alignment and structure
>pdb|1ZYC|A Chain A, Crystal Structure Of Eif2alpha Protein Kinase Gcn2: Wild- Type In Apo Form. Length = 303 Back     alignment and structure
>pdb|4EUT|A Chain A, Structure Of Bx-795 Complexed With Unphosphorylated Human Tbk1 Kinase- Uld Domain Length = 396 Back     alignment and structure
>pdb|1QMZ|A Chain A, Phosphorylated Cdk2-Cyclyin A-Substrate Peptide Complex Length = 299 Back     alignment and structure
>pdb|4EOK|A Chain A, Thr 160 Phosphorylated Cdk2 H84s, Q85m, K89d - Human Cyclin A3 Complex With The Inhibitor Nu6102 Length = 300 Back     alignment and structure
>pdb|1ZY4|A Chain A, Crystal Structure Of Eif2alpha Protein Kinase Gcn2: R794g Hyperactivating Mutant In Apo Form. Length = 303 Back     alignment and structure
>pdb|3ZHP|C Chain C, Human Mst3 (stk24) In Complex With Mo25beta Length = 294 Back     alignment and structure
>pdb|1W98|A Chain A, The Structural Basis Of Cdk2 Activation By Cyclin E Length = 298 Back     alignment and structure
>pdb|1JST|A Chain A, Phosphorylated Cyclin-Dependent Kinase-2 Bound To Cyclin A Length = 298 Back     alignment and structure
>pdb|4I3Z|A Chain A, Structure Of Pcdk2CYCLINA BOUND TO ADP AND 2 MAGNESIUM IONS Length = 296 Back     alignment and structure
>pdb|1E9H|A Chain A, Thr 160 Phosphorylated Cdk2-Human Cyclin A3 Complex With The Inhibitor Indirubin-5-Sulphonate Bound Length = 297 Back     alignment and structure
>pdb|2XRW|A Chain A, Linear Binding Motifs For Jnk And For Calcineurin Antagonistically Control The Nuclear Shuttling Of Nfat4 Length = 371 Back     alignment and structure
>pdb|3VUD|A Chain A, Crystal Structure Of A Cysteine-deficient Mutant M1 In Map Kinase Jnk1 Length = 370 Back     alignment and structure
>pdb|3BHT|A Chain A, Structure Of Phosphorylated Thr160 Cdk2CYCLIN A IN COMPLEX WITH THE Inhibitor Meriolin 3 Length = 300 Back     alignment and structure
>pdb|1UKH|A Chain A, Structural Basis For The Selective Inhibition Of Jnk1 By The Scaffolding Protein Jip1 And Sp600125 Length = 369 Back     alignment and structure
>pdb|2XS0|A Chain A, Linear Binding Motifs For Jnk And For Calcineurin Antagonistically Control The Nuclear Shuttling Of Nfat4 Length = 386 Back     alignment and structure
>pdb|3A7F|A Chain A, Human Mst3 Kinase Length = 303 Back     alignment and structure
>pdb|2IW8|A Chain A, Structure Of Human Thr160-Phospho Cdk2-Cyclin A F82h-L83v- H84d Mutant With An O6-Cyclohexylmethylguanine Inhibitor Length = 302 Back     alignment and structure
>pdb|4EOS|A Chain A, Thr 160 Phosphorylated Cdk2 Wt - Human Cyclin A3 Complex With The Inhibitor Ro3306 Length = 300 Back     alignment and structure
>pdb|4EOJ|A Chain A, Thr 160 Phosphorylated Cdk2 H84s, Q85m, K89d - Human Cyclin A3 Complex With Atp Length = 302 Back     alignment and structure
>pdb|4EOQ|A Chain A, Thr 160 Phosphorylated Cdk2 Wt - Human Cyclin A3 Complex With Atp Length = 301 Back     alignment and structure
>pdb|4BCQ|A Chain A, Structure Of Cdk2 In Complex With Cyclin A And A 2-amino-4- Heteroaryl-pyrimidine Inhibitor Length = 301 Back     alignment and structure
>pdb|3QHR|A Chain A, Structure Of A Pcdk2CYCLINA TRANSITION-State Mimic Length = 298 Back     alignment and structure
>pdb|3CKX|A Chain A, Crystal Structure Of Sterile 20-Like Kinase 3 (Mst3, Stk24) In Complex With Staurosporine Length = 304 Back     alignment and structure
>pdb|2IW6|A Chain A, Structure Of Human Thr160-Phospho Cdk2-Cyclin A Complexed With A Bisanilinopyrimidine Inhibitor Length = 302 Back     alignment and structure
>pdb|1OGU|A Chain A, Structure Of Human Thr160-phospho Cdk2/cyclin A Complexed With A 2-arylamino-4-cyclohexylmethyl-5-nitroso-6- aminopyrimidine Inhibitor Length = 302 Back     alignment and structure
>pdb|3GGF|A Chain A, Crystal Structure Of Human SerineTHREONINE-Protein Kinase Mst4 In Complex With An Quinazolin Length = 301 Back     alignment and structure
>pdb|1H1P|A Chain A, Structure Of Human Thr160-Phospho Cdk2CYCLIN A COMPLEXED With The Inhibitor Nu2058 Length = 303 Back     alignment and structure
>pdb|2JFM|A Chain A, Crystal Structure Of Human Ste20-Like Kinase (Unliganded Form) Length = 325 Back     alignment and structure
>pdb|1ZXE|A Chain A, Crystal Structure Of Eif2alpha Protein Kinase Gcn2: D835n Inactivating Mutant In Apo Form Length = 303 Back     alignment and structure
>pdb|2JFL|A Chain A, Crystal Structure Of Human Ste20-Like Kinase ( Diphosphorylated Form) Bound To 5- Amino-3-((4-( Aminosulfonyl)phenyl)amino)-N-(2,6- Difluorophenyl)-1h-1,2, 4-Triazole-1-Carbothioamide Length = 325 Back     alignment and structure
>pdb|3KGA|A Chain A, Crystal Structure Of Mapkap Kinase 2 (Mk2) Complexed With A Potent 3-Aminopyrazole Atp Site Inhibitor Length = 299 Back     alignment and structure
>pdb|2Y4I|C Chain C, Ksr2-Mek1 Heterodimer Length = 395 Back     alignment and structure
>pdb|3GC9|A Chain A, The Structure Of P38beta C119s, C162s In Complex With A Dihydroquinazolinone Inhibitor Length = 370 Back     alignment and structure
>pdb|3V3V|A Chain A, Structural And Functional Analysis Of Quercetagetin, A Natural Jnk1 Inhibitor Length = 379 Back     alignment and structure
>pdb|1CM8|A Chain A, Phosphorylated Map Kinase P38-Gamma Length = 367 Back     alignment and structure
>pdb|3OHT|A Chain A, Crystal Structure Of Salmo Salar P38alpha Length = 389 Back     alignment and structure
>pdb|4EUU|A Chain A, Structure Of Bx-795 Complexed With Human Tbk1 Kinase Domain Phosphorylated On Ser172 Length = 319 Back     alignment and structure
>pdb|3GC8|A Chain A, The Structure Of P38beta C162s In Complex With A Dihydroquinazolinone Length = 370 Back     alignment and structure
>pdb|3MTL|A Chain A, Crystal Structure Of The Pctaire1 Kinase In Complex With Ind E804 Length = 324 Back     alignment and structure
>pdb|3LM0|A Chain A, Crystal Structure Of Human SerineTHREONINE KINASE 17B (STK17B) Length = 327 Back     alignment and structure
>pdb|2XIK|A Chain A, Structure Of Human Ysk1 (Yeast Sps1-Ste20-Related Kinase 1) Length = 294 Back     alignment and structure
>pdb|1S9I|A Chain A, X-Ray Structure Of The Human Mitogen-Activated Protein Kinase Kinase 2 (Mek2)in A Complex With Ligand And Mgatp Length = 354 Back     alignment and structure
>pdb|3EQC|A Chain A, X-Ray Structure Of The Human Mitogen-Activated Protein Kinase Kinase 1 (Mek1) In A Ternary Complex With Compound 1, Atp-Gs And Mg2p Length = 360 Back     alignment and structure
>pdb|3PPZ|A Chain A, Crystal Structure Of Ctr1 Kinase Domain In Complex With Staurosporine Length = 309 Back     alignment and structure
>pdb|1S9J|A Chain A, X-Ray Structure Of The Human Mitogen-Activated Protein Kinase Kinase 1 (Mek1) In A Complex With Ligand And Mgatp Length = 341 Back     alignment and structure
>pdb|2P55|A Chain A, X-Ray Structure Of The Human Mitogen-Activated Protein Kinase Kinase 1 (Mek1) In A Complex With Ligand And Mgatp Length = 333 Back     alignment and structure
>pdb|3TTJ|A Chain A, Crystal Structure Of Jnk3 Complexed With Cc-359, A Jnk Inhibitor For The Prevention Of Ischemia-Reperfusion Injury Length = 464 Back     alignment and structure
>pdb|2O0U|A Chain A, Crystal Structure Of Human Jnk3 Complexed With N-{3-Cyano-6-[3-(1- Piperidinyl)propanoyl]-4,5,6,7-Tetrahydrothieno[2, 3-C]pyridin-2-Yl}- 1-Naphthalenecarboxamide Length = 364 Back     alignment and structure
>pdb|3FI2|A Chain A, Crystal Structure Of Jnk3 With Amino-Pyrazole Inhibitor, Sr- 3451 Length = 353 Back     alignment and structure
>pdb|3KVX|A Chain A, Jnk3 Bound To Aminopyrimidine Inhibitor, Sr-3562 Length = 364 Back     alignment and structure
>pdb|3FI3|A Chain A, Crystal Structure Of Jnk3 With Indazole Inhibitor, Sr-3737 Length = 364 Back     alignment and structure
>pdb|3FV8|A Chain A, Jnk3 Bound To Piperazine Amide Inhibitor, Sr2774 Length = 355 Back     alignment and structure
>pdb|3OXI|A Chain A, Design And Synthesis Of Disubstituted Thiophene And Thiazole Based Inhibitors Of Jnk For The Treatment Of Neurodegenerative Diseases Length = 362 Back     alignment and structure
>pdb|2OK1|A Chain A, Crystal Structure Of Jnk3 Bound To N-Benzyl-4-(4-(3- Chlorophenyl)-1h-Pyrazol-3-Yl)-1h-Pyrrole-2-Carboxamide Length = 365 Back     alignment and structure
>pdb|3ORN|A Chain A, Mitogen-Activated Protein Kinase Kinase 1 (Mek1) In Complex With Ch4987655 And Mgamp-Pnp Length = 307 Back     alignment and structure
>pdb|3PTG|A Chain A, Design And Synthesis Of A Novel, Orally Efficacious Tri-Substituted Thiophene Based Jnk Inhibitor Length = 363 Back     alignment and structure
>pdb|1JNK|A Chain A, The C-Jun N-Terminal Kinase (Jnk3s) Complexed With Mgamp-Pnp Length = 423 Back     alignment and structure
>pdb|1PMN|A Chain A, Crystal Structure Of Jnk3 In Complex With An Imidazole- Pyrimidine Inhibitor Length = 364 Back     alignment and structure
>pdb|3GP0|A Chain A, Crystal Structure Of Human Mitogen Activated Protein Kinase 11 (p38 Beta) In Complex With Nilotinib Length = 348 Back     alignment and structure
>pdb|4H36|A Chain A, Crystal Structure Of Jnk3 In Complex With Atf2 Peptide Length = 356 Back     alignment and structure
>pdb|2EXC|X Chain X, Inhibitor Complex Of Jnk3 Length = 356 Back     alignment and structure
>pdb|2B1P|A Chain A, Inhibitor Complex Of Jnk3 Length = 355 Back     alignment and structure
>pdb|3MBL|A Chain A, Crystal Structure Of The Human Mitogen-Activated Protein Kinase Kinase 1 (Mek 1) In Complex With Ligand And Mgadp Length = 328 Back     alignment and structure
>pdb|3DV3|A Chain A, Mek1 With Pf-04622664 Bound Length = 322 Back     alignment and structure
>pdb|2R9S|A Chain A, C-Jun N-Terminal Kinase 3 With 3,5-Disubstituted Quinoline Inhibitor Length = 356 Back     alignment and structure
>pdb|3KVW|A Chain A, Crystal Structure Of Dual-Specificity Tyrosine Phosphorylation Regulated Kinase 2 (Dyrk2) In Complex With An Indirubin Ligand Length = 429 Back     alignment and structure
>pdb|4AZF|A Chain A, Human Dyrk2 In Complex With Leucettine L41 Length = 417 Back     alignment and structure
>pdb|3PZE|A Chain A, Jnk1 In Complex With Inhibitor Length = 358 Back     alignment and structure
>pdb|3UIB|A Chain A, Map Kinase Lmampk10 From Leishmania Major In Complex With Sb203580 Length = 362 Back     alignment and structure
>pdb|3ELJ|A Chain A, Jnk1 Complexed With A Bis-Anilino-Pyrrolopyrimidine Inhibitor Length = 369 Back     alignment and structure
>pdb|3PG1|A Chain A, Map Kinase Lmampk10 From Leishmania Major (1.95 Angs Resolution) Length = 362 Back     alignment and structure
>pdb|4AN2|A Chain A, Crystal Structures Of Human Mek1 With Carboxamide-Based Allosteric Inhibitor Xl518 (Gdc-0973), Or Related Analogs. Length = 301 Back     alignment and structure
>pdb|3HMN|A Chain A, Crystal Structure Of Human Mps1 Catalytic Domain In Complex With Atp Length = 342 Back     alignment and structure
>pdb|2JKM|A Chain A, Focal Adhesion Kinase Catalytic Domain In Complex With Bis- Anilino Pyrimidine Inhibitor Length = 276 Back     alignment and structure
>pdb|2ZMC|A Chain A, Crystal Structure Of Human Mitotic Checkpoint Kinase Mps1 Catalytic Domain Apo Form Length = 390 Back     alignment and structure
>pdb|2J0K|A Chain A, Crystal Structure Of A Fragment Of Focal Adhesion Kinase Containing The Ferm And Kinase Domains. Length = 656 Back     alignment and structure
>pdb|2G01|A Chain A, Pyrazoloquinolones As Novel, Selective Jnk1 Inhibitors Length = 370 Back     alignment and structure
>pdb|2POP|A Chain A, The Crystal Structure Of Tab1 And Bir1 Complex Length = 353 Back     alignment and structure
>pdb|2J0M|B Chain B, Crystal Structure A Two-Chain Complex Between The Ferm And Kinase Domains Of Focal Adhesion Kinase. Length = 276 Back     alignment and structure
>pdb|4EC8|A Chain A, Structure Of Full Length Cdk9 In Complex With Cyclint And Drb Length = 373 Back     alignment and structure
>pdb|3BZ3|A Chain A, Crystal Structure Analysis Of Focal Adhesion Kinase With A Methanesulfonamide Diaminopyrimidine Inhibitor Length = 276 Back     alignment and structure
>pdb|2ZMD|A Chain A, Crystal Structure Of Human Mps1 Catalytic Domain T686a Mutant In Complex With Sp600125 Inhibitor Length = 390 Back     alignment and structure
>pdb|4EBW|A Chain A, Structure Of Focal Adhesion Kinase Catalytic Domain In Complex With Novel Allosteric Inhibitor Length = 304 Back     alignment and structure
>pdb|2JKK|A Chain A, Focal Adhesion Kinase Catalytic Domain In Complex With Bis- Anilino Pyrimidine Inhibitor Length = 276 Back     alignment and structure
>pdb|2ETM|A Chain A, Crystal Structure Of Focal Adhesion Kinase Domain Complexed With 7h-Pyrrolo [2,3-D] Pyrimidine Derivative Length = 281 Back     alignment and structure
>pdb|1BI8|A Chain A, Mechanism Of G1 Cyclin Dependent Kinase Inhibition From The Structures Cdk6-P19ink4d Inhibitor Complex Length = 326 Back     alignment and structure
>pdb|2J0J|A Chain A, Crystal Structure Of A Fragment Of Focal Adhesion Kinase Containing The Ferm And Kinase Domains Length = 656 Back     alignment and structure
>pdb|3PXK|A Chain A, Focal Adhesion Kinase Catalytic Domain In Complex With Pyrrolo[2,3- D]thiazole Length = 282 Back     alignment and structure
>pdb|1MP8|A Chain A, Crystal Structure Of Focal Adhesion Kinase (Fak) Length = 281 Back     alignment and structure
>pdb|3O17|A Chain A, Crystal Structure Of Jnk1-Alpha1 Isoform Length = 370 Back     alignment and structure
>pdb|2BUJ|A Chain A, Crystal Structure Of The Human Serine-Threonine Kinase 16 In Complex With Staurosporine Length = 317 Back     alignment and structure
>pdb|3K2L|A Chain A, Crystal Structure Of Dual-Specificity Tyrosine Phosphorylation Regulated Kinase 2 (Dyrk2) Length = 429 Back     alignment and structure
>pdb|3MI9|A Chain A, Crystal Structure Of Hiv-1 Tat Complexed With Human P-Tefb Length = 351 Back     alignment and structure
>pdb|3VQU|A Chain A, Crystal Structure Of Human Mps1 Catalytic Domain In Complex With 4- [(4-Amino-5-Cyano-6-Ethoxypyridin-2- Yl)amino]benzamide Length = 320 Back     alignment and structure
>pdb|2FST|X Chain X, Mitogen Activated Protein Kinase P38alpha (d176a+f327l) Activating Mutant Length = 367 Back     alignment and structure
>pdb|4E5A|X Chain X, The W197a Mutant Of P38a Map Kinase Length = 360 Back     alignment and structure
>pdb|2J0L|A Chain A, Crystal Structure Of A The Active Conformation Of The Kinase Domain Of Focal Adhesion Kinase With A Phosphorylated Activation Loop Length = 276 Back     alignment and structure
>pdb|3GI3|A Chain A, Crystal Structure Of A N-Phenyl-N'-Naphthylurea Analog In Complex With P38 Map Kinase Length = 360 Back     alignment and structure
>pdb|2Y8O|A Chain A, Crystal Structure Of Human P38alpha Complexed With A Mapk Docking Peptide Length = 362 Back     alignment and structure
>pdb|2JGZ|A Chain A, Crystal Structure Of Phospho-Cdk2 In Complex With Cyclin B Length = 289 Back     alignment and structure
>pdb|1OVE|A Chain A, The Structure Of P38 Alpha In Complex With A Dihydroquinolinone Length = 366 Back     alignment and structure
>pdb|1JOW|B Chain B, Crystal Structure Of A Complex Of Human Cdk6 And A Viral Cyclin Length = 308 Back     alignment and structure
>pdb|2FSO|X Chain X, Mitogen Activated Protein Kinase P38alpha (D176a) Activating Mutant Length = 367 Back     alignment and structure
>pdb|3OD6|X Chain X, Crystal Structure Of P38alpha Y323t Active Mutant Length = 360 Back     alignment and structure
>pdb|2BAL|A Chain A, P38alpha Map Kinase Bound To Pyrazoloamine Length = 365 Back     alignment and structure
>pdb|3OEF|X Chain X, Crystal Structure Of Y323f Inactive Mutant Of P38alpha Map Kinase Length = 360 Back     alignment and structure
>pdb|2X7F|A Chain A, Crystal Structure Of The Kinase Domain Of Human Traf2- And Nck-Interacting Kinase With Wee1chk1 Inhibitor Length = 326 Back     alignment and structure
>pdb|1LEW|A Chain A, Crystal Structure Of Map Kinase P38 Complexed To The Docking Site On Its Nuclear Substrate Mef2a Length = 360 Back     alignment and structure
>pdb|2J7T|A Chain A, Crystal Structure Of Human Serine Threonine Kinase-10 Bound To Su11274 Length = 302 Back     alignment and structure
>pdb|2BAJ|A Chain A, P38alpha Bound To Pyrazolourea Length = 365 Back     alignment and structure
>pdb|3HRB|A Chain A, P38 Kinase Crystal Structure In Complex With Small Molecule Inhibitor Length = 359 Back     alignment and structure
>pdb|1M7Q|A Chain A, Crystal Structure Of P38 Map Kinase In Complex With A Dihydroquinazolinone Inhibitor Length = 366 Back     alignment and structure
>pdb|3E92|A Chain A, Crystal Structure Of P38 Kinase In Complex With A Biaryl Amide Inhibitor Length = 371 Back     alignment and structure
>pdb|1DI9|A Chain A, The Structure Of P38 Mitogen-Activated Protein Kinase In Complex With 4-[3-Methylsulfanylanilino]-6,7- Dimethoxyquinazoline Length = 360 Back     alignment and structure
>pdb|2BAQ|A Chain A, P38alpha Bound To Ro3201195 Length = 365 Back     alignment and structure
>pdb|3ZSG|A Chain A, X-Ray Structure Of P38alpha Bound To Tak-715 Length = 362 Back     alignment and structure
>pdb|3GCU|A Chain A, Human P38 Map Kinase In Complex With Rl48 Length = 360 Back     alignment and structure
>pdb|3GCP|A Chain A, Human P38 Map Kinase In Complex With Sb203580 Length = 360 Back     alignment and structure
>pdb|3P4K|A Chain A, The Third Conformation Of P38a Map Kinase Observed In Phosphorylated P38a And In Solution Length = 370 Back     alignment and structure
>pdb|3K3J|A Chain A, P38alpha Bound To Novel Dfg-Out Compound Pf-00416121 Length = 362 Back     alignment and structure
>pdb|2NPQ|A Chain A, A Novel Lipid Binding Site In The P38 Alpha Map Kinase Length = 367 Back     alignment and structure
>pdb|3D83|A Chain A, Crystal Structure Of P38 Kinase In Complex With A Biphenyl Amide Inhibitor Length = 360 Back     alignment and structure
>pdb|3MPT|A Chain A, Crystal Structure Of P38 Kinase In Complex With A Pyrrole-2- Carboxamide Inhibitor Length = 371 Back     alignment and structure
>pdb|1YWR|A Chain A, Crystal Structure Analysis Of Inactive P38 Kinase Domain In Complex With A Monocyclic Pyrazolone Inhibitor Length = 360 Back     alignment and structure
>pdb|2OZA|B Chain B, Structure Of P38alpha Complex Length = 366 Back     alignment and structure
>pdb|1OB3|A Chain A, Structure Of P. Falciparum Pfpk5 Length = 288 Back     alignment and structure
>pdb|3D7Z|A Chain A, Crystal Structure Of P38 Kinase In Complex With A Biphenyl Amide Inhibitor Length = 360 Back     alignment and structure
>pdb|1OZ1|A Chain A, P38 Mitogen-Activated Kinase In Complex With 4-Azaindole Inhibitor Length = 372 Back     alignment and structure
>pdb|1IAN|A Chain A, Human P38 Map Kinase Inhibitor Complex Length = 366 Back     alignment and structure
>pdb|2X9E|A Chain A, Human Mps1 In Complex With Nms-P715 Length = 317 Back     alignment and structure
>pdb|3FI4|A Chain A, P38 Kinase Crystal Structure In Complex With Ro4499 Length = 372 Back     alignment and structure
>pdb|2GFS|A Chain A, P38 Kinase Crystal Structure In Complex With Ro3201195 Length = 372 Back     alignment and structure
>pdb|1YW2|A Chain A, Mutated Mus Musculus P38 Kinase (Mp38) Length = 360 Back     alignment and structure
>pdb|3DBQ|A Chain A, Crystal Structure Of Ttk Kinase Domain Length = 343 Back     alignment and structure
>pdb|3HVC|A Chain A, Crystal Structure Of Human P38alpha Map Kinase Length = 362 Back     alignment and structure
>pdb|3CEK|A Chain A, Crystal Structure Of Human Dual Specificity Protein Kinase (ttk) Length = 313 Back     alignment and structure
>pdb|3TG1|A Chain A, Crystal Structure Of P38alpha In Complex With A Mapk Docking Partner Length = 380 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query1082
2i44_A324 Serine-threonine phosphatase 2C; PSI-2, 8817Z, str 3e-76
1rdq_E350 PKA C-alpha, CAMP-dependent protein kinase, alpha- 5e-66
3tnp_B416 CAMP-dependent protein kinase type II-beta regula 8e-66
1uu3_A310 HPDK1, 3-phosphoinositide dependent protein kinase 1e-63
1fot_A318 TPK1 delta, CAMP-dependent protein kinase type 1; 8e-62
3shr_A299 CGMP-dependent protein kinase 1; cyclic nucleotide 7e-61
4din_B381 CAMP-dependent protein kinase type I-beta regulat 3e-58
4da1_A389 Protein phosphatase 1K, mitochondrial; metal-ION-a 5e-58
3of1_A246 CAMP-dependent protein kinase regulatory subunit; 1e-57
3v8s_A410 RHO-associated protein kinase 1; dimerization, myo 2e-57
2qcs_B291 CAMP-dependent protein kinase type I-alpha regula 3e-57
2iq1_A274 Protein phosphatase 2C kappa, PPM1K; structural ge 3e-57
3g51_A325 Ribosomal protein S6 kinase alpha-3; N-terminal ki 6e-57
3a62_A327 Ribosomal protein S6 kinase beta-1; kinase domain, 2e-56
3txo_A353 PKC-L, NPKC-ETA, protein kinase C ETA type; phosph 1e-55
2r5t_A373 Serine/threonine-protein kinase SGK1; AGC protein 3e-55
1o6l_A337 RAC-beta serine/threonine protein kinase; protein 3e-55
1vzo_A355 Ribosomal protein S6 kinase alpha 5; protein kinas 3e-55
2i0e_A353 Protein kinase C-beta II; serine/threonine protein 6e-55
3a8x_A345 Protein kinase C IOTA type; transferase; HET: TPO; 1e-54
1xjd_A345 Protein kinase C, theta type; PKC-theta, ATP, AMP, 3e-54
4dc2_A396 Protein kinase C IOTA type; kinase, substrate, cel 8e-54
4fr4_A384 YANK1, serine/threonine-protein kinase 32A; struct 8e-54
4aw2_A437 Serine/threonine-protein kinase MRCK alpha; transf 1e-53
2vd5_A412 DMPK protein; serine/threonine-protein kinase, kin 2e-53
3pvu_A 695 Beta-adrenergic receptor kinase 1; transferase, se 4e-53
4ejn_A446 RAC-alpha serine/threonine-protein kinase; AKT1, a 9e-53
3fdn_A279 Serine/threonine-protein kinase 6; aurora kinase i 9e-53
2pnq_A467 [pyruvate dehydrogenase [lipoamide]]-phosphatase 1 5e-52
2p8e_A307 PPM1B beta isoform variant 6; structural genomics, 8e-52
3pfq_A674 PKC-B, PKC-beta, protein kinase C beta type; phosp 8e-52
2i0o_A304 Ser/Thr phosphatase; beta sandwich, structural gen 1e-51
2vgo_A284 Serine/threonine-protein kinase 12-A; nucleotide-b 1e-51
3c4z_A543 Rhodopsin kinase; Ser/Thr kinase, RGS homology dom 3e-51
2acx_A576 G protein-coupled receptor kinase 6; GRK, G transf 3e-51
1a6q_A382 Phosphatase 2C; catalytic mechanism, metalloenzyme 9e-51
3kdj_B316 Protein phosphatase 2C 56; ABA, PYL1, abscisic aci 2e-48
2j4o_A401 Mitogen-activated protein kinase kinase kinase 7-i 6e-47
3qn1_B337 Protein phosphatase 2C 16; start domain, BET V dom 2e-46
2irm_A358 Mitogen-activated protein kinase kinase kinase 7 i 2e-42
2pml_X348 PFPK7, Ser/Thr protein kinase; phosphorylati trans 1e-41
3idb_B161 CAMP-dependent protein kinase type II-beta regulat 2e-41
3idb_B161 CAMP-dependent protein kinase type II-beta regulat 5e-13
3pna_A154 CAMP-dependent protein kinase type I-alpha regula 5e-41
3pna_A154 CAMP-dependent protein kinase type I-alpha regula 4e-11
3ocp_A139 PRKG1 protein; serine/threonine kinase, TF2I and I 1e-40
3ocp_A139 PRKG1 protein; serine/threonine kinase, TF2I and I 4e-11
3cok_A278 Serine/threonine-protein kinase PLK4; POLO-like ki 2e-40
2owb_A335 Serine/threonine-protein kinase PLK1; catalytic do 1e-38
2rku_A294 Serine/threonine-protein kinase PLK1; structure of 1e-38
3d8k_A377 PP2C, protein phosphatase 2C; nysgrc, PSI-II, STR 2e-36
3byv_A377 Rhoptry kinase; malaria, transferase, structural g 2e-35
2isn_A364 NYSGXRC-8828Z, phosphatase; pathogenic strain, pra 9e-34
3dls_A335 PAS domain-containing serine/threonine-protein KI; 1e-32
2iwi_A312 Serine/threonine-protein kinase PIM-2; nucleotide- 2e-32
3a99_A320 Proto-oncogene serine/threonine-protein kinase PI; 3e-32
3q60_A371 ROP5B; pseudokinase, transferase; HET: ATP; 1.72A 4e-32
3dzo_A413 Rhoptry kinase domain; parasitic disease, transfer 1e-31
1phk_A298 Phosphorylase kinase; glycogen metabolism, transfe 1e-31
2eue_A275 Carbon catabolite derepressing protein kinase; kin 2e-31
2h6d_A276 5'-AMP-activated protein kinase catalytic subunit 3e-31
2qr7_A342 Ribosomal protein S6 kinase alpha-3; kinase domain 4e-31
3fe3_A328 MAP/microtubule affinity-regulating kinase 3; seri 6e-31
1kob_A387 Twitchin; kinase, intrasteric regulation; 2.30A {A 8e-31
3h4j_B336 AMPK kdaid, SNF1-like protein kinase SSP2; ATP-bin 9e-31
2zv2_A298 Calcium/calmodulin-dependent protein kinase kinas; 1e-30
3fhr_A336 MAP kinase-activated protein kinase 3; kinase-inhi 1e-30
3hko_A345 Calcium/calmodulin-dependent protein kinase with d 2e-30
3bhy_A283 Death-associated protein kinase 3; death associate 3e-30
2jam_A304 Calcium/calmodulin-dependent protein kinase type 1 4e-30
3kk8_A284 Calcium/calmodulin dependent protein kinase II; AT 5e-30
2wtk_C305 Serine/threonine-protein kinase 11; transferase-me 6e-30
2a2a_A321 Death-associated protein kinase 2; autoinhibition, 6e-30
1tki_A321 Titin; serine kinase, muscle, autoinhibition; 2.00 8e-30
3lm5_A327 Serine/threonine-protein kinase 17B; STK17B, serin 8e-30
3p1a_A311 MYT1 kinase, membrane-associated tyrosine- and thr 1e-29
2y0a_A326 Death-associated protein kinase 1; transferase, ca 1e-29
3nyv_A 484 Calmodulin-domain protein kinase 1; serine/threoni 2e-29
2bdw_A362 Hypothetical protein K11E8.1D; kinase, calmodulin 2e-29
2yab_A361 Death-associated protein kinase 2; apoptosis, tran 2e-29
3mwu_A 486 Calmodulin-domain protein kinase 1; serine/threoni 4e-29
3lij_A 494 Calcium/calmodulin dependent protein kinase with A 4e-29
3is5_A285 Calcium-dependent protein kinase; CDPK, structural 9e-29
2y7j_A365 Phosphorylase B kinase gamma catalytic chain, test 1e-28
3f3z_A277 Calcium/calmodulin-dependent protein kinase with d 1e-28
2wei_A287 Calmodulin-domain protein kinase 1, putative; nucl 2e-28
2x4f_A373 Myosin light chain kinase family member 4; LUNG, b 3e-28
3kn6_A325 Ribosomal protein S6 kinase alpha-5; AMP-PNP, MSK1 3e-28
3soa_A 444 Calcium/calmodulin-dependent protein kinase type a 3e-28
3q5i_A 504 Protein kinase; CDPK, malaria, phosphotransferase, 3e-28
2ycf_A322 Serine/threonine-protein kinase CHK2; transferase, 3e-28
3i6u_A419 CDS1, serine/threonine-protein kinase CHK2; Ser/Th 3e-28
3uto_A 573 Twitchin; kinase, muscle sarcomere, transferase; H 3e-28
2y94_A 476 5'-AMP-activated protein kinase catalytic subunit; 5e-28
1nxk_A400 MAP kinase-activated protein kinase 2; MK2, phosph 6e-28
3tki_A323 Serine/threonine-protein kinase CHK1; cell checkpo 8e-28
2yex_A276 Serine/threonine-protein kinase CHK1; transferase, 1e-27
4apc_A350 Serine/threonine-protein kinase NEK1; transferase; 1e-27
3cek_A313 Dual specificity protein kinase TTK; HMPS1, PYT, E 5e-27
3dbq_A343 Dual specificity protein kinase TTK; MPS1 structur 7e-27
3c0i_A351 Peripheral plasma membrane protein CASK; neurexin, 1e-26
1zy4_A303 Serine/threonine-protein kinase GCN2; translation 3e-26
2w4o_A349 Calcium/calmodulin-dependent protein kinase type I 4e-26
2zmd_A390 Dual specificity protein kinase TTK; MPS1, T686A, 8e-26
3p23_A432 Serine/threonine-protein kinase/endoribonuclease; 1e-25
2d93_A134 RAP guanine nucleotide exchange factor 6; CNMP_bin 3e-25
2d93_A134 RAP guanine nucleotide exchange factor 6; CNMP_bin 8e-11
2w5a_A279 Serine/threonine-protein kinase NEK2; Ser/Thr prot 7e-25
1o7f_A469 CAMP-dependent RAP1 guanine-nucleotide exchange fa 8e-25
1o7f_A469 CAMP-dependent RAP1 guanine-nucleotide exchange fa 7e-23
1o7f_A469 CAMP-dependent RAP1 guanine-nucleotide exchange fa 2e-06
3uc3_A361 Serine/threonine-protein kinase SRK2I; SNRK2, ABA 8e-25
3e7e_A365 HBUB1, BUB1A, mitotic checkpoint serine/threonine- 1e-24
2a19_B284 Interferon-induced, double-stranded RNA-activated 2e-24
2wqm_A310 Serine/threonine-protein kinase NEK7; ATP-binding, 1e-23
2ac3_A316 MAP kinase-interacting serine/threonine kinase 2; 2e-23
2rio_A434 Serine/threonine-protein kinase/endoribonuclease I 5e-23
4euu_A319 Serine/threonine-protein kinase TBK1; ATP binding, 8e-22
3mdp_A142 Cyclic nucleotide-binding domain (CNMP-BD) protei; 3e-21
3mdp_A142 Cyclic nucleotide-binding domain (CNMP-BD) protei; 1e-14
4eut_A396 Serine/threonine-protein kinase TBK1; ATP binding, 2e-20
3m2w_A299 MAP kinase-activated protein kinase 2; small molec 1e-19
2pqq_A149 Putative transcriptional regulator; APC7345, strep 1e-19
2pqq_A149 Putative transcriptional regulator; APC7345, strep 6e-13
1vp6_A138 CNBD, cyclic-nucleotide binding domain of mesorhiz 1e-19
1vp6_A138 CNBD, cyclic-nucleotide binding domain of mesorhiz 7e-17
2buj_A317 Serine/threonine-protein kinase 16; transferase, A 1e-19
4g31_A299 Eukaryotic translation initiation factor 2-alpha; 1e-19
3gyd_A187 CNMP-BD protein, cyclic nucleotide-binding domain; 1e-19
3gyd_A187 CNMP-BD protein, cyclic nucleotide-binding domain; 2e-14
3qa8_A 676 MGC80376 protein; kinase ubiquitin-like domain, ph 6e-19
4g3f_A336 NF-kappa-beta-inducing kinase; non-RD kinase, prot 2e-18
1x8b_A289 WEE1HU, WEE1-like protein kinase; cell cycle, tran 3e-18
2clq_A295 Mitogen-activated protein kinase kinase kinase 5; 1e-17
3qd2_B332 Eukaryotic translation initiation factor 2-alpha; 4e-17
2z69_A154 DNR protein; beta barrel, dimerization helix, tran 2e-16
2z69_A154 DNR protein; beta barrel, dimerization helix, tran 3e-12
3ll6_A337 Cyclin G-associated kinase; transferase, protein k 9e-16
1wgp_A137 Probable cyclic nucleotide-gated ION channel 6; cy 4e-15
1wgp_A137 Probable cyclic nucleotide-gated ION channel 6; cy 4e-10
4ava_A333 Lysine acetyltransferase; allosteric regulation, d 5e-15
4ava_A333 Lysine acetyltransferase; allosteric regulation, d 2e-11
4f8a_A160 Potassium voltage-gated channel subfamily H membe; 1e-14
4f8a_A160 Potassium voltage-gated channel subfamily H membe; 3e-06
2dyl_A318 Dual specificity mitogen-activated protein kinase 2e-14
3fxz_A297 Serine/threonine-protein kinase PAK 1; transferase 3e-14
2c30_A321 Serine/threonine-protein kinase PAK 6; CRIB domain 5e-14
2pzi_A 681 Probable serine/threonine-protein kinase PKNG; ATP 1e-13
1t4h_A290 Serine/threonine-protein kinase WNK1; protein seri 2e-13
3aln_A327 Dual specificity mitogen-activated protein kinase; 3e-13
3d0s_A227 Transcriptional regulatory protein; CAMP receptor 3e-13
3d0s_A227 Transcriptional regulatory protein; CAMP receptor 3e-11
2ptm_A198 Hyperpolarization-activated (IH) channel; ION chan 6e-13
2ptm_A198 Hyperpolarization-activated (IH) channel; ION chan 9e-08
2h34_A309 Serine/threonine-protein kinase PKNE; apoenzyme, t 6e-13
3ukn_A212 Novel protein similar to vertebrate potassium VOL 1e-12
3ukn_A212 Novel protein similar to vertebrate potassium VOL 6e-04
3dv8_A220 Transcriptional regulator, CRP/FNR family; cyclic 1e-12
3dv8_A220 Transcriptional regulator, CRP/FNR family; cyclic 6e-09
4eqm_A294 Protein kinase; transferase; HET: ANP; 3.00A {Stap 2e-12
4ev0_A216 Transcription regulator, CRP family; CAMP binding, 2e-12
4ev0_A216 Transcription regulator, CRP family; CAMP binding, 4e-11
3e97_A231 Transcriptional regulator, CRP/FNR family; YP_6044 3e-12
3e97_A231 Transcriptional regulator, CRP/FNR family; YP_6044 2e-10
3ork_A311 Serine/threonine protein kinase; structural genomi 4e-12
3eqc_A360 Dual specificity mitogen-activated protein kinase; 5e-12
3com_A314 Serine/threonine-protein kinase 4; MST1, STE20-lik 6e-12
3bpz_A202 Potassium/sodium hyperpolarization-activated cycli 7e-12
3bpz_A202 Potassium/sodium hyperpolarization-activated cycli 3e-07
2pk0_A250 Serine/threonine protein phosphatase STP1; SI moti 7e-12
3fme_A290 Dual specificity mitogen-activated protein kinase; 9e-12
3a7i_A303 MST3 kinase, serine/threonine kinase 24 (STE20 hom 1e-11
3an0_A340 Dual specificity mitogen-activated protein kinase; 1e-11
1txo_A237 Putative bacterial enzyme; serine/threonine protei 2e-11
3kcc_A260 Catabolite gene activator; helix-turn-helix, CAMP, 3e-11
3kcc_A260 Catabolite gene activator; helix-turn-helix, CAMP, 1e-10
3uqc_A286 Probable conserved transmembrane protein; structur 3e-11
3fx3_A237 Cyclic nucleotide-binding protein; helix_TURN_heli 4e-11
3fx3_A237 Cyclic nucleotide-binding protein; helix_TURN_heli 3e-09
1o5l_A213 Transcriptional regulator, CRP family; TM1171, str 4e-11
1o5l_A213 Transcriptional regulator, CRP family; TM1171, str 7e-09
3ryp_A210 Catabolite gene activator; CAMP receptor protein ( 6e-11
3ryp_A210 Catabolite gene activator; CAMP receptor protein ( 2e-08
1blx_A326 Cyclin-dependent kinase 6; inhibitor protein, cycl 2e-10
3dkw_A227 DNR protein; CRP-FNR, HTH, beta barrel, dimerizati 2e-10
3dkw_A227 DNR protein; CRP-FNR, HTH, beta barrel, dimerizati 6e-09
2byv_E 999 RAP guanine nucleotide exchange factor 4; EPAC2, C 2e-10
2byv_E999 RAP guanine nucleotide exchange factor 4; EPAC2, C 3e-06
2gau_A232 Transcriptional regulator, CRP/FNR family; structu 3e-10
2gau_A232 Transcriptional regulator, CRP/FNR family; structu 3e-08
3iwz_A230 CAP-like, catabolite activation-like protein; XCC, 4e-10
3iwz_A230 CAP-like, catabolite activation-like protein; XCC, 9e-09
1ob3_A288 PFPK5, cell division control protein 2 homolog; tr 6e-10
1ft9_A222 Carbon monoxide oxidation system transcription reg 6e-10
1ft9_A222 Carbon monoxide oxidation system transcription reg 3e-08
3g33_A308 Cell division protein kinase 4; Ser/Thr protein ki 8e-10
2jfr_A234 Ser-Thr phosphatase MSPP; hydrolase, PPM phosphata 1e-09
3beh_A355 MLL3241 protein; transmembrane protein, membrane p 1e-09
3beh_A355 MLL3241 protein; transmembrane protein, membrane p 7e-06
1zyb_A232 Transcription regulator, CRP family; NP_813211.1, 1e-09
1zyb_A232 Transcription regulator, CRP family; NP_813211.1, 3e-08
3niz_A311 Rhodanese family protein; structural genomics, str 2e-09
4agu_A311 Cyclin-dependent kinase-like 1; transferase, phosp 2e-09
2j7t_A302 Serine/threonine-protein kinase 10; transferase, A 2e-09
2r3i_A299 Cell division protein kinase 2; serine/threonine-p 2e-09
4aaa_A331 Cyclin-dependent kinase-like 2; transferase, phosp 3e-09
3nsz_A330 CK II alpha, casein kinase II subunit alpha; inhib 3e-09
3o0g_A292 Cell division protein kinase 5; kinase activator c 5e-09
2j82_A240 TPPHA, protein serine-threonine phosphatase; PP2C 7e-09
2vwi_A303 Serine/threonine-protein kinase OSR1; STE kinase, 8e-09
3mtl_A324 Cell division protein kinase 16; pctaire1, indirub 9e-09
2fmy_A220 COOA, carbon monoxide oxidation system transcripti 1e-08
2fmy_A220 COOA, carbon monoxide oxidation system transcripti 6e-08
1vt4_I1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-08
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 8e-08
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-07
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 3e-07
3ttj_A464 Mitogen-activated protein kinase 10; JNK3, protein 2e-08
2eva_A307 TAK1 kinase - TAB1 chimera fusion protein; transfe 2e-08
2x7f_A326 TRAF2 and NCK-interacting protein kinase; serine/t 2e-08
3e6c_C250 CPRK, cyclic nucleotide-binding protein; CPRK, hal 2e-08
3e6c_C250 CPRK, cyclic nucleotide-binding protein; CPRK, hal 8e-08
1ua2_A346 CAK, cell division protein kinase 7; cell cycle, p 3e-08
1u5q_A348 Serine/threonine protein kinase TAO2; transferase; 3e-08
3og7_A289 AKAP9-BRAF fusion protein; proto-oncogene, V600E, 3e-08
4e7w_A394 Glycogen synthase kinase 3; GSK3, PTyr195, transfe 4e-08
2xrw_A371 Mitogen-activated protein kinase 8; transcription, 4e-08
2oz6_A207 Virulence factor regulator; winged helix, helix-tu 4e-08
2oz6_A207 Virulence factor regulator; winged helix, helix-tu 3e-07
3gbz_A329 Kinase, CMGC CDK; ssgcid, ATP-binding, nucleotide- 5e-08
3gni_B389 Strad alpha; kinase fold, pseudokinase, alpha heli 8e-08
3coi_A353 Mitogen-activated protein kinase 13; P38D, P38delt 1e-07
3kmu_A271 ILK, integrin-linked kinase; cell adhesion, ANK re 1e-07
2pmi_A317 Negative RE, cyclin-dependent protein kinase PHO85 3e-07
1j1b_A420 Glycogen synthase kinase-3 beta; complex, TAU, AMP 3e-07
3mi9_A351 Cell division protein kinase 9; P-TEFB, HIV-1, pro 3e-07
3la7_A243 Global nitrogen regulator; activator, DNA-binding, 3e-07
3la7_A243 Global nitrogen regulator; activator, DNA-binding, 1e-05
2zcw_A202 TTHA1359, transcriptional regulator, FNR/CRP famil 6e-07
2zcw_A202 TTHA1359, transcriptional regulator, FNR/CRP famil 9e-06
2fst_X367 Mitogen-activated protein kinase 14; active mutant 1e-06
3p86_A309 Serine/threonine-protein kinase CTR1; ETR1, ERS1, 2e-06
3rnr_A211 Stage II sporulation E family protein; structural 2e-06
1cm8_A367 Phosphorylated MAP kinase P38-gamma; phosphorylati 2e-06
3eb0_A383 Putative uncharacterized protein; kinase cryptospo 4e-06
3cf6_E694 RAP guanine nucleotide exchange factor (GEF) 4; EP 7e-06
2i6l_A320 Mitogen-activated protein kinase 6; MAPK6, ERK3, e 1e-05
3b02_A195 Transcriptional regulator, CRP family; structural 2e-05
3b02_A195 Transcriptional regulator, CRP family; structural 2e-04
3dtc_A271 Mitogen-activated protein kinase kinase kinase 9; 2e-05
3e3p_A360 Protein kinase, putative glycogen synthase kinase; 4e-05
3lb7_A307 RAF proto-oncogene serine/threonine-protein kinas; 5e-05
3pg1_A362 Mitogen-activated protein kinase, putative (MAP K 5e-05
2y4i_B319 KSR2, HKSR2, kinase suppressor of RAS 2; transfera 6e-05
4f0f_A287 Serine/threonine-protein kinase ROCO4; LRRK2, ATP- 7e-05
3dn7_A194 Cyclic nucleotide binding regulatory protein; stru 7e-05
3qyz_A364 Mitogen-activated protein kinase 1; transferase, s 9e-05
1wak_A397 Serine/threonine-protein kinase SPRK1; SRPK, trans 2e-04
2bgc_A238 PRFA; bacterial infection, human pathogen, transcr 3e-04
2bgc_A238 PRFA; bacterial infection, human pathogen, transcr 6e-04
>2i44_A Serine-threonine phosphatase 2C; PSI-2, 8817Z, structural genomics, protein structure initiative; 2.04A {Toxoplasma gondii} Length = 324 Back     alignment and structure
 Score =  253 bits (648), Expect = 3e-76
 Identities = 65/337 (19%), Positives = 120/337 (35%), Gaps = 44/337 (13%)

Query: 78  LPPEGSRTVKVPSAKYE---LRYSFLSQRGYYPDALDKANQDSFCIHTPFGTSQDD-HFF 133
           L  +   T+ VP           +  +  G       K  +D F +       +DD  FF
Sbjct: 2   LTMDVPPTIHVPLPPTSYPAFDAAIFTDIGG-----RKHQEDRFTLCPQLVPGRDDCAFF 56

Query: 134 GVFDGHGEFGAQCSQFVKRKLCENLLRNNKFHEDAV--------------------DACH 173
           GVFDG    G   S+ VK  +   L+ +  + E                        A  
Sbjct: 57  GVFDGTV--GDFASENVKDLVVPQLISSPAWQEVTEMLRSDVPATEVDEKLPQLLDQAVD 114

Query: 174 SSYLTTNSQL--HADVLDDSMSGTTAVTVLVRGRTIYVANSGDSRAVLAERRGKEIVAVD 231
             Y   +++L    + L+   + +T+VT ++    + V + GDSR  +       +    
Sbjct: 115 DMYKNADNELVKMCEQLNKDYASSTSVTAVLAKGFVAVGHLGDSRIAMGVETPNGLNCEF 174

Query: 232 LSIDQTPFREDELERVKLSGARVLTLDQIEGLKNPDVQCWGTEEGDDGDPPRLWVPNGMY 291
           L++D  P    E  R+  +G  V  L                     GD           
Sbjct: 175 LTVDHKPDMPHEKLRIMRNGGSVEYLH----------NHNNKPFIRGGDFSFRKSRGEQP 224

Query: 292 PGTAFTRSIGDSIAETIGVVANPEIVVWELTNDHPFFVLASDGVFEFLSSQAVVDMVAK- 350
               ++R+ G    +  G+   P++ V  +T  H   +LA+DG+++ +S+   V++  + 
Sbjct: 225 MQLQYSRAFGGKDLKMYGLSNQPDVRVVRVTPQHRVMILATDGLWDVMSAAQAVEIAMQA 284

Query: 351 YKDPRDACAAIVAESYRLWLQYETRTDDITVIVVHIN 387
            ++ R+   A+V  +           D+IT + V   
Sbjct: 285 RQEGRNPAQALVEMTLAEQQSRNQSADNITAMTVFFK 321
>1rdq_E PKA C-alpha, CAMP-dependent protein kinase, alpha-catalytic SU; CAMP-dependent protein kinase,catalytic mechanism, ATP hydro two nucleotide states; HET: TPO SEP ADP ATP; 1.26A {Mus musculus} SCOP: d.144.1.7 PDB: 2erz_E* 3fjq_E* 1bkx_A* 1atp_E* 1fmo_E* 1j3h_A* 1jlu_E* 1bx6_A* 1re8_A* 1rej_A* 1rek_A* 2cpk_E* 2qcs_A* 2qvs_E* 1l3r_E* 3idb_A* 3idc_A* 3o7l_D* 3ow3_A* 3tnp_C* ... Length = 350 Back     alignment and structure
>3tnp_B CAMP-dependent protein kinase type II-beta regula subunit; PKA RIIB tetrameric holoenzyme, transferase; HET: SEP TPO; 2.30A {Mus musculus} PDB: 3tnq_A* 1cx4_A* 2qvs_B* Length = 416 Back     alignment and structure
>1uu3_A HPDK1, 3-phosphoinositide dependent protein kinase-1; PKB, inhibitor, LY333531, diabetes, cancer, transferase, serine/threonine-protein kinase; HET: SEP LY4; 1.7A {Homo sapiens} SCOP: d.144.1.7 PDB: 1okz_A* 1oky_A* 1uu7_A* 1uu8_A* 2biy_A* 3rwp_A* 2xch_A* 3rwq_A* 3sc1_A* 3qd0_A* 2r7b_A* 3ion_A* 3qcq_A* 3qcs_A* 3qcx_A* 3qcy_A* 3iop_A* 3qd3_A* 3qd4_A* 3h9o_A* ... Length = 310 Back     alignment and structure
>1fot_A TPK1 delta, CAMP-dependent protein kinase type 1; open conformation, transferase; HET: TPO; 2.80A {Saccharomyces cerevisiae} SCOP: d.144.1.7 Length = 318 Back     alignment and structure
>3shr_A CGMP-dependent protein kinase 1; cyclic nucleotide binding domains, cyclic nucleotide protein transferase, PKG; HET: CMP; 2.50A {Bos taurus} Length = 299 Back     alignment and structure
>4din_B CAMP-dependent protein kinase type I-beta regulat subunit, CAMP-dependent protein kinase catalytic subunit A; isoform diversity; HET: TPO SEP ATP; 3.70A {Homo sapiens} Length = 381 Back     alignment and structure
>4da1_A Protein phosphatase 1K, mitochondrial; metal-ION-assisted catalysis, dehydrogenase phosphatase, hydrolase; 2.38A {Homo sapiens} PDB: 3qht_A 1l2n_A Length = 389 Back     alignment and structure
>3of1_A CAMP-dependent protein kinase regulatory subunit; cyclic nucleotide binding domain, evolution, PKA signaling, transfer; HET: CMP; 2.21A {Saccharomyces cerevisiae} Length = 246 Back     alignment and structure
>3v8s_A RHO-associated protein kinase 1; dimerization, myosin, transferase, inhibitor, transf transferase inhibitor complex; HET: 0HD; 2.29A {Homo sapiens} PDB: 3tv7_A* 2etr_A* 2esm_A* 2eto_A* 2etk_A* 3d9v_A* 3ncz_A* 3ndm_A* 2v55_A* 2f2u_A* 2h9v_A* Length = 410 Back     alignment and structure
>2qcs_B CAMP-dependent protein kinase type I-alpha regula subunit, CAMP-dependent protein kinase, alpha-catalytic SU; cyclic adenosine monophosphate; HET: SEP TPO ANP TAM; 2.20A {Bos taurus} PDB: 1rl3_A* 1rgs_A* 1ne6_A* 1ne4_A* Length = 291 Back     alignment and structure
>2iq1_A Protein phosphatase 2C kappa, PPM1K; structural genomics, PSI-2, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.25A {Homo sapiens} Length = 274 Back     alignment and structure
>3g51_A Ribosomal protein S6 kinase alpha-3; N-terminal kinase domain of P90 ribosomal S6 kinase 2, ATP- binding, nucleotide-binding, phosphoprotein; HET: ANP; 1.80A {Mus musculus} PDB: 2z7q_A* 2z7r_A* 2z7s_A* Length = 325 Back     alignment and structure
>3a62_A Ribosomal protein S6 kinase beta-1; kinase domain, inactive, active, ribosomal S6 kinase, activation, alternative initiation, ATP-binding; HET: TPO STU; 2.35A {Homo sapiens} PDB: 3a61_A* 3a60_A* Length = 327 Back     alignment and structure
>3txo_A PKC-L, NPKC-ETA, protein kinase C ETA type; phosphotransferase, transferase-transferase inhibito; HET: TPO 07U; 2.05A {Homo sapiens} Length = 353 Back     alignment and structure
>2r5t_A Serine/threonine-protein kinase SGK1; AGC protein kinase, apoptosis, ATP-binding, cytoplasm, endoplasmic reticulum, nucleotide-binding, nucleus; HET: ANP; 1.90A {Homo sapiens} PDB: 3hdm_A* 3hdn_A* Length = 373 Back     alignment and structure
>1o6l_A RAC-beta serine/threonine protein kinase; protein kinase, transferase, serine/threonine-protein kinase; HET: TPO ANP; 1.6A {Homo sapiens} SCOP: d.144.1.7 PDB: 2jdo_A* 2jdr_A* 2uw9_A* 2x37_A* 2x39_A* 2xh5_A* 3d0e_A* 3e87_A* 3e88_A* 3e8d_A* 1o6k_A* 1mrv_A 1mry_A 1gzn_A 1gzk_A 1gzo_A 3qkl_A* 3ocb_A* 3ow4_A* 3qkk_A* ... Length = 337 Back     alignment and structure
>1vzo_A Ribosomal protein S6 kinase alpha 5; protein kinase, transferase, phosphorylation, serine/threonine protein kinase; 1.8A {Homo sapiens} SCOP: d.144.1.7 Length = 355 Back     alignment and structure
>2i0e_A Protein kinase C-beta II; serine/threonine protein kinase, transferase; HET: TPO SEP PDS; 2.60A {Homo sapiens} PDB: 3iw4_A* Length = 353 Back     alignment and structure
>3a8x_A Protein kinase C IOTA type; transferase; HET: TPO; 2.00A {Homo sapiens} PDB: 3a8w_A* 1zrz_A* Length = 345 Back     alignment and structure
>1xjd_A Protein kinase C, theta type; PKC-theta, ATP, AMP,, transferase; HET: TPO SEP STU; 2.00A {Homo sapiens} SCOP: d.144.1.7 PDB: 2jed_A* Length = 345 Back     alignment and structure
>4dc2_A Protein kinase C IOTA type; kinase, substrate, cell polarity, atypical PKC, trans transferase substrate complex; HET: TPO ADE; 2.40A {Mus musculus} Length = 396 Back     alignment and structure
>4fr4_A YANK1, serine/threonine-protein kinase 32A; structural genomics, structural genomics consortium, SGC, TR; HET: STU; 2.29A {Homo sapiens} Length = 384 Back     alignment and structure
>4aw2_A Serine/threonine-protein kinase MRCK alpha; transferase, CDC42BPA; HET: 22E; 1.70A {Rattus norvegicus} PDB: 3tku_A* 3qfv_A* Length = 437 Back     alignment and structure
>2vd5_A DMPK protein; serine/threonine-protein kinase, kinase, transferase, ATP-BI nucleotide-binding, cardiac contractility, muscle different; HET: BI8; 2.80A {Homo sapiens} Length = 412 Back     alignment and structure
>3pvu_A Beta-adrenergic receptor kinase 1; transferase, serine/threonine-protein kinase, ATP-binding, I membrane; HET: QRW; 2.48A {Bos taurus} PDB: 3psc_A* 3pvw_A* 1omw_A 1ym7_A 2bcj_A* 3cik_A 3krw_A* 3krx_A* 1bak_A Length = 695 Back     alignment and structure
>4ejn_A RAC-alpha serine/threonine-protein kinase; AKT1, autoinhibition, allosteric inhibitor, kinase inhibitor hydrophobic collapase, ATPase; HET: 0R4; 2.19A {Homo sapiens} PDB: 3o96_A* Length = 446 Back     alignment and structure
>3fdn_A Serine/threonine-protein kinase 6; aurora kinase inhibitors, virtual screening, X-RAY CO- crystal analysis, structure-based drug design (SBDD); HET: MMH; 1.90A {Homo sapiens} PDB: 3k5u_A* 3m11_A* 2c6e_A* 1muo_A* 2bmc_A* 2j4z_A* 1ol6_A* 3up2_A* 3unz_A* 3uo5_A* 3uo6_A* 3uod_A* 3uoh_A* 3uoj_A* 3uok_A* 3uo4_A* 3uol_A* 3up7_A* 3lau_A* 2wtv_A* ... Length = 279 Back     alignment and structure
>2pnq_A [pyruvate dehydrogenase [lipoamide]]-phosphatase 1; pyruvate dehydrogenase phosphatase 1, catalytic subunit, PDP1C, hydrolase; 1.81A {Rattus norvegicus} PDB: 3n3c_A 3mq3_A Length = 467 Back     alignment and structure
>2p8e_A PPM1B beta isoform variant 6; structural genomics, hydrolase, PSI-2, protein structure initiative; 1.82A {Homo sapiens} Length = 307 Back     alignment and structure
>3pfq_A PKC-B, PKC-beta, protein kinase C beta type; phosphorylation, transferase; HET: TPO SEP ANP; 4.00A {Rattus norvegicus} PDB: 1tbn_A 1tbo_A 2e73_A Length = 674 Back     alignment and structure
>2i0o_A Ser/Thr phosphatase; beta sandwich, structural genomics, PSI, protei structure initiative, NEW YORK SGX research center for STRU genomics; 1.70A {Anopheles gambiae} Length = 304 Back     alignment and structure
>2vgo_A Serine/threonine-protein kinase 12-A; nucleotide-binding, serine/threonine-protein kinase, ATP-binding, transferase, coiled coil, cell division, kinase; HET: TPO AD5; 1.7A {Xenopus laevis} PDB: 2bfx_A* 2vgp_A* 3ztx_A* 2vrx_A* 2bfy_A* 4af3_A* 3dj6_A* 3d15_A* 3d2i_A* 3d2k_A* 3d14_A* 3dj5_A* 3dj7_A* 3daj_A* 1ol5_A* 1ol7_A* 2x6d_A* 2x6e_A* 2xng_A* 2dwb_A* ... Length = 284 Back     alignment and structure
>3c4z_A Rhodopsin kinase; Ser/Thr kinase, RGS homology domain, G protein coupled recep kinase, GRK, GRK1, P-loop, autophosphoryl ADP, ATP-binding; HET: ADP; 1.84A {Bos taurus} PDB: 3c4x_A* 3c4y_A 3c4w_A* 3c50_A* 3c51_A* 3qc9_A* 2i94_B Length = 543 Back     alignment and structure
>2acx_A G protein-coupled receptor kinase 6; GRK, G transferase; HET: ANP; 2.60A {Homo sapiens} PDB: 3nyn_A* 3nyo_A* Length = 576 Back     alignment and structure
>1a6q_A Phosphatase 2C; catalytic mechanism, metalloenzyme, transductuin, hydrolase; 2.00A {Homo sapiens} SCOP: a.159.1.1 d.219.1.1 PDB: 3fxk_A 3fxj_A 3fxl_A* 3fxm_A* 3fxo_A Length = 382 Back     alignment and structure
>3kdj_B Protein phosphatase 2C 56; ABA, PYL1, abscisic acid signaling pathway, cell membr hydrolase, magnesium, manganese, metal-binding, nucleus; HET: A8S; 1.88A {Arabidopsis thaliana} PDB: 3nmn_B* 3jrq_A* 3ujk_A 3nmv_B 3ujl_B* Length = 316 Back     alignment and structure
>2j4o_A Mitogen-activated protein kinase kinase kinase 7-interacting protein 1; TGF-beta, pseudo-phosphatase, TAK1 binding protein, protein binding; 2.25A {Homo sapiens} PDB: 2pom_A 2pop_A Length = 401 Back     alignment and structure
>3qn1_B Protein phosphatase 2C 16; start domain, BET V domain, PYR/PYL/RCAR, PP2C, abscisic ACI receptor, type 2C protein phosphatase; HET: A8S; 1.80A {Arabidopsis thaliana} PDB: 3ujg_B 3nmt_B* 3rt0_A 3kb3_B* Length = 337 Back     alignment and structure
>2irm_A Mitogen-activated protein kinase kinase kinase 7 interacting protein 1; TAK1-binding protein, TAB1; 3.00A {Anopheles gambiae} Length = 358 Back     alignment and structure
>2pml_X PFPK7, Ser/Thr protein kinase; phosphorylati transferase, transferase; HET: ANP; 2.60A {Plasmodium falciparum} PDB: 2pmn_X* 2pmo_X* Length = 348 Back     alignment and structure
>3idb_B CAMP-dependent protein kinase type II-beta regulatory subunit, CAMP-dependent protein kinase catalytic subunit alpha; PKA, SPR, affinity; HET: TPO SEP ANP; 1.62A {Rattus norvegicus} PDB: 3idc_B* Length = 161 Back     alignment and structure
>3idb_B CAMP-dependent protein kinase type II-beta regulatory subunit, CAMP-dependent protein kinase catalytic subunit alpha; PKA, SPR, affinity; HET: TPO SEP ANP; 1.62A {Rattus norvegicus} PDB: 3idc_B* Length = 161 Back     alignment and structure
>3pna_A CAMP-dependent protein kinase type I-alpha regula subunit; beta-barrel, CAMP-binding, catalytic subunit, transferase; HET: CMP; 1.50A {Bos taurus} PDB: 3fhi_B* 3iia_A 3plq_A* 1u7e_B* 3pvb_B* Length = 154 Back     alignment and structure
>3pna_A CAMP-dependent protein kinase type I-alpha regula subunit; beta-barrel, CAMP-binding, catalytic subunit, transferase; HET: CMP; 1.50A {Bos taurus} PDB: 3fhi_B* 3iia_A 3plq_A* 1u7e_B* 3pvb_B* Length = 154 Back     alignment and structure
>3ocp_A PRKG1 protein; serine/threonine kinase, TF2I and IRAG, transferase; HET: CMP; 2.49A {Homo sapiens} PDB: 3od0_A* 3ogj_A* Length = 139 Back     alignment and structure
>3ocp_A PRKG1 protein; serine/threonine kinase, TF2I and IRAG, transferase; HET: CMP; 2.49A {Homo sapiens} PDB: 3od0_A* 3ogj_A* Length = 139 Back     alignment and structure
>3cok_A Serine/threonine-protein kinase PLK4; POLO-like kinase 4, SAK, STK18, PSI, structural genomics, protein structure initiative; HET: ANP; 2.25A {Homo sapiens} Length = 278 Back     alignment and structure
>2owb_A Serine/threonine-protein kinase PLK1; catalytic domain, POLO-like kinase1, transfera; HET: 626; 2.10A {Homo sapiens} PDB: 2ou7_A* 3fc2_A* 3thb_A* Length = 335 Back     alignment and structure
>2rku_A Serine/threonine-protein kinase PLK1; structure of PLK1, selectivity residues, POLO-like K structure based drug design, ATP-binding; HET: R78 TLA SRT TAR; 1.95A {Homo sapiens} PDB: 2v5q_A 2yac_A* 4a4l_A* 4a4o_A* 3kb7_A* 3d5w_A* 3d5u_A* 3d5v_A 3db8_A* 3dbc_A* 3dbd_A* 3d5x_A* 3db6_A* 3dbe_A* 3dbf_A* Length = 294 Back     alignment and structure
>3d8k_A PP2C, protein phosphatase 2C; nysgrc, PSI-II, STR genomics, protein structure initiative, NEW YORK structural research consortium, nysgxrc; 2.71A {Toxoplasma gondii} Length = 377 Back     alignment and structure
>3byv_A Rhoptry kinase; malaria, transferase, structural genomics, structural genomics consortium, SGC; 1.80A {Toxoplasma gondii} PDB: 2w1z_A Length = 377 Back     alignment and structure
>2isn_A NYSGXRC-8828Z, phosphatase; pathogenic strain, praseodymium, sulfate structural genomics, PSI-2, protein structure initiative; 1.90A {Toxoplasma gondii} Length = 364 Back     alignment and structure
>3dls_A PAS domain-containing serine/threonine-protein KI; PAS kinase, PASK, protein kinase, drug discovery, ATP-bindin kinase, nucleotide-binding; HET: ADP; 2.30A {Homo sapiens} Length = 335 Back     alignment and structure
>2iwi_A Serine/threonine-protein kinase PIM-2; nucleotide-binding, cancer, leukemia, transferase, ATP-binding, proto- oncogene, phosphorylation; HET: HB1; 2.80A {Homo sapiens} Length = 312 Back     alignment and structure
>3a99_A Proto-oncogene serine/threonine-protein kinase PI; PIM-1, P27KIP1, peptide drug, prostate cancer, transferase; HET: ANP; 1.60A {Homo sapiens} PDB: 3bgq_A* 3bgp_A* 2obj_A* 3bgz_A* 3t9i_A* 3dcv_A* 1xws_A* 2xj1_A* 2xix_A* 2xiz_A* 2xj0_A* 2xiy_A* 2xj2_A* 3f2a_A* 1xr1_A* 1xqz_A* 3cy2_A* 3cxw_A* 3cy3_A* 2bik_B* ... Length = 320 Back     alignment and structure
>3q60_A ROP5B; pseudokinase, transferase; HET: ATP; 1.72A {Toxoplasma gondii} PDB: 3q5z_A* Length = 371 Back     alignment and structure
>3dzo_A Rhoptry kinase domain; parasitic disease, transferase, structural genomics, structural genomics consortium, SGC; 1.80A {Toxoplasma gondii} Length = 413 Back     alignment and structure
>1phk_A Phosphorylase kinase; glycogen metabolism, transferase, serine/threonine-protein, ATP-binding, calmodulin-binding; HET: ATP; 2.20A {Oryctolagus cuniculus} SCOP: d.144.1.7 PDB: 1ql6_A* 2phk_A* Length = 298 Back     alignment and structure
>2h6d_A 5'-AMP-activated protein kinase catalytic subunit alpha-2; ATP-binding, cholesterol biosynthesis, fatty acid biosynthesis;kinase, lipid synthesis; 1.85A {Homo sapiens} PDB: 3aqv_A* 2yza_A* Length = 276 Back     alignment and structure
>2qr7_A Ribosomal protein S6 kinase alpha-3; kinase domain, RSK2, autoinhibitory, ATP-binding, nucleotide phosphorylation, serine/threonine-protein kinase; 2.00A {Mus musculus} PDB: 2qr8_A 4d9t_A* 4d9u_A* 3rny_A 2wnt_A Length = 342 Back     alignment and structure
>3fe3_A MAP/microtubule affinity-regulating kinase 3; serine/threonine protein kinase, MARK;PAR-1, UBA domai TAK1;P78;MARK3, ATP-binding; 1.90A {Homo sapiens} PDB: 2qnj_A 1y8g_A* 1zmw_A 1zmu_A 1zmv_A 2wzj_A 2r0i_A 2hak_A 3iec_A Length = 328 Back     alignment and structure
>1kob_A Twitchin; kinase, intrasteric regulation; 2.30A {Aplysia californica} SCOP: d.144.1.7 Length = 387 Back     alignment and structure
>3h4j_B AMPK kdaid, SNF1-like protein kinase SSP2; ATP-binding, nucleotide-binding, phosphoprotei serine/threonine-protein kinase, transferase; 2.80A {Schizosaccharomyces pombe} Length = 336 Back     alignment and structure
>2zv2_A Calcium/calmodulin-dependent protein kinase kinas; beta, camkk2, E.C.2.7.11.17, phosphorylation, AMPKK, metabolism, binding, calmodulin-binding; HET: 609; 2.40A {Homo sapiens} Length = 298 Back     alignment and structure
>3fhr_A MAP kinase-activated protein kinase 3; kinase-inhibitor complex, ATP-binding, cytoplasm, nucleotide-binding, nucleus, phosphoprotein, polymorphism; HET: P4O; 1.90A {Homo sapiens} PDB: 3fxw_A* 3r1n_A* 3she_A* 2oza_A 3fyk_X* 3fyj_X* 2p3g_X* 3ka0_A* 3fpm_A* 2pzy_A* 3a2c_A* 3kc3_A* 3gok_A* 2jbo_A* 2jbp_A* 3r2y_A* 3r30_A* 3r2b_A* Length = 336 Back     alignment and structure
>3hko_A Calcium/calmodulin-dependent protein kinase with domain and 2 calmodulin-like EF...; structural genomics, protist parasite; HET: ANP; 1.80A {Cryptosporidium parvum iowa II} Length = 345 Back     alignment and structure
>3bhy_A Death-associated protein kinase 3; death associated kinase, DAPK3, ZIP kinase, ZIPK, DAP kinase like kinase, DLK, structural genomics consortium; HET: 7CP; 1.24A {Homo sapiens} PDB: 3bqr_A* 2j90_A* 1yrp_A* 2yak_A* 2y4p_A* 3f5u_A* 1jks_A 1jkk_A* 1ig1_A* 1jkl_A 1jkt_A 3eh9_A* 3eha_A* 3f5g_A* 1p4f_A* 1wvw_A 1wvx_A* 1wvy_A* 2w4j_A* 3dgk_A ... Length = 283 Back     alignment and structure
>2jam_A Calcium/calmodulin-dependent protein kinase type 1G; transferase, kinase, membrane, ATP-binding, prenylation, serine/threonine-protein kinase, alternative splicing; HET: J60; 1.7A {Homo sapiens} PDB: 2jc6_A* 1a06_A Length = 304 Back     alignment and structure
>3kk8_A Calcium/calmodulin dependent protein kinase II; ATP-binding, nucleotide-binding, serine/threonine-protein kinase, transferase; HET: TPO; 1.72A {Caenorhabditis elegans} PDB: 3kk9_A* 3kl8_A 2vn9_A* 3bhh_A* Length = 284 Back     alignment and structure
>2wtk_C Serine/threonine-protein kinase 11; transferase-metal-binding protein complex, transferase metal protein complex, nucleus; HET: ANP; 2.65A {Homo sapiens} Length = 305 Back     alignment and structure
>2a2a_A Death-associated protein kinase 2; autoinhibition, transferase; 1.47A {Homo sapiens} PDB: 2cke_A* 1wmk_A 1z9x_A 2a27_A 2x0g_A 2xuu_A* 2w4k_A* 2xzs_A Length = 321 Back     alignment and structure
>1tki_A Titin; serine kinase, muscle, autoinhibition; 2.00A {Homo sapiens} SCOP: d.144.1.7 Length = 321 Back     alignment and structure
>3lm5_A Serine/threonine-protein kinase 17B; STK17B, serine/threonine kinase 17B, DRAK2, DAP kinase relat apoptosis-inducing protein kinase 2; HET: QUE; 2.29A {Homo sapiens} PDB: 3lm0_A* Length = 327 Back     alignment and structure
>3p1a_A MYT1 kinase, membrane-associated tyrosine- and threonine-speci inhibitory kinase; structural genomics, structural genomics consortium, SGC; 1.70A {Homo sapiens} Length = 311 Back     alignment and structure
>2y0a_A Death-associated protein kinase 1; transferase, calmodulin, esprit; HET: MES; 2.60A {Homo sapiens} Length = 326 Back     alignment and structure
>3nyv_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, EF hand, bumped kinase inhibitor; HET: MSE DTQ; 1.88A {Toxoplasma gondii} PDB: 3i79_A* 3i7b_A* 3n51_A* 3i7c_A* 3sx9_A* 3sxf_A* 3t3u_A* 3t3v_A* 3upx_A* 3upz_A* 3v51_A* 3v5p_A* 3v5t_A* 3ku2_A* 3hx4_A* Length = 484 Back     alignment and structure
>2bdw_A Hypothetical protein K11E8.1D; kinase, calmodulin activated, transferase; 1.80A {Caenorhabditis elegans} PDB: 2wel_A* 2v7o_A* 2vz6_A* 1cdm_B 1cm1_B 1cm4_B Length = 362 Back     alignment and structure
>2yab_A Death-associated protein kinase 2; apoptosis, transferase; HET: AMP; 1.90A {Mus musculus} PDB: 2yaa_A* 2ya9_A* Length = 361 Back     alignment and structure
>3mwu_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, bumped kinase inhibitor, BKI; HET: BK3; 1.98A {Cryptosporidium parvum} PDB: 3igo_A* 3ncg_A* Length = 486 Back     alignment and structure
>3lij_A Calcium/calmodulin dependent protein kinase with A kinase domain and 4 calmodulin...; transferase, calcium dependent protein kinase; HET: ANP; 1.90A {Cryptosporidium parvum} PDB: 3hzt_A* 3dxn_A 3l19_A* Length = 494 Back     alignment and structure
>3is5_A Calcium-dependent protein kinase; CDPK, structural genomics, parasitology, structural genomics consortium, SGC, ATP-binding, nucleotide-binding; HET: ANP; 2.55A {Toxoplasma gondii} Length = 285 Back     alignment and structure
>2y7j_A Phosphorylase B kinase gamma catalytic chain, testis/liver isoform; transferase; HET: B49; 2.50A {Homo sapiens} PDB: 1h0t_A 1lp1_B 1q2n_A 2spz_A 3mzw_B* 1ss1_A 2jwd_A 1bdc_A 1bdd_A 1fc2_C* 2b87_A 2b88_A 1h0t_B 1lp1_A 2b87_B 2b89_A 3s1k_A Length = 365 Back     alignment and structure
>3f3z_A Calcium/calmodulin-dependent protein kinase with domain and 4 calmodulin like EF...; calcium dependent protein kinase; HET: SEP DRK; 1.84A {Cryptosporidium parvum iowa II} PDB: 2qg5_A* Length = 277 Back     alignment and structure
>2wei_A Calmodulin-domain protein kinase 1, putative; nucleotide-binding, serine/threonine-protein kinase, CGD3_920, transferase; HET: VGG; 1.65A {Cryptosporidium parvum iowa II} PDB: 3dfa_A 3ma6_A* Length = 287 Back     alignment and structure
>2x4f_A Myosin light chain kinase family member 4; LUNG, breast cancer, transferase, serine/threonine-protein kinase, nucleotide-binding; HET: 16X 1PE; 2.67A {Homo sapiens} Length = 373 Back     alignment and structure
>3kn6_A Ribosomal protein S6 kinase alpha-5; AMP-PNP, MSK1, MSK, ATP-binding, metal-binding, NUCL binding, serine/threonine-protein kinase, transferase; 2.00A {Homo sapiens} PDB: 3kn5_A Length = 325 Back     alignment and structure
>3soa_A Calcium/calmodulin-dependent protein kinase type alpha with A beta 7 linker; phosphorylation, cytosolic, transferase-transferase inhibitor complex; HET: DB8; 3.55A {Homo sapiens} Length = 444 Back     alignment and structure
>3q5i_A Protein kinase; CDPK, malaria, phosphotransferase, structural genomics, structural genomic consortium, SGC, transferase; HET: ANP; 2.10A {Plasmodium berghei} Length = 504 Back     alignment and structure
>2ycf_A Serine/threonine-protein kinase CHK2; transferase, anticancer, anticancer drug design; HET: YCF; 1.77A {Homo sapiens} PDB: 2yiq_A* 2w7x_A* 2ycq_A* 2ycs_A* 2w0j_A* 2yir_A* 2yit_A* 2wtj_A* 2cn8_A* 2wtc_A* 2wtd_A* 2wti_A* 2cn5_A* 2xbj_A* 2xm8_A* 2xm9_A* 2xk9_A* 2ycr_A* Length = 322 Back     alignment and structure
>3i6u_A CDS1, serine/threonine-protein kinase CHK2; Ser/Thr protein kinase, FHA domain, ATP-binding, cell cycle, mutation, LI-fraumeni syndrome, magnesium; 3.00A {Homo sapiens} PDB: 3i6w_A Length = 419 Back     alignment and structure
>3uto_A Twitchin; kinase, muscle sarcomere, transferase; HET: FLC P33; 2.40A {Caenorhabditis elegans} PDB: 1koa_A Length = 573 Back     alignment and structure
>2y94_A 5'-AMP-activated protein kinase catalytic subunit; transferase, nucleotide-binding, staurosporine-binding, serine/threonine-protein kinase; HET: TPO STU AMP; 3.24A {Rattus norvegicus} Length = 476 Back     alignment and structure
>1nxk_A MAP kinase-activated protein kinase 2; MK2, phosphorylation, staurosporine, transfe; HET: STU; 2.70A {Homo sapiens} SCOP: d.144.1.7 PDB: 1kwp_A* 1ny3_A* 2onl_C Length = 400 Back     alignment and structure
>3tki_A Serine/threonine-protein kinase CHK1; cell checkpoint, transferase-transferase inhib complex; HET: S25; 1.60A {Homo sapiens} PDB: 2qhm_A* 2r0u_A* 3tkh_A* 2qhn_A* 2hy0_A* 2hog_A* 2hxq_A* 2hxl_A* 3f9n_A* Length = 323 Back     alignment and structure
>2yex_A Serine/threonine-protein kinase CHK1; transferase, cell cycle; HET: YEX; 1.30A {Homo sapiens} PDB: 2x8e_A* 2ydk_A* 2ydj_A* 2yer_A* 2ydi_A* 1nvq_A* 1nvr_A* 1nvs_A* 2wmq_A* 2wmr_A* 2wms_A* 2wmt_A* 2wmu_A* 2wmv_A* 2wmw_A* 2wmx_A* 2x8d_A* 2x8i_A* 2xey_A* 2xez_A* ... Length = 276 Back     alignment and structure
>4apc_A Serine/threonine-protein kinase NEK1; transferase; 2.10A {Homo sapiens} Length = 350 Back     alignment and structure
>3cek_A Dual specificity protein kinase TTK; HMPS1, PYT, ESK, phosphotyros picked threonine kinase, SGC, structural genomics consortiu binding; HET: 7PE; 2.30A {Homo sapiens} PDB: 3gfw_A* 3h9f_A* 2x9e_A* 3hmp_A* 3hmn_A* 3hmo_A* Length = 313 Back     alignment and structure
>3dbq_A Dual specificity protein kinase TTK; MPS1 structure, kinase activation, phosphorylation, ATP- binding, nucleotide-binding, phosphoprotein; 2.70A {Homo sapiens} Length = 343 Back     alignment and structure
>3c0i_A Peripheral plasma membrane protein CASK; neurexin, Ca2+/calmodulin dependent protein kinase, Mg synaptic plasticity, pseudokinase, maguk; HET: 3AM; 1.85A {Homo sapiens} PDB: 3c0h_A* 3c0g_A* 3mfr_A* 3mfs_A* 3mft_A 3mfu_A* 3tac_A Length = 351 Back     alignment and structure
>1zy4_A Serine/threonine-protein kinase GCN2; translation regulator, signal transduction, acid starvation, starvation stress response; 1.95A {Saccharomyces cerevisiae} PDB: 1zy5_A* 1zyd_A* 1zyc_A* 1zxe_A Length = 303 Back     alignment and structure
>2w4o_A Calcium/calmodulin-dependent protein kinase type IV; calmodulin-binding, nucleotide-binding, serine/threonine-protein kinase, ATP-binding; HET: DKI; 2.17A {Homo sapiens} Length = 349 Back     alignment and structure
>2zmd_A Dual specificity protein kinase TTK; MPS1, T686A, ATP-binding, nucleotide-bindi phosphoprotein, serine/threonine-protein kinase; HET: 537 7PE; 2.88A {Homo sapiens} PDB: 2zmc_A* Length = 390 Back     alignment and structure
>3p23_A Serine/threonine-protein kinase/endoribonuclease; kinase domain, kinase and RNAse function, ATP binding ssRNA dephosphorylated, hydrolase; HET: ADP; 2.70A {Homo sapiens} Length = 432 Back     alignment and structure
>2d93_A RAP guanine nucleotide exchange factor 6; CNMP_binding domain, PDZ domain containing guanine nucleotide exchange factor 2, PDZ-GEF2, RA-GEF-2; NMR {Homo sapiens} Length = 134 Back     alignment and structure
>2d93_A RAP guanine nucleotide exchange factor 6; CNMP_binding domain, PDZ domain containing guanine nucleotide exchange factor 2, PDZ-GEF2, RA-GEF-2; NMR {Homo sapiens} Length = 134 Back     alignment and structure
>2w5a_A Serine/threonine-protein kinase NEK2; Ser/Thr protein kinase, nucleus, meiosis, mitosis, cytoplasm, metal-binding, phosphoprotein; HET: ADP; 1.55A {Homo sapiens} PDB: 2wqo_A* 2xk3_A* 2xk4_A* 2xk6_A* 2xk7_A* 2xk8_A* 2xkc_A* 2xkd_A* 2xke_A* 2xkf_A* 2xnm_A* 2xnn_A* 2xno_A* 2xnp_A* 4afe_A* 2jav_A* 2w5b_A* 2w5h_A 4a4x_A* Length = 279 Back     alignment and structure
>1o7f_A CAMP-dependent RAP1 guanine-nucleotide exchange factor; EPAC2, CAMP-GEF2, campb binding doamin, regulation; 2.5A {Mus musculus} SCOP: a.4.5.31 b.82.3.2 b.82.3.2 Length = 469 Back     alignment and structure
>1o7f_A CAMP-dependent RAP1 guanine-nucleotide exchange factor; EPAC2, CAMP-GEF2, campb binding doamin, regulation; 2.5A {Mus musculus} SCOP: a.4.5.31 b.82.3.2 b.82.3.2 Length = 469 Back     alignment and structure
>1o7f_A CAMP-dependent RAP1 guanine-nucleotide exchange factor; EPAC2, CAMP-GEF2, campb binding doamin, regulation; 2.5A {Mus musculus} SCOP: a.4.5.31 b.82.3.2 b.82.3.2 Length = 469 Back     alignment and structure
>3uc3_A Serine/threonine-protein kinase SRK2I; SNRK2, ABA signaling, transferase; 1.90A {Arabidopsis thaliana} PDB: 3zut_A 3zuu_A 3uc4_A 3ujg_A 3udb_A Length = 361 Back     alignment and structure
>3e7e_A HBUB1, BUB1A, mitotic checkpoint serine/threonine-protein kinas; spindle assembly checkpoint, mitosis, kinase, activation, KE CDC20, ATP-binding; HET: ATP; 2.31A {Homo sapiens} Length = 365 Back     alignment and structure
>2a19_B Interferon-induced, double-stranded RNA-activated kinase; transferase, protein biosynthesis, protein synthesis transferase complex; HET: TPO ANP; 2.50A {Homo sapiens} PDB: 2a1a_B* Length = 284 Back     alignment and structure
>2wqm_A Serine/threonine-protein kinase NEK7; ATP-binding, polymorphism, metal-binding, cell cycle kinase, mitosis, cytoplasm, magnesium, transferase; 2.10A {Homo sapiens} PDB: 2wqn_A* Length = 310 Back     alignment and structure
>2ac3_A MAP kinase-interacting serine/threonine kinase 2; DFD motif, transferase; 2.10A {Homo sapiens} PDB: 2hw7_A* 2ac5_A* 2hw6_A Length = 316 Back     alignment and structure
>2rio_A Serine/threonine-protein kinase/endoribonuclease IRE1; protein-nucleotide complex, ATP-binding, endoplasmic reticulum, glycoprotein; HET: ADP; 2.40A {Saccharomyces cerevisiae} PDB: 3lj0_A* 3lj1_A* 3lj2_A* 3fbv_A* 3sdm_A* 3sdj_A* Length = 434 Back     alignment and structure
>4euu_A Serine/threonine-protein kinase TBK1; ATP binding, phosphorylation, transferase-transferas inhibitor complex; HET: SEP BX7; 1.80A {Homo sapiens} Length = 319 Back     alignment and structure
>3mdp_A Cyclic nucleotide-binding domain (CNMP-BD) protei; structural genomics, joint center for structural genomics; HET: MSE; 1.90A {Geobacter metallireducens} Length = 142 Back     alignment and structure
>3mdp_A Cyclic nucleotide-binding domain (CNMP-BD) protei; structural genomics, joint center for structural genomics; HET: MSE; 1.90A {Geobacter metallireducens} Length = 142 Back     alignment and structure
>4eut_A Serine/threonine-protein kinase TBK1; ATP binding, phosphorylation, transferase-transferas inhibitor complex; HET: BX7; 2.60A {Homo sapiens} Length = 396 Back     alignment and structure
>3m2w_A MAP kinase-activated protein kinase 2; small molecule inhibitor, spiroazetidine-tetracycle, ATP-SIT inhibitor, novartis compound NVP-BXS169; HET: L8I; 2.41A {Homo sapiens} PDB: 3kga_A* 3m42_A* Length = 299 Back     alignment and structure
>2pqq_A Putative transcriptional regulator; APC7345, streptomyces coelicolor structural genomics, PSI-2, protein structure initiative; 2.00A {Streptomyces coelicolor A3} Length = 149 Back     alignment and structure
>2pqq_A Putative transcriptional regulator; APC7345, streptomyces coelicolor structural genomics, PSI-2, protein structure initiative; 2.00A {Streptomyces coelicolor A3} Length = 149 Back     alignment and structure
>1vp6_A CNBD, cyclic-nucleotide binding domain of mesorhizobium LOTI CNG potassium channel; dimer helical bundle beta barrel core with cyclic AMP bound; HET: CMP; 1.70A {Mesorhizobium loti} SCOP: b.82.3.2 PDB: 3cl1_A* 2k0g_A* 2kxl_A 3clp_A* 1u12_A 3co2_A Length = 138 Back     alignment and structure
>1vp6_A CNBD, cyclic-nucleotide binding domain of mesorhizobium LOTI CNG potassium channel; dimer helical bundle beta barrel core with cyclic AMP bound; HET: CMP; 1.70A {Mesorhizobium loti} SCOP: b.82.3.2 PDB: 3cl1_A* 2k0g_A* 2kxl_A 3clp_A* 1u12_A 3co2_A Length = 138 Back     alignment and structure
>2buj_A Serine/threonine-protein kinase 16; transferase, ATP-binding, lipoprotein, myristate, PA phosphorylation; HET: STU; 2.6A {Homo sapiens} Length = 317 Back     alignment and structure
>4g31_A Eukaryotic translation initiation factor 2-alpha; deletion mutant, catalytic domain, synthetic inhibitor, TRAN transferase inhibitor complex; HET: 0WH; 2.28A {Homo sapiens} PDB: 4g34_A* Length = 299 Back     alignment and structure
>3gyd_A CNMP-BD protein, cyclic nucleotide-binding domain; nucleotide binding protein, structural genomics; HET: MSE CMP; 1.79A {Methylobacillus flagellatus KT} Length = 187 Back     alignment and structure
>3gyd_A CNMP-BD protein, cyclic nucleotide-binding domain; nucleotide binding protein, structural genomics; HET: MSE CMP; 1.79A {Methylobacillus flagellatus KT} Length = 187 Back     alignment and structure
>3qa8_A MGC80376 protein; kinase ubiquitin-like domain, phosphorylation, kinase domain ubiquitin-like domain, kinase, substrate binding; 3.60A {Xenopus laevis} PDB: 3qad_A* 3rzf_A* Length = 676 Back     alignment and structure
>4g3f_A NF-kappa-beta-inducing kinase; non-RD kinase, protein serine/threonine kinase, S based drug design, MAP3K14, transferase; HET: 0WB; 1.64A {Mus musculus} PDB: 4g3g_A* 4g3c_A 4dn5_A* Length = 336 Back     alignment and structure
>1x8b_A WEE1HU, WEE1-like protein kinase; cell cycle, transferase; HET: 824; 1.81A {Homo sapiens} PDB: 3bi6_A* 3biz_A* 3cqe_A* 3cr0_A* 2in6_A* 2io6_A* 2z2w_A* Length = 289 Back     alignment and structure
>2clq_A Mitogen-activated protein kinase kinase kinase 5; transferase, metal-binding, apoptosis; HET: STU; 2.3A {Homo sapiens} Length = 295 Back     alignment and structure
>3qd2_B Eukaryotic translation initiation factor 2-alpha; EIF2A kinase, phosphoryalation, gene regulation; HET: TPO; 2.81A {Mus musculus} Length = 332 Back     alignment and structure
>2z69_A DNR protein; beta barrel, dimerization helix, transcription regulator; 2.10A {Pseudomonas aeruginosa} Length = 154 Back     alignment and structure
>2z69_A DNR protein; beta barrel, dimerization helix, transcription regulator; 2.10A {Pseudomonas aeruginosa} Length = 154 Back     alignment and structure
>3ll6_A Cyclin G-associated kinase; transferase, protein kinase, serine/threonine kinase, cyclin clathrine, membrane trafficking, structural genomics; 2.10A {Homo sapiens} Length = 337 Back     alignment and structure
>1wgp_A Probable cyclic nucleotide-gated ION channel 6; cyclic nucleotide monophosphate, CNMP, CNMP-binding, structural genomics; NMR {Arabidopsis thaliana} SCOP: b.82.3.2 Length = 137 Back     alignment and structure
>1wgp_A Probable cyclic nucleotide-gated ION channel 6; cyclic nucleotide monophosphate, CNMP, CNMP-binding, structural genomics; NMR {Arabidopsis thaliana} SCOP: b.82.3.2 Length = 137 Back     alignment and structure
>4ava_A Lysine acetyltransferase; allosteric regulation, domain coupling; HET: ACO; 1.70A {Mycobacterium tuberculosis} PDB: 4avb_A* 4avc_A* Length = 333 Back     alignment and structure
>4ava_A Lysine acetyltransferase; allosteric regulation, domain coupling; HET: ACO; 1.70A {Mycobacterium tuberculosis} PDB: 4avb_A* 4avc_A* Length = 333 Back     alignment and structure
>4f8a_A Potassium voltage-gated channel subfamily H membe; probable regulatory domain of potassium channel, membrane PR transport protein; 2.20A {Mus musculus} Length = 160 Back     alignment and structure
>4f8a_A Potassium voltage-gated channel subfamily H membe; probable regulatory domain of potassium channel, membrane PR transport protein; 2.20A {Mus musculus} Length = 160 Back     alignment and structure
>2dyl_A Dual specificity mitogen-activated protein kinase kinase 7; MKK7, activated mutant, ATP-binding, structural genomics, NPPSFA; 2.45A {Homo sapiens} Length = 318 Back     alignment and structure
>3fxz_A Serine/threonine-protein kinase PAK 1; transferase, ATP-binding, phosphorylation, allosteric enzyme, alternative splicing, apoptosis, cell junction; HET: TPO FLL; 1.64A {Homo sapiens} PDB: 3fy0_A* 4daw_A* 3q52_A* 3q53_A* 1yhw_A 1f3m_C 1yhv_A 2hy8_1* 3q4z_A* Length = 297 Back     alignment and structure
>2c30_A Serine/threonine-protein kinase PAK 6; CRIB domain, ATP-binding, transferase, nucleotide-binding; HET: SEP; 1.6A {Homo sapiens} PDB: 2f57_A* 2j0i_A* 2cdz_A* 2q0n_A* 2x4z_A* 2bva_A* Length = 321 Back     alignment and structure
>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Length = 681 Back     alignment and structure
>1t4h_A Serine/threonine-protein kinase WNK1; protein serine/threonine kinase, transferase; 1.80A {Rattus norvegicus} SCOP: d.144.1.7 PDB: 3fpq_A Length = 290 Back     alignment and structure
>3aln_A Dual specificity mitogen-activated protein kinase; protein AMP-PNP complex, transferase; HET: ANP; 2.30A {Homo sapiens} PDB: 3alo_A* Length = 327 Back     alignment and structure
>3d0s_A Transcriptional regulatory protein; CAMP receptor protein (CRP), dimer, inactive(APO, unliganded allostery, DNA binding, cyclic AMP; 2.00A {Mycobacterium tuberculosis} PDB: 3i54_A* 3i59_A* 3mzh_A* 3h3u_A* 3r6s_A* Length = 227 Back     alignment and structure
>3d0s_A Transcriptional regulatory protein; CAMP receptor protein (CRP), dimer, inactive(APO, unliganded allostery, DNA binding, cyclic AMP; 2.00A {Mycobacterium tuberculosis} PDB: 3i54_A* 3i59_A* 3mzh_A* 3h3u_A* 3r6s_A* Length = 227 Back     alignment and structure
>2ptm_A Hyperpolarization-activated (IH) channel; ION channel, cyclic nucleotide binding domain, C-linker, CAM SPHCN1, HCN; HET: CMP; 1.93A {Strongylocentrotus purpuratus} Length = 198 Back     alignment and structure
>2ptm_A Hyperpolarization-activated (IH) channel; ION channel, cyclic nucleotide binding domain, C-linker, CAM SPHCN1, HCN; HET: CMP; 1.93A {Strongylocentrotus purpuratus} Length = 198 Back     alignment and structure
>2h34_A Serine/threonine-protein kinase PKNE; apoenzyme, transferase; 2.80A {Mycobacterium tuberculosis} Length = 309 Back     alignment and structure
>3ukn_A Novel protein similar to vertebrate potassium VOL channel, subfamily H (EAG-related)...; KCNH, ELK, ERG, CNBD, CNBHD, C-linker, ION channel; 2.20A {Danio rerio} PDB: 3ukt_B 3ukv_B Length = 212 Back     alignment and structure
>3ukn_A Novel protein similar to vertebrate potassium VOL channel, subfamily H (EAG-related)...; KCNH, ELK, ERG, CNBD, CNBHD, C-linker, ION channel; 2.20A {Danio rerio} PDB: 3ukt_B 3ukv_B Length = 212 Back     alignment and structure
>3dv8_A Transcriptional regulator, CRP/FNR family; cyclic nucleotide-binding domain, structural genomics, joint for structural genomics; 2.55A {Eubacterium rectale atcc 33656} Length = 220 Back     alignment and structure
>3dv8_A Transcriptional regulator, CRP/FNR family; cyclic nucleotide-binding domain, structural genomics, joint for structural genomics; 2.55A {Eubacterium rectale atcc 33656} Length = 220 Back     alignment and structure
>4eqm_A Protein kinase; transferase; HET: ANP; 3.00A {Staphylococcus aureus subsp} Length = 294 Back     alignment and structure
>4ev0_A Transcription regulator, CRP family; CAMP binding, winged helix-turn-helix motif, DNA binding, transcription activator; HET: CMP; 2.40A {Thermus thermophilus} Length = 216 Back     alignment and structure
>4ev0_A Transcription regulator, CRP family; CAMP binding, winged helix-turn-helix motif, DNA binding, transcription activator; HET: CMP; 2.40A {Thermus thermophilus} Length = 216 Back     alignment and structure
>3e97_A Transcriptional regulator, CRP/FNR family; YP_604437.1, structural genomics, joint center for structural genomics, JCSG; HET: MSE; 1.86A {Deinococcus geothermalis dsm 11300} Length = 231 Back     alignment and structure
>3e97_A Transcriptional regulator, CRP/FNR family; YP_604437.1, structural genomics, joint center for structural genomics, JCSG; HET: MSE; 1.86A {Deinococcus geothermalis dsm 11300} Length = 231 Back     alignment and structure
>3ork_A Serine/threonine protein kinase; structural genomics, TB structural genomics consortium, TBSG domain, signal transduction; HET: AGS; 1.60A {Mycobacterium tuberculosis} PDB: 3ori_A* 3orl_A* 3oro_A* 3orp_A* 3ort_A* 3f61_A* 1mru_A* 3f69_A* 3orm_A* 1o6y_A* 2fum_A* Length = 311 Back     alignment and structure
>3eqc_A Dual specificity mitogen-activated protein kinase; MEK1 kinase, ATP-binding, disease mutation, nucleoti binding, phosphoprotein; HET: 3BM AGS; 1.80A {Homo sapiens} PDB: 3eqd_A* 3eqf_A* 3eqg_A* 3eqh_A* 3eqi_A* 2y4i_C* 3eqb_A* 2p55_A* 1s9j_A* 3dy7_A* 3e8n_A* 3dv3_A* 3mbl_A* 3pp1_A* 3orn_A* 3os3_A* 3sls_A* 1s9i_A* Length = 360 Back     alignment and structure
>3com_A Serine/threonine-protein kinase 4; MST1, STE20-like kinase, PSI, structural genomics, protein structure initiative; HET: TPO; 2.20A {Homo sapiens} Length = 314 Back     alignment and structure
>3bpz_A Potassium/sodium hyperpolarization-activated cyclic nucleotide-gated channel 2; CNBD, C-linker, pacemaker, HCN, HCN2, CAP, PKA, CAMP, ION channel; HET: CMP; 1.65A {Mus musculus} PDB: 3ffq_A 1q3e_A* 1q43_A* 1q5o_A* 3u10_A* 2q0a_A* 3etq_A* 3u11_A* 3otf_A* 3u0z_A* Length = 202 Back     alignment and structure
>3bpz_A Potassium/sodium hyperpolarization-activated cyclic nucleotide-gated channel 2; CNBD, C-linker, pacemaker, HCN, HCN2, CAP, PKA, CAMP, ION channel; HET: CMP; 1.65A {Mus musculus} PDB: 3ffq_A 1q3e_A* 1q43_A* 1q5o_A* 3u10_A* 2q0a_A* 3etq_A* 3u11_A* 3otf_A* 3u0z_A* Length = 202 Back     alignment and structure
>2pk0_A Serine/threonine protein phosphatase STP1; SI motif, signaling protein; 2.65A {Streptococcus agalactiae} Length = 250 Back     alignment and structure
>3fme_A Dual specificity mitogen-activated protein kinase; active mutant, structural genomics consortium, SCG, binding, nucleotide-binding, phosphoprotein; HET: STU; 2.26A {Homo sapiens} PDB: 3enm_A Length = 290 Back     alignment and structure
>3a7i_A MST3 kinase, serine/threonine kinase 24 (STE20 homolog, yeast); two-LOBE protein kinase fold, ATP-binding, nucleotid binding, transferase; HET: TPO ADE; 1.45A {Homo sapiens} PDB: 3a7g_A* 3a7h_A* 3a7f_A* 3a7j_A* 3ckw_A 3ckx_A* 3ggf_A* 2xik_A* Length = 303 Back     alignment and structure
>1txo_A Putative bacterial enzyme; serine/threonine protein phosphatases, PSTP/PPP, structural genomics, PSI, protein structure initiative; 1.95A {Mycobacterium tuberculosis} SCOP: d.219.1.1 PDB: 2cm1_A Length = 237 Back     alignment and structure
>3kcc_A Catabolite gene activator; helix-turn-helix, CAMP, CAMP-binding, DNA-binding nucleotide-binding, transcription, transcription regulation; HET: CMP; 1.66A {Escherichia coli} Length = 260 Back     alignment and structure
>3kcc_A Catabolite gene activator; helix-turn-helix, CAMP, CAMP-binding, DNA-binding nucleotide-binding, transcription, transcription regulation; HET: CMP; 1.66A {Escherichia coli} Length = 260 Back     alignment and structure
>3uqc_A Probable conserved transmembrane protein; structural genomics, TB structural genomics consortium, TBSG fold, FHAA, transferase; 2.26A {Mycobacterium tuberculosis} PDB: 3oun_B* 3otv_A 3ouk_A Length = 286 Back     alignment and structure
>3fx3_A Cyclic nucleotide-binding protein; helix_TURN_helix, CAMP regulatory protein, structural genomi 2, protein structure initiative; 2.20A {Ruegeria pomeroyi} PDB: 3h3z_A* Length = 237 Back     alignment and structure
>3fx3_A Cyclic nucleotide-binding protein; helix_TURN_helix, CAMP regulatory protein, structural genomi 2, protein structure initiative; 2.20A {Ruegeria pomeroyi} PDB: 3h3z_A* Length = 237 Back     alignment and structure
>1o5l_A Transcriptional regulator, CRP family; TM1171, structural GE JCSG, PSI, protein structure initiative, joint center for S genomics; 2.30A {Thermotoga maritima} SCOP: b.82.3.2 Length = 213 Back     alignment and structure
>1o5l_A Transcriptional regulator, CRP family; TM1171, structural GE JCSG, PSI, protein structure initiative, joint center for S genomics; 2.30A {Thermotoga maritima} SCOP: b.82.3.2 Length = 213 Back     alignment and structure
>3ryp_A Catabolite gene activator; CAMP receptor protein (CRP), allostery, DNA binding cyclic A transcription regulator; HET: CMP; 1.60A {Escherichia coli} PDB: 2cgp_A* 3hif_A 1g6n_A* 3ryr_A* 1i5z_A* 1j59_A* 1lb2_A* 1run_A* 1zrc_A* 1zrd_A* 1zre_A* 1zrf_A* 2gzw_A* 2wc2_A 3iyd_G* 3n4m_A* 3qop_A* 3rdi_A* 3rou_A* 3rpq_A* ... Length = 210 Back     alignment and structure
>3ryp_A Catabolite gene activator; CAMP receptor protein (CRP), allostery, DNA binding cyclic A transcription regulator; HET: CMP; 1.60A {Escherichia coli} PDB: 2cgp_A* 3hif_A 1g6n_A* 3ryr_A* 1i5z_A* 1j59_A* 1lb2_A* 1run_A* 1zrc_A* 1zrd_A* 1zre_A* 1zrf_A* 2gzw_A* 2wc2_A 3iyd_G* 3n4m_A* 3qop_A* 3rdi_A* 3rou_A* 3rpq_A* ... Length = 210 Back     alignment and structure
>1blx_A Cyclin-dependent kinase 6; inhibitor protein, cyclin-dependent kinase, cell cycle control, alpha/beta, complex (inhibitor protein/kinase); 1.90A {Homo sapiens} SCOP: d.144.1.7 PDB: 1bi7_A 1bi8_A 1g3n_A 2f2c_B* 1jow_B* 2euf_B* 1xo2_B* 3nup_A* 3nux_A* 2w9z_B 2w99_B 2w96_B 2w9f_B Length = 326 Back     alignment and structure
>3dkw_A DNR protein; CRP-FNR, HTH, beta barrel, dimerization helix, homodimer, transcription regulator; 3.60A {Pseudomonas aeruginosa} Length = 227 Back     alignment and structure
>3dkw_A DNR protein; CRP-FNR, HTH, beta barrel, dimerization helix, homodimer, transcription regulator; 3.60A {Pseudomonas aeruginosa} Length = 227 Back     alignment and structure
>2byv_E RAP guanine nucleotide exchange factor 4; EPAC2, CAMP-GEF2, CAMP, cyclic nucleotide, regulation, auto-inhibition, CDC25 homology domain; 2.7A {Mus musculus} Length = 999 Back     alignment and structure
>2byv_E RAP guanine nucleotide exchange factor 4; EPAC2, CAMP-GEF2, CAMP, cyclic nucleotide, regulation, auto-inhibition, CDC25 homology domain; 2.7A {Mus musculus} Length = 999 Back     alignment and structure
>2gau_A Transcriptional regulator, CRP/FNR family; structural genomics, porphyromona gingivalis, PSI, protein structure initiative; 1.90A {Porphyromonas gingivalis} SCOP: a.4.5.4 b.82.3.2 Length = 232 Back     alignment and structure
>2gau_A Transcriptional regulator, CRP/FNR family; structural genomics, porphyromona gingivalis, PSI, protein structure initiative; 1.90A {Porphyromonas gingivalis} SCOP: a.4.5.4 b.82.3.2 Length = 232 Back     alignment and structure
>3iwz_A CAP-like, catabolite activation-like protein; XCC, pathogenicity, CRP, CLP, C-DI-GMP receptor, quorum SENS binding, transcription; 2.30A {Xanthomonas campestris PV} Length = 230 Back     alignment and structure
>3iwz_A CAP-like, catabolite activation-like protein; XCC, pathogenicity, CRP, CLP, C-DI-GMP receptor, quorum SENS binding, transcription; 2.30A {Xanthomonas campestris PV} Length = 230 Back     alignment and structure
>1ob3_A PFPK5, cell division control protein 2 homolog; transferase, serine/threonine-protein kinase, ATP-binding, phosphorylation, CDK; 1.9A {Plasmodium falciparum} SCOP: d.144.1.7 PDB: 1v0p_A* 1v0o_A* 1v0b_A Length = 288 Back     alignment and structure
>1ft9_A Carbon monoxide oxidation system transcription regulator; heme sensor, catabolite gene activator protein; HET: HEM; 2.60A {Rhodospirillum rubrum} SCOP: a.4.5.4 b.82.3.1 Length = 222 Back     alignment and structure
>1ft9_A Carbon monoxide oxidation system transcription regulator; heme sensor, catabolite gene activator protein; HET: HEM; 2.60A {Rhodospirillum rubrum} SCOP: a.4.5.4 b.82.3.1 Length = 222 Back     alignment and structure
>3g33_A Cell division protein kinase 4; Ser/Thr protein kinase, cell cycle, phosphorylation, ATP-BIN cell division, disease mutation, kinase; 3.00A {Homo sapiens} Length = 308 Back     alignment and structure
>2jfr_A Ser-Thr phosphatase MSPP; hydrolase, PPM phosphatase, manganese, phosphate; 0.83A {Mycobacterium smegmatis} PDB: 2jfs_A 2jft_A 2v06_A Length = 234 Back     alignment and structure
>3beh_A MLL3241 protein; transmembrane protein, membrane protein; HET: LDA; 3.10A {Mesorhizobium loti} PDB: 2zd9_A* Length = 355 Back     alignment and structure
>3beh_A MLL3241 protein; transmembrane protein, membrane protein; HET: LDA; 3.10A {Mesorhizobium loti} PDB: 2zd9_A* Length = 355 Back     alignment and structure
>1zyb_A Transcription regulator, CRP family; NP_813211.1, structural genomics, joint center for structura genomics, JCSG; 2.15A {Bacteroides thetaiotaomicron} SCOP: a.4.5.4 b.82.3.2 Length = 232 Back     alignment and structure
>1zyb_A Transcription regulator, CRP family; NP_813211.1, structural genomics, joint center for structura genomics, JCSG; 2.15A {Bacteroides thetaiotaomicron} SCOP: a.4.5.4 b.82.3.2 Length = 232 Back     alignment and structure
>3niz_A Rhodanese family protein; structural genomics, structural genomics consortium, SGC, phosphotransferase, cyclin dependent kinase; HET: ADP; 2.40A {Cryptosporidium parvum} PDB: 2qkr_A* Length = 311 Back     alignment and structure
>4agu_A Cyclin-dependent kinase-like 1; transferase, phospho-mimetic; HET: D15; 2.40A {Homo sapiens} Length = 311 Back     alignment and structure
>2j7t_A Serine/threonine-protein kinase 10; transferase, ATP-binding, cell cycle progression, phosphorylation, disease mutation, nucleotide- binding; HET: 274; 2.0A {Homo sapiens} PDB: 4aot_A* 3zz2_A* 2j51_A* 2jfl_A* 2jfm_A* 2uv2_A* Length = 302 Back     alignment and structure
>4aaa_A Cyclin-dependent kinase-like 2; transferase, phospho-mimetic; HET: DKI; 1.53A {Homo sapiens} Length = 331 Back     alignment and structure
>3nsz_A CK II alpha, casein kinase II subunit alpha; inhibitor, transferase-transferase inhibitor CO; HET: ANP; 1.30A {Homo sapiens} PDB: 2r7i_A 3pe1_A* 1jwh_A* 3pe2_A* 3r0t_A* 3h30_A* 3q9w_A* 3q9x_A* 3q9y_A* 3q9z_A* 3qa0_A 3bqc_A* 2rkp_A* 3c13_A* 3fwq_A 3rps_A* 3mb7_A* 3mb6_A* 3owj_A* 3owk_A* ... Length = 330 Back     alignment and structure
>3o0g_A Cell division protein kinase 5; kinase activator complex, kinase inhibitor complex, transferase-transferase activator complex; HET: 3O0; 1.95A {Homo sapiens} PDB: 1unh_A* 1ung_A* 1unl_A* 1h4l_A Length = 292 Back     alignment and structure
>2j82_A TPPHA, protein serine-threonine phosphatase; PP2C family phosphatase, hydrolase; 1.28A {Synechococcus elongatus} PDB: 2j86_A 2y09_A 2xzv_A Length = 240 Back     alignment and structure
>2vwi_A Serine/threonine-protein kinase OSR1; STE kinase, hypertension, transferase; HET: ANP; 2.15A {Homo sapiens} PDB: 3dak_A* Length = 303 Back     alignment and structure
>3mtl_A Cell division protein kinase 16; pctaire1, indirubin, structural genomics, structural consortium, SGC, transferase; HET: FEF; 2.40A {Homo sapiens} Length = 324 Back     alignment and structure
>2fmy_A COOA, carbon monoxide oxidation system transcription RE COOA-1; DNA transcription regulator, DNA binding protein; HET: HEM; 2.20A {Carboxydothermus hydrogenoformans} PDB: 2hkx_A* Length = 220 Back     alignment and structure
>2fmy_A COOA, carbon monoxide oxidation system transcription RE COOA-1; DNA transcription regulator, DNA binding protein; HET: HEM; 2.20A {Carboxydothermus hydrogenoformans} PDB: 2hkx_A* Length = 220 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>3ttj_A Mitogen-activated protein kinase 10; JNK3, protein kinase in transferase-transferase inhibitor complex; HET: JBI; 2.10A {Homo sapiens} PDB: 3tti_A* 1jnk_A* Length = 464 Back     alignment and structure
>2eva_A TAK1 kinase - TAB1 chimera fusion protein; transferase/transferase activator complex; HET: ADN; 2.00A {Homo sapiens} Length = 307 Back     alignment and structure
>2x7f_A TRAF2 and NCK-interacting protein kinase; serine/threonine-protein kinase, phosphoprotein; HET: 824; 2.80A {Homo sapiens} Length = 326 Back     alignment and structure
>3e6c_C CPRK, cyclic nucleotide-binding protein; CPRK, halorespiration; HET: DNA 3C4; 1.80A {Desulfitobacterium hafniense} SCOP: a.4.5.4 b.82.3.2 PDB: 3e6b_A* 3e5u_C* 3e6d_A 3e5x_A* 3e5q_A 2h6b_A* 2h6c_A Length = 250 Back     alignment and structure
>3e6c_C CPRK, cyclic nucleotide-binding protein; CPRK, halorespiration; HET: DNA 3C4; 1.80A {Desulfitobacterium hafniense} SCOP: a.4.5.4 b.82.3.2 PDB: 3e6b_A* 3e5u_C* 3e6d_A 3e5x_A* 3e5q_A 2h6b_A* 2h6c_A Length = 250 Back     alignment and structure
>1ua2_A CAK, cell division protein kinase 7; cell cycle, phosphorylation, protein-protein interaction, PR kinase, cell cycle, transferase; HET: TPO ATP; 3.02A {Homo sapiens} SCOP: d.144.1.7 Length = 346 Back     alignment and structure
>1u5q_A Serine/threonine protein kinase TAO2; transferase; HET: SEP; 2.10A {Rattus norvegicus} SCOP: d.144.1.7 PDB: 1u5r_A* 2gcd_A* Length = 348 Back     alignment and structure
>3og7_A AKAP9-BRAF fusion protein; proto-oncogene, V600E, kinase, transferase; HET: 032; 2.45A {Homo sapiens} PDB: 3c4c_A* 3c4d_A* 3idp_A* 3ii5_A* 3d4q_A* 3ppj_A* 3ppk_A* 3prf_A* 3pri_A* 3psb_A* 3psd_A* 3q4c_A* 3skc_A* 3tv4_A* 3tv6_A* 2fb8_A* 4dbn_A* 1uwj_A* 1uwh_A* 3q96_A* Length = 289 Back     alignment and structure
>4e7w_A Glycogen synthase kinase 3; GSK3, PTyr195, transferase; HET: PTR; 3.30A {Ustilago maydis} Length = 394 Back     alignment and structure
>2xrw_A Mitogen-activated protein kinase 8; transcription, MAPK signaling pathways, linear binding motif; HET: ANP; 1.33A {Homo sapiens} PDB: 1ukh_A 1uki_A* 2xs0_A* 3elj_A* 2h96_A* 2gmx_A* 2g01_A* 2no3_A* 3o2m_A* 3o17_A* 3pze_A* 3g9l_X* 2p33_A* 3cgf_A* 3cgo_A* 3g90_X* 2ok1_A* 3g9n_A* 1pmn_A* 1pmq_A* ... Length = 371 Back     alignment and structure
>2oz6_A Virulence factor regulator; winged helix, helix-turn-helix, transcription factor, CAMP-B proteins, CAMP receptor protein; HET: CMP; 2.80A {Pseudomonas aeruginosa} SCOP: a.4.5.4 b.82.3.2 Length = 207 Back     alignment and structure
>2oz6_A Virulence factor regulator; winged helix, helix-turn-helix, transcription factor, CAMP-B proteins, CAMP receptor protein; HET: CMP; 2.80A {Pseudomonas aeruginosa} SCOP: a.4.5.4 b.82.3.2 Length = 207 Back     alignment and structure
>3gbz_A Kinase, CMGC CDK; ssgcid, ATP-binding, nucleotide-binding, serine/threonine-protein kinase, transferase; 1.85A {Giardia lamblia} PDB: 3gc0_A* Length = 329 Back     alignment and structure
>3gni_B Strad alpha; kinase fold, pseudokinase, alpha helical repeat protein, ADA protein, ATP-binding, cell cycle, kinase, nucleotide-bindin nucleus; HET: ATP CIT; 2.35A {Homo sapiens} PDB: 2wtk_B* Length = 389 Back     alignment and structure
>3coi_A Mitogen-activated protein kinase 13; P38D, P38delta, ERK, MAP kinase, PMK, STK26, stress-activated protein kinase, structural genomics, PSI; 2.09A {Homo sapiens} Length = 353 Back     alignment and structure
>3kmu_A ILK, integrin-linked kinase; cell adhesion, ANK repeat, ATP-binding, cell junction, cell membrane, integrin-binding protein, membrane, nucleotide- binding; 1.80A {Homo sapiens} PDB: 3kmw_A* 3rep_A* Length = 271 Back     alignment and structure
>2pmi_A Negative RE, cyclin-dependent protein kinase PHO85; cyclin-dependent kinase, signaling protein,transfera cycle complex; HET: MES AGS; 2.90A {Saccharomyces cerevisiae} PDB: 2pk9_A* Length = 317 Back     alignment and structure
>1j1b_A Glycogen synthase kinase-3 beta; complex, TAU, AMPPNP, transferase; HET: ANP; 1.80A {Homo sapiens} SCOP: d.144.1.7 PDB: 1i09_A* 1j1c_A* 2jld_A* 3m1s_A* 3pup_A* 3du8_A* 1pyx_A* 1q41_A* 1q3w_A* 1q3d_A* 1q4l_A* 3q3b_A* 1q5k_A* 3i4b_A* 3l1s_A* 1r0e_A* 3zrk_A* 3zrl_A* 3zrm_A* 4dit_A* ... Length = 420 Back     alignment and structure
>3mi9_A Cell division protein kinase 9; P-TEFB, HIV-1, protein binding; HET: TPO; 2.10A {Homo sapiens} PDB: 3mia_A* 3blh_A* 3blq_A* 3blr_A* 3lq5_A* 3my1_A* 3tn8_A* 3tnh_A* 3tni_A* Length = 351 Back     alignment and structure
>3la7_A Global nitrogen regulator; activator, DNA-binding, transcription, transcription regulation; HET: BOG; 1.90A {Anabaena} PDB: 3la2_A* 3la3_A* 2xko_A* 2xgx_A* 2xhk_A* 2xkp_A* Length = 243 Back     alignment and structure
>3la7_A Global nitrogen regulator; activator, DNA-binding, transcription, transcription regulation; HET: BOG; 1.90A {Anabaena} PDB: 3la2_A* 3la3_A* 2xko_A* 2xgx_A* 2xhk_A* 2xkp_A* Length = 243 Back     alignment and structure
>2zcw_A TTHA1359, transcriptional regulator, FNR/CRP family; stationary phase, DNA-binding, transcription regulation; 1.50A {Thermus thermophilus} Length = 202 Back     alignment and structure
>2zcw_A TTHA1359, transcriptional regulator, FNR/CRP family; stationary phase, DNA-binding, transcription regulation; 1.50A {Thermus thermophilus} Length = 202 Back     alignment and structure
>2fst_X Mitogen-activated protein kinase 14; active mutants, lipids, MAP kinase insertion, autophosphorylation, transferase; HET: BOG; 1.45A {Homo sapiens} PDB: 2fso_X* 2fsl_X* 2fsm_X* 2npq_A* 2bal_A* 2baj_A* 2bak_A* 2baq_A* 2qd9_A* 1ian_A* 2rg5_A* 2rg6_A* 3bv2_A* 3bv3_A* 3bx5_A* 3c5u_A* 3cg2_A* 3l8x_A* 3mvl_A* 3mvm_A* ... Length = 367 Back     alignment and structure
>3p86_A Serine/threonine-protein kinase CTR1; ETR1, ERS1, ETR2, phosphorylation, transferase; HET: STU; 2.50A {Arabidopsis thaliana} PDB: 3ppz_A* Length = 309 Back     alignment and structure
>3rnr_A Stage II sporulation E family protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; HET: MSE; 2.00A {Thermanaerovibrio acidaminovorans} Length = 211 Back     alignment and structure
>1cm8_A Phosphorylated MAP kinase P38-gamma; phosphorylation, transferase; HET: TPO PTR ANP; 2.40A {Homo sapiens} SCOP: d.144.1.7 Length = 367 Back     alignment and structure
>3eb0_A Putative uncharacterized protein; kinase cryptosporidium parvum, ATP-binding, kinase, nucleoti binding; HET: PTR DRK; 2.65A {Cryptosporidium parvum iowa II} Length = 383 Back     alignment and structure
>3cf6_E RAP guanine nucleotide exchange factor (GEF) 4; EPAC, rapgef4, CAMP, SP-camps, GEF, gunanine nucleotide exchange factor, G-protein, GTP-binding, nucleotide-binding; HET: SP1; 2.20A {Mus musculus} Length = 694 Back     alignment and structure
>2i6l_A Mitogen-activated protein kinase 6; MAPK6, ERK3, extracellular signal regulated kinase 3, serine phosphorylation, threonine phosphorylation; 2.25A {Homo sapiens} Length = 320 Back     alignment and structure
>3b02_A Transcriptional regulator, CRP family; structural genomics, riken structural genomics/proteomics in RSGI; 1.92A {Thermus thermophilus} PDB: 2zdb_A Length = 195 Back     alignment and structure
>3b02_A Transcriptional regulator, CRP family; structural genomics, riken structural genomics/proteomics in RSGI; 1.92A {Thermus thermophilus} PDB: 2zdb_A Length = 195 Back     alignment and structure
>3dtc_A Mitogen-activated protein kinase kinase kinase 9; mixed-lineage kinase, MLK family, MLK1 and MLK3 subtype selective inhibitors; HET: VIN; 2.60A {Homo sapiens} Length = 271 Back     alignment and structure
>3e3p_A Protein kinase, putative glycogen synthase kinase; leishmaniasis, transferase; 2.00A {Leishmania major} Length = 360 Back     alignment and structure
>3pg1_A Mitogen-activated protein kinase, putative (MAP K protein); EPK Ser/Thr protein kinase fold, Ser/Thr protein kinase, TRA; 1.95A {Leishmania major} Length = 362 Back     alignment and structure
>2y4i_B KSR2, HKSR2, kinase suppressor of RAS 2; transferase, KSR1; HET: ATP; 3.46A {Homo sapiens} Length = 319 Back     alignment and structure
>4f0f_A Serine/threonine-protein kinase ROCO4; LRRK2, ATP-binding, nucleotide serine/threonine-protein kinase, transferase, signaling Pro; HET: ACP; 1.80A {Dictyostelium discoideum} PDB: 4f0g_A 4f1t_A* 4f1m_A* 4f1o_A* Length = 287 Back     alignment and structure
>3dn7_A Cyclic nucleotide binding regulatory protein; structural genomics, APC88869, cyclic nucleotide binding REG protein, PSI-2; 1.80A {Cytophaga hutchinsonii} Length = 194 Back     alignment and structure
>3qyz_A Mitogen-activated protein kinase 1; transferase, serine/threonine-protein kinase, ATP-binding CE phosphorylation; HET: CME Z8B SO4; 1.46A {Rattus norvegicus} PDB: 2fys_B 1erk_A* 3qyi_A* 3erk_A* 3qyw_A* 4erk_A* 2z7l_A* 2erk_A* 1gol_A* 2gph_A 3o71_A 3r63_A 3c9w_A* 2y9q_A* 3sa0_A* 1wzy_A* 2e14_A* 1tvo_A* 2ojg_A* 2oji_A* ... Length = 364 Back     alignment and structure
>1wak_A Serine/threonine-protein kinase SPRK1; SRPK, transferase, alternative splicing, ATP-binding, chromosome partition, differentiation, mRNA processing; 1.73A {Homo sapiens} PDB: 1wbp_A* 3beg_A* 2x7g_A* Length = 397 Back     alignment and structure
>2bgc_A PRFA; bacterial infection, human pathogen, transcriptional regulat transcription; HET: PR3; 2.3A {Listeria monocytogenes} SCOP: a.4.5.4 b.82.3.3 PDB: 2beo_A* 1omi_A Length = 238 Back     alignment and structure
>2bgc_A PRFA; bacterial infection, human pathogen, transcriptional regulat transcription; HET: PR3; 2.3A {Listeria monocytogenes} SCOP: a.4.5.4 b.82.3.3 PDB: 2beo_A* 1omi_A Length = 238 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

No hit with probability above 80.00

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 1082
d1uu3a_288 d.144.1.7 (A:) 3-phosphoinositide dependent protei 2e-47
d2j4za1263 d.144.1.7 (A:126-388) Aurora-related kinase 1 (aur 3e-46
d1fota_316 d.144.1.7 (A:) cAMP-dependent PK, catalytic subuni 2e-45
d1rdqe_350 d.144.1.7 (E:) cAMP-dependent PK, catalytic subuni 4e-45
d1o6la_337 d.144.1.7 (A:) Pkb kinase (Akt-2) {Human (Homo sap 5e-45
d1omwa3364 d.144.1.7 (A:186-549) G-protein coupled receptor k 3e-43
d1xjda_320 d.144.1.7 (A:) Protein kinase C, theta type {Human 1e-42
d1vzoa_322 d.144.1.7 (A:) Ribosomal protein S6 kinase alpha 5 6e-41
d1koaa2350 d.144.1.7 (A:5915-6264) Twitchin, kinase domain {C 1e-39
d1koba_352 d.144.1.7 (A:) Twitchin, kinase domain {California 1e-38
d1phka_277 d.144.1.7 (A:) gamma-subunit of glycogen phosphory 2e-37
d1yhwa1293 d.144.1.7 (A:249-541) pak1 {Human (Homo sapiens) [ 2e-36
d1xwsa_273 d.144.1.7 (A:) Proto-oncogene serine/threonine-pro 9e-36
d2jfla1288 d.144.1.7 (A:21-308) STE20-like serine/threonine-p 1e-35
d1jksa_293 d.144.1.7 (A:) Death-associated protein kinase, Da 2e-35
d1nvra_271 d.144.1.7 (A:) Cell cycle checkpoint kinase chk1 { 4e-35
d1a06a_307 d.144.1.7 (A:) Calmodulin-dependent protein kinase 1e-34
d1t4ha_270 d.144.1.7 (A:) Protein kinase wnk1 {Human (Homo sa 3e-33
d1s9ja_322 d.144.1.7 (A:) Dual specificity mitogen-activated 2e-32
d2java1269 d.144.1.7 (A:3-271) Serine/threonine-protein kinas 1e-31
d2ozaa1335 d.144.1.7 (A:51-385) MAP kinase activated protein 2e-31
d1tkia_321 d.144.1.7 (A:) Titin, kinase domain {Human (Homo s 2e-31
d1u5ra_309 d.144.1.7 (A:) Serine/threonine protein kinase TAO 9e-31
d1ob3a_286 d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {(Plasmod 6e-30
d1o6ya_277 d.144.1.7 (A:) Mycobacterial protein kinase PknB, 2e-29
d1xbba_277 d.144.1.7 (A:) Tyrosine-protein kinase SYK {Human 2e-29
d1cm8a_346 d.144.1.7 (A:) MAP kinase p38-gamma {Human (Homo s 1e-28
d1a6qa2295 d.219.1.1 (A:2-296) Protein serine/threonine phosp 2e-28
d1blxa_305 d.144.1.7 (A:) Cyclin-dependent PK, CDK6 {Human (H 3e-28
d1gz8a_298 d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {Human (H 3e-28
d1pmea_345 d.144.1.7 (A:) MAP kinase Erk2 {Human (Homo sapien 5e-28
d3bqca1328 d.144.1.7 (A:3-330) Protein kinase CK2, alpha subu 7e-28
d1ua2a_299 d.144.1.7 (A:) Cell division protein kinase 7, CDK 8e-27
d1byga_262 d.144.1.7 (A:) Carboxyl-terminal src kinase (csk) 1e-26
d1q5ka_350 d.144.1.7 (A:) Glycogen synthase kinase-3 beta (Gs 4e-26
d1ckia_299 d.144.1.7 (A:) Casein kinase-1, CK1 {Rat (Rattus n 1e-25
d1uwha_276 d.144.1.7 (A:) B-Raf kinase {Human (Homo sapiens) 1e-25
d1k2pa_258 d.144.1.7 (A:) Bruton's tyrosine kinase (Btk) {Hum 1e-24
d1u59a_285 d.144.1.7 (A:) Tyrosine-protein kinase ZAP-70 {Hum 1e-24
d3blha1318 d.144.1.7 (A:8-325) Cell division protein kinase 9 2e-24
d1unla_292 d.144.1.7 (A:) Cyclin-dependent PK, CDK5 {Human (H 9e-24
d1csna_293 d.144.1.7 (A:) Casein kinase-1, CK1 {Fission yeast 9e-24
d2gfsa1348 d.144.1.7 (A:5-352) MAP kinase p38 {Human (Homo sa 2e-23
d1u46a_273 d.144.1.7 (A:) Activated CDC42 kinase 1, ACK1 {Hum 3e-23
d1ne6a1136 b.82.3.2 (A:109-244) Regulatory subunit of Protein 8e-23
d1ne6a1136 b.82.3.2 (A:109-244) Regulatory subunit of Protein 2e-07
d1qpca_272 d.144.1.7 (A:) Lymphocyte kinase (lck) {Human (Hom 1e-22
d2b1pa1355 d.144.1.7 (A:46-400) c-jun N-terminal kinase (jnk3 2e-22
d1opja_287 d.144.1.7 (A:) Abelsone tyrosine kinase (abl) {Mou 3e-22
d1sm2a_263 d.144.1.7 (A:) Tyrosine-protein kinase Itk/Tsk {Hu 3e-22
d1mp8a_273 d.144.1.7 (A:) Focal adhesion kinase 1 (fak) {Huma 3e-22
d1cx4a1136 b.82.3.2 (A:130-265) Regulatory subunit of Protein 5e-22
d1lufa_301 d.144.1.7 (A:) Musk tyrosine kinase {Rat (Rattus n 6e-22
d1fmka3285 d.144.1.7 (A:249-533) c-src tyrosine kinase {Human 9e-22
d1fvra_309 d.144.1.7 (A:) Tie2 kinase {Human (Homo sapiens) [ 1e-21
d1jpaa_299 d.144.1.7 (A:) ephb2 receptor tyrosine kinase {Mou 1e-21
d1rjba_325 d.144.1.7 (A:) Fl cytokine receptor {Human (Homo s 2e-21
d1fgka_299 d.144.1.7 (A:) Fibroblast growth factor receptor 1 3e-21
d1xkka_317 d.144.1.7 (A:) EGF receptor tyrosine kinase, Erbb- 4e-21
d1mqba_283 d.144.1.7 (A:) epha2 receptor tyrosine kinase {Hum 7e-20
d1t46a_311 d.144.1.7 (A:) c-KIT receptor {Human (Homo sapiens 8e-20
d1ywna1299 d.144.1.7 (A:818-1166) Vascular endothelial growth 4e-19
d1r0pa_311 d.144.1.7 (A:) Hepatocyte growth factor receptor, 5e-19
d1q8ya_362 d.144.1.7 (A:) Sky1p {Baker's yeast (Saccharomyces 6e-19
d1p4oa_308 d.144.1.7 (A:) Insulin-like growth factor 1 recept 7e-19
d1txoa_235 d.219.1.1 (A:) putative serine/threonine phosphata 2e-16
d1cx4a2147 b.82.3.2 (A:266-412) Regulatory subunit of Protein 2e-15
d1cx4a2147 b.82.3.2 (A:266-412) Regulatory subunit of Protein 2e-12
d1ne6a2132 b.82.3.2 (A:245-376) Regulatory subunit of Protein 3e-14
d1ne6a2132 b.82.3.2 (A:245-376) Regulatory subunit of Protein 2e-09
d1o7fa2155 b.82.3.2 (A:13-167) Regulatory domain of Epac2, do 2e-13
d1o7fa3124 b.82.3.2 (A:322-445) Regulatory domain of Epac2, d 5e-13
d1o7fa3124 b.82.3.2 (A:322-445) Regulatory domain of Epac2, d 5e-04
d1vjya_303 d.144.1.7 (A:) Type I TGF-beta receptor R4 {Human 2e-12
d1i5za2132 b.82.3.2 (A:6-137) Catabolite gene activator prote 3e-12
d1i5za2132 b.82.3.2 (A:6-137) Catabolite gene activator prote 5e-04
d2gaua2142 b.82.3.2 (A:10-151) Transcriptional regulator PG03 3e-10
d2gaua2142 b.82.3.2 (A:10-151) Transcriptional regulator PG03 6e-04
d1wgpa_137 b.82.3.2 (A:) Probable cyclic nucleotide-gated ion 1e-09
d1vp6a_133 b.82.3.2 (A:) Putative ion channel CnbD {Mesorhizo 3e-09
d1vp6a_133 b.82.3.2 (A:) Putative ion channel CnbD {Mesorhizo 2e-04
d2oz6a2134 b.82.3.2 (A:9-142) Cyclic AMP receptor-like protei 1e-08
d1o5la1129 b.82.3.2 (A:1-129) CRP-like transcriptional regula 8e-07
d1q3ea_193 b.82.3.2 (A:) HCN pacemaker channel {Mouse (Mus mu 9e-07
d2zcwa2112 b.82.3.2 (A:6-117) Transcriptional regulator TTHA1 1e-05
>d1uu3a_ d.144.1.7 (A:) 3-phosphoinositide dependent protein kinase-1 Pdk1 {Human (Homo sapiens) [TaxId: 9606]} Length = 288 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: Protein kinase-like (PK-like)
superfamily: Protein kinase-like (PK-like)
family: Protein kinases, catalytic subunit
domain: 3-phosphoinositide dependent protein kinase-1 Pdk1
species: Human (Homo sapiens) [TaxId: 9606]

 Score =  169 bits (428), Expect = 2e-47
 Identities = 75/262 (28%), Positives = 125/262 (47%), Gaps = 12/262 (4%)

Query: 787  LVLLRDSENFLSLKRFSKQKVKCLGKEVQVLKEKNLMKSVSPSACVPQILCTCADSMHAG 846
            L     +    ++K   K+ +    K   V +E+++M  +       ++  T  D     
Sbjct: 26   LARELATSREYAIKILEKRHIIKENKVPYVTRERDVMSRLD-HPFFVKLYFTFQDDEKLY 84

Query: 847  LLLNTYLACPLASILHT--PLDEQSARFCAASVVAALEDLHKRGVLYRGVSPDVLMLDKS 904
              L+      L   +      DE   RF  A +V+ALE LH +G+++R + P+ ++L++ 
Sbjct: 85   FGLSYAKNGELLKYIRKIGSFDETCTRFYTAEIVSALEYLHGKGIIHRDLKPENILLNED 144

Query: 905  GHLQLVDFRFGK----GLSGNRTFTICGMADYLAPEIVQGKGHGLAADWWALGVLIYFML 960
             H+Q+ DF   K         R  +  G A Y++PE++  K    ++D WALG +IY ++
Sbjct: 145  MHIQITDFGTAKVLSPESKQARANSFVGTAQYVSPELLTEKSACKSSDLWALGCIIYQLV 204

Query: 961  QGEMPFGSWRESEIDIVAKIAKGQLSLPQNLSPEAVDLLTKLLVVDENTRLGSQ---GPT 1017
             G  PF     +E  I  KI K +   P+   P+A DL+ KLLV+D   RLG +   G  
Sbjct: 205  AGLPPF--RAGNEYLIFQKIIKLEYDFPEKFFPKARDLVEKLLVLDATKRLGCEEMEGYG 262

Query: 1018 SVKTHPWFRDVDWKGIAESTSP 1039
             +K HP+F  V W+ + + T P
Sbjct: 263  PLKAHPFFESVTWENLHQQTPP 284
>d2j4za1 d.144.1.7 (A:126-388) Aurora-related kinase 1 (aurora-2) {Human (Homo sapiens) [TaxId: 9606]} Length = 263 Back     information, alignment and structure
>d1fota_ d.144.1.7 (A:) cAMP-dependent PK, catalytic subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 316 Back     information, alignment and structure
>d1rdqe_ d.144.1.7 (E:) cAMP-dependent PK, catalytic subunit {Mouse (Mus musculus) [TaxId: 10090]} Length = 350 Back     information, alignment and structure
>d1o6la_ d.144.1.7 (A:) Pkb kinase (Akt-2) {Human (Homo sapiens) [TaxId: 9606]} Length = 337 Back     information, alignment and structure
>d1omwa3 d.144.1.7 (A:186-549) G-protein coupled receptor kinase 2 {Cow (Bos taurus) [TaxId: 9913]} Length = 364 Back     information, alignment and structure
>d1xjda_ d.144.1.7 (A:) Protein kinase C, theta type {Human (Homo sapiens) [TaxId: 9606]} Length = 320 Back     information, alignment and structure
>d1vzoa_ d.144.1.7 (A:) Ribosomal protein S6 kinase alpha 5, Msk1 {Human (Homo sapiens) [TaxId: 9606]} Length = 322 Back     information, alignment and structure
>d1koaa2 d.144.1.7 (A:5915-6264) Twitchin, kinase domain {Caenorhabditis elegans, pjk4 [TaxId: 6239]} Length = 350 Back     information, alignment and structure
>d1koba_ d.144.1.7 (A:) Twitchin, kinase domain {California sea hare (Aplysia californica), twk43 [TaxId: 6500]} Length = 352 Back     information, alignment and structure
>d1phka_ d.144.1.7 (A:) gamma-subunit of glycogen phosphorylase kinase (Phk) {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Length = 277 Back     information, alignment and structure
>d1yhwa1 d.144.1.7 (A:249-541) pak1 {Human (Homo sapiens) [TaxId: 9606]} Length = 293 Back     information, alignment and structure
>d1xwsa_ d.144.1.7 (A:) Proto-oncogene serine/threonine-protein kinase Pim-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 273 Back     information, alignment and structure
>d2jfla1 d.144.1.7 (A:21-308) STE20-like serine/threonine-protein kinase, SLK {Human (Homo sapiens) [TaxId: 9606]} Length = 288 Back     information, alignment and structure
>d1jksa_ d.144.1.7 (A:) Death-associated protein kinase, Dap {Human (Homo sapiens) [TaxId: 9606]} Length = 293 Back     information, alignment and structure
>d1nvra_ d.144.1.7 (A:) Cell cycle checkpoint kinase chk1 {Human (Homo sapiens) [TaxId: 9606]} Length = 271 Back     information, alignment and structure
>d1a06a_ d.144.1.7 (A:) Calmodulin-dependent protein kinase {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 307 Back     information, alignment and structure
>d1t4ha_ d.144.1.7 (A:) Protein kinase wnk1 {Human (Homo sapiens) [TaxId: 9606]} Length = 270 Back     information, alignment and structure
>d1s9ja_ d.144.1.7 (A:) Dual specificity mitogen-activated protein kinase kinase 1, Mek1 {Human (Homo sapiens) [TaxId: 9606]} Length = 322 Back     information, alignment and structure
>d2java1 d.144.1.7 (A:3-271) Serine/threonine-protein kinase Nek2 {Human (Homo sapiens) [TaxId: 9606]} Length = 269 Back     information, alignment and structure
>d2ozaa1 d.144.1.7 (A:51-385) MAP kinase activated protein kinase 2, mapkap2 {Human (Homo sapiens) [TaxId: 9606]} Length = 335 Back     information, alignment and structure
>d1tkia_ d.144.1.7 (A:) Titin, kinase domain {Human (Homo sapiens) [TaxId: 9606]} Length = 321 Back     information, alignment and structure
>d1u5ra_ d.144.1.7 (A:) Serine/threonine protein kinase TAO2 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 309 Back     information, alignment and structure
>d1ob3a_ d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {(Plasmodium falciparum) [TaxId: 5833]} Length = 286 Back     information, alignment and structure
>d1o6ya_ d.144.1.7 (A:) Mycobacterial protein kinase PknB, catalytic domain {Mycobacterium tuberculosis [TaxId: 1773]} Length = 277 Back     information, alignment and structure
>d1xbba_ d.144.1.7 (A:) Tyrosine-protein kinase SYK {Human (Homo sapiens) [TaxId: 9606]} Length = 277 Back     information, alignment and structure
>d1cm8a_ d.144.1.7 (A:) MAP kinase p38-gamma {Human (Homo sapiens) [TaxId: 9606]} Length = 346 Back     information, alignment and structure
>d1a6qa2 d.219.1.1 (A:2-296) Protein serine/threonine phosphatase 2C, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} Length = 295 Back     information, alignment and structure
>d1blxa_ d.144.1.7 (A:) Cyclin-dependent PK, CDK6 {Human (Homo sapiens) [TaxId: 9606]} Length = 305 Back     information, alignment and structure
>d1gz8a_ d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {Human (Homo sapiens) [TaxId: 9606]} Length = 298 Back     information, alignment and structure
>d1pmea_ d.144.1.7 (A:) MAP kinase Erk2 {Human (Homo sapiens) [TaxId: 9606]} Length = 345 Back     information, alignment and structure
>d3bqca1 d.144.1.7 (A:3-330) Protein kinase CK2, alpha subunit {Rattus norvegicus [TaxId: 10116]} Length = 328 Back     information, alignment and structure
>d1ua2a_ d.144.1.7 (A:) Cell division protein kinase 7, CDK7 {Human (Homo sapiens) [TaxId: 9606]} Length = 299 Back     information, alignment and structure
>d1byga_ d.144.1.7 (A:) Carboxyl-terminal src kinase (csk) {Human (Homo sapiens) [TaxId: 9606]} Length = 262 Back     information, alignment and structure
>d1q5ka_ d.144.1.7 (A:) Glycogen synthase kinase-3 beta (Gsk3b) {Human (Homo sapiens) [TaxId: 9606]} Length = 350 Back     information, alignment and structure
>d1ckia_ d.144.1.7 (A:) Casein kinase-1, CK1 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 299 Back     information, alignment and structure
>d1uwha_ d.144.1.7 (A:) B-Raf kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 276 Back     information, alignment and structure
>d1k2pa_ d.144.1.7 (A:) Bruton's tyrosine kinase (Btk) {Human (Homo sapiens) [TaxId: 9606]} Length = 258 Back     information, alignment and structure
>d1u59a_ d.144.1.7 (A:) Tyrosine-protein kinase ZAP-70 {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d3blha1 d.144.1.7 (A:8-325) Cell division protein kinase 9, CDK9 {Human (Homo sapiens) [TaxId: 9606]} Length = 318 Back     information, alignment and structure
>d1unla_ d.144.1.7 (A:) Cyclin-dependent PK, CDK5 {Human (Homo sapiens) [TaxId: 9606]} Length = 292 Back     information, alignment and structure
>d1csna_ d.144.1.7 (A:) Casein kinase-1, CK1 {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 293 Back     information, alignment and structure
>d2gfsa1 d.144.1.7 (A:5-352) MAP kinase p38 {Human (Homo sapiens) [TaxId: 9606]} Length = 348 Back     information, alignment and structure
>d1u46a_ d.144.1.7 (A:) Activated CDC42 kinase 1, ACK1 {Human (Homo sapiens) [TaxId: 9606]} Length = 273 Back     information, alignment and structure
>d1ne6a1 b.82.3.2 (A:109-244) Regulatory subunit of Protein kinase A {Cow (Bos taurus) [TaxId: 9913]} Length = 136 Back     information, alignment and structure
>d1ne6a1 b.82.3.2 (A:109-244) Regulatory subunit of Protein kinase A {Cow (Bos taurus) [TaxId: 9913]} Length = 136 Back     information, alignment and structure
>d1qpca_ d.144.1.7 (A:) Lymphocyte kinase (lck) {Human (Homo sapiens) [TaxId: 9606]} Length = 272 Back     information, alignment and structure
>d2b1pa1 d.144.1.7 (A:46-400) c-jun N-terminal kinase (jnk3s) {Human (Homo sapiens) [TaxId: 9606]} Length = 355 Back     information, alignment and structure
>d1opja_ d.144.1.7 (A:) Abelsone tyrosine kinase (abl) {Mouse (Mus musculus) [TaxId: 10090]} Length = 287 Back     information, alignment and structure
>d1sm2a_ d.144.1.7 (A:) Tyrosine-protein kinase Itk/Tsk {Human (Homo sapiens) [TaxId: 9606]} Length = 263 Back     information, alignment and structure
>d1mp8a_ d.144.1.7 (A:) Focal adhesion kinase 1 (fak) {Human (Homo sapiens) [TaxId: 9606]} Length = 273 Back     information, alignment and structure
>d1cx4a1 b.82.3.2 (A:130-265) Regulatory subunit of Protein kinase A {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 136 Back     information, alignment and structure
>d1lufa_ d.144.1.7 (A:) Musk tyrosine kinase {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 301 Back     information, alignment and structure
>d1fmka3 d.144.1.7 (A:249-533) c-src tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1fvra_ d.144.1.7 (A:) Tie2 kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 309 Back     information, alignment and structure
>d1jpaa_ d.144.1.7 (A:) ephb2 receptor tyrosine kinase {Mouse (Mus musculus) [TaxId: 10090]} Length = 299 Back     information, alignment and structure
>d1rjba_ d.144.1.7 (A:) Fl cytokine receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 325 Back     information, alignment and structure
>d1fgka_ d.144.1.7 (A:) Fibroblast growth factor receptor 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 299 Back     information, alignment and structure
>d1xkka_ d.144.1.7 (A:) EGF receptor tyrosine kinase, Erbb-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 317 Back     information, alignment and structure
>d1mqba_ d.144.1.7 (A:) epha2 receptor tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 283 Back     information, alignment and structure
>d1t46a_ d.144.1.7 (A:) c-KIT receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 311 Back     information, alignment and structure
>d1ywna1 d.144.1.7 (A:818-1166) Vascular endothelial growth factor receptor 2 (kdr) {Human (Homo sapiens) [TaxId: 9606]} Length = 299 Back     information, alignment and structure
>d1r0pa_ d.144.1.7 (A:) Hepatocyte growth factor receptor, c-MET {Human (Homo sapiens) [TaxId: 9606]} Length = 311 Back     information, alignment and structure
>d1q8ya_ d.144.1.7 (A:) Sky1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 362 Back     information, alignment and structure
>d1p4oa_ d.144.1.7 (A:) Insulin-like growth factor 1 receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 308 Back     information, alignment and structure
>d1txoa_ d.219.1.1 (A:) putative serine/threonine phosphatase pstp/ppp {Mycobacterium tuberculosis [TaxId: 1773]} Length = 235 Back     information, alignment and structure
>d1cx4a2 b.82.3.2 (A:266-412) Regulatory subunit of Protein kinase A {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 147 Back     information, alignment and structure
>d1cx4a2 b.82.3.2 (A:266-412) Regulatory subunit of Protein kinase A {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 147 Back     information, alignment and structure
>d1ne6a2 b.82.3.2 (A:245-376) Regulatory subunit of Protein kinase A {Cow (Bos taurus) [TaxId: 9913]} Length = 132 Back     information, alignment and structure
>d1ne6a2 b.82.3.2 (A:245-376) Regulatory subunit of Protein kinase A {Cow (Bos taurus) [TaxId: 9913]} Length = 132 Back     information, alignment and structure
>d1o7fa2 b.82.3.2 (A:13-167) Regulatory domain of Epac2, domains 1 and 3 {Mouse (Mus musculus) [TaxId: 10090]} Length = 155 Back     information, alignment and structure
>d1o7fa3 b.82.3.2 (A:322-445) Regulatory domain of Epac2, domains 1 and 3 {Mouse (Mus musculus) [TaxId: 10090]} Length = 124 Back     information, alignment and structure
>d1o7fa3 b.82.3.2 (A:322-445) Regulatory domain of Epac2, domains 1 and 3 {Mouse (Mus musculus) [TaxId: 10090]} Length = 124 Back     information, alignment and structure
>d1vjya_ d.144.1.7 (A:) Type I TGF-beta receptor R4 {Human (Homo sapiens) [TaxId: 9606]} Length = 303 Back     information, alignment and structure
>d1i5za2 b.82.3.2 (A:6-137) Catabolite gene activator protein, N-terminal domain {Escherichia coli [TaxId: 562]} Length = 132 Back     information, alignment and structure
>d1i5za2 b.82.3.2 (A:6-137) Catabolite gene activator protein, N-terminal domain {Escherichia coli [TaxId: 562]} Length = 132 Back     information, alignment and structure
>d2gaua2 b.82.3.2 (A:10-151) Transcriptional regulator PG0396, N-terminal domain {Porphyromonas gingivalis [TaxId: 837]} Length = 142 Back     information, alignment and structure
>d2gaua2 b.82.3.2 (A:10-151) Transcriptional regulator PG0396, N-terminal domain {Porphyromonas gingivalis [TaxId: 837]} Length = 142 Back     information, alignment and structure
>d1wgpa_ b.82.3.2 (A:) Probable cyclic nucleotide-gated ion channel 6 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 137 Back     information, alignment and structure
>d1vp6a_ b.82.3.2 (A:) Putative ion channel CnbD {Mesorhizobium loti [TaxId: 381]} Length = 133 Back     information, alignment and structure
>d1vp6a_ b.82.3.2 (A:) Putative ion channel CnbD {Mesorhizobium loti [TaxId: 381]} Length = 133 Back     information, alignment and structure
>d2oz6a2 b.82.3.2 (A:9-142) Cyclic AMP receptor-like protein Vfr {Pseudomonas aeruginosa [TaxId: 287]} Length = 134 Back     information, alignment and structure
>d1o5la1 b.82.3.2 (A:1-129) CRP-like transcriptional regulator TM1171, N-terminal domain {Thermotoga maritima [TaxId: 2336]} Length = 129 Back     information, alignment and structure
>d1q3ea_ b.82.3.2 (A:) HCN pacemaker channel {Mouse (Mus musculus) [TaxId: 10090]} Length = 193 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query1082
d1o6la_337 Pkb kinase (Akt-2) {Human (Homo sapiens) [TaxId: 9 100.0
d1rdqe_350 cAMP-dependent PK, catalytic subunit {Mouse (Mus m 100.0
d1fota_316 cAMP-dependent PK, catalytic subunit {Baker's yeas 100.0
d1uu3a_288 3-phosphoinositide dependent protein kinase-1 Pdk1 100.0
d1omwa3364 G-protein coupled receptor kinase 2 {Cow (Bos taur 100.0
d1xjda_320 Protein kinase C, theta type {Human (Homo sapiens) 100.0
d2j4za1263 Aurora-related kinase 1 (aurora-2) {Human (Homo sa 100.0
d1koaa2350 Twitchin, kinase domain {Caenorhabditis elegans, p 100.0
d1koba_352 Twitchin, kinase domain {California sea hare (Aply 100.0
d1a6qa2295 Protein serine/threonine phosphatase 2C, catalytic 100.0
d1jksa_293 Death-associated protein kinase, Dap {Human (Homo 100.0
d1yhwa1293 pak1 {Human (Homo sapiens) [TaxId: 9606]} 100.0
d1s9ja_322 Dual specificity mitogen-activated protein kinase 100.0
d1a06a_307 Calmodulin-dependent protein kinase {Rat (Rattus n 100.0
d1nvra_271 Cell cycle checkpoint kinase chk1 {Human (Homo sap 100.0
d2java1269 Serine/threonine-protein kinase Nek2 {Human (Homo 100.0
d1vzoa_322 Ribosomal protein S6 kinase alpha 5, Msk1 {Human ( 100.0
d2jfla1288 STE20-like serine/threonine-protein kinase, SLK {H 100.0
d1u5ra_309 Serine/threonine protein kinase TAO2 {Rat (Rattus 100.0
d1phka_277 gamma-subunit of glycogen phosphorylase kinase (Ph 100.0
d1tkia_321 Titin, kinase domain {Human (Homo sapiens) [TaxId: 100.0
d1t4ha_270 Protein kinase wnk1 {Human (Homo sapiens) [TaxId: 100.0
d1xwsa_273 Proto-oncogene serine/threonine-protein kinase Pim 100.0
d2ozaa1335 MAP kinase activated protein kinase 2, mapkap2 {Hu 100.0
d1gz8a_298 Cyclin-dependent PK, CDK2 {Human (Homo sapiens) [T 100.0
d1ua2a_299 Cell division protein kinase 7, CDK7 {Human (Homo 100.0
d1blxa_305 Cyclin-dependent PK, CDK6 {Human (Homo sapiens) [T 100.0
d3bqca1328 Protein kinase CK2, alpha subunit {Rattus norvegic 100.0
d1rjba_325 Fl cytokine receptor {Human (Homo sapiens) [TaxId: 100.0
d1cm8a_346 MAP kinase p38-gamma {Human (Homo sapiens) [TaxId: 100.0
d1o6ya_277 Mycobacterial protein kinase PknB, catalytic domai 100.0
d1ob3a_286 Cyclin-dependent PK, CDK2 {(Plasmodium falciparum) 100.0
d1opja_287 Abelsone tyrosine kinase (abl) {Mouse (Mus musculu 100.0
d1q5ka_350 Glycogen synthase kinase-3 beta (Gsk3b) {Human (Ho 100.0
d3blha1318 Cell division protein kinase 9, CDK9 {Human (Homo 100.0
d1jpaa_299 ephb2 receptor tyrosine kinase {Mouse (Mus musculu 100.0
d2gfsa1348 MAP kinase p38 {Human (Homo sapiens) [TaxId: 9606] 100.0
d1u59a_285 Tyrosine-protein kinase ZAP-70 {Human (Homo sapien 100.0
d1pmea_345 MAP kinase Erk2 {Human (Homo sapiens) [TaxId: 9606 100.0
d1unla_292 Cyclin-dependent PK, CDK5 {Human (Homo sapiens) [T 100.0
d2b1pa1355 c-jun N-terminal kinase (jnk3s) {Human (Homo sapie 100.0
d1xbba_277 Tyrosine-protein kinase SYK {Human (Homo sapiens) 100.0
d1sm2a_263 Tyrosine-protein kinase Itk/Tsk {Human (Homo sapie 100.0
d1qpca_272 Lymphocyte kinase (lck) {Human (Homo sapiens) [Tax 100.0
d1fmka3285 c-src tyrosine kinase {Human (Homo sapiens) [TaxId 100.0
d1k2pa_258 Bruton's tyrosine kinase (Btk) {Human (Homo sapien 100.0
d1fvra_309 Tie2 kinase {Human (Homo sapiens) [TaxId: 9606]} 100.0
d1ywna1299 Vascular endothelial growth factor receptor 2 (kdr 100.0
d1xkka_317 EGF receptor tyrosine kinase, Erbb-1 {Human (Homo 100.0
d1uwha_276 B-Raf kinase {Human (Homo sapiens) [TaxId: 9606]} 100.0
d1mqba_283 epha2 receptor tyrosine kinase {Human (Homo sapien 100.0
d1u46a_273 Activated CDC42 kinase 1, ACK1 {Human (Homo sapien 100.0
d1fgka_299 Fibroblast growth factor receptor 1 {Human (Homo s 100.0
d1mp8a_273 Focal adhesion kinase 1 (fak) {Human (Homo sapiens 100.0
d1lufa_301 Musk tyrosine kinase {Rat (Rattus norvegicus) [Tax 100.0
d1t46a_311 c-KIT receptor {Human (Homo sapiens) [TaxId: 9606] 100.0
d1ckia_299 Casein kinase-1, CK1 {Rat (Rattus norvegicus) [Tax 100.0
d1p4oa_308 Insulin-like growth factor 1 receptor {Human (Homo 100.0
d1byga_262 Carboxyl-terminal src kinase (csk) {Human (Homo sa 100.0
d1csna_293 Casein kinase-1, CK1 {Fission yeast (Schizosacchar 100.0
d1r0pa_311 Hepatocyte growth factor receptor, c-MET {Human (H 100.0
d1q8ya_362 Sky1p {Baker's yeast (Saccharomyces cerevisiae) [T 100.0
d1txoa_235 putative serine/threonine phosphatase pstp/ppp {My 100.0
d1vjya_303 Type I TGF-beta receptor R4 {Human (Homo sapiens) 100.0
d1cx4a1136 Regulatory subunit of Protein kinase A {Rat (Rattu 99.92
d1zara2191 Rio2 serine protein kinase C-terminal domain {Arch 99.89
d1ne6a1136 Regulatory subunit of Protein kinase A {Cow (Bos t 99.89
d1o7fa2155 Regulatory domain of Epac2, domains 1 and 3 {Mouse 99.88
d1cx4a2147 Regulatory subunit of Protein kinase A {Rat (Rattu 99.86
d1ne6a2132 Regulatory subunit of Protein kinase A {Cow (Bos t 99.86
d1o7fa3124 Regulatory domain of Epac2, domains 1 and 3 {Mouse 99.84
d1q3ea_193 HCN pacemaker channel {Mouse (Mus musculus) [TaxId 99.81
d1zyba2147 Probable transcription regulator BT4300, N-termina 99.81
d1wgpa_137 Probable cyclic nucleotide-gated ion channel 6 {Th 99.8
d1cx4a2147 Regulatory subunit of Protein kinase A {Rat (Rattu 99.79
d1vp6a_133 Putative ion channel CnbD {Mesorhizobium loti [Tax 99.79
d1ne6a2132 Regulatory subunit of Protein kinase A {Cow (Bos t 99.78
d1ne6a1136 Regulatory subunit of Protein kinase A {Cow (Bos t 99.77
d2gaua2142 Transcriptional regulator PG0396, N-terminal domai 99.77
d1cx4a1136 Regulatory subunit of Protein kinase A {Rat (Rattu 99.77
d1o7fa2155 Regulatory domain of Epac2, domains 1 and 3 {Mouse 99.76
d1o7fa3124 Regulatory domain of Epac2, domains 1 and 3 {Mouse 99.73
d1wgpa_137 Probable cyclic nucleotide-gated ion channel 6 {Th 99.73
d1i5za2132 Catabolite gene activator protein, N-terminal doma 99.71
d2oz6a2134 Cyclic AMP receptor-like protein Vfr {Pseudomonas 99.7
d1q3ea_193 HCN pacemaker channel {Mouse (Mus musculus) [TaxId 99.69
d1vp6a_133 Putative ion channel CnbD {Mesorhizobium loti [Tax 99.69
d1zyba2147 Probable transcription regulator BT4300, N-termina 99.68
d3e5ua2139 Chlorophenol reduction protein CprK {Desulfitobact 99.67
d1o5la1129 CRP-like transcriptional regulator TM1171, N-termi 99.65
d2gaua2142 Transcriptional regulator PG0396, N-terminal domai 99.62
d1ft9a2132 CO-sensing protein CooA, N-terminal domain {Rhodos 99.6
d2zcwa2112 Transcriptional regulator TTHA1359, N-terminal dom 99.57
d1i5za2132 Catabolite gene activator protein, N-terminal doma 99.56
d2oz6a2134 Cyclic AMP receptor-like protein Vfr {Pseudomonas 99.55
d1o5la1129 CRP-like transcriptional regulator TM1171, N-termi 99.46
d2zcwa2112 Transcriptional regulator TTHA1359, N-terminal dom 99.45
d1ft9a2132 CO-sensing protein CooA, N-terminal domain {Rhodos 99.41
d3e5ua2139 Chlorophenol reduction protein CprK {Desulfitobact 99.39
d1j7la_263 Type IIIa 3',5"-aminoglycoside phosphotransferase 98.8
d2pula1392 Methylthioribose kinase MtnK {Bacillus subtilis [T 98.37
d1nd4a_255 Aminoglycoside 3'-phosphotransferase IIa (Kanamyci 98.18
d1nw1a_395 Choline kinase {Caenorhabditis elegans [TaxId: 623 97.99
d2ppqa1316 Homoserine kinase ThrB {Agrobacterium tumefaciens 97.18
d1zyla1325 RdoA {Escherichia coli [TaxId: 562]} 96.64
>d1o6la_ d.144.1.7 (A:) Pkb kinase (Akt-2) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: Protein kinase-like (PK-like)
superfamily: Protein kinase-like (PK-like)
family: Protein kinases, catalytic subunit
domain: Pkb kinase (Akt-2)
species: Human (Homo sapiens) [TaxId: 9606]

Probab=100.00  E-value=0  Score=444.29  Aligned_cols=288  Identities=27%  Similarity=0.506  Sum_probs=260.1

Q ss_pred             CCCCCCEEEEEEECCCCCEEEEEEEECCCCCEEEEEEEECHHHHCCCHHHHHHHHHHHHCCCCCCCCCCCEEEEEEECCE
Q ss_conf             55767808998846789489999999499939999994020110202499999998333118986621420289841891
Q 001412          765 KVSLTDMEWRKCLYSTDCSEIGLVLLRDSENFLSLKRFSKQKVKCLGKEVQVLKEKNLMKSVSPSACVPQILCTCADSMH  844 (1082)
Q Consensus       765 ~~~~~~y~i~~~LG~G~~g~V~~~~~~~~~~~~aiK~~~k~~~~~~~~~~~~~~E~~il~~l~~~~~I~~l~~~~~~~~~  844 (1082)
                      ++++++|++++.||+|+||.||+|+++.+++.||+|++.+..........++.+|+.+|+.++ ||+|++++++|.+.++
T Consensus         1 ~i~l~dy~~~~~lG~G~fg~V~~~~~~~~~~~~AiK~i~k~~~~~~~~~~~~~~E~~il~~l~-hp~Iv~l~~~~~~~~~   79 (337)
T d1o6la_           1 KVTMNDFDYLKLLGKGTFGKVILVREKATGRYYAMKILRKEVIIAKDEVAHTVTESRVLQNTR-HPFLTALKYAFQTHDR   79 (337)
T ss_dssp             CCCGGGEEEEEEEEECSSEEEEEEEETTTCCEEEEEEEEHHHHHHTTCHHHHHHHHHHHHSCC-CTTBCCEEEEEECSSE
T ss_pred             CCCHHHCEEEEEEECCCCEEEEEEEECCCCCEEEEEEECHHHCCCHHHHHHHHHHHHHHHHCC-CCCEEEEEEEECCCCC
T ss_conf             984474289889831768499999998999899999981565449799999999999998679-9988778764035642


Q ss_pred             EEEEEECCCCCCHHHHHC--CCCCHHHHHHHHHHHHHHHHHHHHCCCEECCCCCCCEEECCCCCEEEEECCCCCCCCC--
Q ss_conf             899991258889778742--9999999999999999999999987978455699959975799599995278744799--
Q 001412          845 AGLLLNTYLACPLASILH--TPLDEQSARFCAASVVAALEDLHKRGVLYRGVSPDVLMLDKSGHLQLVDFRFGKGLSG--  920 (1082)
Q Consensus       845 ~~lv~E~~~g~~L~~~l~--~~l~~~~~~~i~~qi~~aL~~LH~~givHrDLkp~NIlid~~g~vkL~DFg~a~~~~~--  920 (1082)
                      +|+||||+.||+|..++.  +.+++..++.++.||+.||.|||++||+||||||+|||++.+|.+||+|||+|+....  
T Consensus        80 ~~iv~ey~~gg~L~~~~~~~~~~~e~~~~~~~~qil~al~ylH~~~iiHRDlKP~NILl~~~g~vkl~DFG~a~~~~~~~  159 (337)
T d1o6la_          80 LCFVMEYANGGELFFHLSRERVFTEERARFYGAEIVSALEYLHSRDVVYRDIKLENLMLDKDGHIKITDFGLCKEGISDG  159 (337)
T ss_dssp             EEEEEECCTTCBHHHHHHHHSCCCHHHHHHHHHHHHHHHHHHHHTTCBCCCCCGGGEEECTTSCEEECCCTTCBCSCCTT
T ss_pred             CCCCEECCCCCCHHHHHHCCCCCCHHHHHHHHHHHHHHHHHHHHCCCCCCCCCHHHEEECCCCCEEEEECCCCCCCCCCC
T ss_conf             11100035798605555325677599999999999652113431596224647778476589988882056520035678


Q ss_pred             CCCEEEEECCCCCCHHHHCCCCCCCCCCCCCHHHHHHHHCCCCCCCCCCCCCHHHHHHHHHHCCCCCCCCCCHHHHHHHH
Q ss_conf             97303752268889023437998984421112377865436999999999997999999850899999999988999999
Q 001412          921 NRTFTICGMADYLAPEIVQGKGHGLAADWWALGVLIYFMLQGEMPFGSWRESEIDIVAKIAKGQLSLPQNLSPEAVDLLT 1000 (1082)
Q Consensus       921 ~~~~~~~gt~~y~aPE~~~~~~~~~~~DiwslG~il~elltg~~pf~~~~~~~~~~~~~i~~~~~~~p~~~s~~~~~li~ 1000 (1082)
                      ....+.+||+.|+|||++.+.+|+.++|+|||||++|+|++|+.||.+  .+...+++.+....+.+|..+++++++||.
T Consensus       160 ~~~~~~~GT~~Y~aPE~~~~~~y~~~~DiwSlGvilyeml~G~~pf~~--~~~~~~~~~i~~~~~~~p~~~s~~~~dli~  237 (337)
T d1o6la_         160 ATMKTFCGTPEYLAPEVLEDNDYGRAVDWWGLGVVMYEMMCGRLPFYN--QDHERLFELILMEEIRFPRTLSPEAKSLLA  237 (337)
T ss_dssp             CCBCCCEECGGGCCGGGGSSSCBCTTHHHHHHHHHHHHHHHSSCSSCC--SSHHHHHHHHHHCCCCCCTTSCHHHHHHHH
T ss_pred             CCCCCCEECHHHHHHHHCCCCCCCHHHCCCCHHHHHHHHHHCCCCCCC--CCHHHHHHHHHCCCCCCCCCCCHHHHHHHH
T ss_conf             620551008899666650489888333102230678899878999999--699999999852899898668999999998


Q ss_pred             HHCCCCCCCCCCCC--CHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             83136923339999--9357761999778993110137999990000101114478778
Q 001412         1001 KLLVVDENTRLGSQ--GPTSVKTHPWFRDVDWKGIAESTSPVPHEIMSRISQHLDSHFE 1057 (1082)
Q Consensus      1001 ~lL~~dp~~R~s~~--~~~eil~hp~f~~~~~~~~~~~~~~~p~~~~~~~~~~~~~~~~ 1057 (1082)
                      +||+.||.+|++..  .+.++++||||.+++|+.+..+..++|..  +.+....+..++
T Consensus       238 ~~L~~dP~~R~~~~~~~~~eil~Hp~f~~i~~~~l~~~~~~~p~~--P~~~~~~~~~~f  294 (337)
T d1o6la_         238 GLLKKDPKQRLGGGPSDAKEVMEHRFFLSINWQDVVQKKLLPPFK--PQVTSEVDTRYF  294 (337)
T ss_dssp             HHTCSSTTTSTTCSTTTHHHHHTSGGGTTCCHHHHHTTCSCCSCC--CCCSSTTCCTTS
T ss_pred             HHCCCCCHHHCCCCCCCHHHHHCCCCCCCCCHHHHHHCCCCCCCC--CCCCCHHHHHHC
T ss_conf             666389344225652349999729150369999998478998978--888980143323
>d1rdqe_ d.144.1.7 (E:) cAMP-dependent PK, catalytic subunit {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1fota_ d.144.1.7 (A:) cAMP-dependent PK, catalytic subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1uu3a_ d.144.1.7 (A:) 3-phosphoinositide dependent protein kinase-1 Pdk1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1omwa3 d.144.1.7 (A:186-549) G-protein coupled receptor kinase 2 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1xjda_ d.144.1.7 (A:) Protein kinase C, theta type {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2j4za1 d.144.1.7 (A:126-388) Aurora-related kinase 1 (aurora-2) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koaa2 d.144.1.7 (A:5915-6264) Twitchin, kinase domain {Caenorhabditis elegans, pjk4 [TaxId: 6239]} Back     information, alignment and structure
>d1koba_ d.144.1.7 (A:) Twitchin, kinase domain {California sea hare (Aplysia californica), twk43 [TaxId: 6500]} Back     information, alignment and structure
>d1a6qa2 d.219.1.1 (A:2-296) Protein serine/threonine phosphatase 2C, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jksa_ d.144.1.7 (A:) Death-associated protein kinase, Dap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yhwa1 d.144.1.7 (A:249-541) pak1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1s9ja_ d.144.1.7 (A:) Dual specificity mitogen-activated protein kinase kinase 1, Mek1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a06a_ d.144.1.7 (A:) Calmodulin-dependent protein kinase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1nvra_ d.144.1.7 (A:) Cell cycle checkpoint kinase chk1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2java1 d.144.1.7 (A:3-271) Serine/threonine-protein kinase Nek2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vzoa_ d.144.1.7 (A:) Ribosomal protein S6 kinase alpha 5, Msk1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2jfla1 d.144.1.7 (A:21-308) STE20-like serine/threonine-protein kinase, SLK {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u5ra_ d.144.1.7 (A:) Serine/threonine protein kinase TAO2 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1phka_ d.144.1.7 (A:) gamma-subunit of glycogen phosphorylase kinase (Phk) {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure
>d1tkia_ d.144.1.7 (A:) Titin, kinase domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1t4ha_ d.144.1.7 (A:) Protein kinase wnk1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xwsa_ d.144.1.7 (A:) Proto-oncogene serine/threonine-protein kinase Pim-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ozaa1 d.144.1.7 (A:51-385) MAP kinase activated protein kinase 2, mapkap2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gz8a_ d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ua2a_ d.144.1.7 (A:) Cell division protein kinase 7, CDK7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1blxa_ d.144.1.7 (A:) Cyclin-dependent PK, CDK6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3bqca1 d.144.1.7 (A:3-330) Protein kinase CK2, alpha subunit {Rattus norvegicus [TaxId: 10116]} Back     information, alignment and structure
>d1rjba_ d.144.1.7 (A:) Fl cytokine receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cm8a_ d.144.1.7 (A:) MAP kinase p38-gamma {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1o6ya_ d.144.1.7 (A:) Mycobacterial protein kinase PknB, catalytic domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1ob3a_ d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {(Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d1opja_ d.144.1.7 (A:) Abelsone tyrosine kinase (abl) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1q5ka_ d.144.1.7 (A:) Glycogen synthase kinase-3 beta (Gsk3b) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3blha1 d.144.1.7 (A:8-325) Cell division protein kinase 9, CDK9 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jpaa_ d.144.1.7 (A:) ephb2 receptor tyrosine kinase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2gfsa1 d.144.1.7 (A:5-352) MAP kinase p38 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u59a_ d.144.1.7 (A:) Tyrosine-protein kinase ZAP-70 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pmea_ d.144.1.7 (A:) MAP kinase Erk2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1unla_ d.144.1.7 (A:) Cyclin-dependent PK, CDK5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2b1pa1 d.144.1.7 (A:46-400) c-jun N-terminal kinase (jnk3s) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xbba_ d.144.1.7 (A:) Tyrosine-protein kinase SYK {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sm2a_ d.144.1.7 (A:) Tyrosine-protein kinase Itk/Tsk {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qpca_ d.144.1.7 (A:) Lymphocyte kinase (lck) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fmka3 d.144.1.7 (A:249-533) c-src tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k2pa_ d.144.1.7 (A:) Bruton's tyrosine kinase (Btk) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fvra_ d.144.1.7 (A:) Tie2 kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ywna1 d.144.1.7 (A:818-1166) Vascular endothelial growth factor receptor 2 (kdr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xkka_ d.144.1.7 (A:) EGF receptor tyrosine kinase, Erbb-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uwha_ d.144.1.7 (A:) B-Raf kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mqba_ d.144.1.7 (A:) epha2 receptor tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u46a_ d.144.1.7 (A:) Activated CDC42 kinase 1, ACK1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fgka_ d.144.1.7 (A:) Fibroblast growth factor receptor 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mp8a_ d.144.1.7 (A:) Focal adhesion kinase 1 (fak) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lufa_ d.144.1.7 (A:) Musk tyrosine kinase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1t46a_ d.144.1.7 (A:) c-KIT receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ckia_ d.144.1.7 (A:) Casein kinase-1, CK1 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1p4oa_ d.144.1.7 (A:) Insulin-like growth factor 1 receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1byga_ d.144.1.7 (A:) Carboxyl-terminal src kinase (csk) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1csna_ d.144.1.7 (A:) Casein kinase-1, CK1 {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1r0pa_ d.144.1.7 (A:) Hepatocyte growth factor receptor, c-MET {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1q8ya_ d.144.1.7 (A:) Sky1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1txoa_ d.219.1.1 (A:) putative serine/threonine phosphatase pstp/ppp {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1vjya_ d.144.1.7 (A:) Type I TGF-beta receptor R4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cx4a1 b.82.3.2 (A:130-265) Regulatory subunit of Protein kinase A {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1zara2 d.144.1.9 (A:91-281) Rio2 serine protein kinase C-terminal domain {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1ne6a1 b.82.3.2 (A:109-244) Regulatory subunit of Protein kinase A {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1o7fa2 b.82.3.2 (A:13-167) Regulatory domain of Epac2, domains 1 and 3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1cx4a2 b.82.3.2 (A:266-412) Regulatory subunit of Protein kinase A {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1ne6a2 b.82.3.2 (A:245-376) Regulatory subunit of Protein kinase A {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1o7fa3 b.82.3.2 (A:322-445) Regulatory domain of Epac2, domains 1 and 3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1q3ea_ b.82.3.2 (A:) HCN pacemaker channel {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1zyba2 b.82.3.2 (A:1-147) Probable transcription regulator BT4300, N-terminal domain {Bacteroides thetaiotaomicron [TaxId: 818]} Back     information, alignment and structure
>d1wgpa_ b.82.3.2 (A:) Probable cyclic nucleotide-gated ion channel 6 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1cx4a2 b.82.3.2 (A:266-412) Regulatory subunit of Protein kinase A {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1vp6a_ b.82.3.2 (A:) Putative ion channel CnbD {Mesorhizobium loti [TaxId: 381]} Back     information, alignment and structure
>d1ne6a2 b.82.3.2 (A:245-376) Regulatory subunit of Protein kinase A {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1ne6a1 b.82.3.2 (A:109-244) Regulatory subunit of Protein kinase A {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2gaua2 b.82.3.2 (A:10-151) Transcriptional regulator PG0396, N-terminal domain {Porphyromonas gingivalis [TaxId: 837]} Back     information, alignment and structure
>d1cx4a1 b.82.3.2 (A:130-265) Regulatory subunit of Protein kinase A {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1o7fa2 b.82.3.2 (A:13-167) Regulatory domain of Epac2, domains 1 and 3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1o7fa3 b.82.3.2 (A:322-445) Regulatory domain of Epac2, domains 1 and 3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wgpa_ b.82.3.2 (A:) Probable cyclic nucleotide-gated ion channel 6 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1i5za2 b.82.3.2 (A:6-137) Catabolite gene activator protein, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2oz6a2 b.82.3.2 (A:9-142) Cyclic AMP receptor-like protein Vfr {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1q3ea_ b.82.3.2 (A:) HCN pacemaker channel {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1vp6a_ b.82.3.2 (A:) Putative ion channel CnbD {Mesorhizobium loti [TaxId: 381]} Back     information, alignment and structure
>d1zyba2 b.82.3.2 (A:1-147) Probable transcription regulator BT4300, N-terminal domain {Bacteroides thetaiotaomicron [TaxId: 818]} Back     information, alignment and structure
>d3e5ua2 b.82.3.2 (A:9-147) Chlorophenol reduction protein CprK {Desulfitobacterium hafniense [TaxId: 49338]} Back     information, alignment and structure
>d1o5la1 b.82.3.2 (A:1-129) CRP-like transcriptional regulator TM1171, N-terminal domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2gaua2 b.82.3.2 (A:10-151) Transcriptional regulator PG0396, N-terminal domain {Porphyromonas gingivalis [TaxId: 837]} Back     information, alignment and structure
>d1ft9a2 b.82.3.1 (A:2-133) CO-sensing protein CooA, N-terminal domain {Rhodospirillum rubrum [TaxId: 1085]} Back     information, alignment and structure
>d1i5za2 b.82.3.2 (A:6-137) Catabolite gene activator protein, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2oz6a2 b.82.3.2 (A:9-142) Cyclic AMP receptor-like protein Vfr {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1o5la1 b.82.3.2 (A:1-129) CRP-like transcriptional regulator TM1171, N-terminal domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1ft9a2 b.82.3.1 (A:2-133) CO-sensing protein CooA, N-terminal domain {Rhodospirillum rubrum [TaxId: 1085]} Back     information, alignment and structure
>d3e5ua2 b.82.3.2 (A:9-147) Chlorophenol reduction protein CprK {Desulfitobacterium hafniense [TaxId: 49338]} Back     information, alignment and structure
>d1j7la_ d.144.1.6 (A:) Type IIIa 3',5"-aminoglycoside phosphotransferase {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d2pula1 d.144.1.6 (A:5-396) Methylthioribose kinase MtnK {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1nd4a_ d.144.1.6 (A:) Aminoglycoside 3'-phosphotransferase IIa (Kanamycin kinase) {Bacteria (Klebsiella pneumoniae) [TaxId: 573]} Back     information, alignment and structure
>d1nw1a_ d.144.1.8 (A:) Choline kinase {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d2ppqa1 d.144.1.6 (A:5-320) Homoserine kinase ThrB {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1zyla1 d.144.1.6 (A:4-328) RdoA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure