Citrus Sinensis ID: 001477

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820-------830-------840-------850-------860-------870-------880-------890-------900-------910-------920-------930-------940-------950-------960-------970-------980-------990------1000------1010------1020------1030------1040------1050------1060------1070-
MSSLSRELVFLILQFLDEEKFKETVHKLEQESGFFFNMKHFEDQVQAGEWDEVERYLCGFTKVEDNRYSMKIFFEIRKQKYLEALDRQDRAKAVEILVKDLKVFSSFNEELFKEITQLLTLDNFRQNEQLSKYGDTKSARNIMLVELKKLIEANPLFRDKLSFPSFKSSRLRTLINQSLNWQHQLCKNPRPNPDIKTLFTDHSCNPTSNGARPPPPTNNPLVGPIPKAGQFPPIGAHGPFQPVVSPSPGAIAGWMSSNSPSLPHPSMAAGPPGFVQPSSAVGFLKHPRTPTGMTGMDYQSADSDHLMKRIRTGQSDEVSFAGVAHTPNVYSQDDLTKTVVRTLNQGSNVMSMDFHPQQQTILLVGTNVGDISLWEVGSRERLAHKPFKVWDISAASMPLQNALLNDAAISVNRCVWGPDGLMLGVAFSKHIVHLYTYNPTGELRQHLEIDAHVGGVNDIAFAHPNKQLCIVTCGDDKMIKVWDVVAGRKQYTFEGHEAPVYSVCPHHKESIQFIFSTAIDGKIKAWLYDYLGSRVDYDAPGNWCTMMAYSADGTRLFSCGTSKEGESHLVEWNESEGAIKRTYSGFRKRSLGVVQFDTTRNRFLAAGDEFQIKFWDMDNMNMLTTVDADGGLPASPRLRFNKEGSLLAVTTSDNGIKILANSDGVRLLRMLEGRAMDKNRCPSEPISSKPLTINALGPASNVSAAIAPTLERPDRGPPAVSISSLGTIDGSRLVDVKPRVAEDVDKIKSWRIPDISDPSQIKALRLPDSIAASKVVRLIYTNSGLSLLALASNAVHKLWKWQRTERNPSGKATANVAPQLWQPPSGTLMTNDINESKPTEESAACIALSKNDSYVMSASGGKVSLFNMMTFKVMTMFMSPPPAATFLAFHPQDNNIIAIGMEDSSVQIYNVRVDEVKTKLKGHQNRITGLAFSPTLNALVSSGADAQLCMWSIDKWEKLKSRFIQAPAGRQSPLVGETKVQFHNDQTHLLVVHESQISVYDSKLECSRSWSPKDALPAPISSAIYSCDGLLVYAGFCDGAIGVFDAETLRFRCRIGPSAYIPTYAVRLHLA
cccccHHHHHHHHHHcccccHHHHHHHHHccccccccHHHHHHHHHccccHHHcEEcccEEEEccccccEEEEEEEEccHHHHHHHcccHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHccccccHHHHHHcccccHHHHHHHHHHHHHHHccccccccccccccccHHHHHHHHHHHHcEEEEEcccccccccccEEEccccccccccccccccccccccEEEccccccccccccccccEEEEccccccEEEEEccccccccccEEEEcccccccccccccccccccccccccccEEEccccccccEEEEEEccccEEEEEEcccccEEEEEcccccEEEEccccccEEEEEEcccccEEEEEEEccccEEEEEccccccccccccEEEEcccccccccccccccccccEEEEEEcccccEEEEEEccccEEEEEccccccEEEEEEEccccccEEEEEEcccccEEEEEEEEccccEEEEEccccEEEEEcccccccEEEEEcEEcccccEEEEEEccccEEEEEcccccEEEEEccccccEEEEEEcccccEEEEEEcccccccEEEEEEccccEEEEEEcccccccEEEEEEcccccEEEEEEccccEEEEEccccEEEEEEEcccccccccEEEEcccccEEEEEEccccEEEEEcccccEEEEEcccccccEEEEEEccccccEEEEcccccEEEEEcccccEEccccccccEEEEcccccEEEEEccccccEEEcccccEEEEEcccccccccEEEEEcccccccccEEEEEEEccccEEEEEEcccEEEEEEEEcccccccccccccccEEEEEcccccEEEccccccccccccEEEEEEcccccEEEEEEcccEEEEEccccEEEEEEccccccEEEEEEEcccccEEEEEEccccEEEEEccccEEEEEEccccccEEEEEEcccccEEEEEEccccEEEEEcccccEEEEEEccccccccccccccEEEEEcccccEEEEEccccEEEEEcccccEEEEcccccccccEEEEEEcccccEEEEEEccccEEEEEcccccEEEEEcccccEEEEEEccccc
cccHHHHHHHHHHHHHcHHHHHHHHHHHHHHcccEEcHHHHHHHHHcccHHHHHHHHccccEcccccccHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHcHHHHHHcccccccHHHHHHHHHHHHHHHHHHHccccccccccEEEEccccccccccccccccccccccccccccccccccccccccccccccccccHHHHccccccccccccccccccccccccccHHHHcccccccccccEEcccccccccEEEEEEcccccEEEEcccccEEEEEccccccEEEEEEcccccEEEEEEcccccEEEEEEccccEEEEEEcccccEEEEccEEEEEccccccHHHHHHcccccccEEEEEEcccccEEEEEccccEEEEEEEccccEEEEEEEEccccccEEEEEEcccccEEEEEEEccccEEEEEEcccccEEEEEEcccccEEEEEEcccccccEEEEEccccEEEEEEcccccEEEEEccccccEEEEEEcccccEEEEEccccccccEEEEEEcccccEEEEEccccccEEEEEEEcccccEEEEEccccEEEEEEcccccEEEEEEccccccccEEEEEcccccEEEEEccccEEEEEEcccccEEEEEccccEEEEEEcccccEEEEcccccEEEEEEcccccEEEEEccccccEEEEEEcccccEEEEccccccEEEEEcccccEEEEEEEEEcccccccccEccccccccEEEEEEcccccEEEEEEcccccEEEEEEcccccEEEEEccccEEEEEEcccccEEEEEEcccccccccEEEEEEcccccEEEEEcccEEEEEEcccccEEEEEccccccEEEEEEccccccEEEEEccccEEEEEEcccccEEEEEEcccccEEEEEEcccccEEEEcccccEEEEEEcccccEEEEEcccccccEEEccccccEEEEccccEEEEEEccccEEEEcccccEEEEEEccccccccEEEEEEcccccEEEEEccccEEEEEEcccccEEEEEccccccccEEEEEEcc
MSSLSRELVFLILQFLDEEKFKETVHKLEQESGFFFNMKHFEDQVQAGEWDEVERYLCGftkvednrySMKIFFEIRKQKYLEALDRQDRAKAVEILVKDLKVFSSFNEELFKEITQLLTLDnfrqneqlskygdtkSARNIMLVELKKLieanplfrdklsfpsfkssRLRTLINQSLNWQHqlcknprpnpdiktlftdhscnptsngarpppptnnplvgpipkagqfppigahgpfqpvvspspgaiagwmssnspslphpsmaagppgfvqpssavgflkhprtptgmtgmdyqsadSDHLMKRIrtgqsdevsfagvahtpnvysqddlTKTVVRTLNQgsnvmsmdfhpqQQTILLVgtnvgdislwevgsrerlahkpfkvwdisAASMPLQNALLNDAAISVnrcvwgpdglMLGVAFSKHIVHlytynptgelrqhleidahvggvndiafahpnkqlcivtcgddkmiKVWDVVAGRkqytfegheapvysvcphhkESIQFIFSTAIDGKIKAWLYDYLgsrvdydapgnwctmmaysadgtrlfscgtskegesHLVEWNESEGAIKRTYSGfrkrslgvvqfdTTRNRFLAAGDEFQIkfwdmdnmnmlttvdadgglpasprlrfnkegsllavttsdngikilaNSDGVRLLRMLEgramdknrcpsepisskpltinalgpasnvsaaiaptlerpdrgppavsisslgtidgsrlvdvkprvaedvdkikswripdisdpsqikalrlpdsiAASKVVRLIYTNSGLSLLALASNAVHKLWKWqrternpsgkatanvapqlwqppsgtlmtndineskpteESAACIALskndsyvmsasggkvsLFNMMTFKVMtmfmspppaatflafhpqdnniiaigmedssvQIYNVRVDEVKTKLKghqnritglafspTLNALVSSGADAQLCMWSIDKWEKLKSRFiqapagrqsplvgetkvqfhndqtHLLVVHESQISvydsklecsrswspkdalpapissaiyscdgllvyagfcdgaigvfdaeTLRFrcrigpsayiptYAVRLHLA
MSSLSRELVFLILQFLDEEKFKETVHKLEQESGFFFNMKHFEDQVQAGEWDEVERYLCGFtkvednrysMKIFFEIRKQKYLEALDRQDRAKAVEILVKDLKVFSSFNEELFKEITQlltldnfrqneqlskygdtksaRNIMLVELKKLieanplfrdklsFPSFKSSRLRTLINQSLNWQHQLCKNPRPNPDIKTLFTDHSCNPTSNGARPPPPTNNPLVGPIPKAGQFPPIGAHGPFQPVVSPSPGAIAGWMSSNSPSLPHPSMAAGPPGFVQPSSAVGFLKHPRTPTGMTGMDYQSADSDHLMKRIRTGQSDEVSFAGVAHtpnvysqddltKTVVRTLNQGSNVMSMDFHPQQQTILLVGTNVGDISLWEVGSRERLAHKPFKVWDISAASMPLQNALLNDAAISVNRCVWGPDGLMLGVAFSKHIVHLYTYNPTGELRQHLEIDAHVGGVNDIAFAHPNKQLCIVTCGDDKMIKVWDVVAGRKQYTFEGHEAPVYSVCPHHKESIQFIFSTAIDGKIKAWLYDYLGSRVDYDAPGNWCTMMAYSADGTRLFSCGTSKEGESHLVEWNESEgaikrtysgfrkrslgvvqfdttrNRFLAAGDEFQIKFWDMDNMNMLTTVDADGGLPASPRLRFNKEGSLlavttsdngikilansdgVRLLRMLEGRamdknrcpsepisskpltinalgpaSNVSAAIAptlerpdrgppavsisslgtidgsrlvdvkprvaedvdkikswripdisdpsqikalrlpDSIAASKVVRLIYTNSGLSLLALASNAVHKLWKWQRTErnpsgkatanvapqlwqppsGTLMTNDINESKPTEESAACIALSKNDSYVMSASGGKVSLFNMMTFKVMTMFMSPPPAATFLAFHPQDNNIIAIGMEDSSVQIYNVRVDEVKTKLKGHQNRITGLAFSPTLNALVSSGADAQLCMWSIDKWEKLKSRFIQAPAGRQSPLVGETKVQFHNDQTHLLVVHESQISVYDSKLECSRSWSPKDALPAPISSAIYSCDGLLVYAGFCDGAIGVFDAETLRFRCRigpsayiptYAVRLHLA
MSSLSRELVFLILQFLDEEKFKETVHKLEQESGFFFNMKHFEDQVQAGEWDEVERYLCGFTKVEDNRYSMKIFFEIRKQKYLEALDRQDRAKAVEILVKDLKVFSSFNEELFKEITQLLTLDNFRQNEQLSKYGDTKSARNIMLVELKKLIEANPLFRDKLSFPSFKSSRLRTLINQSLNWQHQLCKNPRPNPDIKTLFTDHSCNPTSNGARpppptnnplvgpipKAGQFPPIGAHGPFQPVVSPSPGAIAGWMSSNSPSLPHPSMAAGPPGFVQPSSAVGFLKHPRTPTGMTGMDYQSADSDHLMKRIRTGQSDEVSFAGVAHTPNVYSQDDLTKTVVRTLNQGSNVMSMDFHPQQQTILLVGTNVGDISLWEVGSRERLAHKPFKVWDISAASMPLQNALLNDAAISVNRCVWGPDGLMLGVAFSKHIVHLYTYNPTGELRQHLEIDAHVGGVNDIAFAHPNKQLCIVTCGDDKMIKVWDVVAGRKQYTFEGHEAPVYSVCPHHKESIQFIFSTAIDGKIKAWLYDYLGSRVDYDAPGNWCTMMAYSADGTRLFSCGTSKEGESHLVEWNESEGAIKRTYSGFRKRSLGVVQFDTTRNRFLAAGDEFQIKFWDMDNMNMLTTVDADGGLPASPRLRFNKEGSLLAVTTSDNGIKILANSDGVRLLRMLEGRAMDKNRCPSEPISSKPLTINALGPASNVSAAIAPTLERPDRGPPAVSISSLGTIDGSRLVDVKPRVAEDVDKIKSWRIPDISDPSQIKALRLPDSIAASKVVRLIYTnsglsllalasnaVHKLWKWQRTERNPSGKATANVAPQLWQPPSGTLMTNDINESKPTEESAACIALSKNDSYVMSASGGKVSLFNMMTFKVMTMFMSPPPAATFLAFHPQDNNIIAIGMEDSSVQIYNVRVDEVKTKLKGHQNRITGLAFSPTLNALVSSGADAQLCMWSIDKWEKLKSRFIQAPAGRQSPLVGETKVQFHNDQTHLLVVHESQISVYDSKLECSRSWSPKDALPAPISSAIYSCDGLLVYAGFCDGAIGVFDAETLRFRCRIGPSAYIPTYAVRLHLA
******ELVFLILQFLDEEKFKETVHKLEQESGFFFNMKHFEDQVQAGEWDEVERYLCGFTKVEDNRYSMKIFFEIRKQKYLEALDRQDRAKAVEILVKDLKVFSSFNEELFKEITQLLTLDNFRQNEQLSKYGDTKSARNIMLVELKKLIEANPLFRDKLSFPSFKSSRLRTLINQSLNWQHQLCK************************************************************************************************************************************FAGVAHTPNVYSQDDLTKTVVRTLNQGSNVMSMDFHPQQQTILLVGTNVGDISLWEVGSRERLAHKPFKVWDISAASMPLQNALLNDAAISVNRCVWGPDGLMLGVAFSKHIVHLYTYNPTGELRQHLEIDAHVGGVNDIAFAHPNKQLCIVTCGDDKMIKVWDVVAGRKQYTFEGHEAPVYSVCPHHKESIQFIFSTAIDGKIKAWLYDYLGSRVDYDAPGNWCTMMAYSADGTRLFSCGTSKEGESHLVEWNESEGAIKRTYSGFRKRSLGVVQFDTTRNRFLAAGDEFQIKFWDMDNMNMLTTVDADGGLPA**RLRFNKEGSLLAVTTSDNGIKILANSDGVRLLRML********************************************************IDGSRLVDVKPRVAEDVDKIKSWRIPDISDPSQIKALRLPDSIAASKVVRLIYTNSGLSLLALASNAVHKLWKWQR*****************************************CIALSKNDSYVMSASGGKVSLFNMMTFKVMTMFMSPPPAATFLAFHPQDNNIIAIGMEDSSVQIYNVRVDEVKTKLKGHQNRITGLAFSPTLNALVSSGADAQLCMWSIDKWEKLKSRFIQAPAGRQSPLVGETKVQFHNDQTHLLVVHESQISVYDSKLECSRSWSPKDALPAPISSAIYSCDGLLVYAGFCDGAIGVFDAETLRFRCRIGPSAYIPTYAVRLH**
***LSRELVFLILQFLDEEKFKETVHKLEQESGFFFNMKHFEDQVQAGEWDEVERYLCGFTKVEDNRYSMKIFFEIRKQKYLEALDRQDRAKAVEILVKDLKVFSSFNEELFKEITQLLTLDNFRQNEQLSKYGDTKSARNIMLVELKKLIEANPLFRDKLSFPSFKSSRLRTLINQSLNWQHQLCKNPRPNPDIKTLFTDHSCNPTSNGARPPPPTNNPLVGPIPKAGQFPPIGAHGPFQPVVSPSPGAIAGWMSSNSPSLPHPSMAAGPPGFVQPSSAVGFLKHPRTPTGMTGMDYQSADSDHLMKRIRTGQSDEVSFAGVAHTPNVYSQDDLTKTVVRTLNQGSNVMSMDFHPQQQTILLVGTNVGDISLWEVGSRERLAHKPFKVWDISAASMPLQNALLNDAAISVNRCVWGPDGLMLGVAFSKHIVHLYTYNPTGELRQHLEIDAHVGGVNDIAFAHPNKQLCIVTCGDDKMIKVWDVVAGRKQYTFEGHEAPVYSVCPHHKESIQFIFSTAIDGKIKAWLYDYLGSRVDYDAPGNWCTMMAYSADGTRLFSCGTSKEGESHLVEWNESEGAIKRTYSGFRKRSLGVVQFDTTRNRFLAAGDEFQIKFWDMDNMNMLTTVDADGGLPASPRLRFNKEGSLLAVTTSDNGIKILANSDGVRLLRMLEGRAMDKNRCPSEPISSKPLTINALGPASNVSAAIAPTLERPDRGPPAVSISSLGTIDGSRLVDVKPRVAEDVDKIKSWRIPDISDPSQIKALRLPDSIAASKVVRLIYTNSGLSLLALASNAVHKLWKWQRTERNPSGKATANVAPQLWQPPSGTLMTNDINESKPTEESAACIALSKNDSYVMSASGGKVSLFNMMTFKVMTMFMSPPPAATFLAFHPQDNNIIAIGMEDSSVQIYNVRVDEVKTKLKGHQNRITGLAFSPTLNALVSSGADAQLCMWSIDKWEKLKSRFIQAPAGRQSPLVGETKVQFHNDQTHLLVVHESQISVYDSKLECSRSWSPKDALPAPISSAIYSCDGLLVYAGFCDGAIGVFDAETLRFRCRIGPSAYIPTYAVRLHLA
MSSLSRELVFLILQFLDEEKFKETVHKLEQESGFFFNMKHFEDQVQAGEWDEVERYLCGFTKVEDNRYSMKIFFEIRKQKYLEALDRQDRAKAVEILVKDLKVFSSFNEELFKEITQLLTLDNFRQNEQLSKYGDTKSARNIMLVELKKLIEANPLFRDKLSFPSFKSSRLRTLINQSLNWQHQLCKNPRPNPDIKTLFTDHSCNPTSNGARPPPPTNNPLVGPIPKAGQFPPIGAHGPFQPVVSPSPGAIAGWMSSNSPSLPHPSMAAGPPGFVQPSSAVGFLKHPRTPTGMTGMDYQSADSDHLMKRIRTGQSDEVSFAGVAHTPNVYSQDDLTKTVVRTLNQGSNVMSMDFHPQQQTILLVGTNVGDISLWEVGSRERLAHKPFKVWDISAASMPLQNALLNDAAISVNRCVWGPDGLMLGVAFSKHIVHLYTYNPTGELRQHLEIDAHVGGVNDIAFAHPNKQLCIVTCGDDKMIKVWDVVAGRKQYTFEGHEAPVYSVCPHHKESIQFIFSTAIDGKIKAWLYDYLGSRVDYDAPGNWCTMMAYSADGTRLFSCGTSKEGESHLVEWNESEGAIKRTYSGFRKRSLGVVQFDTTRNRFLAAGDEFQIKFWDMDNMNMLTTVDADGGLPASPRLRFNKEGSLLAVTTSDNGIKILANSDGVRLLRMLEGRAMDKNRCPSEPISSKPLTINALGPASNVSAAIAPTLERPDRGPPAVSISSLGTIDGSRLVDVKPRVAEDVDKIKSWRIPDISDPSQIKALRLPDSIAASKVVRLIYTNSGLSLLALASNAVHKLWKWQRTERNPSGKATANVAPQLWQPPSGTLMTNDINESKPTEESAACIALSKNDSYVMSASGGKVSLFNMMTFKVMTMFMSPPPAATFLAFHPQDNNIIAIGMEDSSVQIYNVRVDEVKTKLKGHQNRITGLAFSPTLNALVSSGADAQLCMWSIDKWEKLKSRFIQAPAGRQSPLVGETKVQFHNDQTHLLVVHESQISVYDSKLECSRSWSPKDALPAPISSAIYSCDGLLVYAGFCDGAIGVFDAETLRFRCRIGPSAYIPTYAVRLHLA
**SLSRELVFLILQFLDEEKFKETVHKLEQESGFFFNMKHFEDQVQAGEWDEVERYLCGFTKVEDNRYSMKIFFEIRKQKYLEALDRQDRAKAVEILVKDLKVFSSFNEELFKEITQLLTLDNFRQNEQLSKYGDTKSARNIMLVELKKLIEANPLFRDKLSFPSFKSSRLRTLINQSLNWQHQLCKNPRPNPDIKTLFTDHSCNPTSN*ARPPPPTNNPLVGPIPKAGQFPPIGAHGPFQPVVSPSPGAIAGWMSSNSPSLPHPSMAAGPPGFVQPSSAVGFLKHPRTPTGMTGMDYQSADSDHLMKRIRTGQSDEVSFAGVAHTPNVYSQDDLTKTVVRTLNQGSNVMSMDFHPQQQTILLVGTNVGDISLWEVGSRERLAHKPFKVWDISAASMPLQNALLNDAAISVNRCVWGPDGLMLGVAFSKHIVHLYTYNPTGELRQHLEIDAHVGGVNDIAFAHPNKQLCIVTCGDDKMIKVWDVVAGRKQYTFEGHEAPVYSVCPHHKESIQFIFSTAIDGKIKAWLYDYLGSRVDYDAPGNWCTMMAYSADGTRLFSCGTSKEGESHLVEWNESEGAIKRTYSGFRKRSLGVVQFDTTRNRFLAAGDEFQIKFWDMDNMNMLTTVDADGGLPASPRLRFNKEGSLLAVTTSDNGIKILANSDGVRLLRMLEGRAMDKNRCPSEPISSKPLTINALGPASNVSAAIAPTLERPDRGPPAVSISSLGTIDGSRLVDVKPRVAEDVDKIKSWRIPDISDPSQIKALRLPDSIAASKVVRLIYTNSGLSLLALASNAVHKLWKWQRTERNPSGKATANVAPQLWQPPSGTLMTNDINESKPTEESAACIALSKNDSYVMSASGGKVSLFNMMTFKVMTMFMSPPPAATFLAFHPQDNNIIAIGMEDSSVQIYNVRVDEVKTKLKGHQNRITGLAFSPTLNALVSSGADAQLCMWSIDKWEKLKSRFIQAPAGRQSPLVGETKVQFHNDQTHLLVVHESQISVYDSKLECSRSWSPKDALPAPISSAIYSCDGLLVYAGFCDGAIGVFDAETLRFRCRIGPSAYIPTYAVRLHLA
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSSLSRELVFLILQFLDEEKFKETVHKLEQESGFFFNMKHFEDQVQAGEWDEVERYLCGFTKVEDNRYSMKIFFEIRKQKYLEALDRQDRAKAVEILVKDLKVFSSFNEELFKEITQLLTLDNFRQNEQLSKYGDTKSARNIMLVELKKLIEANPLFRDKLSFPSFKSSRLRTLINQSLNWQHQLCKNPRPNPDIKTLFTDHSCNPTSNGARPPPPTNNPLVGPIPKAGQFPPIGAHGPFQPVVSPSPGAIAGWMSSNSPSLPHPSMAAGPPGFVQPSSAVGFLKHPRTPTGMTGMDYQSADSDHLMKRIRTGQSDEVSFAGVAHTPNVYSQDDLTKTVVRTLNQGSNVMSMDFHPQQQTILLVGTNVGDISLWEVGSRERLAHKPFKVWDISAASMPLQNALLNDAAISVNRCVWGPDGLMLGVAFSKHIVHLYTYNPTGELRQHLEIDAHVGGVNDIAFAHPNKQLCIVTCGDDKMIKVWDVVAGRKQYTFEGHEAPVYSVCPHHKESIQFIFSTAIDGKIKAWLYDYLGSRVDYDAPGNWCTMMAYSADGTRLFSCGTSKEGESHLVEWNESEGAIKRTYSGFRKRSLGVVQFDTTRNRFLAAGDEFQIKFWDMDNMNMLTTVDADGGLPASPRLRFNKEGSLLAVTTSDNGIKILANSDGVRLLRMLEGRAMDKNRCPSEPISSKPLTINALGPASNVSAAIAPTLERPDRGPPAVSISSLGTIDGSRLVDVKPRVAEDVDKIKSWRIPDISDPSQIKALRLPDSIAASKVVRLIYTNSGLSLLALASNAVHKLWKWQRTERNPSGKATANVAPQLWQPPSGTLMTNDINESKPTEESAACIALSKNDSYVMSASGGKVSLFNMMTFKVMTMFMSPPPAATFLAFHPQDNNIIAIGMEDSSVQIYNVRVDEVKTKLKGHQNRITGLAFSPTLNALVSSGADAQLCMWSIDKWEKLKSRFIQAPAGRQSPLVGETKVQFHNDQTHLLVVHESQISVYDSKLECSRSWSPKDALPAPISSAIYSCDGLLVYAGFCDGAIGVFDAETLRFRCRIGPSAYIPTYAVRLHLA
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query1071 2.2.26 [Sep-21-2011]
Q94AI71131 Protein TOPLESS OS=Arabid yes no 0.973 0.922 0.682 0.0
Q0WV901120 Topless-related protein 1 no no 0.963 0.921 0.677 0.0
Q27GK71135 Topless-related protein 4 no no 0.983 0.927 0.644 0.0
Q9LRZ01131 Topless-related protein 2 no no 0.974 0.923 0.660 0.0
Q84JM41108 Topless-related protein 3 no no 0.966 0.934 0.626 0.0
Q008081356 Vegetative incompatibilit yes no 0.293 0.231 0.270 6e-18
Q8YRI11526 Uncharacterized WD repeat no no 0.554 0.389 0.216 1e-14
Q8YV571683 Uncharacterized WD repeat no no 0.463 0.294 0.218 2e-12
Q12788808 Transducin beta-like prot yes no 0.445 0.590 0.209 5e-11
Q2KJJ5800 Transducin beta-like prot yes no 0.424 0.568 0.213 1e-10
>sp|Q94AI7|TPL_ARATH Protein TOPLESS OS=Arabidopsis thaliana GN=TPL PE=1 SV=1 Back     alignment and function desciption
 Score = 1502 bits (3889), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 734/1076 (68%), Positives = 862/1076 (80%), Gaps = 33/1076 (3%)

Query: 1    MSSLSRELVFLILQFLDEEKFKETVHKLEQESGFFFNMKHFEDQVQAGEWDEVERYLCGF 60
            MSSLSRELVFLILQFLDEEKFKETVHKLEQESGFFFNMK+FED+V  G WDEVE+YL GF
Sbjct: 1    MSSLSRELVFLILQFLDEEKFKETVHKLEQESGFFFNMKYFEDEVHNGNWDEVEKYLSGF 60

Query: 61   TKVEDNRYSMKIFFEIRKQKYLEALDRQDRAKAVEILVKDLKVFSSFNEELFKEITQLLT 120
            TKV+DNRYSMKIFFEIRKQKYLEALD+ DR KAV+ILVKDLKVFS+FNEELFKEITQLLT
Sbjct: 61   TKVDDNRYSMKIFFEIRKQKYLEALDKHDRPKAVDILVKDLKVFSTFNEELFKEITQLLT 120

Query: 121  LDNFRQNEQLSKYGDTKSARNIMLVELKKLIEANPLFRDKLSFPSFKSSRLRTLINQSLN 180
            L+NFR+NEQLSKYGDTKSAR IMLVELKKLIEANPLFRDKL FP+ ++SRLRTLINQSLN
Sbjct: 121  LENFRENEQLSKYGDTKSARAIMLVELKKLIEANPLFRDKLQFPTLRNSRLRTLINQSLN 180

Query: 181  WQHQLCKNPRPNPDIKTLFTDHSCNPTSNGARPPPPTNNPLVGPIPKAGQFPPIGAHGPF 240
            WQHQLCKNPRPNPDIKTLF DHSC P  NGAR P P NNPL+G IPKAG FPP+GAHGPF
Sbjct: 181  WQHQLCKNPRPNPDIKTLFVDHSCGP-PNGARAPSPVNNPLLGGIPKAGGFPPLGAHGPF 239

Query: 241  QPVVSPSPGAIAGWMSSNSPSLPHPSMAAGPPGFVQPSSAVGFLKHPRTPTGMTGMDYQS 300
            QP  SP P  +AGWMSS S S+PHP+++AG      PS     LKHPRTP     +DY S
Sbjct: 240  QPTASPVPTPLAGWMSSPS-SVPHPAVSAGAIALGGPSIPAA-LKHPRTPPTNASLDYPS 297

Query: 301  ADSDHLMKRIR-TGQSDEV---------SFAGVAH--TPNVYSQDDLTKTVVRTLNQGSN 348
            ADS+H+ KR R  G SDEV         SF+G AH  +P   + DDL KTV RTL+QGS+
Sbjct: 298  ADSEHVSKRTRPMGISDEVNLGVNMLPMSFSGQAHGHSPAFKAPDDLPKTVARTLSQGSS 357

Query: 349  VMSMDFHPQQQTILLVGTNVGDISLWEVGSRERLAHKPFKVWDISAASMPLQNALLNDAA 408
             MSMDFHP +QT+LLVGTNVGDI LWEVGSRERL  K FKVWD+S  SMPLQ AL+ +  
Sbjct: 358  PMSMDFHPIKQTLLLVGTNVGDIGLWEVGSRERLVQKTFKVWDLSKCSMPLQAALVKEPV 417

Query: 409  ISVNRCVWGPDGLMLGVAFSKHIVHLYTYNPTGELRQHLEIDAHVGGVNDIAFAHPNKQL 468
            +SVNR +W PDG + GVA+S+HIV LY+Y+   ++RQHLEIDAHVGGVNDI+F+ PNKQL
Sbjct: 418  VSVNRVIWSPDGSLFGVAYSRHIVQLYSYHGGEDMRQHLEIDAHVGGVNDISFSTPNKQL 477

Query: 469  CIVTCGDDKMIKVWDVVAGRKQYTFEGHEAPVYSVCPHHKESIQFIFSTAIDGKIKAWLY 528
            C++TCGDDK IKVWD   G K++TFEGHEAPVYSVCPH+KE+IQFIFSTA+DGKIKAWLY
Sbjct: 478  CVITCGDDKTIKVWDAATGVKRHTFEGHEAPVYSVCPHYKENIQFIFSTALDGKIKAWLY 537

Query: 529  DYLGSRVDYDAPGNWCTMMAYSADGTRLFSCGTSKEGESHLVEWNESEGAIKRTYSGFRK 588
            D +GSRVDYDAPG WCT MAYSADGTRLFSCGTSK+GES +VEWNESEGA+KRTY GF K
Sbjct: 538  DNMGSRVDYDAPGRWCTTMAYSADGTRLFSCGTSKDGESFIVEWNESEGAVKRTYQGFHK 597

Query: 589  RSLGVVQFDTTRNRFLAAGDEFQIKFWDMDNMNMLTTVDADGGLPASPRLRFNKEGSLLA 648
            RSLGVVQFDTT+NR+LAAGD+F IKFWDMD + +LT +D DGGL ASPR+RFNKEGSLLA
Sbjct: 598  RSLGVVQFDTTKNRYLAAGDDFSIKFWDMDAVQLLTAIDGDGGLQASPRIRFNKEGSLLA 657

Query: 649  VTTSDNGIKILANSDGVRLLRMLEGRAMDKNRCPSEPISSKPLTINALGPASNVSAAIAP 708
            V+ ++N IKI+ANSDG+RLL   E  + +         SSKP  IN++  A+  +A  A 
Sbjct: 658  VSGNENVIKIMANSDGLRLLHTFENISSE---------SSKP-AINSIAAAAAAAATSA- 706

Query: 709  TLERPDRGPPAVSISSLGTIDGSRLVDVKPRVAEDV-DKIKSWRIPDISDPSQIKALRLP 767
                 DR    VSI  +   D   +VDVKP + E+  DK K W++ ++S+PSQ ++LRLP
Sbjct: 707  --GHADRSANVVSIQGMNG-DSRNMVDVKPVITEESNDKSKIWKLTEVSEPSQCRSLRLP 763

Query: 768  DSIAASKVVRLIYTNSGLSLLALASNAVHKLWKWQRTERNPSGKATANVAPQLWQPPSGT 827
            +++  +K+ RLI+TNSG ++LALASNA+H LWKWQR ERN +GKATA++ PQ WQP SG 
Sbjct: 764  ENLRVAKISRLIFTNSGNAILALASNAIHLLWKWQRNERNATGKATASLPPQQWQPASGI 823

Query: 828  LMTNDINESKPTEESAACIALSKNDSYVMSASGGKVSLFNMMTFKVMTMFMSPPPAATFL 887
            LMTND+ E+ P EE+  C ALSKNDSYVMSASGGK+SLFNMMTFK M  FM PPPAATFL
Sbjct: 824  LMTNDVAETNP-EEAVPCFALSKNDSYVMSASGGKISLFNMMTFKTMATFMPPPPAATFL 882

Query: 888  AFHPQDNNIIAIGMEDSSVQIYNVRVDEVKTKLKGHQNRITGLAFSPTLNALVSSGADAQ 947
            AFHPQDNNIIAIGM+DS++QIYNVRVDEVK+KLKGH  RITGLAFS  LN LVSSGADAQ
Sbjct: 883  AFHPQDNNIIAIGMDDSTIQIYNVRVDEVKSKLKGHSKRITGLAFSNVLNVLVSSGADAQ 942

Query: 948  LCMWSIDKWEKLKSRFIQAPAGRQSPLVGETKVQFHNDQTHLLVVHESQISVYD-SKLEC 1006
            LC+W+ D WEK +S+ +  P GR +    +T+VQFH DQ H LVVHE+Q+++Y+ +KLEC
Sbjct: 943  LCVWNTDGWEKQRSKVLPLPQGRPNSAPSDTRVQFHQDQAHFLVVHETQLAIYETTKLEC 1002

Query: 1007 SRSWSPKDALPAPISSAIYSCDGLLVYAGFCDGAIGVFDAETLRFRCRIGPSAYIP 1062
             + W+ +++L API+ A +SCD  LVYA F D  + VF +  LR RCR+ PSAY+P
Sbjct: 1003 MKQWAVRESL-APITHATFSCDSQLVYASFMDATVCVFSSANLRLRCRVNPSAYLP 1057
Transcriptional corepressor. May repress the expression of root-promoting genes in the top half of the embryo to allow proper differentiation of the shoot pole during the transition stage of embryogenesis. Regulates the expression of PLT1 and PLT2. Negative regulator of jasmonate responses. Negative regulator of auxin responses.
Arabidopsis thaliana (taxid: 3702)
>sp|Q0WV90|TPR1_ARATH Topless-related protein 1 OS=Arabidopsis thaliana GN=TPR1 PE=1 SV=3 Back     alignment and function description
>sp|Q27GK7|TPR4_ARATH Topless-related protein 4 OS=Arabidopsis thaliana GN=TPR4 PE=1 SV=2 Back     alignment and function description
>sp|Q9LRZ0|TPR2_ARATH Topless-related protein 2 OS=Arabidopsis thaliana GN=TPR2 PE=1 SV=2 Back     alignment and function description
>sp|Q84JM4|TPR3_ARATH Topless-related protein 3 OS=Arabidopsis thaliana GN=TPR3 PE=1 SV=1 Back     alignment and function description
>sp|Q00808|HETE1_PODAS Vegetative incompatibility protein HET-E-1 OS=Podospora anserina GN=HET-E1 PE=4 SV=1 Back     alignment and function description
>sp|Q8YRI1|YY46_NOSS1 Uncharacterized WD repeat-containing protein alr3466 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=alr3466 PE=4 SV=1 Back     alignment and function description
>sp|Q8YV57|Y2124_NOSS1 Uncharacterized WD repeat-containing protein all2124 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=all2124 PE=4 SV=1 Back     alignment and function description
>sp|Q12788|TBL3_HUMAN Transducin beta-like protein 3 OS=Homo sapiens GN=TBL3 PE=1 SV=2 Back     alignment and function description
>sp|Q2KJJ5|TBL3_BOVIN Transducin beta-like protein 3 OS=Bos taurus GN=TBL3 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query1071
2555579651137 conserved hypothetical protein [Ricinus 0.992 0.934 0.903 0.0
2254548321135 PREDICTED: protein TOPLESS [Vitis vinife 0.994 0.938 0.865 0.0
2241288661099 predicted protein [Populus trichocarpa] 0.957 0.933 0.849 0.0
1154749171133 Os08g0162100 [Oryza sativa Japonica Grou 0.990 0.936 0.782 0.0
3571448891135 PREDICTED: topless-related protein 1-lik 0.987 0.932 0.783 0.0
3045555731141 ramosa 1 enhancer locus 2 [Zea mays] gi| 0.988 0.928 0.786 0.0
378062721150 WD-40 repeat protein-like [Oryza sativa 0.990 0.922 0.769 0.0
2420782791136 hypothetical protein SORBIDRAFT_07g00418 0.965 0.910 0.783 0.0
1680311651158 predicted protein [Physcomitrella patens 0.986 0.912 0.726 0.0
1680600041102 predicted protein [Physcomitrella patens 0.954 0.927 0.734 0.0
>gi|255557965|ref|XP_002520011.1| conserved hypothetical protein [Ricinus communis] gi|223540775|gb|EEF42335.1| conserved hypothetical protein [Ricinus communis] Back     alignment and taxonomy information
 Score = 2014 bits (5218), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 961/1064 (90%), Positives = 1014/1064 (95%), Gaps = 1/1064 (0%)

Query: 1    MSSLSRELVFLILQFLDEEKFKETVHKLEQESGFFFNMKHFEDQVQAGEWDEVERYLCGF 60
            MSSLSRELVFLILQFLDEEKFKETVHKLEQESGFFFNMKHFEDQVQAGEWDEVERYLCGF
Sbjct: 1    MSSLSRELVFLILQFLDEEKFKETVHKLEQESGFFFNMKHFEDQVQAGEWDEVERYLCGF 60

Query: 61   TKVEDNRYSMKIFFEIRKQKYLEALDRQDRAKAVEILVKDLKVFSSFNEELFKEITQLLT 120
            TKVEDNRYSMKIFFEIRKQKYLEALDRQDRAKAVEIL KDLKVF+SFNEELFKEITQLLT
Sbjct: 61   TKVEDNRYSMKIFFEIRKQKYLEALDRQDRAKAVEILCKDLKVFASFNEELFKEITQLLT 120

Query: 121  LDNFRQNEQLSKYGDTKSARNIMLVELKKLIEANPLFRDKLSFPSFKSSRLRTLINQSLN 180
            LDNFRQNEQLSKYGDTKSARNIMLVELKKLIEANPLFRDKL+FP+FKSSRLRTLINQSLN
Sbjct: 121  LDNFRQNEQLSKYGDTKSARNIMLVELKKLIEANPLFRDKLTFPAFKSSRLRTLINQSLN 180

Query: 181  WQHQLCKNPRPNPDIKTLFTDHSCNP-TSNGARPPPPTNNPLVGPIPKAGQFPPIGAHGP 239
            WQHQLCKNPRPNPDIKTLFTDHSC+P T+NGARPPPPTN+P+VGPIPKAG FPPIGAHGP
Sbjct: 181  WQHQLCKNPRPNPDIKTLFTDHSCSPSTANGARPPPPTNSPIVGPIPKAGAFPPIGAHGP 240

Query: 240  FQPVVSPSPGAIAGWMSSNSPSLPHPSMAAGPPGFVQPSSAVGFLKHPRTPTGMTGMDYQ 299
            FQPVVSPSPGAIAGWMSSN+PSLPHP++AAGPPG VQPSSA  FLKHPRTPTGMTG+DYQ
Sbjct: 241  FQPVVSPSPGAIAGWMSSNNPSLPHPAVAAGPPGLVQPSSAAAFLKHPRTPTGMTGIDYQ 300

Query: 300  SADSDHLMKRIRTGQSDEVSFAGVAHTPNVYSQDDLTKTVVRTLNQGSNVMSMDFHPQQQ 359
            SADS+HLMKR+RTGQSDEVSF+GVAHTPNVYS DDL KTV+R+L+QGSNVMSMDFHPQQQ
Sbjct: 301  SADSEHLMKRMRTGQSDEVSFSGVAHTPNVYSPDDLPKTVMRSLSQGSNVMSMDFHPQQQ 360

Query: 360  TILLVGTNVGDISLWEVGSRERLAHKPFKVWDISAASMPLQNALLNDAAISVNRCVWGPD 419
            TILLVGTNVGDISLWEVGSRERLAHKPFKVWD+SAASMPLQ ALLNDAAISVNRCVWGPD
Sbjct: 361  TILLVGTNVGDISLWEVGSRERLAHKPFKVWDLSAASMPLQAALLNDAAISVNRCVWGPD 420

Query: 420  GLMLGVAFSKHIVHLYTYNPTGELRQHLEIDAHVGGVNDIAFAHPNKQLCIVTCGDDKMI 479
            GLMLGVAFSKHIV LY YNPTGELRQHLEIDAHVGGVNDIAFAHPNKQLCIVTCGDDKMI
Sbjct: 421  GLMLGVAFSKHIVQLYAYNPTGELRQHLEIDAHVGGVNDIAFAHPNKQLCIVTCGDDKMI 480

Query: 480  KVWDVVAGRKQYTFEGHEAPVYSVCPHHKESIQFIFSTAIDGKIKAWLYDYLGSRVDYDA 539
            KVWD VAGR+QYTFEGHEAPVYSVCPH+KE+IQFIFSTAIDGKIKAWLYD LGSRVDYDA
Sbjct: 481  KVWDAVAGRRQYTFEGHEAPVYSVCPHYKENIQFIFSTAIDGKIKAWLYDSLGSRVDYDA 540

Query: 540  PGNWCTMMAYSADGTRLFSCGTSKEGESHLVEWNESEGAIKRTYSGFRKRSLGVVQFDTT 599
            PG WCTMMAYSADG+RLFSCGTSKEGESHLVEWNESEG IKRTYSGFRKRS GVVQFDTT
Sbjct: 541  PGLWCTMMAYSADGSRLFSCGTSKEGESHLVEWNESEGTIKRTYSGFRKRSSGVVQFDTT 600

Query: 600  RNRFLAAGDEFQIKFWDMDNMNMLTTVDADGGLPASPRLRFNKEGSLLAVTTSDNGIKIL 659
            R+RFLAAGDEFQIKFWDMDN NMLT VDADGGLPASPRLRFNKEGSLLAVTTSDNGIKIL
Sbjct: 601  RSRFLAAGDEFQIKFWDMDNTNMLTAVDADGGLPASPRLRFNKEGSLLAVTTSDNGIKIL 660

Query: 660  ANSDGVRLLRMLEGRAMDKNRCPSEPISSKPLTINALGPASNVSAAIAPTLERPDRGPPA 719
            ANSDG+RL+RMLE RA+DKNR PSEPI+SKPL +NALGP +NVS+ +A  LER DR PPA
Sbjct: 661  ANSDGLRLIRMLESRAIDKNRSPSEPINSKPLIVNALGPVANVSSGLATALERVDRMPPA 720

Query: 720  VSISSLGTIDGSRLVDVKPRVAEDVDKIKSWRIPDISDPSQIKALRLPDSIAASKVVRLI 779
            V+ISSLGT+D SRLVDVKPR+++++DKIKSW+IPDI D S +KALRLPDSIA  KVVRLI
Sbjct: 721  VAISSLGTMDSSRLVDVKPRISDELDKIKSWKIPDIVDQSHLKALRLPDSIATGKVVRLI 780

Query: 780  YTNSGLSLLALASNAVHKLWKWQRTERNPSGKATANVAPQLWQPPSGTLMTNDINESKPT 839
            YTNSGL+LLALASNAVHKLWKWQR+ERNPSGKATA VAPQLWQPPSGTLMTNDI++SKP 
Sbjct: 781  YTNSGLALLALASNAVHKLWKWQRSERNPSGKATAYVAPQLWQPPSGTLMTNDISDSKPA 840

Query: 840  EESAACIALSKNDSYVMSASGGKVSLFNMMTFKVMTMFMSPPPAATFLAFHPQDNNIIAI 899
            EESAACIALSKNDSYVMSASGGKVSLFNMMTFKVMT FMSPPPAATFLAFHPQDNNIIAI
Sbjct: 841  EESAACIALSKNDSYVMSASGGKVSLFNMMTFKVMTTFMSPPPAATFLAFHPQDNNIIAI 900

Query: 900  GMEDSSVQIYNVRVDEVKTKLKGHQNRITGLAFSPTLNALVSSGADAQLCMWSIDKWEKL 959
            GMEDSSVQIYNVRVDEVKTKLKGHQNRITGLAFS +LN LVSSGADAQLC+WSID WEK 
Sbjct: 901  GMEDSSVQIYNVRVDEVKTKLKGHQNRITGLAFSQSLNVLVSSGADAQLCVWSIDGWEKK 960

Query: 960  KSRFIQAPAGRQSPLVGETKVQFHNDQTHLLVVHESQISVYDSKLECSRSWSPKDALPAP 1019
            KSRFIQAP GRQSPL GETKVQFHNDQTHLLVVHESQI++YDSKLEC RSW PKD L AP
Sbjct: 961  KSRFIQAPPGRQSPLAGETKVQFHNDQTHLLVVHESQIAIYDSKLECLRSWYPKDTLTAP 1020

Query: 1020 ISSAIYSCDGLLVYAGFCDGAIGVFDAETLRFRCRIGPSAYIPT 1063
            I+SAIYS DGLLVY GFCDGA+GVFDA++LR RCRI PSAYIP+
Sbjct: 1021 IASAIYSSDGLLVYTGFCDGAVGVFDADSLRVRCRIAPSAYIPS 1064

Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|225454832|ref|XP_002275116.1| PREDICTED: protein TOPLESS [Vitis vinifera] gi|297737353|emb|CBI26554.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|224128866|ref|XP_002328986.1| predicted protein [Populus trichocarpa] gi|222839220|gb|EEE77571.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|115474917|ref|NP_001061055.1| Os08g0162100 [Oryza sativa Japonica Group] gi|113623024|dbj|BAF22969.1| Os08g0162100 [Oryza sativa Japonica Group] gi|125560238|gb|EAZ05686.1| hypothetical protein OsI_27917 [Oryza sativa Indica Group] gi|371501278|dbj|BAL44266.1| ASP1 protein [Oryza sativa Japonica Group] Back     alignment and taxonomy information
>gi|357144889|ref|XP_003573449.1| PREDICTED: topless-related protein 1-like [Brachypodium distachyon] Back     alignment and taxonomy information
>gi|304555573|ref|NP_001167872.2| ramosa 1 enhancer locus 2 [Zea mays] gi|303387473|gb|ADM15670.1| ramosa 1 enhancer locus 2 [Zea mays] gi|303387475|gb|ADM15671.1| ramosa 1 enhancer locus 2 [Zea mays] gi|413917313|gb|AFW57245.1| ramosa1 enhancer locus2 [Zea mays] Back     alignment and taxonomy information
>gi|37806272|dbj|BAC99788.1| WD-40 repeat protein-like [Oryza sativa Japonica Group] gi|125602281|gb|EAZ41606.1| hypothetical protein OsJ_26138 [Oryza sativa Japonica Group] Back     alignment and taxonomy information
>gi|242078279|ref|XP_002443908.1| hypothetical protein SORBIDRAFT_07g004180 [Sorghum bicolor] gi|241940258|gb|EES13403.1| hypothetical protein SORBIDRAFT_07g004180 [Sorghum bicolor] Back     alignment and taxonomy information
>gi|168031165|ref|XP_001768092.1| predicted protein [Physcomitrella patens subsp. patens] gi|162680730|gb|EDQ67164.1| predicted protein [Physcomitrella patens subsp. patens] Back     alignment and taxonomy information
>gi|168060004|ref|XP_001781989.1| predicted protein [Physcomitrella patens subsp. patens] gi|162666562|gb|EDQ53213.1| predicted protein [Physcomitrella patens subsp. patens] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query1071
TAIR|locus:20362041131 TPL "TOPLESS" [Arabidopsis tha 0.973 0.922 0.667 0.0
TAIR|locus:20867701131 TPR2 "TOPLESS-related 2" [Arab 0.973 0.922 0.653 0.0
TAIR|locus:21988881120 TPR1 "TOPLESS-related 1" [Arab 0.650 0.622 0.706 0.0
TAIR|locus:2040100740 AT2G25420 "AT2G25420" [Arabido 0.279 0.404 0.376 1.2e-76
ASPGD|ASPL00000321621364 AN8468 [Emericella nidulans (t 0.492 0.387 0.240 9.6e-22
DICTYBASE|DDB_G0278353530 smu1 "suppressor of mec-8 and 0.147 0.298 0.294 4.8e-18
FB|FBgn0037094630 CG7611 [Drosophila melanogaste 0.180 0.306 0.266 2.8e-12
ASPGD|ASPL0000038644577 AN10391 [Emericella nidulans ( 0.225 0.419 0.274 6.2e-12
TAIR|locus:2159562589 AT5G08560 "AT5G08560" [Arabido 0.173 0.315 0.246 1.3e-10
DICTYBASE|DDB_G0287273335 wdr5 "WD40 repeat-containing p 0.183 0.588 0.259 1.8e-10
TAIR|locus:2036204 TPL "TOPLESS" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 3716 (1313.2 bits), Expect = 0., P = 0.
 Identities = 718/1076 (66%), Positives = 842/1076 (78%)

Query:     1 MSSLSRELVFLILQFLDEEKFKETVHKLEQESGFFFNMKHFEDQVQAGEWDEVERYLCGF 60
             MSSLSRELVFLILQFLDEEKFKETVHKLEQESGFFFNMK+FED+V  G WDEVE+YL GF
Sbjct:     1 MSSLSRELVFLILQFLDEEKFKETVHKLEQESGFFFNMKYFEDEVHNGNWDEVEKYLSGF 60

Query:    61 TKVEDNRYSMKIFFEIRKQKYLEALDRQDRAKAVEILVKDLKVFSSFNEELFKEITQLLT 120
             TKV+DNRYSMKIFFEIRKQKYLEALD+ DR KAV+ILVKDLKVFS+FNEELFKEITQLLT
Sbjct:    61 TKVDDNRYSMKIFFEIRKQKYLEALDKHDRPKAVDILVKDLKVFSTFNEELFKEITQLLT 120

Query:   121 LDNFRQNEQLSKYGDTKSARNIMLVELKKLIEANPLFRDKLSFPSFKSSRLRTLINQSLN 180
             L+NFR+NEQLSKYGDTKSAR IMLVELKKLIEANPLFRDKL FP+ ++SRLRTLINQSLN
Sbjct:   121 LENFRENEQLSKYGDTKSARAIMLVELKKLIEANPLFRDKLQFPTLRNSRLRTLINQSLN 180

Query:   181 WQHQLCKNPRPNPDIKTLFTDHSCNPTSNGARXXXXXXXXXXXXXXKAGQFPPIGAHGPF 240
             WQHQLCKNPRPNPDIKTLF DHSC P  NGAR              KAG FPP+GAHGPF
Sbjct:   181 WQHQLCKNPRPNPDIKTLFVDHSCGPP-NGARAPSPVNNPLLGGIPKAGGFPPLGAHGPF 239

Query:   241 QPVVSPSPGAIAGWMSSNSPSLPHPSMAAGPPGFVQPSSAVGFLKHPRTPTGMTGMDYQS 300
             QP  SP P  +AGWMSS S S+PHP+++AG      PS     LKHPRTP     +DY S
Sbjct:   240 QPTASPVPTPLAGWMSSPS-SVPHPAVSAGAIALGGPSIPAA-LKHPRTPPTNASLDYPS 297

Query:   301 ADSDHLMKRIRT-GQSDEV---------SFAGVAH--TPNVYSQDDLTKTVVRTLNQGSN 348
             ADS+H+ KR R  G SDEV         SF+G AH  +P   + DDL KTV RTL+QGS+
Sbjct:   298 ADSEHVSKRTRPMGISDEVNLGVNMLPMSFSGQAHGHSPAFKAPDDLPKTVARTLSQGSS 357

Query:   349 VMSMDFHPQQQTILLVGTNVGDISLWEVGSRERLAHKPFKVWDISAASMPLQNALLNDAA 408
              MSMDFHP +QT+LLVGTNVGDI LWEVGSRERL  K FKVWD+S  SMPLQ AL+ +  
Sbjct:   358 PMSMDFHPIKQTLLLVGTNVGDIGLWEVGSRERLVQKTFKVWDLSKCSMPLQAALVKEPV 417

Query:   409 ISVNRCVWGPDGLMLGVAFSKHIVHLYTYNPTGELRQHLEIDAHVGGVNDIAFAHPNKQL 468
             +SVNR +W PDG + GVA+S+HIV LY+Y+   ++RQHLEIDAHVGGVNDI+F+ PNKQL
Sbjct:   418 VSVNRVIWSPDGSLFGVAYSRHIVQLYSYHGGEDMRQHLEIDAHVGGVNDISFSTPNKQL 477

Query:   469 CIVTCGDDKMIKVWDVVAGRKQYTFEGHEAPVYSVCPHHKESIQFIFSTAIDGKIKAWLY 528
             C++TCGDDK IKVWD   G K++TFEGHEAPVYSVCPH+KE+IQFIFSTA+DGKIKAWLY
Sbjct:   478 CVITCGDDKTIKVWDAATGVKRHTFEGHEAPVYSVCPHYKENIQFIFSTALDGKIKAWLY 537

Query:   529 DYLGSRVDYDAPGNWCTMMAYSADGTRLFSCGTSKEGESHLVEWNESEGAIKRTYSGFRK 588
             D +GSRVDYDAPG WCT MAYSADGTRLFSCGTSK+GES +VEWNESEGA+KRTY GF K
Sbjct:   538 DNMGSRVDYDAPGRWCTTMAYSADGTRLFSCGTSKDGESFIVEWNESEGAVKRTYQGFHK 597

Query:   589 RSLGVVQFDTTRNRFLAAGDEFQIKFWDMDNMNMLTTVDADGGLPASPRLRFNKEGSLLA 648
             RSLGVVQFDTT+NR+LAAGD+F IKFWDMD + +LT +D DGGL ASPR+RFNKEGSLLA
Sbjct:   598 RSLGVVQFDTTKNRYLAAGDDFSIKFWDMDAVQLLTAIDGDGGLQASPRIRFNKEGSLLA 657

Query:   649 VTTSDNGIKILANSDGVRLLRMLEGRAMDKNRCPSEPISSKPLTINALGPASNVSAAIAP 708
             V+ ++N IKI+ANSDG+RLL   E  +       SE  SSKP  IN++  A+   AA A 
Sbjct:   658 VSGNENVIKIMANSDGLRLLHTFENIS-------SE--SSKP-AINSIAAAA---AAAAT 704

Query:   709 TLERPDRGPPAVSISSLGTIDGSRLVDVKPRVAEDV-DKIKSWRIPDISDPSQIKALRLP 767
             +    DR    VSI  +   D   +VDVKP + E+  DK K W++ ++S+PSQ ++LRLP
Sbjct:   705 SAGHADRSANVVSIQGMNG-DSRNMVDVKPVITEESNDKSKIWKLTEVSEPSQCRSLRLP 763

Query:   768 DSIAASKVVRLIYTXXXXXXXXXXXXXVHKLWKWQRTERNPSGKATANVAPQLWQPPSGT 827
             +++  +K+ RLI+T             +H LWKWQR ERN +GKATA++ PQ WQP SG 
Sbjct:   764 ENLRVAKISRLIFTNSGNAILALASNAIHLLWKWQRNERNATGKATASLPPQQWQPASGI 823

Query:   828 LMTNDINESKPTEESAACIALSKNDSYVMSASGGKVSLFNMMTFKVMTMFMSPPPAATFL 887
             LMTND+ E+ P EE+  C ALSKNDSYVMSASGGK+SLFNMMTFK M  FM PPPAATFL
Sbjct:   824 LMTNDVAETNP-EEAVPCFALSKNDSYVMSASGGKISLFNMMTFKTMATFMPPPPAATFL 882

Query:   888 AFHPQDNNIIAIGMEDSSVQIYNVRVDEVKTKLKGHQNRITGLAFSPTLNALVSSGADAQ 947
             AFHPQDNNIIAIGM+DS++QIYNVRVDEVK+KLKGH  RITGLAFS  LN LVSSGADAQ
Sbjct:   883 AFHPQDNNIIAIGMDDSTIQIYNVRVDEVKSKLKGHSKRITGLAFSNVLNVLVSSGADAQ 942

Query:   948 LCMWSIDKWEKLKSRFIQAPAGRQSPLVGETKVQFHNDQTHLLVVHESQISVYDS-KLEC 1006
             LC+W+ D WEK +S+ +  P GR +    +T+VQFH DQ H LVVHE+Q+++Y++ KLEC
Sbjct:   943 LCVWNTDGWEKQRSKVLPLPQGRPNSAPSDTRVQFHQDQAHFLVVHETQLAIYETTKLEC 1002

Query:  1007 SRSWSPKDALPAPISSAIYSCDGLLVYAGFCDGAIGVFDAETLRFRCRIGPSAYIP 1062
              + W+ +++L API+ A +SCD  LVYA F D  + VF +  LR RCR+ PSAY+P
Sbjct:  1003 MKQWAVRESL-APITHATFSCDSQLVYASFMDATVCVFSSANLRLRCRVNPSAYLP 1057
GO:0005634 "nucleus" evidence=ISM;IDA
GO:0005515 "protein binding" evidence=IPI
GO:0010072 "primary shoot apical meristem specification" evidence=IGI;IMP
GO:0009733 "response to auxin stimulus" evidence=IPI
GO:0010051 "xylem and phloem pattern formation" evidence=IGI
GO:0042803 "protein homodimerization activity" evidence=IPI
GO:0045892 "negative regulation of transcription, DNA-dependent" evidence=IDA
GO:0005829 "cytosol" evidence=IDA
GO:0009867 "jasmonic acid mediated signaling pathway" evidence=IMP
TAIR|locus:2086770 TPR2 "TOPLESS-related 2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2198888 TPR1 "TOPLESS-related 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2040100 AT2G25420 "AT2G25420" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
ASPGD|ASPL0000032162 AN8468 [Emericella nidulans (taxid:162425)] Back     alignment and assigned GO terms
DICTYBASE|DDB_G0278353 smu1 "suppressor of mec-8 and unc-52-like protein" [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms
FB|FBgn0037094 CG7611 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
ASPGD|ASPL0000038644 AN10391 [Emericella nidulans (taxid:162425)] Back     alignment and assigned GO terms
TAIR|locus:2159562 AT5G08560 "AT5G08560" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
DICTYBASE|DDB_G0287273 wdr5 "WD40 repeat-containing protein" [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q94AI7TPL_ARATHNo assigned EC number0.68210.97380.9221yesno

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
GSVIVG00014065001
SubName- Full=Chromosome chr16 scaffold_10, whole genome shotgun sequence; (1135 aa)
(Vitis vinifera)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query1071
cd00200289 cd00200, WD40, WD40 domain, found in a number of e 1e-22
cd00200289 cd00200, WD40, WD40 domain, found in a number of e 5e-22
cd00200289 cd00200, WD40, WD40 domain, found in a number of e 5e-20
COG2319466 COG2319, COG2319, FOG: WD40 repeat [General functi 1e-17
cd00200289 cd00200, WD40, WD40 domain, found in a number of e 2e-14
COG2319466 COG2319, COG2319, FOG: WD40 repeat [General functi 3e-14
COG2319466 COG2319, COG2319, FOG: WD40 repeat [General functi 4e-14
cd00200289 cd00200, WD40, WD40 domain, found in a number of e 5e-14
smart0066858 smart00668, CTLH, C-terminal to LisH motif 5e-12
COG2319466 COG2319, COG2319, FOG: WD40 repeat [General functi 3e-11
COG2319466 COG2319, COG2319, FOG: WD40 repeat [General functi 2e-08
cd00200 289 cd00200, WD40, WD40 domain, found in a number of e 6e-08
cd00200289 cd00200, WD40, WD40 domain, found in a number of e 2e-07
smart0066734 smart00667, LisH, Lissencephaly type-1-like homolo 5e-06
smart0032040 smart00320, WD40, WD40 repeats 2e-05
pfam0040039 pfam00400, WD40, WD domain, G-beta repeat 3e-05
pfam0040039 pfam00400, WD40, WD domain, G-beta repeat 6e-05
smart0032040 smart00320, WD40, WD40 repeats 7e-05
pfam0040039 pfam00400, WD40, WD domain, G-beta repeat 0.002
pfam10607144 pfam10607, CLTH, CTLH/CRA C-terminal to LisH motif 0.003
>gnl|CDD|238121 cd00200, WD40, WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and bottom surface of the propeller are proposed to coordinate interactions with other proteins and/or small ligands; 7 copies of the repeat are present in this alignment Back     alignment and domain information 
 Score = 98.9 bits (247), Expect = 1e-22
 Identities = 61/231 (26%), Positives = 88/231 (38%), Gaps = 32/231 (13%)

Query: 336 TKTVVRTLNQ-GSNVMSMDFHPQQQTILLVGTNVGDISLWEVGSRERLAHKPFKVWDISA 394
           T   VRTL    S V S+ F P  + IL   +    I +W+V + + L            
Sbjct: 82  TGECVRTLTGHTSYVSSVAFSPDGR-ILSSSSRDKTIKVWDVETGKCL------------ 128

Query: 395 ASMPLQNALLNDAAISVNRCVWGPDGLMLGVAFSKHIVHLYTYNPTGELRQHLEIDAHVG 454
                    L      VN   + PDG  +  +     + L+    TG+      +  H G
Sbjct: 129 -------TTLRGHTDWVNSVAFSPDGTFVASSSQDGTIKLWDLR-TGKCVA--TLTGHTG 178

Query: 455 GVNDIAFAHPNKQLCIVTCGDDKMIKVWDVVAGRKQYTFEGHEAPVYSVCPHHKESIQFI 514
            VN +AF+   ++L   +   D  IK+WD+  G+   T  GHE  V SV          +
Sbjct: 179 EVNSVAFSPDGEKLL--SSSSDGTIKLWDLSTGKCLGTLRGHENGVNSVAFSPDG--YLL 234

Query: 515 FSTAIDGKIKAWLYDYLGSRVDYDAPG--NWCTMMAYSADGTRLFSCGTSK 563
            S + DG I+ W  D           G  N  T +A+S DG RL S     
Sbjct: 235 ASGSEDGTIRVW--DLRTGECVQTLSGHTNSVTSLAWSPDGKRLASGSADG 283

Length = 289
>gnl|CDD|238121 cd00200, WD40, WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and bottom surface of the propeller are proposed to coordinate interactions with other proteins and/or small ligands; 7 copies of the repeat are present in this alignment Back     alignment and domain information
>gnl|CDD|238121 cd00200, WD40, WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and bottom surface of the propeller are proposed to coordinate interactions with other proteins and/or small ligands; 7 copies of the repeat are present in this alignment Back     alignment and domain information
>gnl|CDD|225201 COG2319, COG2319, FOG: WD40 repeat [General function prediction only] Back     alignment and domain information
>gnl|CDD|238121 cd00200, WD40, WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and bottom surface of the propeller are proposed to coordinate interactions with other proteins and/or small ligands; 7 copies of the repeat are present in this alignment Back     alignment and domain information
>gnl|CDD|225201 COG2319, COG2319, FOG: WD40 repeat [General function prediction only] Back     alignment and domain information
>gnl|CDD|225201 COG2319, COG2319, FOG: WD40 repeat [General function prediction only] Back     alignment and domain information
>gnl|CDD|238121 cd00200, WD40, WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and bottom surface of the propeller are proposed to coordinate interactions with other proteins and/or small ligands; 7 copies of the repeat are present in this alignment Back     alignment and domain information
>gnl|CDD|128914 smart00668, CTLH, C-terminal to LisH motif Back     alignment and domain information
>gnl|CDD|225201 COG2319, COG2319, FOG: WD40 repeat [General function prediction only] Back     alignment and domain information
>gnl|CDD|225201 COG2319, COG2319, FOG: WD40 repeat [General function prediction only] Back     alignment and domain information
>gnl|CDD|238121 cd00200, WD40, WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and bottom surface of the propeller are proposed to coordinate interactions with other proteins and/or small ligands; 7 copies of the repeat are present in this alignment Back     alignment and domain information
>gnl|CDD|238121 cd00200, WD40, WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and bottom surface of the propeller are proposed to coordinate interactions with other proteins and/or small ligands; 7 copies of the repeat are present in this alignment Back     alignment and domain information
>gnl|CDD|128913 smart00667, LisH, Lissencephaly type-1-like homology motif Back     alignment and domain information
>gnl|CDD|197651 smart00320, WD40, WD40 repeats Back     alignment and domain information
>gnl|CDD|201208 pfam00400, WD40, WD domain, G-beta repeat Back     alignment and domain information
>gnl|CDD|201208 pfam00400, WD40, WD domain, G-beta repeat Back     alignment and domain information
>gnl|CDD|197651 smart00320, WD40, WD40 repeats Back     alignment and domain information
>gnl|CDD|201208 pfam00400, WD40, WD domain, G-beta repeat Back     alignment and domain information
>gnl|CDD|220824 pfam10607, CLTH, CTLH/CRA C-terminal to LisH motif domain Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 1071
KOG0293519 consensus WD40 repeat-containing protein [Function 100.0
KOG0275508 consensus Conserved WD40 repeat-containing protein 100.0
KOG0319 775 consensus WD40-repeat-containing subunit of the 18 100.0
KOG0319775 consensus WD40-repeat-containing subunit of the 18 100.0
KOG0318603 consensus WD40 repeat stress protein/actin interac 100.0
KOG0291 893 consensus WD40-repeat-containing subunit of the 18 100.0
KOG0291 893 consensus WD40-repeat-containing subunit of the 18 100.0
KOG0318603 consensus WD40 repeat stress protein/actin interac 100.0
KOG0306 888 consensus WD40-repeat-containing subunit of the 18 100.0
KOG0271480 consensus Notchless-like WD40 repeat-containing pr 100.0
KOG0271480 consensus Notchless-like WD40 repeat-containing pr 100.0
KOG0306 888 consensus WD40-repeat-containing subunit of the 18 100.0
KOG0263707 consensus Transcription initiation factor TFIID, s 100.0
KOG1408 1080 consensus WD40 repeat protein [Function unknown] 100.0
KOG0272459 consensus U4/U6 small nuclear ribonucleoprotein Pr 100.0
KOG0273524 consensus Beta-transducin family (WD-40 repeat) pr 100.0
KOG1063764 consensus RNA polymerase II elongator complex, sub 100.0
KOG0286343 consensus G-protein beta subunit [General function 100.0
KOG0272459 consensus U4/U6 small nuclear ribonucleoprotein Pr 100.0
KOG0276 794 consensus Vesicle coat complex COPI, beta' subunit 100.0
KOG0279315 consensus G protein beta subunit-like protein [Sig 100.0
KOG1408 1080 consensus WD40 repeat protein [Function unknown] 100.0
KOG1539 910 consensus WD repeat protein [General function pred 100.0
KOG1539 910 consensus WD repeat protein [General function pred 100.0
KOG1063764 consensus RNA polymerase II elongator complex, sub 100.0
KOG0276 794 consensus Vesicle coat complex COPI, beta' subunit 100.0
KOG0286343 consensus G-protein beta subunit [General function 100.0
KOG0292 1202 consensus Vesicle coat complex COPI, alpha subunit 100.0
KOG0315311 consensus G-protein beta subunit-like protein (con 100.0
KOG2106626 consensus Uncharacterized conserved protein, conta 100.0
KOG0292 1202 consensus Vesicle coat complex COPI, alpha subunit 100.0
KOG0296399 consensus Angio-associated migratory cell protein 100.0
KOG0295406 consensus WD40 repeat-containing protein [Function 100.0
KOG0279315 consensus G protein beta subunit-like protein [Sig 100.0
KOG0284464 consensus Polyadenylation factor I complex, subuni 100.0
KOG0315311 consensus G-protein beta subunit-like protein (con 100.0
KOG0285460 consensus Pleiotropic regulator 1 [RNA processing 100.0
KOG0273524 consensus Beta-transducin family (WD-40 repeat) pr 100.0
KOG0296399 consensus Angio-associated migratory cell protein 100.0
KOG0265338 consensus U5 snRNP-specific protein-like factor an 100.0
KOG0645312 consensus WD40 repeat protein [General function pr 100.0
KOG2106626 consensus Uncharacterized conserved protein, conta 100.0
KOG0295406 consensus WD40 repeat-containing protein [Function 100.0
KOG0285460 consensus Pleiotropic regulator 1 [RNA processing 100.0
KOG2048 691 consensus WD40 repeat protein [General function pr 100.0
KOG0266456 consensus WD40 repeat-containing protein [General 100.0
KOG0265338 consensus U5 snRNP-specific protein-like factor an 100.0
KOG0316307 consensus Conserved WD40 repeat-containing protein 100.0
KOG0293519 consensus WD40 repeat-containing protein [Function 100.0
KOG2048691 consensus WD40 repeat protein [General function pr 100.0
KOG0263707 consensus Transcription initiation factor TFIID, s 100.0
KOG1445 1012 consensus Tumor-specific antigen (contains WD repe 100.0
KOG0282503 consensus mRNA splicing factor [Function unknown] 100.0
KOG0284464 consensus Polyadenylation factor I complex, subuni 100.0
KOG0281499 consensus Beta-TrCP (transducin repeats containing 100.0
KOG0645312 consensus WD40 repeat protein [General function pr 100.0
KOG0282503 consensus mRNA splicing factor [Function unknown] 100.0
cd00200289 WD40 WD40 domain, found in a number of eukaryotic 100.0
KOG0266456 consensus WD40 repeat-containing protein [General 99.98
KOG0316307 consensus Conserved WD40 repeat-containing protein 99.97
PLN00181793 protein SPA1-RELATED; Provisional 99.97
KOG0281499 consensus Beta-TrCP (transducin repeats containing 99.97
KOG0973 942 consensus Histone transcription regulator HIRA, WD 99.97
cd00200289 WD40 WD40 domain, found in a number of eukaryotic 99.97
KOG0278334 consensus Serine/threonine kinase receptor-associa 99.97
KOG0641350 consensus WD40 repeat protein [General function pr 99.97
PLN00181793 protein SPA1-RELATED; Provisional 99.97
KOG0310487 consensus Conserved WD40 repeat-containing protein 99.97
KOG0275508 consensus Conserved WD40 repeat-containing protein 99.97
KOG0288459 consensus WD40 repeat protein TipD [General functi 99.97
KOG0313423 consensus Microtubule binding protein YTM1 (contai 99.97
KOG0278334 consensus Serine/threonine kinase receptor-associa 99.97
KOG0643327 consensus Translation initiation factor 3, subunit 99.96
KOG0643327 consensus Translation initiation factor 3, subunit 99.96
KOG1446311 consensus Histone H3 (Lys4) methyltransferase comp 99.96
PTZ00421493 coronin; Provisional 99.96
KOG1407313 consensus WD40 repeat protein [Function unknown] 99.96
KOG0647347 consensus mRNA export protein (contains WD40 repea 99.96
KOG0277311 consensus Peroxisomal targeting signal type 2 rece 99.96
KOG1445 1012 consensus Tumor-specific antigen (contains WD repe 99.96
KOG1407313 consensus WD40 repeat protein [Function unknown] 99.96
KOG0305484 consensus Anaphase promoting complex, Cdc20, Cdh1, 99.96
KOG0640430 consensus mRNA cleavage stimulating factor complex 99.96
KOG0313423 consensus Microtubule binding protein YTM1 (contai 99.96
KOG0283712 consensus WD40 repeat-containing protein [Function 99.96
KOG0274537 consensus Cdc4 and related F-box and WD-40 protein 99.96
KOG0640430 consensus mRNA cleavage stimulating factor complex 99.96
KOG1446311 consensus Histone H3 (Lys4) methyltransferase comp 99.96
KOG0277311 consensus Peroxisomal targeting signal type 2 rece 99.95
KOG0299479 consensus U3 snoRNP-associated protein (contains W 99.95
KOG0305484 consensus Anaphase promoting complex, Cdc20, Cdh1, 99.95
KOG0283 712 consensus WD40 repeat-containing protein [Function 99.95
KOG0288459 consensus WD40 repeat protein TipD [General functi 99.95
KOG0772641 consensus Uncharacterized conserved protein, conta 99.95
PTZ00420568 coronin; Provisional 99.95
KOG0772641 consensus Uncharacterized conserved protein, conta 99.95
KOG2096420 consensus WD40 repeat protein [General function pr 99.95
PTZ00421493 coronin; Provisional 99.95
KOG0300481 consensus WD40 repeat-containing protein [Function 99.95
KOG1274 933 consensus WD40 repeat protein [General function pr 99.94
KOG0289506 consensus mRNA splicing factor [General function p 99.94
KOG0301745 consensus Phospholipase A2-activating protein (con 99.94
KOG0268433 consensus Sof1-like rRNA processing protein (conta 99.94
KOG0308735 consensus Conserved WD40 repeat-containing protein 99.94
KOG0274537 consensus Cdc4 and related F-box and WD-40 protein 99.94
KOG0289506 consensus mRNA splicing factor [General function p 99.94
KOG1036323 consensus Mitotic spindle checkpoint protein BUB3, 99.94
KOG0308735 consensus Conserved WD40 repeat-containing protein 99.94
KOG0310487 consensus Conserved WD40 repeat-containing protein 99.94
KOG0300481 consensus WD40 repeat-containing protein [Function 99.94
KOG0299479 consensus U3 snoRNP-associated protein (contains W 99.94
KOG0294362 consensus WD40 repeat-containing protein [Function 99.94
KOG0268433 consensus Sof1-like rRNA processing protein (conta 99.94
KOG0647347 consensus mRNA export protein (contains WD40 repea 99.93
KOG1332299 consensus Vesicle coat complex COPII, subunit SEC1 99.93
PTZ00420568 coronin; Provisional 99.93
KOG0264422 consensus Nucleosome remodeling factor, subunit CA 99.93
KOG0973 942 consensus Histone transcription regulator HIRA, WD 99.93
KOG2096420 consensus WD40 repeat protein [General function pr 99.93
KOG0641350 consensus WD40 repeat protein [General function pr 99.92
KOG0639705 consensus Transducin-like enhancer of split protei 99.92
KOG0294362 consensus WD40 repeat-containing protein [Function 99.92
KOG1963 792 consensus WD40 repeat protein [General function pr 99.92
KOG4283397 consensus Transcription-coupled repair protein CSA 99.92
KOG1963 792 consensus WD40 repeat protein [General function pr 99.92
KOG0646476 consensus WD40 repeat protein [General function pr 99.91
KOG0301 745 consensus Phospholipase A2-activating protein (con 99.91
KOG1538 1081 consensus Uncharacterized conserved protein WDR10, 99.91
KOG1273405 consensus WD40 repeat protein [General function pr 99.91
KOG1274 933 consensus WD40 repeat protein [General function pr 99.91
KOG1036323 consensus Mitotic spindle checkpoint protein BUB3, 99.91
KOG1332299 consensus Vesicle coat complex COPII, subunit SEC1 99.91
KOG0264422 consensus Nucleosome remodeling factor, subunit CA 99.91
KOG4328498 consensus WD40 protein [Function unknown] 99.91
KOG2055514 consensus WD40 repeat protein [General function pr 99.91
KOG0646476 consensus WD40 repeat protein [General function pr 99.91
TIGR03866300 PQQ_ABC_repeats PQQ-dependent catabolism-associate 99.9
KOG2055514 consensus WD40 repeat protein [General function pr 99.9
KOG0639705 consensus Transducin-like enhancer of split protei 99.9
KOG1273405 consensus WD40 repeat protein [General function pr 99.9
TIGR03866300 PQQ_ABC_repeats PQQ-dependent catabolism-associate 99.9
KOG0267 825 consensus Microtubule severing protein katanin p80 99.9
KOG0650733 consensus WD40 repeat nucleolar protein Bop1, invo 99.9
KOG0321 720 consensus WD40 repeat-containing protein L2DTL [Fu 99.89
KOG0269839 consensus WD40 repeat-containing protein [Function 99.88
KOG4283397 consensus Transcription-coupled repair protein CSA 99.88
KOG0270463 consensus WD40 repeat-containing protein [Function 99.88
KOG0269839 consensus WD40 repeat-containing protein [Function 99.88
KOG0321720 consensus WD40 repeat-containing protein L2DTL [Fu 99.87
KOG0650733 consensus WD40 repeat nucleolar protein Bop1, invo 99.87
KOG2445361 consensus Nuclear pore complex component (sc Seh1) 99.87
KOG1009434 consensus Chromatin assembly complex 1 subunit B/C 99.87
KOG0307 1049 consensus Vesicle coat complex COPII, subunit SEC3 99.86
KOG0267 825 consensus Microtubule severing protein katanin p80 99.86
KOG1538 1081 consensus Uncharacterized conserved protein WDR10, 99.86
KOG1034385 consensus Transcriptional repressor EED/ESC/FIE, r 99.85
KOG4378 673 consensus Nuclear protein COP1 [Signal transductio 99.85
KOG2445361 consensus Nuclear pore complex component (sc Seh1) 99.85
KOG2919406 consensus Guanine nucleotide-binding protein [Gene 99.85
COG2319466 FOG: WD40 repeat [General function prediction only 99.84
KOG4328498 consensus WD40 protein [Function unknown] 99.84
KOG4497447 consensus Uncharacterized conserved protein WDR8, 99.84
KOG0302440 consensus Ribosome Assembly protein [General funct 99.84
KOG1034385 consensus Transcriptional repressor EED/ESC/FIE, r 99.84
COG2319466 FOG: WD40 repeat [General function prediction only 99.83
KOG0302440 consensus Ribosome Assembly protein [General funct 99.82
KOG0270463 consensus WD40 repeat-containing protein [Function 99.82
KOG0307 1049 consensus Vesicle coat complex COPII, subunit SEC3 99.81
KOG1912 1062 consensus WD40 repeat protein [General function pr 99.81
KOG4378673 consensus Nuclear protein COP1 [Signal transductio 99.81
KOG0303472 consensus Actin-binding protein Coronin, contains 99.81
KOG1009434 consensus Chromatin assembly complex 1 subunit B/C 99.81
KOG1912 1062 consensus WD40 repeat protein [General function pr 99.81
KOG1524 737 consensus WD40 repeat-containing protein CHE-2 [Ge 99.8
KOG0303472 consensus Actin-binding protein Coronin, contains 99.8
KOG1524737 consensus WD40 repeat-containing protein CHE-2 [Ge 99.79
KOG2919406 consensus Guanine nucleotide-binding protein [Gene 99.78
KOG0322323 consensus G-protein beta subunit-like protein GNB1 99.78
KOG1310758 consensus WD40 repeat protein [General function pr 99.78
KOG0290364 consensus Conserved WD40 repeat-containing protein 99.77
KOG1188376 consensus WD40 repeat protein [General function pr 99.76
KOG0322323 consensus G-protein beta subunit-like protein GNB1 99.76
PRK11028330 6-phosphogluconolactonase; Provisional 99.76
KOG4227609 consensus WD40 repeat protein [General function pr 99.76
KOG1188376 consensus WD40 repeat protein [General function pr 99.75
KOG0644 1113 consensus Uncharacterized conserved protein, conta 99.75
KOG0642577 consensus Cell-cycle nuclear protein, contains WD- 99.75
KOG1007370 consensus WD repeat protein TSSC1, WD repeat super 99.75
KOG4497447 consensus Uncharacterized conserved protein WDR8, 99.75
KOG0649325 consensus WD40 repeat protein [General function pr 99.75
KOG1007370 consensus WD repeat protein TSSC1, WD repeat super 99.74
KOG1587555 consensus Cytoplasmic dynein intermediate chain [C 99.74
KOG0642577 consensus Cell-cycle nuclear protein, contains WD- 99.74
KOG1334559 consensus WD40 repeat protein [General function pr 99.74
KOG0649325 consensus WD40 repeat protein [General function pr 99.73
KOG1587555 consensus Cytoplasmic dynein intermediate chain [C 99.71
KOG2110391 consensus Uncharacterized conserved protein, conta 99.71
PRK11028330 6-phosphogluconolactonase; Provisional 99.7
KOG0290364 consensus Conserved WD40 repeat-containing protein 99.7
KOG4227 609 consensus WD40 repeat protein [General function pr 99.7
KOG15171387 consensus Guanine nucleotide binding protein MIP1 99.7
KOG0771398 consensus Prolactin regulatory element-binding pro 99.68
KOG0644 1113 consensus Uncharacterized conserved protein, conta 99.68
KOG0771398 consensus Prolactin regulatory element-binding pro 99.67
COG4946668 Uncharacterized protein related to the periplasmic 99.67
KOG15171387 consensus Guanine nucleotide binding protein MIP1 99.67
PRK01742429 tolB translocation protein TolB; Provisional 99.67
PF02239369 Cytochrom_D1: Cytochrome D1 heme domain; PDB: 1NNO 99.65
KOG1523361 consensus Actin-related protein Arp2/3 complex, su 99.65
KOG12401431 consensus Protein kinase containing WD40 repeats [ 99.65
PF02239369 Cytochrom_D1: Cytochrome D1 heme domain; PDB: 1NNO 99.64
KOG2321703 consensus WD40 repeat protein [General function pr 99.62
KOG12401431 consensus Protein kinase containing WD40 repeats [ 99.62
KOG2110391 consensus Uncharacterized conserved protein, conta 99.61
PRK01742429 tolB translocation protein TolB; Provisional 99.61
KOG1334559 consensus WD40 repeat protein [General function pr 99.61
KOG1523361 consensus Actin-related protein Arp2/3 complex, su 99.61
PF04762 928 IKI3: IKI3 family; InterPro: IPR006849 Members of 99.61
KOG2139445 consensus WD40 repeat protein [General function pr 99.59
KOG2041 1189 consensus WD40 repeat protein [General function pr 99.59
KOG2139445 consensus WD40 repeat protein [General function pr 99.59
KOG2111346 consensus Uncharacterized conserved protein, conta 99.58
KOG2394636 consensus WD40 protein DMR-N9 [General function pr 99.56
KOG18321516 consensus HIV-1 Vpr-binding protein [Cell cycle co 99.56
PRK03629429 tolB translocation protein TolB; Provisional 99.56
KOG1272545 consensus WD40-repeat-containing subunit of the 18 99.55
KOG1310758 consensus WD40 repeat protein [General function pr 99.54
KOG0974 967 consensus WD-repeat protein WDR6, WD repeat superf 99.54
PRK03629429 tolB translocation protein TolB; Provisional 99.53
KOG2394636 consensus WD40 protein DMR-N9 [General function pr 99.53
KOG3881412 consensus Uncharacterized conserved protein [Funct 99.52
PRK05137435 tolB translocation protein TolB; Provisional 99.52
PRK02889427 tolB translocation protein TolB; Provisional 99.51
PRK04922433 tolB translocation protein TolB; Provisional 99.5
KOG2041 1189 consensus WD40 repeat protein [General function pr 99.5
PRK04922433 tolB translocation protein TolB; Provisional 99.5
COG5354 561 Uncharacterized protein, contains Trp-Asp (WD) rep 99.5
KOG0974 967 consensus WD-repeat protein WDR6, WD repeat superf 99.5
PRK02889427 tolB translocation protein TolB; Provisional 99.49
KOG2315566 consensus Predicted translation initiation factor 99.49
KOG2111346 consensus Uncharacterized conserved protein, conta 99.49
KOG1272545 consensus WD40-repeat-containing subunit of the 18 99.48
PRK05137435 tolB translocation protein TolB; Provisional 99.47
PF10282345 Lactonase: Lactonase, 7-bladed beta-propeller; Int 99.46
KOG2315566 consensus Predicted translation initiation factor 99.46
KOG1409404 consensus Uncharacterized conserved protein, conta 99.44
COG2706346 3-carboxymuconate cyclase [Carbohydrate transport 99.44
PF08662194 eIF2A: Eukaryotic translation initiation factor eI 99.43
KOG2321 703 consensus WD40 repeat protein [General function pr 99.43
COG4946 668 Uncharacterized protein related to the periplasmic 99.42
COG5354561 Uncharacterized protein, contains Trp-Asp (WD) rep 99.42
KOG3881412 consensus Uncharacterized conserved protein [Funct 99.41
KOG1354433 consensus Serine/threonine protein phosphatase 2A, 99.41
PRK01029428 tolB translocation protein TolB; Provisional 99.4
KOG2314698 consensus Translation initiation factor 3, subunit 99.38
COG2706346 3-carboxymuconate cyclase [Carbohydrate transport 99.38
KOG1354433 consensus Serine/threonine protein phosphatase 2A, 99.38
PF08662194 eIF2A: Eukaryotic translation initiation factor eI 99.37
KOG2314698 consensus Translation initiation factor 3, subunit 99.35
TIGR02658352 TTQ_MADH_Hv methylamine dehydrogenase heavy chain. 99.35
PRK00178430 tolB translocation protein TolB; Provisional 99.35
PF04762 928 IKI3: IKI3 family; InterPro: IPR006849 Members of 99.35
PRK04792448 tolB translocation protein TolB; Provisional 99.34
PRK01029428 tolB translocation protein TolB; Provisional 99.33
PF10282345 Lactonase: Lactonase, 7-bladed beta-propeller; Int 99.32
PRK04792448 tolB translocation protein TolB; Provisional 99.32
PRK00178430 tolB translocation protein TolB; Provisional 99.31
TIGR02800417 propeller_TolB tol-pal system beta propeller repea 99.29
TIGR02800417 propeller_TolB tol-pal system beta propeller repea 99.28
KOG4547541 consensus WD40 repeat-containing protein [General 99.25
KOG0280339 consensus Uncharacterized conserved protein [Amino 99.23
TIGR02658352 TTQ_MADH_Hv methylamine dehydrogenase heavy chain. 99.23
TIGR03300377 assembly_YfgL outer membrane assembly lipoprotein 99.17
KOG2659228 consensus LisH motif-containing protein [Cytoskele 99.17
KOG0309 1081 consensus Conserved WD40 repeat-containing protein 99.15
KOG4547 541 consensus WD40 repeat-containing protein [General 99.15
KOG0280339 consensus Uncharacterized conserved protein [Amino 99.13
KOG1409404 consensus Uncharacterized conserved protein, conta 99.13
PLN02919 1057 haloacid dehalogenase-like hydrolase family protei 99.1
TIGR03300377 assembly_YfgL outer membrane assembly lipoprotein 99.08
PLN029191057 haloacid dehalogenase-like hydrolase family protei 99.06
PRK04043419 tolB translocation protein TolB; Provisional 99.04
KOG41901034 consensus Uncharacterized conserved protein [Funct 99.03
PF15492282 Nbas_N: Neuroblastoma-amplified sequence, N termin 99.0
PRK04043419 tolB translocation protein TolB; Provisional 98.95
KOG10642439 consensus RAVE (regulator of V-ATPase assembly) co 98.94
KOG10642439 consensus RAVE (regulator of V-ATPase assembly) co 98.92
KOG0309 1081 consensus Conserved WD40 repeat-containing protein 98.9
KOG3914 390 consensus WD repeat protein WDR4 [Function unknown 98.88
KOG4532344 consensus WD40-like repeat containing protein [Gen 98.87
KOG18321516 consensus HIV-1 Vpr-binding protein [Cell cycle co 98.87
KOG41901034 consensus Uncharacterized conserved protein [Funct 98.81
PRK11138394 outer membrane biogenesis protein BamB; Provisiona 98.79
PF07433305 DUF1513: Protein of unknown function (DUF1513); In 98.77
KOG3914390 consensus WD repeat protein WDR4 [Function unknown 98.76
KOG3617 1416 consensus WD40 and TPR repeat-containing protein [ 98.73
PF15492282 Nbas_N: Neuroblastoma-amplified sequence, N termin 98.72
KOG4532344 consensus WD40-like repeat containing protein [Gen 98.71
PRK11138394 outer membrane biogenesis protein BamB; Provisiona 98.71
COG5170460 CDC55 Serine/threonine protein phosphatase 2A, reg 98.7
KOG3617 1416 consensus WD40 and TPR repeat-containing protein [ 98.7
KOG0882558 consensus Cyclophilin-related peptidyl-prolyl cis- 98.7
COG5170460 CDC55 Serine/threonine protein phosphatase 2A, reg 98.68
KOG18971096 consensus Damage-specific DNA binding complex, sub 98.66
KOG4714319 consensus Nucleoporin [Nuclear structure] 98.66
KOG4649354 consensus PQQ (pyrrolo-quinoline quinone) repeat p 98.65
PF08450246 SGL: SMP-30/Gluconolaconase/LRE-like region; Inter 98.65
KOG1645463 consensus RING-finger-containing E3 ubiquitin liga 98.65
KOG4714319 consensus Nucleoporin [Nuclear structure] 98.64
PF07433305 DUF1513: Protein of unknown function (DUF1513); In 98.6
PF08450246 SGL: SMP-30/Gluconolaconase/LRE-like region; Inter 98.59
KOG2695425 consensus WD40 repeat protein [General function pr 98.59
KOG4649354 consensus PQQ (pyrrolo-quinoline quinone) repeat p 98.56
PRK02888635 nitrous-oxide reductase; Validated 98.56
KOG0882558 consensus Cyclophilin-related peptidyl-prolyl cis- 98.55
PF13360238 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 98.55
PF0040039 WD40: WD domain, G-beta repeat; InterPro: IPR01978 98.52
PRK02888635 nitrous-oxide reductase; Validated 98.5
PF13360238 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 98.49
PF06433342 Me-amine-dh_H: Methylamine dehydrogenase heavy cha 98.48
KOG1275 1118 consensus PAB-dependent poly(A) ribonuclease, subu 98.46
PF06433342 Me-amine-dh_H: Methylamine dehydrogenase heavy cha 98.45
PF00930353 DPPIV_N: Dipeptidyl peptidase IV (DPP IV) N-termin 98.43
KOG3621726 consensus WD40 repeat-containing protein [General 98.41
KOG1920 1265 consensus IkappaB kinase complex, IKAP component [ 98.39
KOG1920 1265 consensus IkappaB kinase complex, IKAP component [ 98.36
KOG0396389 consensus Uncharacterized conserved protein [Funct 98.32
PF0040039 WD40: WD domain, G-beta repeat; InterPro: IPR01978 98.32
PF14583386 Pectate_lyase22: Oligogalacturonate lyase; PDB: 3C 98.32
PF10607145 CLTH: CTLH/CRA C-terminal to LisH motif domain; In 98.31
KOG2114 933 consensus Vacuolar assembly/sorting protein PEP5/V 98.29
KOG2695425 consensus WD40 repeat protein [General function pr 98.28
KOG1645463 consensus RING-finger-containing E3 ubiquitin liga 98.26
KOG1897 1096 consensus Damage-specific DNA binding complex, sub 98.26
PF00930353 DPPIV_N: Dipeptidyl peptidase IV (DPP IV) N-termin 98.26
KOG2066 846 consensus Vacuolar assembly/sorting protein VPS41 98.25
KOG3621 726 consensus WD40 repeat-containing protein [General 98.21
KOG1275 1118 consensus PAB-dependent poly(A) ribonuclease, subu 98.19
cd00216488 PQQ_DH Dehydrogenases with pyrrolo-quinoline quino 98.18
KOG2114 933 consensus Vacuolar assembly/sorting protein PEP5/V 98.18
PF11768545 DUF3312: Protein of unknown function (DUF3312); In 98.12
KOG2066 846 consensus Vacuolar assembly/sorting protein VPS41 98.08
cd00216488 PQQ_DH Dehydrogenases with pyrrolo-quinoline quino 98.08
PF04053 443 Coatomer_WDAD: Coatomer WD associated region ; Int 98.01
PF11768545 DUF3312: Protein of unknown function (DUF3312); In 98.01
COG0823425 TolB Periplasmic component of the Tol biopolymer t 98.0
PF0851327 LisH: LisH; InterPro: IPR013720 The LisH motif is 98.0
TIGR03075527 PQQ_enz_alc_DH PQQ-dependent dehydrogenase, methan 97.97
smart0066858 CTLH C-terminal to LisH motif. Alpha-helical motif 97.95
COG0823425 TolB Periplasmic component of the Tol biopolymer t 97.91
PF08596395 Lgl_C: Lethal giant larvae(Lgl) like, C-terminal; 97.91
smart0066734 LisH Lissencephaly type-1-like homology motif. Alp 97.89
PF08596395 Lgl_C: Lethal giant larvae(Lgl) like, C-terminal; 97.88
PF04053443 Coatomer_WDAD: Coatomer WD associated region ; Int 97.87
PF06977248 SdiA-regulated: SdiA-regulated; InterPro: IPR00972 97.86
PF14583386 Pectate_lyase22: Oligogalacturonate lyase; PDB: 3C 97.85
PF06977248 SdiA-regulated: SdiA-regulated; InterPro: IPR00972 97.84
COG3391381 Uncharacterized conserved protein [Function unknow 97.81
PF02897414 Peptidase_S9_N: Prolyl oligopeptidase, N-terminal 97.81
KOG1008783 consensus Uncharacterized conserved protein, conta 97.73
PF04841 410 Vps16_N: Vps16, N-terminal region; InterPro: IPR00 97.72
PF00780275 CNH: CNH domain; InterPro: IPR001180 Based on sequ 97.7
TIGR03075527 PQQ_enz_alc_DH PQQ-dependent dehydrogenase, methan 97.63
PRK13616591 lipoprotein LpqB; Provisional 97.62
KOG1008 783 consensus Uncharacterized conserved protein, conta 97.5
COG3490366 Uncharacterized protein conserved in bacteria [Fun 97.5
PF02897414 Peptidase_S9_N: Prolyl oligopeptidase, N-terminal 97.44
PF04841410 Vps16_N: Vps16, N-terminal region; InterPro: IPR00 97.43
PF14870302 PSII_BNR: Photosynthesis system II assembly factor 97.4
PRK13616591 lipoprotein LpqB; Provisional 97.39
COG3391381 Uncharacterized conserved protein [Function unknow 97.36
PF00780275 CNH: CNH domain; InterPro: IPR001180 Based on sequ 97.35
COG3490366 Uncharacterized protein conserved in bacteria [Fun 97.34
PF10647253 Gmad1: Lipoprotein LpqB beta-propeller domain; Int 97.27
PF05694461 SBP56: 56kDa selenium binding protein (SBP56); Int 97.15
KOG2817394 consensus Predicted E3 ubiquitin ligase [Posttrans 97.14
COG3386307 Gluconolactonase [Carbohydrate transport and metab 97.12
PF03178321 CPSF_A: CPSF A subunit region; InterPro: IPR004871 97.1
PF08553 794 VID27: VID27 cytoplasmic protein; InterPro: IPR013 97.07
smart0032040 WD40 WD40 repeats. Note that these repeats are per 97.06
COG3386307 Gluconolactonase [Carbohydrate transport and metab 97.05
PF03178321 CPSF_A: CPSF A subunit region; InterPro: IPR004871 97.04
PF14655415 RAB3GAP2_N: Rab3 GTPase-activating protein regulat 97.01
KOG4640 665 consensus Anaphase-promoting complex (APC), subuni 97.01
TIGR03074764 PQQ_membr_DH membrane-bound PQQ-dependent dehydrog 96.95
KOG4640 665 consensus Anaphase-promoting complex (APC), subuni 96.94
PF14655415 RAB3GAP2_N: Rab3 GTPase-activating protein regulat 96.88
PRK10115686 protease 2; Provisional 96.87
PF10647253 Gmad1: Lipoprotein LpqB beta-propeller domain; Int 96.84
KOG2395 644 consensus Protein involved in vacuole import and d 96.81
PF14783111 BBS2_Mid: Ciliary BBSome complex subunit 2, middle 96.7
smart0032040 WD40 WD40 repeats. Note that these repeats are per 96.67
PF05694461 SBP56: 56kDa selenium binding protein (SBP56); Int 96.63
PRK10115686 protease 2; Provisional 96.53
PF08553794 VID27: VID27 cytoplasmic protein; InterPro: IPR013 96.5
PF14727418 PHTB1_N: PTHB1 N-terminus 96.4
PF14783111 BBS2_Mid: Ciliary BBSome complex subunit 2, middle 96.34
KOG4441571 consensus Proteins containing BTB/POZ and Kelch do 96.32
PF15390 671 DUF4613: Domain of unknown function (DUF4613) 96.3
PRK13684334 Ycf48-like protein; Provisional 96.28
KOG2079 1206 consensus Vacuolar assembly/sorting protein VPS8 [ 96.2
KOG2444238 consensus WD40 repeat protein [General function pr 96.17
PF05096264 Glu_cyclase_2: Glutamine cyclotransferase; InterPr 96.15
PHA02713557 hypothetical protein; Provisional 96.13
PF1289447 Apc4_WD40: Anaphase-promoting complex subunit 4 WD 96.07
cd08044133 TAF5_NTD2 TAF5_NTD2 is the second conserved N-term 96.05
COG3204316 Uncharacterized protein conserved in bacteria [Fun 96.03
COG3204316 Uncharacterized protein conserved in bacteria [Fun 96.01
KOG2395644 consensus Protein involved in vacuole import and d 95.97
PF07995331 GSDH: Glucose / Sorbosone dehydrogenase; InterPro: 95.93
PHA02713557 hypothetical protein; Provisional 95.75
PF1289447 Apc4_WD40: Anaphase-promoting complex subunit 4 WD 95.68
PF05096264 Glu_cyclase_2: Glutamine cyclotransferase; InterPr 95.65
TIGR03074764 PQQ_membr_DH membrane-bound PQQ-dependent dehydrog 95.62
KOG2079 1206 consensus Vacuolar assembly/sorting protein VPS8 [ 95.42
KOG4499310 consensus Ca2+-binding protein Regucalcin/SMP30 [I 95.41
TIGR03118336 PEPCTERM_chp_1 conserved hypothetical protein TIGR 95.31
PF04494142 TFIID_90kDa: WD40 associated region in TFIID subun 95.24
PLN00033398 photosystem II stability/assembly factor; Provisio 95.2
PHA03098534 kelch-like protein; Provisional 95.17
KOG4499310 consensus Ca2+-binding protein Regucalcin/SMP30 [I 95.16
PHA02790480 Kelch-like protein; Provisional 94.9
KOG4441571 consensus Proteins containing BTB/POZ and Kelch do 94.8
PF12234631 Rav1p_C: RAVE protein 1 C terminal; InterPro: IPR0 94.79
PF12234 631 Rav1p_C: RAVE protein 1 C terminal; InterPro: IPR0 94.75
TIGR02604 367 Piru_Ver_Nterm putative membrane-bound dehydrogena 94.73
KOG2280 829 consensus Vacuolar assembly/sorting protein VPS16 94.57
TIGR03118336 PEPCTERM_chp_1 conserved hypothetical protein TIGR 94.35
PF14870302 PSII_BNR: Photosynthesis system II assembly factor 94.26
PLN00033398 photosystem II stability/assembly factor; Provisio 94.23
PF13449326 Phytase-like: Esterase-like activity of phytase 94.22
PHA03098534 kelch-like protein; Provisional 94.14
PF07995331 GSDH: Glucose / Sorbosone dehydrogenase; InterPro: 94.11
PF14761215 HPS3_N: Hermansky-Pudlak syndrome 3 94.01
PF15390671 DUF4613: Domain of unknown function (DUF4613) 94.0
KOG2444238 consensus WD40 repeat protein [General function pr 93.97
KOG2247 615 consensus WD40 repeat-containing protein [General 93.68
COG3823262 Glutamine cyclotransferase [Posttranslational modi 92.98
COG4257353 Vgb Streptogramin lyase [Defense mechanisms] 92.97
PF08728 717 CRT10: CRT10; InterPro: IPR014839 CRT10 is a trans 92.91
PF13449326 Phytase-like: Esterase-like activity of phytase 92.9
KOG3630 1405 consensus Nuclear pore complex, Nup214/CAN compone 92.73
TIGR02604367 Piru_Ver_Nterm putative membrane-bound dehydrogena 92.62
KOG1916 1283 consensus Nuclear protein, contains WD40 repeats [ 92.62
KOG3630 1405 consensus Nuclear pore complex, Nup214/CAN compone 92.41
KOG2377 657 consensus Uncharacterized conserved protein [Funct 92.38
PF03022287 MRJP: Major royal jelly protein; InterPro: IPR0035 91.96
PF10168 717 Nup88: Nuclear pore component; InterPro: IPR019321 91.88
PHA02790480 Kelch-like protein; Provisional 91.62
KOG2280829 consensus Vacuolar assembly/sorting protein VPS16 91.61
PF1031343 DUF2415: Uncharacterised protein domain (DUF2415); 91.31
TIGR03606 454 non_repeat_PQQ dehydrogenase, PQQ-dependent, s-GDH 91.25
PF10214 765 Rrn6: RNA polymerase I-specific transcription-init 91.08
PF1031343 DUF2415: Uncharacterised protein domain (DUF2415); 90.82
PF11725 1774 AvrE: Pathogenicity factor; InterPro: IPR021085 Th 90.77
PF08728717 CRT10: CRT10; InterPro: IPR014839 CRT10 is a trans 90.7
PF14727418 PHTB1_N: PTHB1 N-terminus 90.67
smart00036302 CNH Domain found in NIK1-like kinases, mouse citro 90.56
COG4257353 Vgb Streptogramin lyase [Defense mechanisms] 90.55
PF10168 717 Nup88: Nuclear pore component; InterPro: IPR019321 90.45
KOG2377657 consensus Uncharacterized conserved protein [Funct 90.34
PRK13613599 lipoprotein LpqB; Provisional 90.26
COG1520370 FOG: WD40-like repeat [Function unknown] 90.07
COG3292671 Predicted periplasmic ligand-binding sensor domain 89.93
KOG1900 1311 consensus Nuclear pore complex, Nup155 component ( 89.73
COG3823262 Glutamine cyclotransferase [Posttranslational modi 89.71
COG5167 776 VID27 Protein involved in vacuole import and degra 89.57
KOG1900 1311 consensus Nuclear pore complex, Nup155 component ( 89.56
PF07569219 Hira: TUP1-like enhancer of split; InterPro: IPR01 89.47
PRK13615557 lipoprotein LpqB; Provisional 89.27
PF0767639 PD40: WD40-like Beta Propeller Repeat; InterPro: I 89.21
KOG1916 1283 consensus Nuclear protein, contains WD40 repeats [ 89.19
PF02333381 Phytase: Phytase; InterPro: IPR003431 Phytase (3.1 89.13
COG5167776 VID27 Protein involved in vacuole import and degra 88.99
PF14761215 HPS3_N: Hermansky-Pudlak syndrome 3 88.83
PF14781136 BBS2_N: Ciliary BBSome complex subunit 2, N-termin 88.6
PRK13684334 Ycf48-like protein; Provisional 88.4
PF12657173 TFIIIC_delta: Transcription factor IIIC subunit de 88.21
KOG1983 993 consensus Tomosyn and related SNARE-interacting pr 87.77
COG4590 733 ABC-type uncharacterized transport system, permeas 87.72
COG4590 733 ABC-type uncharacterized transport system, permeas 87.63
COG5290 1243 IkappaB kinase complex, IKAP component [Transcript 87.06
TIGR03606 454 non_repeat_PQQ dehydrogenase, PQQ-dependent, s-GDH 86.52
PRK14131376 N-acetylneuraminic acid mutarotase; Provisional 86.51
PRK13614573 lipoprotein LpqB; Provisional 86.23
COG1520370 FOG: WD40-like repeat [Function unknown] 86.2
KOG2247615 consensus WD40 repeat-containing protein [General 86.13
PF08801 422 Nucleoporin_N: Nup133 N terminal like; InterPro: I 85.43
KOG18981205 consensus Splicing factor 3b, subunit 3 [RNA proce 85.36
TIGR0227642 beta_rpt_yvtn 40-residue YVTN family beta-propelle 84.4
PRK13613599 lipoprotein LpqB; Provisional 84.32
PRK14131376 N-acetylneuraminic acid mutarotase; Provisional 83.87
PF07569219 Hira: TUP1-like enhancer of split; InterPro: IPR01 83.56
COG3292671 Predicted periplasmic ligand-binding sensor domain 83.28
TIGR03548323 mutarot_permut cyclically-permuted mutatrotase fam 83.16
PLN02193470 nitrile-specifier protein 82.67
PF07250243 Glyoxal_oxid_N: Glyoxal oxidase N-terminus; InterP 82.61
KOG1898 1205 consensus Splicing factor 3b, subunit 3 [RNA proce 82.37
KOG4460 741 consensus Nuclear pore complex, Nup88/rNup84 compo 81.1
COG5276370 Uncharacterized conserved protein [Function unknow 81.09
>KOG0293 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information 
Probab=100.00  E-value=8.4e-69  Score=526.65  Aligned_cols=490  Identities=21%  Similarity=0.311  Sum_probs=407.1

Q ss_pred             hHHHHHHHHHHhhhccHHHHHHHHHHHcCCCcc---HHHHHHHhhcccHHHHHHHhcCcCcccccchhhHHHHHHHHHHH
Q 001477            5 SRELVFLILQFLDEEKFKETVHKLEQESGFFFN---MKHFEDQVQAGEWDEVERYLCGFTKVEDNRYSMKIFFEIRKQKY   81 (1071)
Q Consensus         5 ~~e~~rli~q~L~~~g~~~s~~~L~~Esg~~~~---~~~l~~~i~~g~w~~~~~~l~~l~~~~~~~~~~~~~~~i~~~~~   81 (1071)
                      +-|++||+.|+|..+||.+|+.+||.|||+.+.   .+.|.++++.|+|+.++..+..+ ..+++...+++.|++++|+|
T Consensus        17 k~efi~il~q~l~slgy~~S~~~lE~es~ll~~tat~klf~q~vlqg~w~q~v~~~~~i-~~~de~~~~ea~fLv~kQ~f   95 (519)
T KOG0293|consen   17 KGEFIRILWQILYSLGYDHSSPLLEWESGLLIPTATTKLFDQQVLQGQWDQQVMSLVRI-SFEDERNRKEAMFLVNKQIF   95 (519)
T ss_pred             cchhhHhHHHHHHhcCccccchhhHHhhCcccccchHHHHHHHHHcccHHHHHHHHhhc-cCcchhhhHHHHHHHHHHHH
Confidence            458999999999999999999999999999886   89999999999999999988877 34555667789999999999


Q ss_pred             HHHhcccCHHHHHHHHHhhcccccccCHHHHHHHHHhhcccCc-cchhhhccCCCchhHHHHHHHHHHhhcccCcccccc
Q 001477           82 LEALDRQDRAKAVEILVKDLKVFSSFNEELFKEITQLLTLDNF-RQNEQLSKYGDTKSARNIMLVELKKLIEANPLFRDK  160 (1071)
Q Consensus        82 lEll~~~~~~~A~~~l~~~~~~~~~~~~~~~~~l~~ll~~~~~-~~~~~~~~~~~~~~~R~~l~~~l~~~~~~~~~~~~~  160 (1071)
                      ||++..|...+|+.+||+.+.++ .+..+++++|+.-|..++- ..++... -......|..|+++|+++|||+++    
T Consensus        96 LEf~k~~~is~al~~l~~~~~~l-r~~~kk~~el~~sll~sn~~~~ne~~~-~~~~~n~R~~ll~elskyi~p~il----  169 (519)
T KOG0293|consen   96 LEFLKTGSISHALPVLRNPVLYL-RKNKKKFHELASSLLVSNDQFSNEENT-TAQLNNERDKLLDELSKYIPPNIL----  169 (519)
T ss_pred             HHHHhhccHhhhhHhhhcchhhh-hhhHHHHHHHHHHHhccccccccccch-hhhhchhHHHHHHHHHhhCCHhhc----
Confidence            99999999999999999999999 5689999999877665443 3333321 223567799999999999999998    


Q ss_pred             CCCCCCcchHHHHHHHHHHHHHHhhCCCCCCCCCccccccccccCCCCCCCCCCCCCCCCcccCCCCCCCCCCCCCCCCC
Q 001477          161 LSFPSFKSSRLRTLINQSLNWQHQLCKNPRPNPDIKTLFTDHSCNPTSNGARPPPPTNNPLVGPIPKAGQFPPIGAHGPF  240 (1071)
Q Consensus       161 ~~~~~~p~~rL~~ll~qa~~~q~~~~~~~~~~~~~~~l~~d~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~h~~f  240 (1071)
                           +|++||++||+||++||++.|+|||+ .+..|||.||.|++            .++    |. .+.|++.+    
T Consensus       170 -----lP~rRLehLl~qAv~~Q~d~cvyhns-ldsvsll~Dh~c~~------------~qi----p~-qt~qil~~----  222 (519)
T KOG0293|consen  170 -----LPKRRLEHLLEQAVKYQRDSCVYHNS-LDSVSLLSDHFCGR------------LQI----PS-QTWQILQD----  222 (519)
T ss_pred             -----CChHHHHHHHHHHHHHHHhHhHHhcc-cchhhhhhhcccCc------------ccC----Cc-hhhhhHhh----
Confidence                 99999999999999999999999995 55589999999999            233    21 11122222    


Q ss_pred             CCCCCCCcccccccccCCCCCCCCCCccCCCCCCCCCCcccccccCCCCCCCCCcccccCCChhhHHhhcccCCcceeec
Q 001477          241 QPVVSPSPGAIAGWMSSNSPSLPHPSMAAGPPGFVQPSSAVGFLKHPRTPTGMTGMDYQSADSDHLMKRIRTGQSDEVSF  320 (1071)
Q Consensus       241 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~v~~  320 (1071)
                                                                                                      
T Consensus       223 --------------------------------------------------------------------------------  222 (519)
T KOG0293|consen  223 --------------------------------------------------------------------------------  222 (519)
T ss_pred             --------------------------------------------------------------------------------
Confidence                                                                                            


Q ss_pred             cCCCCCCccccCCccceeeEEeecCCCCeEEEEeecCCCeEEEEEcCCCeEEEEecCCCcccccccceeecccccccchh
Q 001477          321 AGVAHTPNVYSQDDLTKTVVRTLNQGSNVMSMDFHPQQQTILLVGTNVGDISLWEVGSRERLAHKPFKVWDISAASMPLQ  400 (1071)
Q Consensus       321 s~~~~~~~~~~~d~~~~~~~~~~~h~~~V~~~~fsp~g~~lla~gs~dg~i~iwd~~~~~~~~~~~~~~~d~~~~~~~~~  400 (1071)
                                              |.++||.+.||++|+ +||+++.|.+..||++.....+     ++.          
T Consensus       223 ------------------------htdEVWfl~FS~nGk-yLAsaSkD~Taiiw~v~~d~~~-----kl~----------  262 (519)
T KOG0293|consen  223 ------------------------HTDEVWFLQFSHNGK-YLASASKDSTAIIWIVVYDVHF-----KLK----------  262 (519)
T ss_pred             ------------------------CCCcEEEEEEcCCCe-eEeeccCCceEEEEEEecCcce-----eee----------
Confidence                                    456899999999998 7999999999999998654321     111          


Q ss_pred             hhhcccCCCCeeEEEECCCCCEEEEEeCCCeEEEEEecCCCccceeeEeecccCCEEEEEEecCCCceEEEEEeCCCcEE
Q 001477          401 NALLNDAAISVNRCVWGPDGLMLGVAFSKHIVHLYTYNPTGELRQHLEIDAHVGGVNDIAFAHPNKQLCIVTCGDDKMIK  480 (1071)
Q Consensus       401 ~~~~~~h~~~v~~~~~spd~~~la~~~~dg~i~iwd~~~~~~~~~~~~~~~h~~~v~~~~~s~d~~~~~l~s~~~d~~i~  480 (1071)
                       ..+.+|..+|..+.||||.++|++|+.|..+.+||+.+|.......  .+|...+.+++|.|||.  .+++|+.|+++.
T Consensus       263 -~tlvgh~~~V~yi~wSPDdryLlaCg~~e~~~lwDv~tgd~~~~y~--~~~~~S~~sc~W~pDg~--~~V~Gs~dr~i~  337 (519)
T KOG0293|consen  263 -KTLVGHSQPVSYIMWSPDDRYLLACGFDEVLSLWDVDTGDLRHLYP--SGLGFSVSSCAWCPDGF--RFVTGSPDRTII  337 (519)
T ss_pred             -eeeecccCceEEEEECCCCCeEEecCchHheeeccCCcchhhhhcc--cCcCCCcceeEEccCCc--eeEecCCCCcEE
Confidence             1267899999999999999999999999999999999998765322  24567899999999999  799999999999


Q ss_pred             EEEccCCceeEEecCC-CCCeEEEEecccCCccEEEEEecCCeEEEEEcCCCceeEEecCCCCcEEEEEEccCCCEEEEe
Q 001477          481 VWDVVAGRKQYTFEGH-EAPVYSVCPHHKESIQFIFSTAIDGKIKAWLYDYLGSRVDYDAPGNWCTMMAYSADGTRLFSC  559 (1071)
Q Consensus       481 iwd~~~~~~~~~~~~h-~~~v~~i~~~~~~~~~~l~s~~~d~~i~vwd~~~~~~~~~~~~~~~~i~~~~~s~~~~~l~~~  559 (1071)
                      .||+ +|+.+...++- ...|.+++.++++  .++++.+.|..|++++.++..... +.....+|++++.|.|++++++.
T Consensus       338 ~wdl-Dgn~~~~W~gvr~~~v~dlait~Dg--k~vl~v~~d~~i~l~~~e~~~dr~-lise~~~its~~iS~d~k~~Lvn  413 (519)
T KOG0293|consen  338 MWDL-DGNILGNWEGVRDPKVHDLAITYDG--KYVLLVTVDKKIRLYNREARVDRG-LISEEQPITSFSISKDGKLALVN  413 (519)
T ss_pred             EecC-CcchhhcccccccceeEEEEEcCCC--cEEEEEecccceeeechhhhhhhc-cccccCceeEEEEcCCCcEEEEE
Confidence            9995 55656666653 3568999998754  899999999999999987655543 33356689999999999999987


Q ss_pred             ccCCCCCCeEEEEeCCCCceeEEeecccccc-eeEEEEeC-CCCEEEEEeCCCcEEEEeCCCCceeEEEecCCCCCCcce
Q 001477          560 GTSKEGESHLVEWNESEGAIKRTYSGFRKRS-LGVVQFDT-TRNRFLAAGDEFQIKFWDMDNMNMLTTVDADGGLPASPR  637 (1071)
Q Consensus       560 ~~~~d~~~~i~iwd~~~~~~~~~~~~~~~~~-v~~~~~~~-~~~~l~~~~~dg~i~iwd~~~~~~~~~~~~~~~~~~v~~  637 (1071)
                      -.    +..+++||++..+.++.+.||..+. +-.-||.. +..++++||+|+.|+||+..+++++..+.+|..  .|++
T Consensus       414 L~----~qei~LWDl~e~~lv~kY~Ghkq~~fiIrSCFgg~~~~fiaSGSED~kvyIWhr~sgkll~~LsGHs~--~vNc  487 (519)
T KOG0293|consen  414 LQ----DQEIHLWDLEENKLVRKYFGHKQGHFIIRSCFGGGNDKFIASGSEDSKVYIWHRISGKLLAVLSGHSK--TVNC  487 (519)
T ss_pred             cc----cCeeEEeecchhhHHHHhhcccccceEEEeccCCCCcceEEecCCCceEEEEEccCCceeEeecCCcc--eeeE
Confidence            65    6669999999999999999987642 33344544 458899999999999999999999999998765  7999


Q ss_pred             EEEcC-CCCEEEEEeCCCcEEEEEcCC
Q 001477          638 LRFNK-EGSLLAVTTSDNGIKILANSD  663 (1071)
Q Consensus       638 ~~~s~-~~~~l~~~~~dg~v~iw~~~~  663 (1071)
                      ++|+| +..++|++++||+||||....
T Consensus       488 VswNP~~p~m~ASasDDgtIRIWg~~~  514 (519)
T KOG0293|consen  488 VSWNPADPEMFASASDDGTIRIWGPSD  514 (519)
T ss_pred             EecCCCCHHHhhccCCCCeEEEecCCc
Confidence            99999 667999999999999998754

>KOG0275 consensus Conserved WD40 repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG0319 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification] Back     alignment and domain information
>KOG0319 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification] Back     alignment and domain information
>KOG0318 consensus WD40 repeat stress protein/actin interacting protein [Cytoskeleton] Back     alignment and domain information
>KOG0291 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification] Back     alignment and domain information
>KOG0291 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification] Back     alignment and domain information
>KOG0318 consensus WD40 repeat stress protein/actin interacting protein [Cytoskeleton] Back     alignment and domain information
>KOG0306 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification] Back     alignment and domain information
>KOG0271 consensus Notchless-like WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0271 consensus Notchless-like WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0306 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification] Back     alignment and domain information
>KOG0263 consensus Transcription initiation factor TFIID, subunit TAF5 (also component of histone acetyltransferase SAGA) [Transcription] Back     alignment and domain information
>KOG1408 consensus WD40 repeat protein [Function unknown] Back     alignment and domain information
>KOG0272 consensus U4/U6 small nuclear ribonucleoprotein Prp4 (contains WD40 repeats) [RNA processing and modification] Back     alignment and domain information
>KOG0273 consensus Beta-transducin family (WD-40 repeat) protein [Chromatin structure and dynamics] Back     alignment and domain information
>KOG1063 consensus RNA polymerase II elongator complex, subunit ELP2, WD repeat superfamily [Chromatin structure and dynamics; Transcription] Back     alignment and domain information
>KOG0286 consensus G-protein beta subunit [General function prediction only] Back     alignment and domain information
>KOG0272 consensus U4/U6 small nuclear ribonucleoprotein Prp4 (contains WD40 repeats) [RNA processing and modification] Back     alignment and domain information
>KOG0276 consensus Vesicle coat complex COPI, beta' subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0279 consensus G protein beta subunit-like protein [Signal transduction mechanisms] Back     alignment and domain information
>KOG1408 consensus WD40 repeat protein [Function unknown] Back     alignment and domain information
>KOG1539 consensus WD repeat protein [General function prediction only] Back     alignment and domain information
>KOG1539 consensus WD repeat protein [General function prediction only] Back     alignment and domain information
>KOG1063 consensus RNA polymerase II elongator complex, subunit ELP2, WD repeat superfamily [Chromatin structure and dynamics; Transcription] Back     alignment and domain information
>KOG0276 consensus Vesicle coat complex COPI, beta' subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0286 consensus G-protein beta subunit [General function prediction only] Back     alignment and domain information
>KOG0292 consensus Vesicle coat complex COPI, alpha subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0315 consensus G-protein beta subunit-like protein (contains WD40 repeats) [General function prediction only] Back     alignment and domain information
>KOG2106 consensus Uncharacterized conserved protein, contains HELP and WD40 domains [Function unknown] Back     alignment and domain information
>KOG0292 consensus Vesicle coat complex COPI, alpha subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0296 consensus Angio-associated migratory cell protein (contains WD40 repeats) [Function unknown] Back     alignment and domain information
>KOG0295 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0279 consensus G protein beta subunit-like protein [Signal transduction mechanisms] Back     alignment and domain information
>KOG0284 consensus Polyadenylation factor I complex, subunit PFS2 [RNA processing and modification] Back     alignment and domain information
>KOG0315 consensus G-protein beta subunit-like protein (contains WD40 repeats) [General function prediction only] Back     alignment and domain information
>KOG0285 consensus Pleiotropic regulator 1 [RNA processing and modification] Back     alignment and domain information
>KOG0273 consensus Beta-transducin family (WD-40 repeat) protein [Chromatin structure and dynamics] Back     alignment and domain information
>KOG0296 consensus Angio-associated migratory cell protein (contains WD40 repeats) [Function unknown] Back     alignment and domain information
>KOG0265 consensus U5 snRNP-specific protein-like factor and related proteins [RNA processing and modification] Back     alignment and domain information
>KOG0645 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG2106 consensus Uncharacterized conserved protein, contains HELP and WD40 domains [Function unknown] Back     alignment and domain information
>KOG0295 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0285 consensus Pleiotropic regulator 1 [RNA processing and modification] Back     alignment and domain information
>KOG2048 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0266 consensus WD40 repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG0265 consensus U5 snRNP-specific protein-like factor and related proteins [RNA processing and modification] Back     alignment and domain information
>KOG0316 consensus Conserved WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0293 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG2048 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0263 consensus Transcription initiation factor TFIID, subunit TAF5 (also component of histone acetyltransferase SAGA) [Transcription] Back     alignment and domain information
>KOG1445 consensus Tumor-specific antigen (contains WD repeats) [Cytoskeleton] Back     alignment and domain information
>KOG0282 consensus mRNA splicing factor [Function unknown] Back     alignment and domain information
>KOG0284 consensus Polyadenylation factor I complex, subunit PFS2 [RNA processing and modification] Back     alignment and domain information
>KOG0281 consensus Beta-TrCP (transducin repeats containing)/Slimb proteins [Function unknown] Back     alignment and domain information
>KOG0645 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0282 consensus mRNA splicing factor [Function unknown] Back     alignment and domain information
>cd00200 WD40 WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and botto Back     alignment and domain information
>KOG0266 consensus WD40 repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG0316 consensus Conserved WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>PLN00181 protein SPA1-RELATED; Provisional Back     alignment and domain information
>KOG0281 consensus Beta-TrCP (transducin repeats containing)/Slimb proteins [Function unknown] Back     alignment and domain information
>KOG0973 consensus Histone transcription regulator HIRA, WD repeat superfamily [Cell cycle control, cell division, chromosome partitioning; Transcription] Back     alignment and domain information
>cd00200 WD40 WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and botto Back     alignment and domain information
>KOG0278 consensus Serine/threonine kinase receptor-associated protein [Lipid transport and metabolism] Back     alignment and domain information
>KOG0641 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PLN00181 protein SPA1-RELATED; Provisional Back     alignment and domain information
>KOG0310 consensus Conserved WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0275 consensus Conserved WD40 repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG0288 consensus WD40 repeat protein TipD [General function prediction only] Back     alignment and domain information
>KOG0313 consensus Microtubule binding protein YTM1 (contains WD40 repeats) [Cytoskeleton] Back     alignment and domain information
>KOG0278 consensus Serine/threonine kinase receptor-associated protein [Lipid transport and metabolism] Back     alignment and domain information
>KOG0643 consensus Translation initiation factor 3, subunit i (eIF-3i)/TGF-beta receptor-interacting protein (TRIP-1) [Translation, ribosomal structure and biogenesis; Signal transduction mechanisms] Back     alignment and domain information
>KOG0643 consensus Translation initiation factor 3, subunit i (eIF-3i)/TGF-beta receptor-interacting protein (TRIP-1) [Translation, ribosomal structure and biogenesis; Signal transduction mechanisms] Back     alignment and domain information
>KOG1446 consensus Histone H3 (Lys4) methyltransferase complex and RNA cleavage factor II complex, subunit SWD2 [RNA processing and modification; Chromatin structure and dynamics; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PTZ00421 coronin; Provisional Back     alignment and domain information
>KOG1407 consensus WD40 repeat protein [Function unknown] Back     alignment and domain information
>KOG0647 consensus mRNA export protein (contains WD40 repeats) [RNA processing and modification] Back     alignment and domain information
>KOG0277 consensus Peroxisomal targeting signal type 2 receptor [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1445 consensus Tumor-specific antigen (contains WD repeats) [Cytoskeleton] Back     alignment and domain information
>KOG1407 consensus WD40 repeat protein [Function unknown] Back     alignment and domain information
>KOG0305 consensus Anaphase promoting complex, Cdc20, Cdh1, and Ama1 subunits [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0640 consensus mRNA cleavage stimulating factor complex; subunit 1 [RNA processing and modification] Back     alignment and domain information
>KOG0313 consensus Microtubule binding protein YTM1 (contains WD40 repeats) [Cytoskeleton] Back     alignment and domain information
>KOG0283 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0274 consensus Cdc4 and related F-box and WD-40 proteins [General function prediction only] Back     alignment and domain information
>KOG0640 consensus mRNA cleavage stimulating factor complex; subunit 1 [RNA processing and modification] Back     alignment and domain information
>KOG1446 consensus Histone H3 (Lys4) methyltransferase complex and RNA cleavage factor II complex, subunit SWD2 [RNA processing and modification; Chromatin structure and dynamics; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0277 consensus Peroxisomal targeting signal type 2 receptor [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0299 consensus U3 snoRNP-associated protein (contains WD40 repeats) [RNA processing and modification] Back     alignment and domain information
>KOG0305 consensus Anaphase promoting complex, Cdc20, Cdh1, and Ama1 subunits [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0283 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0288 consensus WD40 repeat protein TipD [General function prediction only] Back     alignment and domain information
>KOG0772 consensus Uncharacterized conserved protein, contains WD40 repeat [Function unknown] Back     alignment and domain information
>PTZ00420 coronin; Provisional Back     alignment and domain information
>KOG0772 consensus Uncharacterized conserved protein, contains WD40 repeat [Function unknown] Back     alignment and domain information
>KOG2096 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PTZ00421 coronin; Provisional Back     alignment and domain information
>KOG0300 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG1274 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0289 consensus mRNA splicing factor [General function prediction only] Back     alignment and domain information
>KOG0301 consensus Phospholipase A2-activating protein (contains WD40 repeats) [Lipid transport and metabolism] Back     alignment and domain information
>KOG0268 consensus Sof1-like rRNA processing protein (contains WD40 repeats) [RNA processing and modification] Back     alignment and domain information
>KOG0308 consensus Conserved WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0274 consensus Cdc4 and related F-box and WD-40 proteins [General function prediction only] Back     alignment and domain information
>KOG0289 consensus mRNA splicing factor [General function prediction only] Back     alignment and domain information
>KOG1036 consensus Mitotic spindle checkpoint protein BUB3, WD repeat superfamily [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0308 consensus Conserved WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0310 consensus Conserved WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0300 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0299 consensus U3 snoRNP-associated protein (contains WD40 repeats) [RNA processing and modification] Back     alignment and domain information
>KOG0294 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0268 consensus Sof1-like rRNA processing protein (contains WD40 repeats) [RNA processing and modification] Back     alignment and domain information
>KOG0647 consensus mRNA export protein (contains WD40 repeats) [RNA processing and modification] Back     alignment and domain information
>KOG1332 consensus Vesicle coat complex COPII, subunit SEC13 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PTZ00420 coronin; Provisional Back     alignment and domain information
>KOG0264 consensus Nucleosome remodeling factor, subunit CAF1/NURF55/MSI1 [Chromatin structure and dynamics] Back     alignment and domain information
>KOG0973 consensus Histone transcription regulator HIRA, WD repeat superfamily [Cell cycle control, cell division, chromosome partitioning; Transcription] Back     alignment and domain information
>KOG2096 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0641 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0639 consensus Transducin-like enhancer of split protein (contains WD40 repeats) [Chromatin structure and dynamics] Back     alignment and domain information
>KOG0294 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG1963 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG4283 consensus Transcription-coupled repair protein CSA, contains WD40 domain [Transcription; Replication, recombination and repair] Back     alignment and domain information
>KOG1963 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0646 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0301 consensus Phospholipase A2-activating protein (contains WD40 repeats) [Lipid transport and metabolism] Back     alignment and domain information
>KOG1538 consensus Uncharacterized conserved protein WDR10, contains WD40 repeats [General function prediction only] Back     alignment and domain information
>KOG1273 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG1274 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG1036 consensus Mitotic spindle checkpoint protein BUB3, WD repeat superfamily [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG1332 consensus Vesicle coat complex COPII, subunit SEC13 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0264 consensus Nucleosome remodeling factor, subunit CAF1/NURF55/MSI1 [Chromatin structure and dynamics] Back     alignment and domain information
>KOG4328 consensus WD40 protein [Function unknown] Back     alignment and domain information
>KOG2055 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0646 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>TIGR03866 PQQ_ABC_repeats PQQ-dependent catabolism-associated beta-propeller protein Back     alignment and domain information
>KOG2055 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0639 consensus Transducin-like enhancer of split protein (contains WD40 repeats) [Chromatin structure and dynamics] Back     alignment and domain information
>KOG1273 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>TIGR03866 PQQ_ABC_repeats PQQ-dependent catabolism-associated beta-propeller protein Back     alignment and domain information
>KOG0267 consensus Microtubule severing protein katanin p80 subunit B (contains WD40 repeats) [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0650 consensus WD40 repeat nucleolar protein Bop1, involved in ribosome biogenesis [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG0321 consensus WD40 repeat-containing protein L2DTL [Function unknown] Back     alignment and domain information
>KOG0269 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG4283 consensus Transcription-coupled repair protein CSA, contains WD40 domain [Transcription; Replication, recombination and repair] Back     alignment and domain information
>KOG0270 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0269 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0321 consensus WD40 repeat-containing protein L2DTL [Function unknown] Back     alignment and domain information
>KOG0650 consensus WD40 repeat nucleolar protein Bop1, involved in ribosome biogenesis [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG2445 consensus Nuclear pore complex component (sc Seh1) [Nuclear structure; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1009 consensus Chromatin assembly complex 1 subunit B/CAC2 (contains WD40 repeats) [Chromatin structure and dynamics; Replication, recombination and repair] Back     alignment and domain information
>KOG0307 consensus Vesicle coat complex COPII, subunit SEC31 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0267 consensus Microtubule severing protein katanin p80 subunit B (contains WD40 repeats) [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG1538 consensus Uncharacterized conserved protein WDR10, contains WD40 repeats [General function prediction only] Back     alignment and domain information
>KOG1034 consensus Transcriptional repressor EED/ESC/FIE, required for transcriptional silencing, WD repeat superfamily [Transcription] Back     alignment and domain information
>KOG4378 consensus Nuclear protein COP1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG2445 consensus Nuclear pore complex component (sc Seh1) [Nuclear structure; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG2919 consensus Guanine nucleotide-binding protein [General function prediction only] Back     alignment and domain information
>COG2319 FOG: WD40 repeat [General function prediction only] Back     alignment and domain information
>KOG4328 consensus WD40 protein [Function unknown] Back     alignment and domain information
>KOG4497 consensus Uncharacterized conserved protein WDR8, contains WD repeats [General function prediction only] Back     alignment and domain information
>KOG0302 consensus Ribosome Assembly protein [General function prediction only] Back     alignment and domain information
>KOG1034 consensus Transcriptional repressor EED/ESC/FIE, required for transcriptional silencing, WD repeat superfamily [Transcription] Back     alignment and domain information
>COG2319 FOG: WD40 repeat [General function prediction only] Back     alignment and domain information
>KOG0302 consensus Ribosome Assembly protein [General function prediction only] Back     alignment and domain information
>KOG0270 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0307 consensus Vesicle coat complex COPII, subunit SEC31 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1912 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG4378 consensus Nuclear protein COP1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0303 consensus Actin-binding protein Coronin, contains WD40 repeats [Cytoskeleton] Back     alignment and domain information
>KOG1009 consensus Chromatin assembly complex 1 subunit B/CAC2 (contains WD40 repeats) [Chromatin structure and dynamics; Replication, recombination and repair] Back     alignment and domain information
>KOG1912 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG1524 consensus WD40 repeat-containing protein CHE-2 [General function prediction only] Back     alignment and domain information
>KOG0303 consensus Actin-binding protein Coronin, contains WD40 repeats [Cytoskeleton] Back     alignment and domain information
>KOG1524 consensus WD40 repeat-containing protein CHE-2 [General function prediction only] Back     alignment and domain information
>KOG2919 consensus Guanine nucleotide-binding protein [General function prediction only] Back     alignment and domain information
>KOG0322 consensus G-protein beta subunit-like protein GNB1L, contains WD repeats [General function prediction only] Back     alignment and domain information
>KOG1310 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0290 consensus Conserved WD40 repeat-containing protein AN11 [Function unknown] Back     alignment and domain information
>KOG1188 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0322 consensus G-protein beta subunit-like protein GNB1L, contains WD repeats [General function prediction only] Back     alignment and domain information
>PRK11028 6-phosphogluconolactonase; Provisional Back     alignment and domain information
>KOG4227 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG1188 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0644 consensus Uncharacterized conserved protein, contains WD40 repeat and BROMO domains [General function prediction only] Back     alignment and domain information
>KOG0642 consensus Cell-cycle nuclear protein, contains WD-40 repeats [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG1007 consensus WD repeat protein TSSC1, WD repeat superfamily [Function unknown] Back     alignment and domain information
>KOG4497 consensus Uncharacterized conserved protein WDR8, contains WD repeats [General function prediction only] Back     alignment and domain information
>KOG0649 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG1007 consensus WD repeat protein TSSC1, WD repeat superfamily [Function unknown] Back     alignment and domain information
>KOG1587 consensus Cytoplasmic dynein intermediate chain [Cytoskeleton] Back     alignment and domain information
>KOG0642 consensus Cell-cycle nuclear protein, contains WD-40 repeats [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG1334 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0649 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG1587 consensus Cytoplasmic dynein intermediate chain [Cytoskeleton] Back     alignment and domain information
>KOG2110 consensus Uncharacterized conserved protein, contains WD40 repeats [Function unknown] Back     alignment and domain information
>PRK11028 6-phosphogluconolactonase; Provisional Back     alignment and domain information
>KOG0290 consensus Conserved WD40 repeat-containing protein AN11 [Function unknown] Back     alignment and domain information
>KOG4227 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG1517 consensus Guanine nucleotide binding protein MIP1 [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0771 consensus Prolactin regulatory element-binding protein/Protein transport protein SEC12p [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0644 consensus Uncharacterized conserved protein, contains WD40 repeat and BROMO domains [General function prediction only] Back     alignment and domain information
>KOG0771 consensus Prolactin regulatory element-binding protein/Protein transport protein SEC12p [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>COG4946 Uncharacterized protein related to the periplasmic component of the Tol biopolymer transport system [Function unknown] Back     alignment and domain information
>KOG1517 consensus Guanine nucleotide binding protein MIP1 [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PRK01742 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PF02239 Cytochrom_D1: Cytochrome D1 heme domain; PDB: 1NNO_B 1HZU_A 1N15_B 1N50_A 1GJQ_A 1BL9_B 1NIR_B 1N90_B 1HZV_A 1AOQ_A Back     alignment and domain information
>KOG1523 consensus Actin-related protein Arp2/3 complex, subunit ARPC1/p41-ARC [Cytoskeleton] Back     alignment and domain information
>KOG1240 consensus Protein kinase containing WD40 repeats [Signal transduction mechanisms] Back     alignment and domain information
>PF02239 Cytochrom_D1: Cytochrome D1 heme domain; PDB: 1NNO_B 1HZU_A 1N15_B 1N50_A 1GJQ_A 1BL9_B 1NIR_B 1N90_B 1HZV_A 1AOQ_A Back     alignment and domain information
>KOG2321 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG1240 consensus Protein kinase containing WD40 repeats [Signal transduction mechanisms] Back     alignment and domain information
>KOG2110 consensus Uncharacterized conserved protein, contains WD40 repeats [Function unknown] Back     alignment and domain information
>PRK01742 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG1334 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG1523 consensus Actin-related protein Arp2/3 complex, subunit ARPC1/p41-ARC [Cytoskeleton] Back     alignment and domain information
>PF04762 IKI3: IKI3 family; InterPro: IPR006849 Members of this family are components of the elongator multi-subunit component of a novel RNA polymerase II holoenzyme for transcriptional elongation [] Back     alignment and domain information
>KOG2139 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG2041 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG2139 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG2111 consensus Uncharacterized conserved protein, contains WD40 repeats [Function unknown] Back     alignment and domain information
>KOG2394 consensus WD40 protein DMR-N9 [General function prediction only] Back     alignment and domain information
>KOG1832 consensus HIV-1 Vpr-binding protein [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PRK03629 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG1272 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification] Back     alignment and domain information
>KOG1310 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0974 consensus WD-repeat protein WDR6, WD repeat superfamily [General function prediction only] Back     alignment and domain information
>PRK03629 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG2394 consensus WD40 protein DMR-N9 [General function prediction only] Back     alignment and domain information
>KOG3881 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK05137 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK02889 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK04922 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG2041 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PRK04922 tolB translocation protein TolB; Provisional Back     alignment and domain information
>COG5354 Uncharacterized protein, contains Trp-Asp (WD) repeat [General function prediction only] Back     alignment and domain information
>KOG0974 consensus WD-repeat protein WDR6, WD repeat superfamily [General function prediction only] Back     alignment and domain information
>PRK02889 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG2315 consensus Predicted translation initiation factor related to eIF-3a [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG2111 consensus Uncharacterized conserved protein, contains WD40 repeats [Function unknown] Back     alignment and domain information
>KOG1272 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification] Back     alignment and domain information
>PRK05137 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PF10282 Lactonase: Lactonase, 7-bladed beta-propeller; InterPro: IPR019405 6-phosphogluconolactonases (6PGL) 3 Back     alignment and domain information
>KOG2315 consensus Predicted translation initiation factor related to eIF-3a [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG1409 consensus Uncharacterized conserved protein, contains WD40 repeats and FYVE domains [Function unknown] Back     alignment and domain information
>COG2706 3-carboxymuconate cyclase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PF08662 eIF2A: Eukaryotic translation initiation factor eIF2A; InterPro: IPR013979 This entry contains beta propellor domains found in eukaryotic translation initiation factors and TolB domain-containing proteins Back     alignment and domain information
>KOG2321 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>COG4946 Uncharacterized protein related to the periplasmic component of the Tol biopolymer transport system [Function unknown] Back     alignment and domain information
>COG5354 Uncharacterized protein, contains Trp-Asp (WD) repeat [General function prediction only] Back     alignment and domain information
>KOG3881 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1354 consensus Serine/threonine protein phosphatase 2A, regulatory subunit [Signal transduction mechanisms] Back     alignment and domain information
>PRK01029 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG2314 consensus Translation initiation factor 3, subunit b (eIF-3b) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>COG2706 3-carboxymuconate cyclase [Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG1354 consensus Serine/threonine protein phosphatase 2A, regulatory subunit [Signal transduction mechanisms] Back     alignment and domain information
>PF08662 eIF2A: Eukaryotic translation initiation factor eIF2A; InterPro: IPR013979 This entry contains beta propellor domains found in eukaryotic translation initiation factors and TolB domain-containing proteins Back     alignment and domain information
>KOG2314 consensus Translation initiation factor 3, subunit b (eIF-3b) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>TIGR02658 TTQ_MADH_Hv methylamine dehydrogenase heavy chain Back     alignment and domain information
>PRK00178 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PF04762 IKI3: IKI3 family; InterPro: IPR006849 Members of this family are components of the elongator multi-subunit component of a novel RNA polymerase II holoenzyme for transcriptional elongation [] Back     alignment and domain information
>PRK04792 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK01029 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PF10282 Lactonase: Lactonase, 7-bladed beta-propeller; InterPro: IPR019405 6-phosphogluconolactonases (6PGL) 3 Back     alignment and domain information
>PRK04792 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK00178 tolB translocation protein TolB; Provisional Back     alignment and domain information
>TIGR02800 propeller_TolB tol-pal system beta propeller repeat protein TolB Back     alignment and domain information
>TIGR02800 propeller_TolB tol-pal system beta propeller repeat protein TolB Back     alignment and domain information
>KOG4547 consensus WD40 repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG0280 consensus Uncharacterized conserved protein [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR02658 TTQ_MADH_Hv methylamine dehydrogenase heavy chain Back     alignment and domain information
>TIGR03300 assembly_YfgL outer membrane assembly lipoprotein YfgL Back     alignment and domain information
>KOG2659 consensus LisH motif-containing protein [Cytoskeleton] Back     alignment and domain information
>KOG0309 consensus Conserved WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG4547 consensus WD40 repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG0280 consensus Uncharacterized conserved protein [Amino acid transport and metabolism] Back     alignment and domain information
>KOG1409 consensus Uncharacterized conserved protein, contains WD40 repeats and FYVE domains [Function unknown] Back     alignment and domain information
>PLN02919 haloacid dehalogenase-like hydrolase family protein Back     alignment and domain information
>TIGR03300 assembly_YfgL outer membrane assembly lipoprotein YfgL Back     alignment and domain information
>PLN02919 haloacid dehalogenase-like hydrolase family protein Back     alignment and domain information
>PRK04043 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG4190 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF15492 Nbas_N: Neuroblastoma-amplified sequence, N terminal Back     alignment and domain information
>PRK04043 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG1064 consensus RAVE (regulator of V-ATPase assembly) complex subunit RAV1/DMX protein, WD repeat superfamily [General function prediction only] Back     alignment and domain information
>KOG1064 consensus RAVE (regulator of V-ATPase assembly) complex subunit RAV1/DMX protein, WD repeat superfamily [General function prediction only] Back     alignment and domain information
>KOG0309 consensus Conserved WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG3914 consensus WD repeat protein WDR4 [Function unknown] Back     alignment and domain information
>KOG4532 consensus WD40-like repeat containing protein [General function prediction only] Back     alignment and domain information
>KOG1832 consensus HIV-1 Vpr-binding protein [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG4190 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK11138 outer membrane biogenesis protein BamB; Provisional Back     alignment and domain information
>PF07433 DUF1513: Protein of unknown function (DUF1513); InterPro: IPR008311 There are currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function Back     alignment and domain information
>KOG3914 consensus WD repeat protein WDR4 [Function unknown] Back     alignment and domain information
>KOG3617 consensus WD40 and TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF15492 Nbas_N: Neuroblastoma-amplified sequence, N terminal Back     alignment and domain information
>KOG4532 consensus WD40-like repeat containing protein [General function prediction only] Back     alignment and domain information
>PRK11138 outer membrane biogenesis protein BamB; Provisional Back     alignment and domain information
>COG5170 CDC55 Serine/threonine protein phosphatase 2A, regulatory subunit [Signal transduction mechanisms] Back     alignment and domain information
>KOG3617 consensus WD40 and TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG0882 consensus Cyclophilin-related peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5170 CDC55 Serine/threonine protein phosphatase 2A, regulatory subunit [Signal transduction mechanisms] Back     alignment and domain information
>KOG1897 consensus Damage-specific DNA binding complex, subunit DDB1 [Replication, recombination and repair] Back     alignment and domain information
>KOG4714 consensus Nucleoporin [Nuclear structure] Back     alignment and domain information
>KOG4649 consensus PQQ (pyrrolo-quinoline quinone) repeat protein [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PF08450 SGL: SMP-30/Gluconolaconase/LRE-like region; InterPro: IPR013658 This family describes a region that is found in proteins expressed by a variety of eukaryotic and prokaryotic species Back     alignment and domain information
>KOG1645 consensus RING-finger-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4714 consensus Nucleoporin [Nuclear structure] Back     alignment and domain information
>PF07433 DUF1513: Protein of unknown function (DUF1513); InterPro: IPR008311 There are currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function Back     alignment and domain information
>PF08450 SGL: SMP-30/Gluconolaconase/LRE-like region; InterPro: IPR013658 This family describes a region that is found in proteins expressed by a variety of eukaryotic and prokaryotic species Back     alignment and domain information
>KOG2695 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG4649 consensus PQQ (pyrrolo-quinoline quinone) repeat protein [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PRK02888 nitrous-oxide reductase; Validated Back     alignment and domain information
>KOG0882 consensus Cyclophilin-related peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13360 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 3Q54_A 2YH3_A 3PRW_A 3P1L_A 3Q7M_A 3Q7O_A 3Q7N_A Back     alignment and domain information
>PF00400 WD40: WD domain, G-beta repeat; InterPro: IPR019781 WD-40 repeats (also known as WD or beta-transducin repeats) are short ~40 amino acid motifs, often terminating in a Trp-Asp (W-D) dipeptide Back     alignment and domain information
>PRK02888 nitrous-oxide reductase; Validated Back     alignment and domain information
>PF13360 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 3Q54_A 2YH3_A 3PRW_A 3P1L_A 3Q7M_A 3Q7O_A 3Q7N_A Back     alignment and domain information
>PF06433 Me-amine-dh_H: Methylamine dehydrogenase heavy chain (MADH); InterPro: IPR009451 Methylamine dehydrogenase (1 Back     alignment and domain information
>KOG1275 consensus PAB-dependent poly(A) ribonuclease, subunit PAN2 [Replication, recombination and repair] Back     alignment and domain information
>PF06433 Me-amine-dh_H: Methylamine dehydrogenase heavy chain (MADH); InterPro: IPR009451 Methylamine dehydrogenase (1 Back     alignment and domain information
>PF00930 DPPIV_N: Dipeptidyl peptidase IV (DPP IV) N-terminal region; InterPro: IPR002469 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>KOG3621 consensus WD40 repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG1920 consensus IkappaB kinase complex, IKAP component [Transcription] Back     alignment and domain information
>KOG1920 consensus IkappaB kinase complex, IKAP component [Transcription] Back     alignment and domain information
>KOG0396 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF00400 WD40: WD domain, G-beta repeat; InterPro: IPR019781 WD-40 repeats (also known as WD or beta-transducin repeats) are short ~40 amino acid motifs, often terminating in a Trp-Asp (W-D) dipeptide Back     alignment and domain information
>PF14583 Pectate_lyase22: Oligogalacturonate lyase; PDB: 3C5M_C 3PE7_A Back     alignment and domain information
>PF10607 CLTH: CTLH/CRA C-terminal to LisH motif domain; InterPro: IPR019589 This entry represents the CRA (or CT11-RanBPM) domain, which is a protein-protein interaction domain present in crown eukaryotes (plants, animals, fungi) and which is found in Ran-binding proteins such as Ran-binding protein 9 (RanBP9 or RanBPM) and RanBP10 Back     alignment and domain information
>KOG2114 consensus Vacuolar assembly/sorting protein PEP5/VPS11 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG2695 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG1645 consensus RING-finger-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1897 consensus Damage-specific DNA binding complex, subunit DDB1 [Replication, recombination and repair] Back     alignment and domain information
>PF00930 DPPIV_N: Dipeptidyl peptidase IV (DPP IV) N-terminal region; InterPro: IPR002469 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>KOG2066 consensus Vacuolar assembly/sorting protein VPS41 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG3621 consensus WD40 repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG1275 consensus PAB-dependent poly(A) ribonuclease, subunit PAN2 [Replication, recombination and repair] Back     alignment and domain information
>cd00216 PQQ_DH Dehydrogenases with pyrrolo-quinoline quinone (PQQ) as cofactor, like ethanol, methanol, and membrane bound glucose dehydrogenases Back     alignment and domain information
>KOG2114 consensus Vacuolar assembly/sorting protein PEP5/VPS11 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF11768 DUF3312: Protein of unknown function (DUF3312); InterPro: IPR024511 This is a eukaryotic family of uncharacterised proteins that contain WD40 repeats Back     alignment and domain information
>KOG2066 consensus Vacuolar assembly/sorting protein VPS41 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>cd00216 PQQ_DH Dehydrogenases with pyrrolo-quinoline quinone (PQQ) as cofactor, like ethanol, methanol, and membrane bound glucose dehydrogenases Back     alignment and domain information
>PF04053 Coatomer_WDAD: Coatomer WD associated region ; InterPro: IPR006692 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>PF11768 DUF3312: Protein of unknown function (DUF3312); InterPro: IPR024511 This is a eukaryotic family of uncharacterised proteins that contain WD40 repeats Back     alignment and domain information
>COG0823 TolB Periplasmic component of the Tol biopolymer transport system [Intracellular trafficking and secretion] Back     alignment and domain information
>PF08513 LisH: LisH; InterPro: IPR013720 The LisH motif is found in a large number of eukaryotic proteins, from metazoa, fungi and plants that have a wide range of functions Back     alignment and domain information
>TIGR03075 PQQ_enz_alc_DH PQQ-dependent dehydrogenase, methanol/ethanol family Back     alignment and domain information
>smart00668 CTLH C-terminal to LisH motif Back     alignment and domain information
>COG0823 TolB Periplasmic component of the Tol biopolymer transport system [Intracellular trafficking and secretion] Back     alignment and domain information
>PF08596 Lgl_C: Lethal giant larvae(Lgl) like, C-terminal; InterPro: IPR013905 The Lethal giant larvae (Lgl) tumour suppressor protein is conserved from yeast to mammals Back     alignment and domain information
>smart00667 LisH Lissencephaly type-1-like homology motif Back     alignment and domain information
>PF08596 Lgl_C: Lethal giant larvae(Lgl) like, C-terminal; InterPro: IPR013905 The Lethal giant larvae (Lgl) tumour suppressor protein is conserved from yeast to mammals Back     alignment and domain information
>PF04053 Coatomer_WDAD: Coatomer WD associated region ; InterPro: IPR006692 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>PF06977 SdiA-regulated: SdiA-regulated; InterPro: IPR009722 This entry represents a conserved region approximately 100 residues long within a number of hypothetical bacterial proteins that may be regulated by SdiA, a member of the LuxR family of transcriptional regulators [] Back     alignment and domain information
>PF14583 Pectate_lyase22: Oligogalacturonate lyase; PDB: 3C5M_C 3PE7_A Back     alignment and domain information
>PF06977 SdiA-regulated: SdiA-regulated; InterPro: IPR009722 This entry represents a conserved region approximately 100 residues long within a number of hypothetical bacterial proteins that may be regulated by SdiA, a member of the LuxR family of transcriptional regulators [] Back     alignment and domain information
>COG3391 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF02897 Peptidase_S9_N: Prolyl oligopeptidase, N-terminal beta-propeller domain; InterPro: IPR004106 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>KOG1008 consensus Uncharacterized conserved protein, contains WD40 repeats [Function unknown] Back     alignment and domain information
>PF04841 Vps16_N: Vps16, N-terminal region; InterPro: IPR006926 This protein forms part of the Class C vacuolar protein sorting (Vps) complex Back     alignment and domain information
>PF00780 CNH: CNH domain; InterPro: IPR001180 Based on sequence similarities a domain of homology has been identified in the following proteins []: Citron and Citron kinase Back     alignment and domain information
>TIGR03075 PQQ_enz_alc_DH PQQ-dependent dehydrogenase, methanol/ethanol family Back     alignment and domain information
>PRK13616 lipoprotein LpqB; Provisional Back     alignment and domain information
>KOG1008 consensus Uncharacterized conserved protein, contains WD40 repeats [Function unknown] Back     alignment and domain information
>COG3490 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF02897 Peptidase_S9_N: Prolyl oligopeptidase, N-terminal beta-propeller domain; InterPro: IPR004106 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>PF04841 Vps16_N: Vps16, N-terminal region; InterPro: IPR006926 This protein forms part of the Class C vacuolar protein sorting (Vps) complex Back     alignment and domain information
>PF14870 PSII_BNR: Photosynthesis system II assembly factor YCF48; PDB: 2XBG_A Back     alignment and domain information
>PRK13616 lipoprotein LpqB; Provisional Back     alignment and domain information
>COG3391 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF00780 CNH: CNH domain; InterPro: IPR001180 Based on sequence similarities a domain of homology has been identified in the following proteins []: Citron and Citron kinase Back     alignment and domain information
>COG3490 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF10647 Gmad1: Lipoprotein LpqB beta-propeller domain; InterPro: IPR018910 The Gmad1 domain is found associated with IPR019606 from INTERPRO, in bacterial spore formation Back     alignment and domain information
>PF05694 SBP56: 56kDa selenium binding protein (SBP56); InterPro: IPR008826 This family consists of several eukaryotic selenium binding proteins as well as three sequences from archaea Back     alignment and domain information
>KOG2817 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG3386 Gluconolactonase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PF03178 CPSF_A: CPSF A subunit region; InterPro: IPR004871 This family includes a region that lies towards the C terminus of the cleavage and polyadenylation specificity factor (CPSF) A (160 kDa) subunit Back     alignment and domain information
>PF08553 VID27: VID27 cytoplasmic protein; InterPro: IPR013863 This entry represents fungal and plant proteins and contains many hypothetical proteins Back     alignment and domain information
>smart00320 WD40 WD40 repeats Back     alignment and domain information
>COG3386 Gluconolactonase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PF03178 CPSF_A: CPSF A subunit region; InterPro: IPR004871 This family includes a region that lies towards the C terminus of the cleavage and polyadenylation specificity factor (CPSF) A (160 kDa) subunit Back     alignment and domain information
>PF14655 RAB3GAP2_N: Rab3 GTPase-activating protein regulatory subunit N-terminus Back     alignment and domain information
>KOG4640 consensus Anaphase-promoting complex (APC), subunit 4 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR03074 PQQ_membr_DH membrane-bound PQQ-dependent dehydrogenase, glucose/quinate/shikimate family Back     alignment and domain information
>KOG4640 consensus Anaphase-promoting complex (APC), subunit 4 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF14655 RAB3GAP2_N: Rab3 GTPase-activating protein regulatory subunit N-terminus Back     alignment and domain information
>PRK10115 protease 2; Provisional Back     alignment and domain information
>PF10647 Gmad1: Lipoprotein LpqB beta-propeller domain; InterPro: IPR018910 The Gmad1 domain is found associated with IPR019606 from INTERPRO, in bacterial spore formation Back     alignment and domain information
>KOG2395 consensus Protein involved in vacuole import and degradation [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF14783 BBS2_Mid: Ciliary BBSome complex subunit 2, middle region Back     alignment and domain information
>smart00320 WD40 WD40 repeats Back     alignment and domain information
>PF05694 SBP56: 56kDa selenium binding protein (SBP56); InterPro: IPR008826 This family consists of several eukaryotic selenium binding proteins as well as three sequences from archaea Back     alignment and domain information
>PRK10115 protease 2; Provisional Back     alignment and domain information
>PF08553 VID27: VID27 cytoplasmic protein; InterPro: IPR013863 This entry represents fungal and plant proteins and contains many hypothetical proteins Back     alignment and domain information
>PF14727 PHTB1_N: PTHB1 N-terminus Back     alignment and domain information
>PF14783 BBS2_Mid: Ciliary BBSome complex subunit 2, middle region Back     alignment and domain information
>KOG4441 consensus Proteins containing BTB/POZ and Kelch domains, involved in regulatory/signal transduction processes [Signal transduction mechanisms; General function prediction only] Back     alignment and domain information
>PF15390 DUF4613: Domain of unknown function (DUF4613) Back     alignment and domain information
>PRK13684 Ycf48-like protein; Provisional Back     alignment and domain information
>KOG2079 consensus Vacuolar assembly/sorting protein VPS8 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG2444 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PF05096 Glu_cyclase_2: Glutamine cyclotransferase; InterPro: IPR007788 This family of enzymes 2 Back     alignment and domain information
>PHA02713 hypothetical protein; Provisional Back     alignment and domain information
>PF12894 Apc4_WD40: Anaphase-promoting complex subunit 4 WD40 domain Back     alignment and domain information
>cd08044 TAF5_NTD2 TAF5_NTD2 is the second conserved N-terminal region of TATA Binding Protein (TBP) Associated Factor 5 (TAF5), involved in forming Transcription Factor IID (TFIID) Back     alignment and domain information
>COG3204 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>COG3204 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>KOG2395 consensus Protein involved in vacuole import and degradation [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF07995 GSDH: Glucose / Sorbosone dehydrogenase; InterPro: IPR012938 Proteins containing this domain are thought to be glucose/sorbosone dehydrogenases Back     alignment and domain information
>PHA02713 hypothetical protein; Provisional Back     alignment and domain information
>PF12894 Apc4_WD40: Anaphase-promoting complex subunit 4 WD40 domain Back     alignment and domain information
>PF05096 Glu_cyclase_2: Glutamine cyclotransferase; InterPro: IPR007788 This family of enzymes 2 Back     alignment and domain information
>TIGR03074 PQQ_membr_DH membrane-bound PQQ-dependent dehydrogenase, glucose/quinate/shikimate family Back     alignment and domain information
>KOG2079 consensus Vacuolar assembly/sorting protein VPS8 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG4499 consensus Ca2+-binding protein Regucalcin/SMP30 [Inorganic ion transport and metabolism; Signal transduction mechanisms] Back     alignment and domain information
>TIGR03118 PEPCTERM_chp_1 conserved hypothetical protein TIGR03118 Back     alignment and domain information
>PF04494 TFIID_90kDa: WD40 associated region in TFIID subunit; InterPro: IPR007582 This region, possibly a domain is found in subunits of transcription factor TFIID Back     alignment and domain information
>PLN00033 photosystem II stability/assembly factor; Provisional Back     alignment and domain information
>PHA03098 kelch-like protein; Provisional Back     alignment and domain information
>KOG4499 consensus Ca2+-binding protein Regucalcin/SMP30 [Inorganic ion transport and metabolism; Signal transduction mechanisms] Back     alignment and domain information
>PHA02790 Kelch-like protein; Provisional Back     alignment and domain information
>KOG4441 consensus Proteins containing BTB/POZ and Kelch domains, involved in regulatory/signal transduction processes [Signal transduction mechanisms; General function prediction only] Back     alignment and domain information
>PF12234 Rav1p_C: RAVE protein 1 C terminal; InterPro: IPR022033 This domain family is found in eukaryotes, and is typically between 621 and 644 amino acids in length Back     alignment and domain information
>PF12234 Rav1p_C: RAVE protein 1 C terminal; InterPro: IPR022033 This domain family is found in eukaryotes, and is typically between 621 and 644 amino acids in length Back     alignment and domain information
>TIGR02604 Piru_Ver_Nterm putative membrane-bound dehydrogenase domain Back     alignment and domain information
>KOG2280 consensus Vacuolar assembly/sorting protein VPS16 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>TIGR03118 PEPCTERM_chp_1 conserved hypothetical protein TIGR03118 Back     alignment and domain information
>PF14870 PSII_BNR: Photosynthesis system II assembly factor YCF48; PDB: 2XBG_A Back     alignment and domain information
>PLN00033 photosystem II stability/assembly factor; Provisional Back     alignment and domain information
>PF13449 Phytase-like: Esterase-like activity of phytase Back     alignment and domain information
>PHA03098 kelch-like protein; Provisional Back     alignment and domain information
>PF07995 GSDH: Glucose / Sorbosone dehydrogenase; InterPro: IPR012938 Proteins containing this domain are thought to be glucose/sorbosone dehydrogenases Back     alignment and domain information
>PF14761 HPS3_N: Hermansky-Pudlak syndrome 3 Back     alignment and domain information
>PF15390 DUF4613: Domain of unknown function (DUF4613) Back     alignment and domain information
>KOG2444 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG2247 consensus WD40 repeat-containing protein [General function prediction only] Back     alignment and domain information
>COG3823 Glutamine cyclotransferase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG4257 Vgb Streptogramin lyase [Defense mechanisms] Back     alignment and domain information
>PF08728 CRT10: CRT10; InterPro: IPR014839 CRT10 is a transcriptional regulator of ribonucleotide reductase (RNR) genes [] Back     alignment and domain information
>PF13449 Phytase-like: Esterase-like activity of phytase Back     alignment and domain information
>KOG3630 consensus Nuclear pore complex, Nup214/CAN component [Nuclear structure; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>TIGR02604 Piru_Ver_Nterm putative membrane-bound dehydrogenase domain Back     alignment and domain information
>KOG1916 consensus Nuclear protein, contains WD40 repeats [General function prediction only] Back     alignment and domain information
>KOG3630 consensus Nuclear pore complex, Nup214/CAN component [Nuclear structure; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG2377 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF03022 MRJP: Major royal jelly protein; InterPro: IPR003534 The major royal jelly proteins (MRJPs) comprise 12 Back     alignment and domain information
>PF10168 Nup88: Nuclear pore component; InterPro: IPR019321 Nup88 can be divided into two structural domains; the N-terminal two-thirds of the protein have no obvious structural motifs Back     alignment and domain information
>PHA02790 Kelch-like protein; Provisional Back     alignment and domain information
>KOG2280 consensus Vacuolar assembly/sorting protein VPS16 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF10313 DUF2415: Uncharacterised protein domain (DUF2415); InterPro: IPR019417 This entry represents a short (30 residues) domain of unknown function found in a family of fungal proteins Back     alignment and domain information
>TIGR03606 non_repeat_PQQ dehydrogenase, PQQ-dependent, s-GDH family Back     alignment and domain information
>PF10214 Rrn6: RNA polymerase I-specific transcription-initiation factor; InterPro: IPR019350 RNA polymerase I-specific transcription-initiation factor Rrn6 and Rrn7 represent components of a multisubunit transcription factor essential for the initiation of rDNA transcription by Pol I [] Back     alignment and domain information
>PF10313 DUF2415: Uncharacterised protein domain (DUF2415); InterPro: IPR019417 This entry represents a short (30 residues) domain of unknown function found in a family of fungal proteins Back     alignment and domain information
>PF11725 AvrE: Pathogenicity factor; InterPro: IPR021085 This family is secreted by Gram-negative Gammaproteobacteria such as Pseudomonas syringae of tomato and Erwinia amylovora (Fire blight bacteria), amongst others Back     alignment and domain information
>PF08728 CRT10: CRT10; InterPro: IPR014839 CRT10 is a transcriptional regulator of ribonucleotide reductase (RNR) genes [] Back     alignment and domain information
>PF14727 PHTB1_N: PTHB1 N-terminus Back     alignment and domain information
>smart00036 CNH Domain found in NIK1-like kinases, mouse citron and yeast ROM1, ROM2 Back     alignment and domain information
>COG4257 Vgb Streptogramin lyase [Defense mechanisms] Back     alignment and domain information
>PF10168 Nup88: Nuclear pore component; InterPro: IPR019321 Nup88 can be divided into two structural domains; the N-terminal two-thirds of the protein have no obvious structural motifs Back     alignment and domain information
>KOG2377 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK13613 lipoprotein LpqB; Provisional Back     alignment and domain information
>COG1520 FOG: WD40-like repeat [Function unknown] Back     alignment and domain information
>COG3292 Predicted periplasmic ligand-binding sensor domain [Signal transduction mechanisms] Back     alignment and domain information
>KOG1900 consensus Nuclear pore complex, Nup155 component (D Nup154, sc Nup157/Nup170) [Nuclear structure; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>COG3823 Glutamine cyclotransferase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5167 VID27 Protein involved in vacuole import and degradation [Intracellular trafficking and secretion] Back     alignment and domain information
>KOG1900 consensus Nuclear pore complex, Nup155 component (D Nup154, sc Nup157/Nup170) [Nuclear structure; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF07569 Hira: TUP1-like enhancer of split; InterPro: IPR011494 The Hira proteins are found in a range of eukaryotes and are implicated in the assembly of repressive chromatin Back     alignment and domain information
>PRK13615 lipoprotein LpqB; Provisional Back     alignment and domain information
>PF07676 PD40: WD40-like Beta Propeller Repeat; InterPro: IPR011659 WD-40 repeats (also known as WD or beta-transducin repeats) are short ~40 amino acid motifs, often terminating in a Trp-Asp (W-D) dipeptide Back     alignment and domain information
>KOG1916 consensus Nuclear protein, contains WD40 repeats [General function prediction only] Back     alignment and domain information
>PF02333 Phytase: Phytase; InterPro: IPR003431 Phytase (3 Back     alignment and domain information
>COG5167 VID27 Protein involved in vacuole import and degradation [Intracellular trafficking and secretion] Back     alignment and domain information
>PF14761 HPS3_N: Hermansky-Pudlak syndrome 3 Back     alignment and domain information
>PF14781 BBS2_N: Ciliary BBSome complex subunit 2, N-terminal Back     alignment and domain information
>PRK13684 Ycf48-like protein; Provisional Back     alignment and domain information
>PF12657 TFIIIC_delta: Transcription factor IIIC subunit delta N-term; InterPro: IPR024761 This entry represents a domain found towards the N terminus of the 90 kDa subunit of transcription factor IIIC (also known as subunit 9 in yeast []) Back     alignment and domain information
>KOG1983 consensus Tomosyn and related SNARE-interacting proteins [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>COG4590 ABC-type uncharacterized transport system, permease component [General function prediction only] Back     alignment and domain information
>COG4590 ABC-type uncharacterized transport system, permease component [General function prediction only] Back     alignment and domain information
>COG5290 IkappaB kinase complex, IKAP component [Transcription] Back     alignment and domain information
>TIGR03606 non_repeat_PQQ dehydrogenase, PQQ-dependent, s-GDH family Back     alignment and domain information
>PRK14131 N-acetylneuraminic acid mutarotase; Provisional Back     alignment and domain information
>PRK13614 lipoprotein LpqB; Provisional Back     alignment and domain information
>COG1520 FOG: WD40-like repeat [Function unknown] Back     alignment and domain information
>KOG2247 consensus WD40 repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF08801 Nucleoporin_N: Nup133 N terminal like; InterPro: IPR014908 Nucleoporins are the main components of the nuclear pore complex (NPC) in eukaryotic cells, and mediate bidirectional nucleocytoplasmic transport, especially of mRNA and proteins Back     alignment and domain information
>KOG1898 consensus Splicing factor 3b, subunit 3 [RNA processing and modification] Back     alignment and domain information
>TIGR02276 beta_rpt_yvtn 40-residue YVTN family beta-propeller repeat Back     alignment and domain information
>PRK13613 lipoprotein LpqB; Provisional Back     alignment and domain information
>PRK14131 N-acetylneuraminic acid mutarotase; Provisional Back     alignment and domain information
>PF07569 Hira: TUP1-like enhancer of split; InterPro: IPR011494 The Hira proteins are found in a range of eukaryotes and are implicated in the assembly of repressive chromatin Back     alignment and domain information
>COG3292 Predicted periplasmic ligand-binding sensor domain [Signal transduction mechanisms] Back     alignment and domain information
>TIGR03548 mutarot_permut cyclically-permuted mutatrotase family protein Back     alignment and domain information
>PLN02193 nitrile-specifier protein Back     alignment and domain information
>PF07250 Glyoxal_oxid_N: Glyoxal oxidase N-terminus; InterPro: IPR009880 This entry represents the N terminus (approximately 300 residues) of a number of plant and fungal glyoxal oxidase enzymes Back     alignment and domain information
>KOG1898 consensus Splicing factor 3b, subunit 3 [RNA processing and modification] Back     alignment and domain information
>KOG4460 consensus Nuclear pore complex, Nup88/rNup84 component [Nuclear structure; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>COG5276 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query1071
2ymu_A577 Structure Of A Highly Repetitive Propeller Structur 3e-08
2ymu_A577 Structure Of A Highly Repetitive Propeller Structur 5e-04
2xl2_A334 Wdr5 In Complex With An Rbbp5 Peptide Recruited To 4e-08
2xl2_A334 Wdr5 In Complex With An Rbbp5 Peptide Recruited To 2e-04
2gnq_A336 Structure Of Wdr5 Length = 336 5e-08
2gnq_A336 Structure Of Wdr5 Length = 336 2e-04
2h9l_A329 Wdr5delta23 Length = 329 1e-07
2h9l_A329 Wdr5delta23 Length = 329 2e-04
3mks_B464 Crystal Structure Of Yeast Cdc4SKP1 IN COMPLEX WITH 1e-07
2co0_A315 Wdr5 And Unmodified Histone H3 Complex At 2.25 Angs 1e-07
2co0_A315 Wdr5 And Unmodified Histone H3 Complex At 2.25 Angs 2e-04
2cnx_A315 Wdr5 And Histone H3 Lysine 4 Dimethyl Complex At 2. 1e-07
2cnx_A315 Wdr5 And Histone H3 Lysine 4 Dimethyl Complex At 2. 2e-04
1nex_B464 Crystal Structure Of Scskp1-Sccdc4-Cpd Peptide Comp 2e-07
3mxx_A315 Crystal Structure Of Wdr5 Mutant (S62a) Length = 31 2e-07
3mxx_A315 Crystal Structure Of Wdr5 Mutant (S62a) Length = 31 1e-04
3n0d_A315 Crystal Structure Of Wdr5 Mutant (W330f) Length = 3 2e-07
3n0d_A315 Crystal Structure Of Wdr5 Mutant (W330f) Length = 3 4e-04
3n0e_A315 Crystal Structure Of Wdr5 Mutant (W330y) Length = 3 2e-07
3n0e_A315 Crystal Structure Of Wdr5 Mutant (W330y) Length = 3 4e-04
3sfz_A 1249 Crystal Structure Of Full-Length Murine Apaf-1 Leng 4e-07
3shf_A 1256 Crystal Structure Of The R265s Mutant Of Full-Lengt 4e-07
2g9a_A311 Structural Basis For The Specific Recognition Of Me 4e-07
2g9a_A311 Structural Basis For The Specific Recognition Of Me 4e-04
3smr_A312 Crystal Structure Of Human Wd Repeat Domain 5 With 4e-07
3smr_A312 Crystal Structure Of Human Wd Repeat Domain 5 With 4e-04
2g99_A308 Structural Basis For The Specific Recognition Of Me 4e-07
2g99_A308 Structural Basis For The Specific Recognition Of Me 4e-04
3psl_A318 Fine-Tuning The Stimulation Of Mll1 Methyltransfera 5e-07
3psl_A318 Fine-Tuning The Stimulation Of Mll1 Methyltransfera 5e-04
2h9m_A313 Wdr5 In Complex With Unmodified H3k4 Peptide Length 5e-07
2h9m_A313 Wdr5 In Complex With Unmodified H3k4 Peptide Length 5e-04
2h68_A312 Histone H3 Recognition And Presentation By The Wdr5 5e-07
2h68_A312 Histone H3 Recognition And Presentation By The Wdr5 5e-04
2h13_A317 Crystal Structure Of Wdr5HISTONE H3 COMPLEX Length 5e-07
2h13_A317 Crystal Structure Of Wdr5HISTONE H3 COMPLEX Length 5e-04
4a7j_A318 Symmetric Dimethylation Of H3 Arginine 2 Is A Novel 5e-07
4a7j_A318 Symmetric Dimethylation Of H3 Arginine 2 Is A Novel 5e-04
3emh_A318 Structural Basis Of Wdr5-Mll Interaction Length = 3 5e-07
3emh_A318 Structural Basis Of Wdr5-Mll Interaction Length = 3 5e-04
3iza_B 1263 Structure Of An Apoptosome-Procaspase-9 Card Comple 2e-06
3zey_7318 High-resolution Cryo-electron Microscopy Structure 7e-06
2b4e_A 402 Crystal Structure Of Murine Coronin-1: Monoclinic F 1e-05
2pm9_A416 Crystal Structure Of Yeast Sec1331 VERTEX ELEMENT O 1e-05
2aq5_A 402 Crystal Structure Of Murine Coronin-1 Length = 402 1e-05
3jpx_A402 Eed: A Novel Histone Trimethyllysine Binder Within 4e-05
3iiy_A365 Crystal Structure Of Eed In Complex With A Trimethy 4e-05
3jzn_A366 Structure Of Eed In Apo Form Length = 366 4e-05
2qxv_A361 Structural Basis Of Ezh2 Recognition By Eed Length 4e-05
3iiw_A365 Crystal Structure Of Eed In Complex With A Trimethy 4e-05
2xzm_R343 Crystal Structure Of The Eukaryotic 40s Ribosomal S 2e-04
1vyh_C410 Paf-Ah Holoenzyme: Lis1ALFA2 Length = 410 7e-04
>pdb|2YMU|A Chain A, Structure Of A Highly Repetitive Propeller Structure Length = 577 Back     alignment and structure 
Iteration: 1

 Score = 58.2 bits (139), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 76/268 (28%), Positives = 117/268 (43%), Gaps = 29/268 (10%)
Query: 414 CVWG----PDGLMLGVAFSKHIVHLYTYNPTGELRQHLEIDAHVGGVNDIAFAHPNKQLC 469
            VWG    PDG  +  A     V L+  N  G+L Q L    H   V  +AF+ P+ Q  
Sbjct: 182 SVWGVAFSPDGQTIASASDDKTVKLWNRN--GQLLQTLT--GHSSSVRGVAFS-PDGQ-T 235
Query: 470 IVTCGDDKMIKVWDVVAGRKQYTFEGHEAPVYSVCPHHKESIQFIFSTAIDGKIKAWLYD 529
           I +  DDK +K+W+   G+   T  GH + V  V    +   Q I S + D  +K W  +
Sbjct: 236 IASASDDKTVKLWN-RNGQLLQTLTGHSSSVNGVA--FRPDGQTIASASDDKTVKLWNRN 292
Query: 530 -YLGSRVDYDAPGNWCTMMAYSADGTRLFSCGTSKEGESHLVEWNESEGAIKRTYSGFRK 588
             L   +   +   W   +A+S DG  + S    K     +  WN   G   +T +G   
Sbjct: 293 GQLLQTLTGHSSSVWG--VAFSPDGQTIASASDDKT----VKLWNR-NGQHLQTLTGHSS 345
Query: 589 RSLGVVQFDTTRNRFLAAGDEFQIKFWDMDNMNMLTTVDADGGLPASPR-LRFNKEGSLL 647
              GV  F        +A D+  +K W+  N  +L T+    G  +S R + F+ +G  +
Sbjct: 346 SVWGVA-FSPDGQTIASASDDKTVKLWNR-NGQLLQTLT---GHSSSVRGVAFSPDGQTI 400
Query: 648 AVTTSDNGIKILANSDGVRLLRMLEGRA 675
           A  + D  +K L N +G +LL+ L G +
Sbjct: 401 ASASDDKTVK-LWNRNG-QLLQTLTGHS 426
>pdb|2YMU|A Chain A, Structure Of A Highly Repetitive Propeller Structure Length = 577 Back     alignment and structure
>pdb|2XL2|A Chain A, Wdr5 In Complex With An Rbbp5 Peptide Recruited To Novel Site Length = 334 Back     alignment and structure
>pdb|2XL2|A Chain A, Wdr5 In Complex With An Rbbp5 Peptide Recruited To Novel Site Length = 334 Back     alignment and structure
>pdb|2GNQ|A Chain A, Structure Of Wdr5 Length = 336 Back     alignment and structure
>pdb|2GNQ|A Chain A, Structure Of Wdr5 Length = 336 Back     alignment and structure
>pdb|2H9L|A Chain A, Wdr5delta23 Length = 329 Back     alignment and structure
>pdb|2H9L|A Chain A, Wdr5delta23 Length = 329 Back     alignment and structure
>pdb|3MKS|B Chain B, Crystal Structure Of Yeast Cdc4SKP1 IN COMPLEX WITH AN ALLOSTERIC Inhibitor Scf-I2 Length = 464 Back     alignment and structure
>pdb|2CO0|A Chain A, Wdr5 And Unmodified Histone H3 Complex At 2.25 Angstrom Length = 315 Back     alignment and structure
>pdb|2CO0|A Chain A, Wdr5 And Unmodified Histone H3 Complex At 2.25 Angstrom Length = 315 Back     alignment and structure
>pdb|2CNX|A Chain A, Wdr5 And Histone H3 Lysine 4 Dimethyl Complex At 2.1 Angstrom Length = 315 Back     alignment and structure
>pdb|2CNX|A Chain A, Wdr5 And Histone H3 Lysine 4 Dimethyl Complex At 2.1 Angstrom Length = 315 Back     alignment and structure
>pdb|1NEX|B Chain B, Crystal Structure Of Scskp1-Sccdc4-Cpd Peptide Complex Length = 464 Back     alignment and structure
>pdb|3MXX|A Chain A, Crystal Structure Of Wdr5 Mutant (S62a) Length = 315 Back     alignment and structure
>pdb|3MXX|A Chain A, Crystal Structure Of Wdr5 Mutant (S62a) Length = 315 Back     alignment and structure
>pdb|3N0D|A Chain A, Crystal Structure Of Wdr5 Mutant (W330f) Length = 315 Back     alignment and structure
>pdb|3N0D|A Chain A, Crystal Structure Of Wdr5 Mutant (W330f) Length = 315 Back     alignment and structure
>pdb|3N0E|A Chain A, Crystal Structure Of Wdr5 Mutant (W330y) Length = 315 Back     alignment and structure
>pdb|3N0E|A Chain A, Crystal Structure Of Wdr5 Mutant (W330y) Length = 315 Back     alignment and structure
>pdb|3SFZ|A Chain A, Crystal Structure Of Full-Length Murine Apaf-1 Length = 1249 Back     alignment and structure
>pdb|3SHF|A Chain A, Crystal Structure Of The R265s Mutant Of Full-Length Murine Apaf-1 Length = 1256 Back     alignment and structure
>pdb|2G9A|A Chain A, Structural Basis For The Specific Recognition Of Methylated Histone H3 Lysine 4 By The Wd-40 Protein Wdr5 Length = 311 Back     alignment and structure
>pdb|2G9A|A Chain A, Structural Basis For The Specific Recognition Of Methylated Histone H3 Lysine 4 By The Wd-40 Protein Wdr5 Length = 311 Back     alignment and structure
>pdb|3SMR|A Chain A, Crystal Structure Of Human Wd Repeat Domain 5 With Compound Length = 312 Back     alignment and structure
>pdb|3SMR|A Chain A, Crystal Structure Of Human Wd Repeat Domain 5 With Compound Length = 312 Back     alignment and structure
>pdb|2G99|A Chain A, Structural Basis For The Specific Recognition Of Methylated Histone H3 Lysine 4 By The Wd-40 Protein Wdr5 Length = 308 Back     alignment and structure
>pdb|2G99|A Chain A, Structural Basis For The Specific Recognition Of Methylated Histone H3 Lysine 4 By The Wd-40 Protein Wdr5 Length = 308 Back     alignment and structure
>pdb|3PSL|A Chain A, Fine-Tuning The Stimulation Of Mll1 Methyltransferase Activity By A Histone H3 Based Peptide Mimetic Length = 318 Back     alignment and structure
>pdb|3PSL|A Chain A, Fine-Tuning The Stimulation Of Mll1 Methyltransferase Activity By A Histone H3 Based Peptide Mimetic Length = 318 Back     alignment and structure
>pdb|2H9M|A Chain A, Wdr5 In Complex With Unmodified H3k4 Peptide Length = 313 Back     alignment and structure
>pdb|2H9M|A Chain A, Wdr5 In Complex With Unmodified H3k4 Peptide Length = 313 Back     alignment and structure
>pdb|2H68|A Chain A, Histone H3 Recognition And Presentation By The Wdr5 Module Of The Mll1 Complex Length = 312 Back     alignment and structure
>pdb|2H68|A Chain A, Histone H3 Recognition And Presentation By The Wdr5 Module Of The Mll1 Complex Length = 312 Back     alignment and structure
>pdb|2H13|A Chain A, Crystal Structure Of Wdr5HISTONE H3 COMPLEX Length = 317 Back     alignment and structure
>pdb|2H13|A Chain A, Crystal Structure Of Wdr5HISTONE H3 COMPLEX Length = 317 Back     alignment and structure
>pdb|4A7J|A Chain A, Symmetric Dimethylation Of H3 Arginine 2 Is A Novel Histone Mark That Supports Euchromatin Maintenance Length = 318 Back     alignment and structure
>pdb|4A7J|A Chain A, Symmetric Dimethylation Of H3 Arginine 2 Is A Novel Histone Mark That Supports Euchromatin Maintenance Length = 318 Back     alignment and structure
>pdb|3EMH|A Chain A, Structural Basis Of Wdr5-Mll Interaction Length = 318 Back     alignment and structure
>pdb|3EMH|A Chain A, Structural Basis Of Wdr5-Mll Interaction Length = 318 Back     alignment and structure
>pdb|3ZEY|7 Chain 7, High-resolution Cryo-electron Microscopy Structure Of The Trypanosoma Brucei Ribosome Length = 318 Back     alignment and structure
>pdb|2B4E|A Chain A, Crystal Structure Of Murine Coronin-1: Monoclinic Form Length = 402 Back     alignment and structure
>pdb|2PM9|A Chain A, Crystal Structure Of Yeast Sec1331 VERTEX ELEMENT OF THE Copii Vesicular Coat Length = 416 Back     alignment and structure
>pdb|2AQ5|A Chain A, Crystal Structure Of Murine Coronin-1 Length = 402 Back     alignment and structure
>pdb|3JPX|A Chain A, Eed: A Novel Histone Trimethyllysine Binder Within The Eed-Ezh2 Polycomb Complex Length = 402 Back     alignment and structure
>pdb|3IIY|A Chain A, Crystal Structure Of Eed In Complex With A Trimethylated Histone H1k26 Peptide Length = 365 Back     alignment and structure
>pdb|3JZN|A Chain A, Structure Of Eed In Apo Form Length = 366 Back     alignment and structure
>pdb|2QXV|A Chain A, Structural Basis Of Ezh2 Recognition By Eed Length = 361 Back     alignment and structure
>pdb|3IIW|A Chain A, Crystal Structure Of Eed In Complex With A Trimethylated Histone H3k27 Peptide Length = 365 Back     alignment and structure
>pdb|2XZM|R Chain R, Crystal Structure Of The Eukaryotic 40s Ribosomal Subunit In Complex With Initiation Factor 1. This File Contains The 40s Subunit And Initiation Factor For Molecule 1 Length = 343 Back     alignment and structure
>pdb|1VYH|C Chain C, Paf-Ah Holoenzyme: Lis1ALFA2 Length = 410 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

No hit with probability above 80.00

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 1071
d1tbga_340 b.69.4.1 (A:) beta1-subunit of the signal-transduc 1e-16
d1tbga_340 b.69.4.1 (A:) beta1-subunit of the signal-transduc 1e-15
d1tbga_340 b.69.4.1 (A:) beta1-subunit of the signal-transduc 9e-12
d1tbga_340 b.69.4.1 (A:) beta1-subunit of the signal-transduc 1e-09
d1tbga_ 340 b.69.4.1 (A:) beta1-subunit of the signal-transduc 1e-04
d1vyhc1317 b.69.4.1 (C:92-408) Platelet-activating factor ace 3e-16
d1vyhc1317 b.69.4.1 (C:92-408) Platelet-activating factor ace 4e-15
d1vyhc1317 b.69.4.1 (C:92-408) Platelet-activating factor ace 7e-15
d1vyhc1317 b.69.4.1 (C:92-408) Platelet-activating factor ace 2e-12
d1vyhc1317 b.69.4.1 (C:92-408) Platelet-activating factor ace 2e-09
d1vyhc1317 b.69.4.1 (C:92-408) Platelet-activating factor ace 2e-07
d1vyhc1 317 b.69.4.1 (C:92-408) Platelet-activating factor ace 7e-06
d1vyhc1317 b.69.4.1 (C:92-408) Platelet-activating factor ace 2e-05
d1vyhc1 317 b.69.4.1 (C:92-408) Platelet-activating factor ace 1e-04
d1erja_388 b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yea 5e-13
d1erja_388 b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yea 9e-13
d1erja_388 b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yea 7e-11
d1erja_388 b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yea 1e-08
d1erja_388 b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yea 2e-08
d1erja_388 b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yea 2e-06
d1k8kc_ 371 b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 4e-12
d1k8kc_371 b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 4e-11
d1k8kc_371 b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 0.001
d1k8kc_371 b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 0.003
d2ovrb2342 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing 3e-11
d2ovrb2342 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing 1e-06
d2ovrb2342 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing 2e-06
d2ovrb2342 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing 4e-06
d2ovrb2342 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing 8e-05
d2ovrb2 342 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing 0.002
d1nexb2355 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker' 9e-10
d1nexb2355 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker' 8e-08
d1nexb2355 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker' 1e-07
d1nexb2 355 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker' 1e-05
d1nexb2355 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker' 5e-04
d1p22a2293 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (be 4e-09
d1p22a2293 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (be 2e-07
d1p22a2293 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (be 1e-05
d1p22a2293 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (be 0.002
d1nr0a2299 b.69.4.1 (A:313-611) Actin interacting protein 1 { 8e-09
d1nr0a2 299 b.69.4.1 (A:313-611) Actin interacting protein 1 { 3e-05
d1nr0a2299 b.69.4.1 (A:313-611) Actin interacting protein 1 { 1e-04
d1nr0a2299 b.69.4.1 (A:313-611) Actin interacting protein 1 { 3e-04
d1nr0a2299 b.69.4.1 (A:313-611) Actin interacting protein 1 { 7e-04
d1nr0a2299 b.69.4.1 (A:313-611) Actin interacting protein 1 { 9e-04
d1gxra_337 b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Hum 1e-08
d1gxra_337 b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Hum 5e-08
d1gxra_337 b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Hum 1e-07
d1gxra_337 b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Hum 7e-06
d1gxra_337 b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Hum 1e-05
d1gxra_337 b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Hum 6e-05
d1yfqa_342 b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Bake 2e-08
d1yfqa_342 b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Bake 2e-08
d1yfqa_342 b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Bake 9e-06
d1yfqa_ 342 b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Bake 2e-05
d1yfqa_342 b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Bake 1e-04
d1yfqa_ 342 b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Bake 5e-04
d1yfqa_342 b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Bake 0.002
d1pgua2287 b.69.4.1 (A:327-613) Actin interacting protein 1 { 3e-08
d1pgua2287 b.69.4.1 (A:327-613) Actin interacting protein 1 { 2e-06
d1pgua2287 b.69.4.1 (A:327-613) Actin interacting protein 1 { 5e-06
d1pgua2287 b.69.4.1 (A:327-613) Actin interacting protein 1 { 4e-05
d1pgua2 287 b.69.4.1 (A:327-613) Actin interacting protein 1 { 3e-04
d1hzua2426 b.70.2.1 (A:118-543) C-terminal (heme d1) domain o 9e-08
d1hzua2426 b.70.2.1 (A:118-543) C-terminal (heme d1) domain o 4e-04
d1hzua2 426 b.70.2.1 (A:118-543) C-terminal (heme d1) domain o 0.003
d1sq9a_393 b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Bake 1e-07
d1sq9a_393 b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Bake 1e-05
d1sq9a_393 b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Bake 8e-05
d1nr0a1 311 b.69.4.1 (A:2-312) Actin interacting protein 1 {Ne 8e-07
d1nr0a1311 b.69.4.1 (A:2-312) Actin interacting protein 1 {Ne 4e-06
d1nr0a1311 b.69.4.1 (A:2-312) Actin interacting protein 1 {Ne 3e-05
d1nr0a1311 b.69.4.1 (A:2-312) Actin interacting protein 1 {Ne 4e-05
d1pbyb_337 b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase 2e-06
d1k32a3360 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Ar 3e-06
d1k32a3360 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Ar 4e-05
d1k32a3360 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Ar 6e-05
d1k32a3360 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Ar 0.001
d1k32a3 360 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Ar 0.002
d1pgua1325 b.69.4.1 (A:2-326) Actin interacting protein 1 {Ba 4e-06
d1pgua1325 b.69.4.1 (A:2-326) Actin interacting protein 1 {Ba 1e-05
d1pgua1325 b.69.4.1 (A:2-326) Actin interacting protein 1 {Ba 1e-04
d1pgua1 325 b.69.4.1 (A:2-326) Actin interacting protein 1 {Ba 5e-04
d1l0qa2301 b.69.2.3 (A:1-301) Surface layer protein {Archaeon 5e-06
d1ri6a_333 b.69.11.1 (A:) Putative isomerase YbhE {Escherichi 1e-05
d1ri6a_333 b.69.11.1 (A:) Putative isomerase YbhE {Escherichi 7e-04
d2bbkh_355 b.69.2.1 (H:) Methylamine dehydrogenase, H-chain { 1e-05
d2bbkh_355 b.69.2.1 (H:) Methylamine dehydrogenase, H-chain { 2e-04
d1qnia2441 b.69.3.1 (A:10-450) Nitrous oxide reductase, N-ter 1e-04
d1jmxb_346 b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase 1e-04
d1jmxb_346 b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase 6e-04
d1jmxb_346 b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase 0.001
d1qksa2 432 b.70.2.1 (A:136-567) C-terminal (heme d1) domain o 3e-04
d1qksa2432 b.70.2.1 (A:136-567) C-terminal (heme d1) domain o 7e-04
d1jofa_365 b.69.10.1 (A:) 3-carboxy-cis,cis-mucoante lactoniz 0.001
d1mdah_368 b.69.2.1 (H:) Methylamine dehydrogenase, H-chain { 0.001
>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Length = 340 Back     information, alignment and structure

class: All beta proteins
fold: 7-bladed beta-propeller
superfamily: WD40 repeat-like
family: WD40-repeat
domain: beta1-subunit of the signal-transducing G protein heterotrimer
species: Cow (Bos taurus) [TaxId: 9913]

 Score = 80.6 bits (197), Expect = 1e-16
 Identities = 44/339 (12%), Positives = 100/339 (29%), Gaps = 32/339 (9%)

Query: 302 DSDHLMKRIRTGQSDEVSFAGVAHTPNVYSQDDLTKTVVRTLN-QGSNVMSMDFHPQQQT 360
           +++ L  +IR  +           T N+     +     RTL    + + +M +    + 
Sbjct: 10  EAEQLKNQIRDARKACADATLSQITNNIDPVGRIQMRTRRTLRGHLAKIYAMHWGTDSRL 69

Query: 361 ILLVGTNVGDISLWEVGSRERLAHKPFKVWDISAASMPLQNALLNDAAISVNRCVWGPDG 420
            L+  +  G + +W+  +  ++   P +   +   +       +    +     ++    
Sbjct: 70  -LVSASQDGKLIIWDSYTTNKVHAIPLRSSWVMTCAYAPSGNYVACGGLDNICSIYNLKT 128

Query: 421 LMLGVAFSKHIVHLYTYNPTGELRQHLEIDAHVGGVNDIAFAHPNKQLCI---------- 470
               V  S+ +     Y          +I    G      +     Q             
Sbjct: 129 REGNVRVSRELAGHTGYLSCCRFLDDNQIVTSSGDTTCALWDIETGQQTTTFTGHTGDVM 188

Query: 471 -----------VTCGDDKMIKVWDVVAGRKQYTFEGHEAPVYSVCPHHKESIQFIFSTAI 519
                      V+   D   K+WDV  G  + TF GHE+ + ++C           + + 
Sbjct: 189 SLSLAPDTRLFVSGACDASAKLWDVREGMCRQTFTGHESDINAICFFPNG--NAFATGSD 246

Query: 520 DGKIKAWLYDYLGSRVDYDAPGNWC--TMMAYSADGTRLFSCGTSKEGESHLVEWNESEG 577
           D   + +        + Y      C  T +++S  G  L +       + +   W+  + 
Sbjct: 247 DATCRLFDLRADQELMTYSHDNIICGITSVSFSKSGRLLLAGYD----DFNCNVWDALKA 302

Query: 578 AIKRTYSGFRKRSLGVVQFDTTRNRFLAAGDEFQIKFWD 616
                 +G   R    +              +  +K W+
Sbjct: 303 DRAGVLAGHDNRVSC-LGVTDDGMAVATGSWDSFLKIWN 340
>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Length = 340 Back     information, alignment and structure
>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Length = 340 Back     information, alignment and structure
>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Length = 340 Back     information, alignment and structure
>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Length = 340 Back     information, alignment and structure
>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Length = 317 Back     information, alignment and structure
>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Length = 317 Back     information, alignment and structure
>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Length = 317 Back     information, alignment and structure
>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Length = 317 Back     information, alignment and structure
>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Length = 317 Back     information, alignment and structure
>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Length = 317 Back     information, alignment and structure
>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Length = 317 Back     information, alignment and structure
>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Length = 317 Back     information, alignment and structure
>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Length = 317 Back     information, alignment and structure
>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 388 Back     information, alignment and structure
>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 388 Back     information, alignment and structure
>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 388 Back     information, alignment and structure
>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 388 Back     information, alignment and structure
>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 388 Back     information, alignment and structure
>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 388 Back     information, alignment and structure
>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} Length = 371 Back     information, alignment and structure
>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} Length = 371 Back     information, alignment and structure
>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} Length = 371 Back     information, alignment and structure
>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} Length = 371 Back     information, alignment and structure
>d2ovrb2 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Length = 342 Back     information, alignment and structure
>d2ovrb2 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Length = 342 Back     information, alignment and structure
>d2ovrb2 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Length = 342 Back     information, alignment and structure
>d2ovrb2 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Length = 342 Back     information, alignment and structure
>d2ovrb2 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Length = 342 Back     information, alignment and structure
>d2ovrb2 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Length = 342 Back     information, alignment and structure
>d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 355 Back     information, alignment and structure
>d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 355 Back     information, alignment and structure
>d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 355 Back     information, alignment and structure
>d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 355 Back     information, alignment and structure
>d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 355 Back     information, alignment and structure
>d1p22a2 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} Length = 293 Back     information, alignment and structure
>d1p22a2 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} Length = 293 Back     information, alignment and structure
>d1p22a2 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} Length = 293 Back     information, alignment and structure
>d1p22a2 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} Length = 293 Back     information, alignment and structure
>d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 299 Back     information, alignment and structure
>d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 299 Back     information, alignment and structure
>d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 299 Back     information, alignment and structure
>d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 299 Back     information, alignment and structure
>d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 299 Back     information, alignment and structure
>d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 299 Back     information, alignment and structure
>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 337 Back     information, alignment and structure
>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 337 Back     information, alignment and structure
>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 337 Back     information, alignment and structure
>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 337 Back     information, alignment and structure
>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 337 Back     information, alignment and structure
>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 337 Back     information, alignment and structure
>d1yfqa_ b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 342 Back     information, alignment and structure
>d1yfqa_ b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 342 Back     information, alignment and structure
>d1yfqa_ b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 342 Back     information, alignment and structure
>d1yfqa_ b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 342 Back     information, alignment and structure
>d1yfqa_ b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 342 Back     information, alignment and structure
>d1yfqa_ b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 342 Back     information, alignment and structure
>d1yfqa_ b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 342 Back     information, alignment and structure
>d1pgua2 b.69.4.1 (A:327-613) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 287 Back     information, alignment and structure
>d1pgua2 b.69.4.1 (A:327-613) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 287 Back     information, alignment and structure
>d1pgua2 b.69.4.1 (A:327-613) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 287 Back     information, alignment and structure
>d1pgua2 b.69.4.1 (A:327-613) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 287 Back     information, alignment and structure
>d1pgua2 b.69.4.1 (A:327-613) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 287 Back     information, alignment and structure
>d1hzua2 b.70.2.1 (A:118-543) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Pseudomonas aeruginosa [TaxId: 287]} Length = 426 Back     information, alignment and structure
>d1hzua2 b.70.2.1 (A:118-543) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Pseudomonas aeruginosa [TaxId: 287]} Length = 426 Back     information, alignment and structure
>d1hzua2 b.70.2.1 (A:118-543) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Pseudomonas aeruginosa [TaxId: 287]} Length = 426 Back     information, alignment and structure
>d1sq9a_ b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 393 Back     information, alignment and structure
>d1sq9a_ b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 393 Back     information, alignment and structure
>d1sq9a_ b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 393 Back     information, alignment and structure
>d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 311 Back     information, alignment and structure
>d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 311 Back     information, alignment and structure
>d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 311 Back     information, alignment and structure
>d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 311 Back     information, alignment and structure
>d1pbyb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Paracoccus denitrificans [TaxId: 266]} Length = 337 Back     information, alignment and structure
>d1k32a3 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Length = 360 Back     information, alignment and structure
>d1k32a3 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Length = 360 Back     information, alignment and structure
>d1k32a3 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Length = 360 Back     information, alignment and structure
>d1k32a3 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Length = 360 Back     information, alignment and structure
>d1k32a3 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Length = 360 Back     information, alignment and structure
>d1pgua1 b.69.4.1 (A:2-326) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 325 Back     information, alignment and structure
>d1pgua1 b.69.4.1 (A:2-326) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 325 Back     information, alignment and structure
>d1pgua1 b.69.4.1 (A:2-326) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 325 Back     information, alignment and structure
>d1pgua1 b.69.4.1 (A:2-326) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 325 Back     information, alignment and structure
>d1l0qa2 b.69.2.3 (A:1-301) Surface layer protein {Archaeon Methanosarcina mazei [TaxId: 2209]} Length = 301 Back     information, alignment and structure
>d1ri6a_ b.69.11.1 (A:) Putative isomerase YbhE {Escherichia coli [TaxId: 562]} Length = 333 Back     information, alignment and structure
>d1ri6a_ b.69.11.1 (A:) Putative isomerase YbhE {Escherichia coli [TaxId: 562]} Length = 333 Back     information, alignment and structure
>d2bbkh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Length = 355 Back     information, alignment and structure
>d2bbkh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Length = 355 Back     information, alignment and structure
>d1qnia2 b.69.3.1 (A:10-450) Nitrous oxide reductase, N-terminal domain {Pseudomonas nautica [TaxId: 2743]} Length = 441 Back     information, alignment and structure
>d1jmxb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Pseudomonas putida [TaxId: 303]} Length = 346 Back     information, alignment and structure
>d1jmxb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Pseudomonas putida [TaxId: 303]} Length = 346 Back     information, alignment and structure
>d1jmxb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Pseudomonas putida [TaxId: 303]} Length = 346 Back     information, alignment and structure
>d1qksa2 b.70.2.1 (A:136-567) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Paracoccus denitrificans [TaxId: 266]} Length = 432 Back     information, alignment and structure
>d1qksa2 b.70.2.1 (A:136-567) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Paracoccus denitrificans [TaxId: 266]} Length = 432 Back     information, alignment and structure
>d1jofa_ b.69.10.1 (A:) 3-carboxy-cis,cis-mucoante lactonizing enzyme {Neurospora crassa [TaxId: 5141]} Length = 365 Back     information, alignment and structure
>d1mdah_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Length = 368 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query1071
d1gxra_337 Groucho/tle1, C-terminal domain {Human (Homo sapie 100.0
d1vyhc1317 Platelet-activating factor acetylhydrolase IB subu 100.0
d1erja_388 Tup1, C-terminal domain {Baker's yeast (Saccharomy 100.0
d1erja_388 Tup1, C-terminal domain {Baker's yeast (Saccharomy 100.0
d1nr0a1311 Actin interacting protein 1 {Nematode (Caenorhabdi 100.0
d1vyhc1317 Platelet-activating factor acetylhydrolase IB subu 100.0
d1gxra_337 Groucho/tle1, C-terminal domain {Human (Homo sapie 100.0
d1tbga_340 beta1-subunit of the signal-transducing G protein 100.0
d1nexb2355 Cdc4 propeller domain {Baker's yeast (Saccharomyce 100.0
d1k8kc_371 Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taur 100.0
d1nr0a1311 Actin interacting protein 1 {Nematode (Caenorhabdi 100.0
d1nexb2355 Cdc4 propeller domain {Baker's yeast (Saccharomyce 100.0
d1tbga_340 beta1-subunit of the signal-transducing G protein 100.0
d1k8kc_371 Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taur 100.0
d2ovrb2342 F-box/WD repeat-containing protein 7, FBXW7 {Human 100.0
d1nr0a2299 Actin interacting protein 1 {Nematode (Caenorhabdi 100.0
d2ovrb2342 F-box/WD repeat-containing protein 7, FBXW7 {Human 100.0
d1nr0a2299 Actin interacting protein 1 {Nematode (Caenorhabdi 100.0
d1pgua1325 Actin interacting protein 1 {Baker's yeast (Saccha 100.0
d1pgua1325 Actin interacting protein 1 {Baker's yeast (Saccha 100.0
d1sq9a_393 Antiviral protein Ski8 (Ski8p) {Baker's yeast (Sac 100.0
d1qksa2432 C-terminal (heme d1) domain of cytochrome cd1-nitr 100.0
d1sq9a_393 Antiviral protein Ski8 (Ski8p) {Baker's yeast (Sac 100.0
d1p22a2293 F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Hom 100.0
d1hzua2426 C-terminal (heme d1) domain of cytochrome cd1-nitr 100.0
d1pgua2287 Actin interacting protein 1 {Baker's yeast (Saccha 99.98
d1pgua2287 Actin interacting protein 1 {Baker's yeast (Saccha 99.98
d1qksa2432 C-terminal (heme d1) domain of cytochrome cd1-nitr 99.97
d1yfqa_342 Cell cycle arrest protein BUB3 {Baker's yeast (Sac 99.97
d1hzua2426 C-terminal (heme d1) domain of cytochrome cd1-nitr 99.97
d1p22a2293 F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Hom 99.97
d1yfqa_342 Cell cycle arrest protein BUB3 {Baker's yeast (Sac 99.97
d1k32a3360 Tricorn protease domain 2 {Archaeon Thermoplasma a 99.97
d1k32a3360 Tricorn protease domain 2 {Archaeon Thermoplasma a 99.97
d1l0qa2301 Surface layer protein {Archaeon Methanosarcina maz 99.94
d1l0qa2301 Surface layer protein {Archaeon Methanosarcina maz 99.94
d1pbyb_337 Quinohemoprotein amine dehydrogenase B chain {Para 99.93
d1pbyb_337 Quinohemoprotein amine dehydrogenase B chain {Para 99.93
d1jmxb_346 Quinohemoprotein amine dehydrogenase B chain {Pseu 99.93
d1jmxb_346 Quinohemoprotein amine dehydrogenase B chain {Pseu 99.93
d2madh_373 Methylamine dehydrogenase, H-chain {Gram negative 99.92
d2madh_373 Methylamine dehydrogenase, H-chain {Gram negative 99.91
d1ri6a_333 Putative isomerase YbhE {Escherichia coli [TaxId: 99.88
d2bbkh_355 Methylamine dehydrogenase, H-chain {Paracoccus den 99.87
d2bbkh_355 Methylamine dehydrogenase, H-chain {Paracoccus den 99.85
d2bgra1470 Dipeptidyl peptidase IV/CD26, N-terminal domain {P 99.8
d2bgra1470 Dipeptidyl peptidase IV/CD26, N-terminal domain {P 99.74
d1mdah_368 Methylamine dehydrogenase, H-chain {Paracoccus den 99.73
d1mdah_368 Methylamine dehydrogenase, H-chain {Paracoccus den 99.72
d1qnia2441 Nitrous oxide reductase, N-terminal domain {Pseudo 99.67
d1qnia2441 Nitrous oxide reductase, N-terminal domain {Pseudo 99.6
d1jofa_365 3-carboxy-cis,cis-mucoante lactonizing enzyme {Neu 99.52
d1jofa_365 3-carboxy-cis,cis-mucoante lactonizing enzyme {Neu 99.44
d2p4oa1302 Hypothetical protein All0351 homologue {Nostoc pun 99.44
d2hqsa1269 TolB, C-terminal domain {Escherichia coli [TaxId: 99.43
d1xfda1465 Dipeptidyl aminopeptidase-like protein 6, DPP6, N- 99.42
d2hqsa1269 TolB, C-terminal domain {Escherichia coli [TaxId: 99.38
d1rwia_260 Serine/threonine-protein kinase PknD {Mycobacteriu 99.25
d1rwia_260 Serine/threonine-protein kinase PknD {Mycobacteriu 99.25
d2p4oa1302 Hypothetical protein All0351 homologue {Nostoc pun 99.24
d1q7fa_279 Brain tumor cg10719-pa {Fruit fly (Drosophila mela 99.17
d1xfda1465 Dipeptidyl aminopeptidase-like protein 6, DPP6, N- 99.12
d1pjxa_314 Diisopropylfluorophosphatase (phosphotriesterase, 99.06
d2dg1a1319 Lactonase Drp35 {Staphylococcus aureus [TaxId: 128 99.05
d1pjxa_314 Diisopropylfluorophosphatase (phosphotriesterase, 99.02
d1q7fa_279 Brain tumor cg10719-pa {Fruit fly (Drosophila mela 98.95
d1k32a2281 Tricorn protease N-terminal domain {Archaeon Therm 98.9
d1k32a2281 Tricorn protease N-terminal domain {Archaeon Therm 98.87
d2dg1a1319 Lactonase Drp35 {Staphylococcus aureus [TaxId: 128 98.75
d2ghsa1295 Regucalcin {Agrobacterium tumefaciens [TaxId: 358] 98.57
d1npea_263 Nidogen {Mouse (Mus musculus) [TaxId: 10090]} 97.7
d2ad6a1571 Methanol dehydrogenase, heavy chain {Methylophilus 97.69
d1fwxa2459 Nitrous oxide reductase, N-terminal domain {Paraco 97.67
d1kb0a2573 Quinoprotein alcohol dehydrogenase, N-terminal dom 97.66
d1kb0a2573 Quinoprotein alcohol dehydrogenase, N-terminal dom 97.56
d1w6sa_596 Methanol dehydrogenase, heavy chain {Methylobacter 97.43
d1w6sa_596 Methanol dehydrogenase, heavy chain {Methylobacter 97.42
d1kv9a2560 Quinoprotein alcohol dehydrogenase, N-terminal dom 97.41
d2ad6a1571 Methanol dehydrogenase, heavy chain {Methylophilus 97.31
d1fwxa2459 Nitrous oxide reductase, N-terminal domain {Paraco 97.22
d1utca2327 Clathrin heavy-chain terminal domain {Rat (Rattus 97.13
d1k3ia3387 Galactose oxidase, central domain {Fungi (Fusarium 97.03
d2nxpa1149 TAF5 subunit of TFIID {Human (Homo sapiens) [TaxId 97.0
d1k3ia3387 Galactose oxidase, central domain {Fungi (Fusarium 96.89
d1ijqa1266 Low density lipoprotein (LDL) receptor {Human (Hom 96.89
d1flga_582 Ethanol dehydrogenase {Pseudomonas aeruginosa [Tax 96.8
d1npea_263 Nidogen {Mouse (Mus musculus) [TaxId: 10090]} 96.57
d1ijqa1266 Low density lipoprotein (LDL) receptor {Human (Hom 96.27
d1kv9a2560 Quinoprotein alcohol dehydrogenase, N-terminal dom 96.23
d2j4ba1131 TAF5 subunit of TFIID {Encephalitozoon cuniculi [T 96.17
d1qfma1430 Prolyl oligopeptidase, N-terminal domain {Pig (Sus 95.95
d1flga_582 Ethanol dehydrogenase {Pseudomonas aeruginosa [Tax 95.94
d1utca2327 Clathrin heavy-chain terminal domain {Rat (Rattus 95.84
d1qfma1430 Prolyl oligopeptidase, N-terminal domain {Pig (Sus 95.28
d2j49a1134 TAF5 subunit of TFIID {Saccharomyces cerevisiae [T 95.1
d1uuja_76 Lissencephaly-1 protein (Lis-1, PAF-AH alpha) N-te 94.94
d1h6la_353 Thermostable phytase (3-phytase) {Bacillus amyloli 92.23
d1crua_450 Soluble quinoprotein glucose dehydrogenase {Acinet 85.76
d1xipa_381 Nucleoporin NUP159 {Baker's yeast (Saccharomyces c 84.78
>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All beta proteins
fold: 7-bladed beta-propeller
superfamily: WD40 repeat-like
family: WD40-repeat
domain: Groucho/tle1, C-terminal domain
species: Human (Homo sapiens) [TaxId: 9606]

Probab=100.00  E-value=1.5e-40  Score=286.40  Aligned_cols=295  Identities=13%  Similarity=0.194  Sum_probs=253.3

Q ss_pred             CEEEEEEECCCCCEEEEEEECCCCEEEEEECCCCEEEEEECCCCCCCCCCCCEEECCCCCCCCHHHHHCCCCCCCEEEEE
Q ss_conf             20357750489975799961599929999838770999952887634566513211444651002110366788816999
Q 001477          336 TKTVVRTLNQGSNVMSMDFHPQQQTILLVGTNVGDISLWEVGSRERLAHKPFKVWDISAASMPLQNALLNDAAISVNRCV  415 (1071)
Q Consensus       336 ~~~~~~~~~h~~~V~~~~fsp~g~~lla~g~~dg~i~iwd~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~h~~~v~~i~  415 (1071)
                      ..+.+.++.|...|+|++|+|+|+ +|++|+ ||.|+|||+.++......              ......+|.+.|.+++
T Consensus        41 ~~~~~~~~~H~~~V~~v~fs~~g~-~latg~-dg~V~iWd~~~~~~~~~~--------------~~~~~~~h~~~I~~v~  104 (337)
T d1gxra_          41 HARQINTLNHGEVVCAVTISNPTR-HVYTGG-KGCVKVWDISHPGNKSPV--------------SQLDCLNRDNYIRSCK  104 (337)
T ss_dssp             EEEEEEEECCSSCCCEEEECSSSS-EEEEEC-BSEEEEEETTSTTCCSCS--------------EEEECSCTTSBEEEEE
T ss_pred             CCEEEEECCCCCCEEEEEECCCCC-EEEEEE-CCEEEEEECCCCCCCCEE--------------EEEEECCCCCCEEEEE
T ss_conf             754999879999289999989999-999997-998899773677633116--------------8764048899689999


Q ss_pred             ECCCCCEEEEEECCCEEEEEEECCCCCCCEEEEEECCCCCEEEEEEECCCCCEEEEEEECCCCEEEEECCCCCEEEEECC
Q ss_conf             88999989999599949999905998311026863356887789992699935999993998399998568813478207
Q 001477          416 WGPDGLMLGVAFSKHIVHLYTYNPTGELRQHLEIDAHVGGVNDIAFAHPNKQLCIVTCGDDKMIKVWDVVAGRKQYTFEG  495 (1071)
Q Consensus       416 ~spdg~~las~~~dg~i~iwd~~~~~~~~~~~~~~~h~~~v~~i~~s~d~~~~~l~s~~~d~~i~iwd~~~~~~~~~~~~  495 (1071)
                      |+||+++|++++.|+.|++||+...... ....+..|...+.+++|+|++.  ++++++.|+.+++|++.+++......+
T Consensus       105 ~s~dg~~l~s~~~dg~i~iwd~~~~~~~-~~~~~~~~~~~v~~~~~~~~~~--~l~s~~~d~~i~~~~~~~~~~~~~~~~  181 (337)
T d1gxra_         105 LLPDGCTLIVGGEASTLSIWDLAAPTPR-IKAELTSSAPACYALAISPDSK--VCFSCCSDGNIAVWDLHNQTLVRQFQG  181 (337)
T ss_dssp             ECTTSSEEEEEESSSEEEEEECCCC--E-EEEEEECSSSCEEEEEECTTSS--EEEEEETTSCEEEEETTTTEEEEEECC
T ss_pred             ECCCCCEEEEEECCCCCCCCCCCCCCCC-CCCCCCCCCCCCCCCCCCCCCC--CCCCCCCCCCCCCCCCCCCCCCCCCCC
T ss_conf             8679988988612332111111111111-1111111111111111111111--111111111111111111111111111


Q ss_pred             CCCCEEEEEECCCCCCCEEEEEECCCEEEEEECCCCCEEEEECCCCCCEEEEEECCCCCEEEEECCCCCCCCEEEEEECC
Q ss_conf             99985799742568942999992699399997677842577349998189999925999799951488899709999689
Q 001477          496 HEAPVYSVCPHHKESIQFIFSTAIDGKIKAWLYDYLGSRVDYDAPGNWCTMMAYSADGTRLFSCGTSKEGESHLVEWNES  575 (1071)
Q Consensus       496 h~~~v~~i~~~~~~~~~~l~s~~~d~~i~iwd~~~~~~~~~~~~~~~~i~~~~~s~~~~~l~~~~~~~d~~~~i~iwd~~  575 (1071)
                      |...+.+++|++++  ..+++++.|+.+++||+++++....+. +...+.+++|+|+++++++++.    ++.+++||+.
T Consensus       182 ~~~~v~~l~~s~~~--~~~~~~~~d~~v~i~d~~~~~~~~~~~-~~~~i~~l~~~~~~~~l~~~~~----d~~i~i~d~~  254 (337)
T d1gxra_         182 HTDGASCIDISNDG--TKLWTGGLDNTVRSWDLREGRQLQQHD-FTSQIFSLGYCPTGEWLAVGME----SSNVEVLHVN  254 (337)
T ss_dssp             CSSCEEEEEECTTS--SEEEEEETTSEEEEEETTTTEEEEEEE-CSSCEEEEEECTTSSEEEEEET----TSCEEEEETT
T ss_pred             CCCCCCCCCCCCCC--CCCCCCCCCCCCCCCCCCCCEEECCCC-CCCCEEEEEECCCCCCCCEECC----CCCCCCCCCC
T ss_conf             11111101234443--211223566553211111100000246-6661579997153030000002----5642111111


Q ss_pred             CCCEEEEEECCCCCCEEEEEEECCCCEEEEEECCCCEEEEECCCCCEEEEEECCCCCCCCCEEEECCCCCEEEEEECCCC
Q ss_conf             98056776165664055999938999999982899399995899912499715999998233897389999999958991
Q 001477          576 EGAIKRTYSGFRKRSLGVVQFDTTRNRFLAAGDEFQIKFWDMDNMNMLTTVDADGGLPASPRLRFNKEGSLLAVTTSDNG  655 (1071)
Q Consensus       576 ~~~~~~~~~~~~~~~i~~~~~~~~~~~l~~~~~dg~i~iwd~~~~~~~~~~~~~~~~~~v~~~~~s~~~~~l~~~~~dg~  655 (1071)
                      ++.... ...|.. .|.+++|+|+++++++++.|+.|++||..+++.+..+...   ..|.+++|+|++++|++++.||.
T Consensus       255 ~~~~~~-~~~~~~-~i~~v~~s~~g~~l~s~s~Dg~i~iwd~~~~~~~~~~~~~---~~v~~~~~s~d~~~l~t~s~D~~  329 (337)
T d1gxra_         255 KPDKYQ-LHLHES-CVLSLKFAYCGKWFVSTGKDNLLNAWRTPYGASIFQSKES---SSVLSCDISVDDKYIVTGSGDKK  329 (337)
T ss_dssp             SSCEEE-ECCCSS-CEEEEEECTTSSEEEEEETTSEEEEEETTTCCEEEEEECS---SCEEEEEECTTSCEEEEEETTSC
T ss_pred             CCCCCC-CCCCCC-CCCEEEECCCCCEEEEEECCCEEEEEECCCCCEEEECCCC---CCEEEEEEECCCCEEEEEECCCE
T ss_conf             111000-012456-5416999899999999948996999989999799992699---98799999279999999908996


Q ss_pred             EEEEEC
Q ss_conf             999996
Q 001477          656 IKILAN  661 (1071)
Q Consensus       656 i~iw~~  661 (1071)
                      |++|++
T Consensus       330 I~vWdl  335 (337)
T d1gxra_         330 ATVYEV  335 (337)
T ss_dssp             EEEEEE
T ss_pred             EEEEEE
T ss_conf             999977
>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2ovrb2 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d2ovrb2 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1pgua1 b.69.4.1 (A:2-326) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1pgua1 b.69.4.1 (A:2-326) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1sq9a_ b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1qksa2 b.70.2.1 (A:136-567) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1sq9a_ b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1p22a2 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hzua2 b.70.2.1 (A:118-543) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1pgua2 b.69.4.1 (A:327-613) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1pgua2 b.69.4.1 (A:327-613) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1qksa2 b.70.2.1 (A:136-567) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1yfqa_ b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1hzua2 b.70.2.1 (A:118-543) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1p22a2 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yfqa_ b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1k32a3 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1k32a3 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1l0qa2 b.69.2.3 (A:1-301) Surface layer protein {Archaeon Methanosarcina mazei [TaxId: 2209]} Back     information, alignment and structure
>d1l0qa2 b.69.2.3 (A:1-301) Surface layer protein {Archaeon Methanosarcina mazei [TaxId: 2209]} Back     information, alignment and structure
>d1pbyb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1pbyb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1jmxb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1jmxb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d2madh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Gram negative methylotrophic bacteria (Thiobacillus versutus) [TaxId: 34007]} Back     information, alignment and structure
>d2madh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Gram negative methylotrophic bacteria (Thiobacillus versutus) [TaxId: 34007]} Back     information, alignment and structure
>d1ri6a_ b.69.11.1 (A:) Putative isomerase YbhE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2bbkh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d2bbkh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d2bgra1 b.70.3.1 (A:39-508) Dipeptidyl peptidase IV/CD26, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d2bgra1 b.70.3.1 (A:39-508) Dipeptidyl peptidase IV/CD26, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1mdah_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1mdah_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1qnia2 b.69.3.1 (A:10-450) Nitrous oxide reductase, N-terminal domain {Pseudomonas nautica [TaxId: 2743]} Back     information, alignment and structure
>d1qnia2 b.69.3.1 (A:10-450) Nitrous oxide reductase, N-terminal domain {Pseudomonas nautica [TaxId: 2743]} Back     information, alignment and structure
>d1jofa_ b.69.10.1 (A:) 3-carboxy-cis,cis-mucoante lactonizing enzyme {Neurospora crassa [TaxId: 5141]} Back     information, alignment and structure
>d1jofa_ b.69.10.1 (A:) 3-carboxy-cis,cis-mucoante lactonizing enzyme {Neurospora crassa [TaxId: 5141]} Back     information, alignment and structure
>d2p4oa1 b.68.6.3 (A:4-305) Hypothetical protein All0351 homologue {Nostoc punctiforme [TaxId: 272131]} Back     information, alignment and structure
>d2hqsa1 b.68.4.1 (A:163-431) TolB, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xfda1 b.70.3.1 (A:127-591) Dipeptidyl aminopeptidase-like protein 6, DPP6, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2hqsa1 b.68.4.1 (A:163-431) TolB, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1rwia_ b.68.9.1 (A:) Serine/threonine-protein kinase PknD {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1rwia_ b.68.9.1 (A:) Serine/threonine-protein kinase PknD {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2p4oa1 b.68.6.3 (A:4-305) Hypothetical protein All0351 homologue {Nostoc punctiforme [TaxId: 272131]} Back     information, alignment and structure
>d1q7fa_ b.68.9.1 (A:) Brain tumor cg10719-pa {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1xfda1 b.70.3.1 (A:127-591) Dipeptidyl aminopeptidase-like protein 6, DPP6, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pjxa_ b.68.6.1 (A:) Diisopropylfluorophosphatase (phosphotriesterase, DFP) {Squid (Loligo vulgaris) [TaxId: 6622]} Back     information, alignment and structure
>d2dg1a1 b.68.6.1 (A:6-324) Lactonase Drp35 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1pjxa_ b.68.6.1 (A:) Diisopropylfluorophosphatase (phosphotriesterase, DFP) {Squid (Loligo vulgaris) [TaxId: 6622]} Back     information, alignment and structure
>d1q7fa_ b.68.9.1 (A:) Brain tumor cg10719-pa {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1k32a2 b.68.7.1 (A:39-319) Tricorn protease N-terminal domain {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1k32a2 b.68.7.1 (A:39-319) Tricorn protease N-terminal domain {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d2dg1a1 b.68.6.1 (A:6-324) Lactonase Drp35 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d2ghsa1 b.68.6.1 (A:20-314) Regucalcin {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1npea_ b.68.5.1 (A:) Nidogen {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2ad6a1 b.70.1.1 (A:1-571) Methanol dehydrogenase, heavy chain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} Back     information, alignment and structure
>d1fwxa2 b.69.3.1 (A:8-451) Nitrous oxide reductase, N-terminal domain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1kb0a2 b.70.1.1 (A:1-573) Quinoprotein alcohol dehydrogenase, N-terminal domain {Comamonas testosteroni [TaxId: 285]} Back     information, alignment and structure
>d1kb0a2 b.70.1.1 (A:1-573) Quinoprotein alcohol dehydrogenase, N-terminal domain {Comamonas testosteroni [TaxId: 285]} Back     information, alignment and structure
>d1w6sa_ b.70.1.1 (A:) Methanol dehydrogenase, heavy chain {Methylobacterium extorquens [TaxId: 408]} Back     information, alignment and structure
>d1w6sa_ b.70.1.1 (A:) Methanol dehydrogenase, heavy chain {Methylobacterium extorquens [TaxId: 408]} Back     information, alignment and structure
>d1kv9a2 b.70.1.1 (A:1-560) Quinoprotein alcohol dehydrogenase, N-terminal domain {Pseudomonas putida, hk5 [TaxId: 303]} Back     information, alignment and structure
>d2ad6a1 b.70.1.1 (A:1-571) Methanol dehydrogenase, heavy chain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} Back     information, alignment and structure
>d1fwxa2 b.69.3.1 (A:8-451) Nitrous oxide reductase, N-terminal domain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1utca2 b.69.6.1 (A:4-330) Clathrin heavy-chain terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1k3ia3 b.69.1.1 (A:151-537) Galactose oxidase, central domain {Fungi (Fusarium sp.) [TaxId: 29916]} Back     information, alignment and structure
>d2nxpa1 d.379.1.1 (A:195-343) TAF5 subunit of TFIID {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k3ia3 b.69.1.1 (A:151-537) Galactose oxidase, central domain {Fungi (Fusarium sp.) [TaxId: 29916]} Back     information, alignment and structure
>d1ijqa1 b.68.5.1 (A:377-642) Low density lipoprotein (LDL) receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1flga_ b.70.1.1 (A:) Ethanol dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1npea_ b.68.5.1 (A:) Nidogen {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ijqa1 b.68.5.1 (A:377-642) Low density lipoprotein (LDL) receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kv9a2 b.70.1.1 (A:1-560) Quinoprotein alcohol dehydrogenase, N-terminal domain {Pseudomonas putida, hk5 [TaxId: 303]} Back     information, alignment and structure
>d2j4ba1 d.379.1.1 (A:18-148) TAF5 subunit of TFIID {Encephalitozoon cuniculi [TaxId: 6035]} Back     information, alignment and structure
>d1qfma1 b.69.7.1 (A:1-430) Prolyl oligopeptidase, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1flga_ b.70.1.1 (A:) Ethanol dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1utca2 b.69.6.1 (A:4-330) Clathrin heavy-chain terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1qfma1 b.69.7.1 (A:1-430) Prolyl oligopeptidase, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d2j49a1 d.379.1.1 (A:149-282) TAF5 subunit of TFIID {Saccharomyces cerevisiae [TaxId: 4932]} Back     information, alignment and structure
>d1uuja_ a.221.1.1 (A:) Lissencephaly-1 protein (Lis-1, PAF-AH alpha) N-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1h6la_ b.68.3.1 (A:) Thermostable phytase (3-phytase) {Bacillus amyloliquefaciens [TaxId: 1390]} Back     information, alignment and structure
>d1crua_ b.68.2.1 (A:) Soluble quinoprotein glucose dehydrogenase {Acinetobacter calcoaceticus [TaxId: 471]} Back     information, alignment and structure
>d1xipa_ b.69.14.1 (A:) Nucleoporin NUP159 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure