Citrus Sinensis ID: 001490


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820-------830-------840-------850-------860-------870-------880-------890-------900-------910-------920-------930-------940-------950-------960-------970-------980-------990------1000------1010------1020------1030------1040------1050------1060------107
MHRLERESRFYFDMKFFEDMILDGKWEDVEQYLSSFTKVDDNRYSTKIYFEIRKQNFFEALDGHDIAKALNILKKDLKDFAPGNEELFKELAQLLTLDDIRDHELLSKYYGDALSARKNMMLELKQIIEANPILQGKLKFPSIKRQRLRRLINQSLNWQHVHCANPQPNPDINTLFVDHVCQLQETDFSGQSSESNALPPQTTQSPSSWNFSSSMLTDSAVSFVALSLSDPTNKAVTMDRPEDSDILSEKSPVRILNEQASTVTYPGVSLKNIPDYSPKSSLKKEMFQSFGETSFSDFPKTVAQTLIEGSSSPMSMDFHPVQHTLLLVGTNVGDTGLWDVNSGQKLFIRNFKVWDIGACSMLFKTALVRDPGVSVNRVVWSPDGSLLGVAYSKHIVQLYAYHGGSDARQQLEIDAHVGNVNDLAFSAPCKQISVITCGDDKTIKVWDAVTGSRTYSFEGHGAPVYSLCPHAKENIHFIFSISVDGKIKAWLYDSLGARVDYDAPGLGCTRMAYSANGRRLFSCGTSKEGESFLVEWNESEGAIKRTYQGLQLQHNSVSVVHFDTAKDQILAAGDDHVIKIWDMNKVQLLTTIDAGGGLPENPRICFNKNGTLLAVIANENRIKILETPESNSVDAAGVLSDNLRKLSVNPISTVTGAGIANGSVSVNEDPKEDVKPEISVEAENKSEVEKPLFARPSECQSLLLPSKVKANKISRLTYNNGGQAIFALASNGVHLMWRWPRNDLTLSTEATTKVPPRLYQPRHGPQFMVNDTTDSNSQEAVPCFALSKNDAYLFSASGGVISLYIVMTFKTILTIMPPSPTATSLAFNPHDNNVIAIGMDDSTILIYNARSSEVISKLEGHSKRVTGLVFSDALNILVSSGGDAQIFVWDVDGWGIQTCRSLQTPDGVMTLAPSETHIQFHKDQTRFLLVHETHLAIYEAEELTCLKQWFPISSVPISQATFSCDCRMVFTSFVDGTLSIHEASNLEVQCRILSTAYLRPTTSCLHVYPHAIAAHPLKPTQFAVGLTNGEVYVIEPNEPGDTWAVLPPDEIVGDQPTSTSEGDRAMDG
cccccccccccccccccccccccccHHHHHHHHccccccccccccEEEEEEEEEccHHHHHcccccccEEEEEEccccccccccHHHHHHHHcccccccccHHHHHHHHHcccHHHHHHHHHHHHHHccccccccccccccHHHHHHHHHHHHHHHHcccccccccccccHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEccccccccccccccccccccccccccccccccEEEEcccccccEEEEEccccEEEEEcccccEEEEcccccccEEEEEEcccccEEEEEEEccccEEEEEcccccEEEEEEEEEEEcccccccccccccccccccEEEEEEcccccEEEEEEccccEEEEEccccccccccEEEccccccEEEEEEcccccEEEEEcccccccEEEEEcccccEEEEcccccccEEEEEEEEcccccEEEEEEccccEEEEEcccccEEEEEEcccccEEEEEEcccccEEEEEEcccccccEEEEEEcccccEEEEEcccccccccEEEEEEcccccEEEEEEccccEEEEEccccEEEEEEEcccccccccEEEEcccccEEEEEEccccEEEEEccccccccccccccccEEEEEEcccccEEEEEEccccEEEEccccccccccEEEcccccccccccEEEccccccEEEEEccccccEEEEEEEcccccEEEEEEcccEEEEEEcccccEEEEEEccccccEEEEEcccccEEEEcccccccccccccEEEEcccccEEEEEEcccEEEEEccccEEEEEEccccccEEEEEEccccccEEEEEEccccEEEEEccccEEEEEcccccccEEEEEEcccccEEEEEEccccEEEEEcccccEEEEEEcccccccccccccccEEEEEccccEEEEEEcccEEEEEcccccEEEEEcccccccEEEEEEcccccEEEEEEccccEEEEEcccccEEEEEEcccccccccccccEEcEEEEEEcccccEEEEEEccccEEEEcccccccccccccccccccccccccccccccccc
ccccccccccEEcHHHHHHHHHcccHHHHHHHHccccEccccccHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHcHHHHHHccccccHHHHHHHHHHHHHHHHHHHHccccccccccEEEEccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHcccccccccccccccccccccccccccccccEEEcccccccccccccccccccEEEEEcccccEEEEEccccccEEEEEEcccccEEEEEEccccEEEEEEcccccEEEEEEEEEEEccccccccHHHHcccccccEEEEEEcccccEEEEEccccEEEEEEccccccEEEEEEEccccccEEEEEEcccccEEEEEEcccccEEEEEEcccccEEEEEccccccEEEEEEcccccccEEEEEccccEEEEEEcccccEEEEEEcccccEEEEEEcccccEEEEEccccccccEEEEEEcccccEEEEEEccccccccEEEEEEcccccEEEEEccccEEEEEEcccccEEEEEEcccccccEEEEEEcccccEEEEEccccEEEEEEcccccEEEEEccccccEEEEEEcccccEEEEEccccEEEEEEcccccEEEEEccccccccccccEEEEEcccccEEEEEcccccEEEEEEEEccccEEEEEEccccEEEEEEcccccEEEEEccccccEEEEEEcccccEEEEcccccccccccEEEEEEcccccEEEEEcccEEEEEEcccccEEEEEccccccEEEEEEccccccEEEEEccccEEEEEEcccccEEEEEEcccccEEEEEEcccccEEEEEccccEEEEEEccccEEEEEccccccEEEEEEcccccEEEEcccccEEEEEcccEEEEEEcccccEEEEEcccccccEEEEEEcccccEEEEEccccEEEEEEcccccEEEEEccccccccccccccccEEEEEEccccccEEEEEccccEEEEEEcccccccccccccccEEEEcccccEEEEccccc
mhrleresrfyfDMKFFEDMILDGKWEDVEQYLSSFtkvddnrystkIYFEIRKQNFFEALDGHDIAKALNILKKDLKDFAPGNEELFKELAQLLTLDDIRDHELLSKYYGDALSARKNMMLELKQIIEanpilqgklkfpsiKRQRLRRLINQSLNWQhvhcanpqpnpdintLFVDHVCqlqetdfsgqssesnalppqttqspsswnfsssmltdSAVSFVALslsdptnkavtmdrpedsdilsekspvrilneqastvtypgvslknipdyspksslkKEMFQsfgetsfsdfpKTVAQTLiegssspmsmdfhpVQHTLLLVGtnvgdtglwdvnsgqklFIRNFKVWDIGACSMLFKTAlvrdpgvsvnrvvwspdgsllgVAYSKHIVQLYAyhggsdarQQLEIdahvgnvndlafsapckqisvitcgddktikVWDAvtgsrtysfeghgapvyslcphakeniHFIFSISVDGKIKAWLYDSlgarvdydapglgctrmaysangrrlfscgtskegESFLVEWNESEGAIKRTYQglqlqhnsvsvvhfdtakdQILAAGDDHVIKIWDMNKVQLLTTidaggglpenpricfnknGTLLAVIANEnrikiletpesnsvdaagvlsdnlrklsvnpistvtgagiangsvsvnedpkedvkpeisveaenksevekplfarpsecqslllpskvkankisrltyNNGGQAIFALASNGVhlmwrwprndltlsteattkvpprlyqprhgpqfmvndttdsnsqeavpcfalskndaylfsaSGGVISLYIVMTFKTIltimppsptatslafnphdnnviaigmddstiLIYNARSSEVISKLEGHSKRVTGLVFSDALNILVssggdaqifvwdvdgwgiqtcrslqtpdgvmtlapsethiqfHKDQTRFLLVHETHLAIYEAEELTclkqwfpissvpisqatfscdcrmvftsfvdgtlsiheASNLEVQCRILSTaylrpttsclhvyphaiaahplkptqfavgltngevyviepnepgdtwavlppdeivgdqptstsegdramdg
mhrleresrfyfdMKFFEDMILDGKWEDVEQYLSsftkvddnrysTKIYFEIRKQNFFEALDGHDIAKALNILKKDLKDFAPGNEELFKELAQLLTLDDIRDHELLSKYYGDALSARKNMMLELKQIIeanpilqgklkFPSIKRQRLRRLINQSLNWQHVHCANPQPNPDINTLFVDHVCQLQETDFSGQSSESNALPPQTTQSPSSWNFSSSMLTDSAVSFVALSLsdptnkavtmdrpedsdilsekspvrilneqastvtypgvslknipDYSPKSSLKKEMFQSFGETSFSDFPKTVAQTLIEGSSSPMSMDFHPVQHTLLLVGTNVGDTGLWDVNSGQKLFIRNFKVWDIGACSMLFKTALVRDPGVSVNRVVWSPDGSLLGVAYSKHIVQLYAYHGGSDARQQLEIDAHVGNVNDLAFSAPCKQIsvitcgddktIKVWDAVTGSRTYSFEGHGAPVYSLCPHAKENIHFIFSISVDGKIKAWLYDSLGARVDYDAPGLGCTRMAYSANGRRLFSCGTSKEGESFLVEWNESEGAIKRTYQGLQLQHNSVSVVHFDTAKDQILAAGDDHVIKIWDMNKVQLLTTIDAGGGLPENPRICFNKNGTLLAVIANENRIKIletpesnsvdaAGVLSDNLRKLSVNPIStvtgagiangsvsvnedpkedVKPEisveaenksevekplfarpsecqslllpSKVKANKISRLTYNNGGQAIFALASNGVHLMWRWPRNDLTLSTEATTKVPPRLYQPRHGPQFMVNDTTDSNSQEAVPCFALSKNDAYLFSASGGVISLYIVMTFKTILTIMPPSPTATSLAFNPHDNNVIAIGMDDSTILIYNARSSEVISKLEGHSKRVTGLVFSDALNILVSSGGDAQIFVWDVDGWGIQTCRSLQTPDGVMTLAPSETHIQFHKDQTRFLLVHETHLAIYEAEELTCLKQWFPISSVPISQATFSCDCRMVFTSFVDGTLSIHEASNLEVQCRILSTAYLRPTTSCLHVYPHAIAAHPLKPTQFAVGLTNGEVYVIEPNEPGDTWAVLPPDEivgdqptstsegdramdg
MHRLERESRFYFDMKFFEDMILDGKWEDVEQYLSSFTKVDDNRYSTKIYFEIRKQNFFEALDGHDIAKALNILKKDLKDFAPGNEELFKELAQLLTLDDIRDHELLSKYYGDALSARKNMMLELKQIIEANPILQGKLKFPSIKRQRLRRLINQSLNWQHVHCANPQPNPDINTLFVDHVCQLQETDFSGQSSESNALPPQTTQSPSSWNFSSSMLTDSAVSFVALSLSDPTNKAVTMDRPEDSDILSEKSPVRILNEQASTVTYPGVSLKNIPDYSPKSSLKKEMFQSFGETSFSDFPKTVAQTLIEGSSSPMSMDFHPVQHTLLLVGTNVGDTGLWDVNSGQKLFIRNFKVWDIGACSMLFKTALVRDPGVSVNRVVWSPDGSLLGVAYSKHIVQLYAYHGGSDARQQLEIDAHVGNVNDLAFSAPCKQISVITCGDDKTIKVWDAVTGSRTYSFEGHGAPVYSLCPHAKENIHFIFSISVDGKIKAWLYDSLGARVDYDAPGLGCTRMAYSANGRRLFSCGTSKEGESFLVEWNESEGAIKRTYQGLQLQHNSVSVVHFDTAKDQILAAGDDHVIKIWDMNKVQLLTTIDAGGGLPENPRICFNKNGTLLAVIANENRIKILETPESNSVDAAGVLSDNLRKLSVNPISTVTGAGIANGSVSVNEDPKEDVKPEISVEAENKSEVEKPLFARPSECQSLLLPSKVKANKISRLTYNNGGQAIFALASNGVHLMWRWPRNDLTLSTEATTKVPPRLYQPRHGPQFMVNDTTDSNSQEAVPCFALSKNDAYLFSASGGVISLYIVMTFKTILTIMPPSPTATSLAFNPHDNNVIAIGMDDSTILIYNARSSEVISKLEGHSKRVTGLVFSDALNILVSSGGDAQIFVWDVDGWGIQTCRSLQTPDGVMTLAPSETHIQFHKDQTRFLLVHETHLAIYEAEELTCLKQWFPISSVPISQATFSCDCRMVFTSFVDGTLSIHEASNLEVQCRILSTAYLRPTTSCLHVYPHAIAAHPLKPTQFAVGLTNGEVYVIEPNEPGDTWAVLPPDEIVGDQPTSTSEGDRAMDG
********RFYFDMKFFEDMILDGKWEDVEQYLSSFTKVDDNRYSTKIYFEIRKQNFFEALDGHDIAKALNILKKDLKDFAPGNEELFKELAQLLTLDDIRDHELLSKYYGDALSARKNMMLELKQIIEANPILQGKLKFPSIKRQRLRRLINQSLNWQHVHCANPQPNPDINTLFVDHVCQLQ*************************************************************************************************************************************FHPVQHTLLLVGTNVGDTGLWDVNSGQKLFIRNFKVWDIGACSMLFKTALVRDPGVSVNRVVWSPDGSLLGVAYSKHIVQLYAYHGGSDARQQLEIDAHVGNVNDLAFSAPCKQISVITCGDDKTIKVWDAVTGSRTYSFEGHGAPVYSLCPHAKENIHFIFSISVDGKIKAWLYDSLGARVDYDAPGLGCTRMAYSANGRRLFSCGTSKEGESFLVEWNESEGAIKRTYQGLQLQHNSVSVVHFDTAKDQILAAGDDHVIKIWDMNKVQLLTTIDAGGGLPENPRICFNKNGTLLAVIANENRIKILET********AGVLSDNLRKLSVNPISTVTG*********************************************LLLPSKVKANKISRLTYNNGGQAIFALASNGVHLMWRWPRNDLTLST*******************************AVPCFALSKNDAYLFSASGGVISLYIVMTFKTILTIMPPSPTATSLAFNPHDNNVIAIGMDDSTILIYNARSSEVISKLEGHSKRVTGLVFSDALNILVSSGGDAQIFVWDVDGWGIQTCRSLQTPDGVMTLAPSETHIQFHKDQTRFLLVHETHLAIYEAEELTCLKQWFPISSVPISQATFSCDCRMVFTSFVDGTLSIHEASNLEVQCRILSTAYLRPTTSCLHVYPHAIAAHPLKPTQFAVGLTNGEVYVIEPNEPGDTWAVL**********************
*HRLERESRFYFDMKFFEDMILDGKWEDVEQYLSSFTKVDDNRYSTKIYFEIRKQNFFEALDGHDIAKALNILKKDLKDFAPGNEELFKELAQLLTLDDIRDHELLSKYYGDALSARKNMMLELKQIIEANPILQGKLKFPSIKRQR***LIN*SLNWQHVHCANPQPNPDINTLFVDHVCQLQET***GQSSESNALPPQTTQSPSSWNFSSSMLTDSAVSFVAL************************SPVRILNEQASTVTYPGVSLKNIPDYSPKSSLKKEMFQSFGETSFSDFPKTVAQTLIEGSSSPMSMDFHPVQHTLLLVGTNVGDTGLWDVNSGQKLFIRNFKVWDIGACSMLFKTALVRDPGVSVNRVVWSPDGSLLGVAYSKHIVQLYAYHGGSDARQQLEIDAHVGNVNDLAFSAPCKQISVITCGDDKTIKVWDAVTGSRTYSFEGHGAPVYSLCPHAKENIHFIFSISVDGKIKAWLYDSLGARVDYDAPGLGCTRMAYSANGRRLFSCGTSKEGESFLVEWNESEGAIKRTYQGLQLQHNSVSVVHFDTAKDQILAAGDDHVIKIWDMNKVQLLTTIDAGGGLPENPRICFNKNGTLLAVIANENRIKILETPESNSVDAAGVLSDNLRKLSVNPISTVTGAGIANGSVSVNEDPKEDVKPEISVEAENKSEVEKPLFARPSECQSLLLPSKVKANKISRLTYNNGGQAIFALASNGVHLMWRWPRNDLTLSTEATTKVPPRLYQPRHGPQFMVNDTTDSNSQEAVPCFALSKNDAYLFSASGGVISLYIVMTFKTILTIMPPSPTATSLAFNPHDNNVIAIGMDDSTILIYNARSSEVISKLEGHSKRVTGLVFSDALNILVSSGGDAQIFVWDVDGWGIQTCRSLQTPDGVMTLAPSETHIQFHKDQTRFLLVHETHLAIYEAEELTCLKQWFPISSVPISQATFSCDCRMVFTSFVDGTLSIHEASNLEVQCRILSTAYLRPTTSCLHVYPHAIAAHPLKPTQFAVGLTNGEVYVIEPNEPGDTWAV***********************
MHRLERESRFYFDMKFFEDMILDGKWEDVEQYLSSFTKVDDNRYSTKIYFEIRKQNFFEALDGHDIAKALNILKKDLKDFAPGNEELFKELAQLLTLDDIRDHELLSKYYGDALSARKNMMLELKQIIEANPILQGKLKFPSIKRQRLRRLINQSLNWQHVHCANPQPNPDINTLFVDHVCQLQET***********************NFSSSMLTDSAVSFVALSLSDPTNKAVTMDRPEDSDILSEKSPVRILNEQASTVTYPGVSLKNIPDYSPKSSLKKEMFQSFGETSFSDFPKTVAQTLIEGSSSPMSMDFHPVQHTLLLVGTNVGDTGLWDVNSGQKLFIRNFKVWDIGACSMLFKTALVRDPGVSVNRVVWSPDGSLLGVAYSKHIVQLYAYHGGSDARQQLEIDAHVGNVNDLAFSAPCKQISVITCGDDKTIKVWDAVTGSRTYSFEGHGAPVYSLCPHAKENIHFIFSISVDGKIKAWLYDSLGARVDYDAPGLGCTRMAYSANGRRLFSCGTSKEGESFLVEWNESEGAIKRTYQGLQLQHNSVSVVHFDTAKDQILAAGDDHVIKIWDMNKVQLLTTIDAGGGLPENPRICFNKNGTLLAVIANENRIKILETPESNSVDAAGVLSDNLRKLSVNPISTVTGAGIANGSVSV***********ISVEAENKSEVEKPLFARPSECQSLLLPSKVKANKISRLTYNNGGQAIFALASNGVHLMWRWPRNDLTLSTEATTKVPPRLYQPRHGPQFMVNDTTDSNSQEAVPCFALSKNDAYLFSASGGVISLYIVMTFKTILTIMPPSPTATSLAFNPHDNNVIAIGMDDSTILIYNARSSEVISKLEGHSKRVTGLVFSDALNILVSSGGDAQIFVWDVDGWGIQTCRSLQTPDGVMTLAPSETHIQFHKDQTRFLLVHETHLAIYEAEELTCLKQWFPISSVPISQATFSCDCRMVFTSFVDGTLSIHEASNLEVQCRILSTAYLRPTTSCLHVYPHAIAAHPLKPTQFAVGLTNGEVYVIEPNEPGDTWAVLPPDEIVGD**************
*****RESRFYFDMKFFEDMILDGKWEDVEQYLSSFTKVDDNRYSTKIYFEIRKQNFFEALDGHDIAKALNILKKDLKDFAPGNEELFKELAQLLTLDDIRDHELLSKYYGDALSARKNMMLELKQIIEANPILQGKLKFPSIKRQRLRRLINQSLNWQHVHCANPQPNPDINTLFVDHVCQLQETDFSGQSSESNALPPQTTQSPSSWNFSSSMLTDSAVSFVALSLSDPTNKAVTMDRPEDSDILSEKSPVRILNEQASTVTYPGVSLKNIPDYSPKSSLKKEMFQSFGETSFSDFPKTVAQTLIEGSSSPMSMDFHPVQHTLLLVGTNVGDTGLWDVNSGQKLFIRNFKVWDIGACSMLFKTALVRDPGVSVNRVVWSPDGSLLGVAYSKHIVQLYAYHGGSDARQQLEIDAHVGNVNDLAFSAPCKQISVITCGDDKTIKVWDAVTGSRTYSFEGHGAPVYSLCPHAKENIHFIFSISVDGKIKAWLYDSLGARVDYDAPGLGCTRMAYSANGRRLFSCGTSKEGESFLVEWNESEGAIKRTYQGLQLQHNSVSVVHFDTAKDQILAAGDDHVIKIWDMNKVQLLTTIDAGGGLPENPRICFNKNGTLLAVIANENRIKILETPESNSVDAAGVLSDNLRKLSVNPISTVTGAGIANGSVSVNEDPKEDVKPEISVEAENKSEVEKPLFARPSECQSLLLPSKVKANKISRLTYNNGGQAIFALASNGVHLMWRWPRNDLTLSTEATTKVPPRLYQPRHGPQFMVNDTTDSNSQEAVPCFALSKNDAYLFSASGGVISLYIVMTFKTILTIMPPSPTATSLAFNPHDNNVIAIGMDDSTILIYNARSSEVISKLEGHSKRVTGLVFSDALNILVSSGGDAQIFVWDVDGWGIQTCRSLQTPDGVMTLAPSETHIQFHKDQTRFLLVHETHLAIYEAEELTCLKQWFPISSVPISQATFSCDCRMVFTSFVDGTLSIHEASNLEVQCRILSTAYLRPTTSCLHVYPHAIAAHPLKPTQFAVGLTNGEVYVIEPNEPGDTWAVLPPDEIVGDQPTSTSEGD*****
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MHRLERESRFYFDMKFFEDMILDGKWEDVEQYLSSFTKVDDNRYSTKIYFEIRKQNFFEALDGHDIAKALNILKKDLKDFAPGNEELFKELAQLLTLDDIRDHELLSKYYGDALSARKNMMLELKQIIEANPILQGKLKFPSIKRQRLRRLINQSLNWQHVHCANPQPNPDINTLFVDHVCQLQETDFSGQSSESNALPPQTTQSPSSWNFSSSMLTDSAVSFVALSLSDPTNKAVTMDRPEDSDILSEKSPVRILNEQASTVTYPGVSLKNIPDYSPKSSLKKEMFQSFGETSFSDFPKTVAQTLIEGSSSPMSMDFHPVQHTLLLVGTNVGDTGLWDVNSGQKLFIRNFKVWDIGACSMLFKTALVRDPGVSVNRVVWSPDGSLLGVAYSKHIVQLYAYHGGSDARQQLEIDAHVGNVNDLAFSAPCKQISVITCGDDKTIKVWDAVTGSRTYSFEGHGAPVYSLCPHAKENIHFIFSISVDGKIKAWLYDSLGARVDYDAPGLGCTRMAYSANGRRLFSCGTSKEGESFLVEWNESEGAIKRTYQGLQLQHNSVSVVHFDTAKDQILAAGDDHVIKIWDMNKVQLLTTIDAGGGLPENPRICFNKNGTLLAVIANENRIKILETPESNSVDAAGVLSDNLRKLSVNPISTVTGAGIANGSVSVNEDPKEDVKPEISVEAENKSEVEKPLFARPSECQSLLLPSKVKANKISRLTYNNGGQAIFALASNGVHLMWRWPRNDLTLSTEATTKVPPRLYQPRHGPQFMVNDTTDSNSQEAVPCFALSKNDAYLFSASGGVISLYIVMTFKTILTIMPPSPTATSLAFNPHDNNVIAIGMDDSTILIYNARSSEVISKLEGHSKRVTGLVFSDALNILVSSGGDAQIFVWDVDGWGIQTCRSLQTPDGVMTLAPSETHIQFHKDQTRFLLVHETHLAIYEAEELTCLKQWFPISSVPISQATFSCDCRMVFTSFVDGTLSIHEASNLEVQCRILSTAYLRPTTSCLHVYPHAIAAHPLKPTQFAVGLTNGEVYVIEPNEPGDTWAVLPPDEIVGDQPTSTSEGDRAMDG
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query1068 2.2.26 [Sep-21-2011]
Q0WV901120 Topless-related protein 1 yes no 0.962 0.917 0.541 0.0
Q94AI71131 Protein TOPLESS OS=Arabid no no 0.984 0.929 0.536 0.0
Q27GK71135 Topless-related protein 4 no no 0.970 0.913 0.496 0.0
Q9LRZ01131 Topless-related protein 2 no no 0.958 0.905 0.460 0.0
Q84JM41108 Topless-related protein 3 no no 0.964 0.929 0.462 0.0
Q008081356 Vegetative incompatibilit yes no 0.268 0.211 0.274 1e-18
Q8YRI11526 Uncharacterized WD repeat no no 0.503 0.352 0.220 1e-14
Q8YTC21258 Uncharacterized WD repeat no no 0.477 0.405 0.220 3e-13
Q8YV571683 Uncharacterized WD repeat no no 0.470 0.298 0.225 2e-11
P49695742 Probable serine/threonine no no 0.237 0.342 0.248 2e-11
>sp|Q0WV90|TPR1_ARATH Topless-related protein 1 OS=Arabidopsis thaliana GN=TPR1 PE=1 SV=3 Back     alignment and function desciption
 Score = 1154 bits (2986), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 593/1095 (54%), Positives = 759/1095 (69%), Gaps = 67/1095 (6%)

Query: 1    MHRLERESRFYFDMKFFEDMILDGKWEDVEQYLSSFTKVDDNRYSTKIYFEIRKQNFFEA 60
            +H+LE+ES F+F+MK+FED + +G W++VE+YLS FTKVDDNRYS KI+FEIRKQ + EA
Sbjct: 25   VHKLEQESGFFFNMKYFEDEVHNGNWDEVEKYLSGFTKVDDNRYSMKIFFEIRKQKYLEA 84

Query: 61   LDGHDIAKALNILKKDLKDFAPGNEELFKELAQLLTLDDIRDHELLSKYYGDALSARKNM 120
            LD HD  KA++IL KDLK F+  NEELFKE+ QLLTL++ R++E LSKY GD  SAR  M
Sbjct: 85   LDRHDRPKAVDILVKDLKVFSTFNEELFKEITQLLTLENFRENEQLSKY-GDTKSARAIM 143

Query: 121  MLELKQIIEANPILQGKLKFPSIKRQRLRRLINQSLNWQHVHCANPQPNPDINTLFVDHV 180
            ++ELK++IEANP+ + KL+FP+++  RLR LINQSLNWQH  C NP+PNPDI TLFVDH 
Sbjct: 144  LVELKKLIEANPLFRDKLQFPTLRTSRLRTLINQSLNWQHQLCKNPRPNPDIKTLFVDHS 203

Query: 181  CQLQE---------TDFSGQSSESNALPP-------QTTQSP-----SSWNFSSSMLTDS 219
            C+L               G   ++   PP       Q T SP     + W  S S +   
Sbjct: 204  CRLPNDARAPSPVNNPLLGSLPKAEGFPPLGAHGPFQPTPSPVPTPLAGWMSSPSSVPHP 263

Query: 220  AVSFVALSLSDPTNKAV-----------TMDRPE-DSDILSEKS-PVRILNEQASTV--- 263
            AVS   ++L  P+ +A             +D P  DSD +S+++ P+ I +E +  V   
Sbjct: 264  AVSGGPIALGAPSIQAALKHPRTPPSNSAVDYPSGDSDHVSKRTRPMGISDEVSLGVNML 323

Query: 264  --TYPGVSLKNIPDYSPKSSLKKEMFQSFGETSFSDFPKTVAQTLIEGSSSPMSMDFHPV 321
              T+PG           ++    + F++       D PKTVA+TL +GSS PMSMDFHP+
Sbjct: 324  PMTFPG-----------QAHGHNQTFKAP-----DDLPKTVARTLSQGSS-PMSMDFHPI 366

Query: 322  QHTLLLVGTNVGDTGLWDVNSGQKLFIRNFKVWDIGACSMLFKTALVRDPGVSVNRVVWS 381
            + TLLLVGTNVGD GLW+V S ++L  + FKVWD+  CSM  + ALV++P VSVNRV+WS
Sbjct: 367  KQTLLLVGTNVGDIGLWEVGSRERLVQKTFKVWDLSKCSMPLQAALVKEPVVSVNRVIWS 426

Query: 382  PDGSLLGVAYSKHIVQLYAYHGGSDARQQLEIDAHVGNVNDLAFSAPCKQISVITCGDDK 441
            PDGSL GVAYS+HIVQLY+YHGG D RQ LEIDAHVG VND+AFS P KQ+ V TCGDDK
Sbjct: 427  PDGSLFGVAYSRHIVQLYSYHGGEDMRQHLEIDAHVGGVNDIAFSTPNKQLCVTTCGDDK 486

Query: 442  TIKVWDAVTGSRTYSFEGHGAPVYSLCPHAKENIHFIFSISVDGKIKAWLYDSLGARVDY 501
            TIKVWDA TG + Y+FEGH APVYS+CPH KENI FIFS ++DGKIKAWLYD++G+RVDY
Sbjct: 487  TIKVWDAATGVKRYTFEGHEAPVYSICPHYKENIQFIFSTALDGKIKAWLYDNMGSRVDY 546

Query: 502  DAPGLGCTRMAYSANGRRLFSCGTSKEGESFLVEWNESEGAIKRTYQGLQLQHNSVSVVH 561
            +APG  CT MAYSA+G RLFSCGTSK+GESF+VEWNESEGA+KRTYQG      S+ VV 
Sbjct: 547  EAPGRWCTTMAYSADGTRLFSCGTSKDGESFIVEWNESEGAVKRTYQG--FHKRSLGVVQ 604

Query: 562  FDTAKDQILAAGDDHVIKIWDMNKVQLLTTIDAGGGLPENPRICFNKNGTLLAVIANENR 621
            FDT K++ LAAGDD  IK WDM+ +QLLT IDA GGL  +PRI FNK G+LLAV AN+N 
Sbjct: 605  FDTTKNRYLAAGDDFSIKFWDMDTIQLLTAIDADGGLQASPRIRFNKEGSLLAVSANDNM 664

Query: 622  IKILETPES-NSVDAAGVLSDNLRKLSVNPISTVTGAGIANGSVSVNEDPKE--DVKPEI 678
            IK++   +    +     LS    K ++N I  V           +N D +   DVKP I
Sbjct: 665  IKVMANSDGLRLLHTVENLSSESSKPAINSIPMVERPASVVSIPGMNGDSRNMVDVKPVI 724

Query: 679  SVEAENKSEVEK-PLFARPSECQSLLLPSKVKANKISRLTYNNGGQAIFALASNGVHLMW 737
            + E+ +KS+V K      PS+C+SL LP  ++  KISRL + N G AI ALASN +HL+W
Sbjct: 725  TEESNDKSKVWKLTEVGEPSQCRSLRLPENMRVTKISRLIFTNSGNAILALASNAIHLLW 784

Query: 738  RWPRNDLTLSTEATTKVPPRLYQPRHGPQFMVNDTTDSNSQEAVPCFALSKNDAYLFSAS 797
            +W RND   + +AT  +PP+ +QP  G   M ND  ++N +EAVPCFALSKND+Y+ SAS
Sbjct: 785  KWQRNDRNATGKATASLPPQQWQPASG-ILMTNDVAETNPEEAVPCFALSKNDSYVMSAS 843

Query: 798  GGVISLYIVMTFKTILTIMPPSPTATSLAFNPHDNNVIAIGMDDSTILIYNARSSEVISK 857
            GG ISL+ +MTFKT+ T MPP P AT LAF+P DNN+IAIGMDDSTI IYN R  EV SK
Sbjct: 844  GGKISLFNMMTFKTMATFMPPPPAATFLAFHPQDNNIIAIGMDDSTIQIYNVRVDEVKSK 903

Query: 858  LEGHSKRVTGLVFSDALNILVSSGGDAQIFVWDVDGWGIQTCRSLQTPDGVMTLAPSETH 917
            L+GHSKR+TGL FS+ LN+LVSSG DAQ+ VW+ DGW  Q  + LQ P G  T + S+T 
Sbjct: 904  LKGHSKRITGLAFSNVLNVLVSSGADAQLCVWNTDGWEKQKSKVLQIPQGRSTSSLSDTR 963

Query: 918  IQFHKDQTRFLLVHETHLAIYEAEELTCLKQWFPI--SSVPISQATFSCDCRMVFTSFVD 975
            +QFH+DQ  FL+VHET LAIYE  +L C+KQW P+  S+ PI+ ATFSCD ++++TSF+D
Sbjct: 964  VQFHQDQVHFLVVHETQLAIYETTKLECMKQW-PVRESAAPITHATFSCDSQLIYTSFMD 1022

Query: 976  GTLSIHEASNLEVQCRILSTAYLRPTTSCLHVYPHAIAAHPLKPTQFAVGLTNGEVYVIE 1035
             T+ +  ++NL ++CR+  +AYL  + S  +V+P  IAAHP +   FAVGL++G V++ E
Sbjct: 1023 ATICVFSSANLRLRCRVNPSAYLPASLSNSNVHPLVIAAHPQESNMFAVGLSDGGVHIFE 1082

Query: 1036 PNEPGDTWAVLPPDE 1050
            P E    W V PP E
Sbjct: 1083 PLESEGKWGVAPPPE 1097




Transcriptional corepressor. Activates TIR-NB-LRR R protein-mediated immune responses through repression of negative regulators such as CNGC2/DND1. Negative regulator of jasmonate responses.
Arabidopsis thaliana (taxid: 3702)
>sp|Q94AI7|TPL_ARATH Protein TOPLESS OS=Arabidopsis thaliana GN=TPL PE=1 SV=1 Back     alignment and function description
>sp|Q27GK7|TPR4_ARATH Topless-related protein 4 OS=Arabidopsis thaliana GN=TPR4 PE=1 SV=2 Back     alignment and function description
>sp|Q9LRZ0|TPR2_ARATH Topless-related protein 2 OS=Arabidopsis thaliana GN=TPR2 PE=1 SV=2 Back     alignment and function description
>sp|Q84JM4|TPR3_ARATH Topless-related protein 3 OS=Arabidopsis thaliana GN=TPR3 PE=1 SV=1 Back     alignment and function description
>sp|Q00808|HETE1_PODAS Vegetative incompatibility protein HET-E-1 OS=Podospora anserina GN=HET-E1 PE=4 SV=1 Back     alignment and function description
>sp|Q8YRI1|YY46_NOSS1 Uncharacterized WD repeat-containing protein alr3466 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=alr3466 PE=4 SV=1 Back     alignment and function description
>sp|Q8YTC2|Y2800_NOSS1 Uncharacterized WD repeat-containing protein alr2800 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=alr2800 PE=4 SV=1 Back     alignment and function description
>sp|Q8YV57|Y2124_NOSS1 Uncharacterized WD repeat-containing protein all2124 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=all2124 PE=4 SV=1 Back     alignment and function description
>sp|P49695|PKWA_THECU Probable serine/threonine-protein kinase PkwA OS=Thermomonospora curvata GN=pkwA PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query1068
2241419311109 predicted protein [Populus trichocarpa] 0.971 0.935 0.583 0.0
3565506301132 PREDICTED: topless-related protein 1-lik 0.957 0.903 0.553 0.0
3574553011134 WD repeat-containing protein, putative [ 0.958 0.902 0.547 0.0
3574553051149 WD repeat-containing protein, putative [ 0.958 0.891 0.547 0.0
3574553031112 WD repeat-containing protein, putative [ 0.958 0.920 0.553 0.0
3565262421133 PREDICTED: protein TOPLESS-like [Glycine 0.956 0.902 0.548 0.0
3574588751138 WD repeat-containing protein, putative [ 0.959 0.900 0.550 0.0
3565548021136 PREDICTED: topless-related protein 1-lik 0.969 0.911 0.547 0.0
2978398871120 hypothetical protein ARALYDRAFT_895943 [ 0.955 0.911 0.544 0.0
244618491127 CTV.2 [Citrus trifoliata] 0.954 0.904 0.550 0.0
>gi|224141931|ref|XP_002324314.1| predicted protein [Populus trichocarpa] gi|222865748|gb|EEF02879.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
 Score = 1184 bits (3063), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 628/1076 (58%), Positives = 763/1076 (70%), Gaps = 38/1076 (3%)

Query: 4    LERESRFYFDMKFFEDMILDGKWEDVEQYLSSFTKVDDNRYSTKIYFEIRKQNFFEALDG 63
            LERES +YF MKFFEDMI  G W++ E+YLS FTK+DDNRYSTKIYFEIRKQ F E LD 
Sbjct: 28   LERESGYYFSMKFFEDMIRSGNWDEAERYLSCFTKLDDNRYSTKIYFEIRKQKFLEVLDN 87

Query: 64   HDIAKALNILKKDLKDFAPGNEELFKELAQLLTLDDIRDHELLSKYYGDALSARKNMMLE 123
             + +KAL+IL KDLK FAP NEEL KE+  LLTL++IRDHE LS  Y DA SARK MM+E
Sbjct: 88   DERSKALDILMKDLKAFAPDNEELLKEMTLLLTLNNIRDHESLS-MYSDAESARKVMMVE 146

Query: 124  LKQIIEANPILQGKLKFPSIKRQRLRRLINQSLNWQHVHCANPQPNPDINTLFVDHVCQL 183
            LK++IEANP+L+ KL+FP+I   RLRRLINQSLNWQH+HCA PQPNPDI TLFVDH+C  
Sbjct: 147  LKKVIEANPLLRDKLEFPNIANHRLRRLINQSLNWQHMHCAYPQPNPDIRTLFVDHICVP 206

Query: 184  QETD---FSGQSSESNALPPQTTQ----SPSSWNFSSSMLTDSAVSFVALSLSDPTNKAV 236
              +D   FS  +S+SN LP QTT     + S+ N +SS    S++S  ALSL  PTN   
Sbjct: 207  IPSDDHLFSA-ASDSNPLPSQTTSMLVSTSSASNSTSSSEAHSSISSEALSLGVPTNIGS 265

Query: 237  TMDRPEDSDILS-------EKSPVRILNEQASTVTYPGVSLKNIPDYSPKSSLKKEMFQS 289
             +   E   +LS         + + +L E  +TV   G+    I +    S+    +F  
Sbjct: 266  FIVVIEKKLLLSLTIYSMFVAAMIEVL-EDNTTVNDSGIPKNRIVNLKRPSNEASLIFHF 324

Query: 290  FGETSFS-----DFPKTVAQTLIEGSSSPMSMDFHPVQHTLLLVGTNVGDTGLWDVNSGQ 344
            F     S     D PK V + L EGSS P SMDFHP + T+LLVGT VGD GLW+V+SG+
Sbjct: 325  FLLKHCSVNISDDLPKNVFRILNEGSS-PTSMDFHPEKQTVLLVGTTVGDIGLWEVSSGE 383

Query: 345  KLFIRNFKVWDIGACSMLFKTALVRDPGVSVNRVVWSPDGSLLGVAYSKHIVQLYAYHGG 404
             L  RNFKVWDI ACSM+FK  L++DP VSVNRV WSP+G L GVAYSKH+VQ+Y+Y+  
Sbjct: 384  SLLSRNFKVWDIAACSMMFKATLLKDPSVSVNRVAWSPEGGLFGVAYSKHLVQIYSYNEA 443

Query: 405  SDARQQLEIDAHVGNVNDLAFSAPCKQISVITCGDDKTIKVWDAVTGSRTYSFEGHGAPV 464
             DARQQLEIDAHVG VNDL FSAP KQ+ VITCGDDK +K WDA  G + Y+FEGH APV
Sbjct: 444  KDARQQLEIDAHVGGVNDLTFSAPEKQLLVITCGDDKIVKAWDATDGVKMYTFEGHDAPV 503

Query: 465  YSLCPHAKENIHFIFSISVDGKIKAWLYDSLGARVDYDAPGLGCTRMAYSANGRRLFSCG 524
            YSLCP++K N+HF+F+ SV+G IK WLYD+LGARVDYDAPGLGCT MAYS + RRLFSCG
Sbjct: 504  YSLCPYSKGNVHFVFATSVNGNIKVWLYDNLGARVDYDAPGLGCTSMAYSGD-RRLFSCG 562

Query: 525  TSKEGESFLVEWNESEGAIKRTYQGLQLQHNSVSVVHFDTAKDQILAAGDDHVIKIWDMN 584
            TS  GESFLVEW++SEGAIKRTY G  LQ NS SVV FD  K+Q+LAAGD+HVIKIWDMN
Sbjct: 563  TSGSGESFLVEWDDSEGAIKRTYLG--LQKNSSSVVQFDIMKNQVLAAGDEHVIKIWDMN 620

Query: 585  KVQLLTTIDAGGGLPENPRICFNKNGTLLAVIANENRIKILETPES--NSVDAAGVLSDN 642
            K++L TTIDA GGLP NP + FNK GTLLAV AN+N+IKIL    S  +       L D+
Sbjct: 621  KIELFTTIDAEGGLPANPCVRFNKEGTLLAVSANDNKIKILAKDGSLQSLHTTENCLDDD 680

Query: 643  LRKLSVNPISTVTGAGIANGSVS------VNEDPKEDVKPEISVEAENKSEVEKPLFARP 696
             R +S   IS    A  A+ +V+      +     + VK +I+ +              P
Sbjct: 681  FRLVS-EAISKGACAQDADEAVAKQCFNLLQNGNLKAVKSKITGKDTKSKSGRLIELNSP 739

Query: 697  SECQSLLLPSKVKANKISRLTYNNGGQAIFALASNGVHLMWRWPRNDLTLSTEATTKVPP 756
            S+CQ L LPS +KANKISRL YNN G +I AL SN  HL W+WP+ND  LS  A  KV P
Sbjct: 740  SQCQILRLPSHMKANKISRLIYNNAGNSILALTSNATHLYWKWPQNDFDLSDTAAAKVSP 799

Query: 757  RLYQPRHGPQFMVNDTTDSNSQEAVPCFALSKNDAYLFSASGGVISLYIVMTFKTILTIM 816
            +L+QPR     M ND T SN +E VPCFALS+ND+YL S+SGG ISLY ++ FKT+L+IM
Sbjct: 800  QLWQPRSYSGLMTNDLTGSNPEETVPCFALSRNDSYLMSSSGGRISLYNLLKFKTMLSIM 859

Query: 817  PPSPTATSLAFNPHDNNVIAIGMDDSTILIYNARSSEVISKLEGHSKRVTGLVFSDALNI 876
             P P AT +AF+P DNN++AIG D+STILIYN RS++VI+ LEGHSKRV+GL FS+ LN+
Sbjct: 860  QPPPAATCIAFHPQDNNILAIGRDNSTILIYNVRSAKVITILEGHSKRVSGLAFSNDLNL 919

Query: 877  LVSSGGDAQIFVWDVDGWGIQTCRSLQTPDGVMTLAPS-ETHIQFHKDQTRFLLVHETHL 935
            LVSSG DAQIFVW+V+GW  Q    LQ PDG +  + S +THIQFH++QT FL VHETHL
Sbjct: 920  LVSSGADAQIFVWNVEGWYKQRSTFLQIPDGRIPFSLSTDTHIQFHQNQTEFLSVHETHL 979

Query: 936  AIYEAEELTCLKQWFPIS-SVPISQATFSCDCRMVFTSFVDGTLSIHEASNLEVQCRILS 994
            AIYEA +L C+KQW P   + PIS ATFSCD +MV+ SF+DG +SI +AS+ ++ C+I  
Sbjct: 980  AIYEARKLECVKQWIPGDFATPISHATFSCDGQMVYASFLDGLVSIFDASDFQLYCQINP 1039

Query: 995  TAYLRPTTSCLHVYPHAIAAHPLKPTQFAVGLTNGEVYVIEPNEPGDTWAVLPPDE 1050
            TAYL PT+S L VYP AIAAHP +P QFAVGLT+G V V EP      W++L  DE
Sbjct: 1040 TAYLFPTSS-LGVYPIAIAAHPQEPNQFAVGLTDGGVIVFEPPISAGKWSMLTADE 1094




Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|356550630|ref|XP_003543688.1| PREDICTED: topless-related protein 1-like [Glycine max] Back     alignment and taxonomy information
>gi|357455301|ref|XP_003597931.1| WD repeat-containing protein, putative [Medicago truncatula] gi|355486979|gb|AES68182.1| WD repeat-containing protein, putative [Medicago truncatula] Back     alignment and taxonomy information
>gi|357455305|ref|XP_003597933.1| WD repeat-containing protein, putative [Medicago truncatula] gi|355486981|gb|AES68184.1| WD repeat-containing protein, putative [Medicago truncatula] Back     alignment and taxonomy information
>gi|357455303|ref|XP_003597932.1| WD repeat-containing protein, putative [Medicago truncatula] gi|355486980|gb|AES68183.1| WD repeat-containing protein, putative [Medicago truncatula] Back     alignment and taxonomy information
>gi|356526242|ref|XP_003531727.1| PREDICTED: protein TOPLESS-like [Glycine max] Back     alignment and taxonomy information
>gi|357458875|ref|XP_003599718.1| WD repeat-containing protein, putative [Medicago truncatula] gi|357468121|ref|XP_003604345.1| WD repeat-containing protein, putative [Medicago truncatula] gi|355488766|gb|AES69969.1| WD repeat-containing protein, putative [Medicago truncatula] gi|355505400|gb|AES86542.1| WD repeat-containing protein, putative [Medicago truncatula] Back     alignment and taxonomy information
>gi|356554802|ref|XP_003545731.1| PREDICTED: topless-related protein 1-like isoform 1 [Glycine max] Back     alignment and taxonomy information
>gi|297839887|ref|XP_002887825.1| hypothetical protein ARALYDRAFT_895943 [Arabidopsis lyrata subsp. lyrata] gi|297333666|gb|EFH64084.1| hypothetical protein ARALYDRAFT_895943 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|24461849|gb|AAN62336.1|AF506028_3 CTV.2 [Citrus trifoliata] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query1068
TAIR|locus:21988881120 TPR1 "TOPLESS-related 1" [Arab 0.751 0.716 0.559 1e-306
TAIR|locus:20362041131 TPL "TOPLESS" [Arabidopsis tha 0.808 0.763 0.537 9.4e-306
TAIR|locus:20867701131 TPR2 "TOPLESS-related 2" [Arab 0.640 0.604 0.482 4.2e-261
TAIR|locus:2040100740 AT2G25420 "AT2G25420" [Arabido 0.328 0.474 0.361 4.5e-78
ASPGD|ASPL00000321621364 AN8468 [Emericella nidulans (t 0.569 0.445 0.239 4.5e-17
MGI|MGI:1918511476 Poc1b "POC1 centriolar protein 0.235 0.527 0.242 3.3e-14
UNIPROTKB|G3N3E5308 WDR5 "WD repeat-containing pro 0.191 0.665 0.243 8e-14
FB|FBgn0040066361 wds "will die slowly" [Drosoph 0.191 0.567 0.247 1.1e-13
UNIPROTKB|Q5M786334 wdr5 "WD repeat-containing pro 0.191 0.613 0.243 1.1e-13
UNIPROTKB|Q2KIG2334 WDR5 "WD repeat-containing pro 0.191 0.613 0.243 1.4e-13
TAIR|locus:2198888 TPR1 "TOPLESS-related 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 2337 (827.7 bits), Expect = 1.0e-306, Sum P(2) = 1.0e-306
 Identities = 463/827 (55%), Positives = 589/827 (71%)

Query:   231 PTNKAVTMDRPE-DSDILSEKSPVRILNEQASTVTYPGVSLKNIPDYSPKSSLKKEMFQS 289
             P+N AV  D P  DSD +S+++    ++++ S     GV++  +P   P  +      Q+
Sbjct:   288 PSNSAV--DYPSGDSDHVSKRTRPMGISDEVSL----GVNM--LPMTFPGQAHGHN--QT 337

Query:   290 FGETSFSDFPKTVAQTLIEGSSSPMSMDFHPVQHTLLLVGTNVGDTGLWDVNSGQKLFIR 349
             F      D PKTVA+TL +GSS PMSMDFHP++ TLLLVGTNVGD GLW+V S ++L  +
Sbjct:   338 FKAPD--DLPKTVARTLSQGSS-PMSMDFHPIKQTLLLVGTNVGDIGLWEVGSRERLVQK 394

Query:   350 NFKVWDIGACSMLFKTALVRDPGVSVNRVVWSPDGSLLGVAYSKHIVQLYAYHGGSDARQ 409
              FKVWD+  CSM  + ALV++P VSVNRV+WSPDGSL GVAYS+HIVQLY+YHGG D RQ
Sbjct:   395 TFKVWDLSKCSMPLQAALVKEPVVSVNRVIWSPDGSLFGVAYSRHIVQLYSYHGGEDMRQ 454

Query:   410 QLEIDAHVGNVNDLAFSAPCKQISVITCGDDKTIKVWDAVTGSRTYSFEGHGAPVYSLCP 469
              LEIDAHVG VND+AFS P KQ+ V TCGDDKTIKVWDA TG + Y+FEGH APVYS+CP
Sbjct:   455 HLEIDAHVGGVNDIAFSTPNKQLCVTTCGDDKTIKVWDAATGVKRYTFEGHEAPVYSICP 514

Query:   470 HAKENIHFIFSISVDGKIKAWLYDSLGARVDYDAPGLGCTRMAYSANGRRLFSCGTSKEG 529
             H KENI FIFS ++DGKIKAWLYD++G+RVDY+APG  CT MAYSA+G RLFSCGTSK+G
Sbjct:   515 HYKENIQFIFSTALDGKIKAWLYDNMGSRVDYEAPGRWCTTMAYSADGTRLFSCGTSKDG 574

Query:   530 ESFLVEWNESEGAIKRTYQGLQLQHNSVSVVHFDTAKDQILAAGDDHVIKIWDMNKVQLL 589
             ESF+VEWNESEGA+KRTYQG   +  S+ VV FDT K++ LAAGDD  IK WDM+ +QLL
Sbjct:   575 ESFIVEWNESEGAVKRTYQGFHKR--SLGVVQFDTTKNRYLAAGDDFSIKFWDMDTIQLL 632

Query:   590 TTIDAGGGLPENPRICFNKNGTLLAVIANENRIKILETPES-NSVDAAGVLSDNLRKLSV 648
             T IDA GGL  +PRI FNK G+LLAV AN+N IK++   +    +     LS    K ++
Sbjct:   633 TAIDADGGLQASPRIRFNKEGSLLAVSANDNMIKVMANSDGLRLLHTVENLSSESSKPAI 692

Query:   649 NPISTVTGAGIANGSVSVNEDPKE--DVKPEISVEAENKSEVEKPL-FARPSECQSLLLP 705
             N I  V           +N D +   DVKP I+ E+ +KS+V K      PS+C+SL LP
Sbjct:   693 NSIPMVERPASVVSIPGMNGDSRNMVDVKPVITEESNDKSKVWKLTEVGEPSQCRSLRLP 752

Query:   706 SKVKANKISRLTYNNGGQAIFALASNGVHLMWRWPRNDLTLSTEATTKVPPRLYQPRHGP 765
               ++  KISRL + N G AI ALASN +HL+W+W RND   + +AT  +PP+ +QP  G 
Sbjct:   753 ENMRVTKISRLIFTNSGNAILALASNAIHLLWKWQRNDRNATGKATASLPPQQWQPASGI 812

Query:   766 QFMVNDTTDSNSQEAVPCFALSKNDAYLFSASGGVISLYIVMTFKTILTIMPPSPTATSL 825
               M ND  ++N +EAVPCFALSKND+Y+ SASGG ISL+ +MTFKT+ T MPP P AT L
Sbjct:   813 -LMTNDVAETNPEEAVPCFALSKNDSYVMSASGGKISLFNMMTFKTMATFMPPPPAATFL 871

Query:   826 AFNPHDNNVIAIGMDDSTILIYNARSSEVISKLEGHSKRVTGLVFSDALNILVSSGGDAQ 885
             AF+P DNN+IAIGMDDSTI IYN R  EV SKL+GHSKR+TGL FS+ LN+LVSSG DAQ
Sbjct:   872 AFHPQDNNIIAIGMDDSTIQIYNVRVDEVKSKLKGHSKRITGLAFSNVLNVLVSSGADAQ 931

Query:   886 IFVWDVDGWGIQTCRSLQTPDGVMTLAPSETHIQFHKDQTRFLLVHETHLAIYEAEELTC 945
             + VW+ DGW  Q  + LQ P G  T + S+T +QFH+DQ  FL+VHET LAIYE  +L C
Sbjct:   932 LCVWNTDGWEKQKSKVLQIPQGRSTSSLSDTRVQFHQDQVHFLVVHETQLAIYETTKLEC 991

Query:   946 LKQWFPI--SSVPISQATFSCDCRMVFTSFVDGTLSIHEASNLEVQCRILSTAYLRPTTS 1003
             +KQW P+  S+ PI+ ATFSCD ++++TSF+D T+ +  ++NL ++CR+  +AYL  + S
Sbjct:   992 MKQW-PVRESAAPITHATFSCDSQLIYTSFMDATICVFSSANLRLRCRVNPSAYLPASLS 1050

Query:  1004 CLHVYPHAIAAHPLKPTQFAVGLTNGEVYVIEPNEPGDTWAVLPPDE 1050
               +V+P  IAAHP +   FAVGL++G V++ EP E    W V PP E
Sbjct:  1051 NSNVHPLVIAAHPQESNMFAVGLSDGGVHIFEPLESEGKWGVAPPPE 1097


GO:0005634 "nucleus" evidence=ISM
GO:0010072 "primary shoot apical meristem specification" evidence=IGI
GO:0005829 "cytosol" evidence=IDA
GO:0005515 "protein binding" evidence=IPI
TAIR|locus:2036204 TPL "TOPLESS" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2086770 TPR2 "TOPLESS-related 2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2040100 AT2G25420 "AT2G25420" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
ASPGD|ASPL0000032162 AN8468 [Emericella nidulans (taxid:162425)] Back     alignment and assigned GO terms
MGI|MGI:1918511 Poc1b "POC1 centriolar protein homolog B (Chlamydomonas)" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|G3N3E5 WDR5 "WD repeat-containing protein 5" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
FB|FBgn0040066 wds "will die slowly" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
UNIPROTKB|Q5M786 wdr5 "WD repeat-containing protein 5" [Xenopus (Silurana) tropicalis (taxid:8364)] Back     alignment and assigned GO terms
UNIPROTKB|Q2KIG2 WDR5 "WD repeat-containing protein 5" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q0WV90TPR1_ARATHNo assigned EC number0.54150.96250.9178yesno

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Your Input:
estExt_Genewise1_v1.C_LG_XVIII1717
hypothetical protein (1109 aa)
(Populus trichocarpa)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query1068
cd00200289 cd00200, WD40, WD40 domain, found in a number of e 4e-27
COG2319466 COG2319, COG2319, FOG: WD40 repeat [General functi 2e-18
cd00200289 cd00200, WD40, WD40 domain, found in a number of e 3e-14
cd00200289 cd00200, WD40, WD40 domain, found in a number of e 3e-14
smart0066858 smart00668, CTLH, C-terminal to LisH motif 1e-12
cd00200289 cd00200, WD40, WD40 domain, found in a number of e 3e-11
COG2319466 COG2319, COG2319, FOG: WD40 repeat [General functi 1e-10
COG2319466 COG2319, COG2319, FOG: WD40 repeat [General functi 2e-10
COG2319466 COG2319, COG2319, FOG: WD40 repeat [General functi 4e-10
COG2319466 COG2319, COG2319, FOG: WD40 repeat [General functi 1e-09
COG2319466 COG2319, COG2319, FOG: WD40 repeat [General functi 1e-07
cd00200289 cd00200, WD40, WD40 domain, found in a number of e 6e-07
cd00200289 cd00200, WD40, WD40 domain, found in a number of e 8e-07
cd00200289 cd00200, WD40, WD40 domain, found in a number of e 6e-06
smart0032040 smart00320, WD40, WD40 repeats 8e-06
pfam0040039 pfam00400, WD40, WD domain, G-beta repeat 3e-05
pfam0040039 pfam00400, WD40, WD domain, G-beta repeat 5e-05
PTZ00421 493 PTZ00421, PTZ00421, coronin; Provisional 2e-04
smart0032040 smart00320, WD40, WD40 repeats 3e-04
>gnl|CDD|238121 cd00200, WD40, WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and bottom surface of the propeller are proposed to coordinate interactions with other proteins and/or small ligands; 7 copies of the repeat are present in this alignment Back     alignment and domain information
 Score =  112 bits (281), Expect = 4e-27
 Identities = 81/324 (25%), Positives = 126/324 (38%), Gaps = 47/324 (14%)

Query: 307 IEGSSSP-MSMDFHPVQHTLLLVGTNVGDTGLWDVNSGQKLFIRNFKVWDIGACSMLFKT 365
           ++G +     + F P    L         TG  D            KVWD+   +     
Sbjct: 5   LKGHTGGVTCVAFSPDGKLLA--------TGSGD---------GTIKVWDL--ETGELLR 45

Query: 366 ALVRDPGVSVNRVVWSPDGSLLGVAYSKHIVQLYAYHGGSDARQQLEIDAHVGNVNDLAF 425
            L       V  V  S DG+ L    S   ++L+    G   R    +  H   V+ +AF
Sbjct: 46  TLK-GHTGPVRDVAASADGTYLASGSSDKTIRLWDLETGECVR---TLTGHTSYVSSVAF 101

Query: 426 SAPCKQISVITCGDDKTIKVWDAVTGSRTYSFEGHGAPVYSLCPHAKENIHFIFSISVDG 485
           S P  +I + +   DKTIKVWD  TG    +  GH   V S+      +  F+ S S DG
Sbjct: 102 S-PDGRI-LSSSSRDKTIKVWDVETGKCLTTLRGHTDWVNSVAFS--PDGTFVASSSQDG 157

Query: 486 KIKAWLYDSLGARVDYDAPG--LGCTRMAYSANGRRLFSCGTSKEGESFLVEWNESEGAI 543
            IK W  D    +      G       +A+S +G +L S  +   G   L  W+ S G  
Sbjct: 158 TIKLW--DLRTGKCVATLTGHTGEVNSVAFSPDGEKLLSSSSD--GTIKL--WDLSTGKC 211

Query: 544 KRTYQGLQLQH-NSVSVVHFDTAKDQILAAGDDHVIKIWDMNKVQLLTTIDAGGGLPENP 602
             T +G    H N V+ V F      + +  +D  I++WD+   + + T+        N 
Sbjct: 212 LGTLRG----HENGVNSVAFSPDGYLLASGSEDGTIRVWDLRTGECVQTLSG----HTNS 263

Query: 603 --RICFNKNGTLLAVIANENRIKI 624
              + ++ +G  LA  + +  I+I
Sbjct: 264 VTSLAWSPDGKRLASGSADGTIRI 287


Length = 289

>gnl|CDD|225201 COG2319, COG2319, FOG: WD40 repeat [General function prediction only] Back     alignment and domain information
>gnl|CDD|238121 cd00200, WD40, WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and bottom surface of the propeller are proposed to coordinate interactions with other proteins and/or small ligands; 7 copies of the repeat are present in this alignment Back     alignment and domain information
>gnl|CDD|238121 cd00200, WD40, WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and bottom surface of the propeller are proposed to coordinate interactions with other proteins and/or small ligands; 7 copies of the repeat are present in this alignment Back     alignment and domain information
>gnl|CDD|128914 smart00668, CTLH, C-terminal to LisH motif Back     alignment and domain information
>gnl|CDD|238121 cd00200, WD40, WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and bottom surface of the propeller are proposed to coordinate interactions with other proteins and/or small ligands; 7 copies of the repeat are present in this alignment Back     alignment and domain information
>gnl|CDD|225201 COG2319, COG2319, FOG: WD40 repeat [General function prediction only] Back     alignment and domain information
>gnl|CDD|225201 COG2319, COG2319, FOG: WD40 repeat [General function prediction only] Back     alignment and domain information
>gnl|CDD|225201 COG2319, COG2319, FOG: WD40 repeat [General function prediction only] Back     alignment and domain information
>gnl|CDD|225201 COG2319, COG2319, FOG: WD40 repeat [General function prediction only] Back     alignment and domain information
>gnl|CDD|225201 COG2319, COG2319, FOG: WD40 repeat [General function prediction only] Back     alignment and domain information
>gnl|CDD|238121 cd00200, WD40, WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and bottom surface of the propeller are proposed to coordinate interactions with other proteins and/or small ligands; 7 copies of the repeat are present in this alignment Back     alignment and domain information
>gnl|CDD|238121 cd00200, WD40, WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and bottom surface of the propeller are proposed to coordinate interactions with other proteins and/or small ligands; 7 copies of the repeat are present in this alignment Back     alignment and domain information
>gnl|CDD|238121 cd00200, WD40, WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and bottom surface of the propeller are proposed to coordinate interactions with other proteins and/or small ligands; 7 copies of the repeat are present in this alignment Back     alignment and domain information
>gnl|CDD|197651 smart00320, WD40, WD40 repeats Back     alignment and domain information
>gnl|CDD|201208 pfam00400, WD40, WD domain, G-beta repeat Back     alignment and domain information
>gnl|CDD|201208 pfam00400, WD40, WD domain, G-beta repeat Back     alignment and domain information
>gnl|CDD|173611 PTZ00421, PTZ00421, coronin; Provisional Back     alignment and domain information
>gnl|CDD|197651 smart00320, WD40, WD40 repeats Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 1068
KOG0293519 consensus WD40 repeat-containing protein [Function 100.0
KOG0319775 consensus WD40-repeat-containing subunit of the 18 100.0
KOG0319775 consensus WD40-repeat-containing subunit of the 18 100.0
KOG0318603 consensus WD40 repeat stress protein/actin interac 100.0
KOG0318603 consensus WD40 repeat stress protein/actin interac 100.0
KOG0291 893 consensus WD40-repeat-containing subunit of the 18 100.0
KOG0291893 consensus WD40-repeat-containing subunit of the 18 100.0
KOG0275508 consensus Conserved WD40 repeat-containing protein 100.0
KOG0306 888 consensus WD40-repeat-containing subunit of the 18 100.0
KOG0306888 consensus WD40-repeat-containing subunit of the 18 100.0
KOG0271480 consensus Notchless-like WD40 repeat-containing pr 100.0
KOG0271480 consensus Notchless-like WD40 repeat-containing pr 100.0
KOG1408 1080 consensus WD40 repeat protein [Function unknown] 100.0
KOG1408 1080 consensus WD40 repeat protein [Function unknown] 100.0
KOG0272459 consensus U4/U6 small nuclear ribonucleoprotein Pr 100.0
KOG1063764 consensus RNA polymerase II elongator complex, sub 100.0
KOG1539 910 consensus WD repeat protein [General function pred 100.0
KOG0279315 consensus G protein beta subunit-like protein [Sig 100.0
KOG0272459 consensus U4/U6 small nuclear ribonucleoprotein Pr 100.0
KOG1063764 consensus RNA polymerase II elongator complex, sub 100.0
KOG0286343 consensus G-protein beta subunit [General function 100.0
KOG0276 794 consensus Vesicle coat complex COPI, beta' subunit 100.0
KOG1539 910 consensus WD repeat protein [General function pred 100.0
KOG0286343 consensus G-protein beta subunit [General function 100.0
KOG0315311 consensus G-protein beta subunit-like protein (con 100.0
KOG0279315 consensus G protein beta subunit-like protein [Sig 100.0
KOG0276 794 consensus Vesicle coat complex COPI, beta' subunit 100.0
KOG0292 1202 consensus Vesicle coat complex COPI, alpha subunit 100.0
KOG0273524 consensus Beta-transducin family (WD-40 repeat) pr 100.0
KOG0295406 consensus WD40 repeat-containing protein [Function 100.0
KOG2106626 consensus Uncharacterized conserved protein, conta 100.0
KOG0296399 consensus Angio-associated migratory cell protein 100.0
KOG0296399 consensus Angio-associated migratory cell protein 100.0
KOG0315311 consensus G-protein beta subunit-like protein (con 100.0
KOG0285460 consensus Pleiotropic regulator 1 [RNA processing 100.0
KOG2048691 consensus WD40 repeat protein [General function pr 100.0
KOG0645312 consensus WD40 repeat protein [General function pr 100.0
KOG0292 1202 consensus Vesicle coat complex COPI, alpha subunit 100.0
KOG2106626 consensus Uncharacterized conserved protein, conta 100.0
KOG0273524 consensus Beta-transducin family (WD-40 repeat) pr 100.0
KOG0316307 consensus Conserved WD40 repeat-containing protein 100.0
KOG0263707 consensus Transcription initiation factor TFIID, s 100.0
KOG0265338 consensus U5 snRNP-specific protein-like factor an 100.0
KOG0293519 consensus WD40 repeat-containing protein [Function 100.0
KOG0295406 consensus WD40 repeat-containing protein [Function 100.0
KOG0265338 consensus U5 snRNP-specific protein-like factor an 100.0
KOG0266456 consensus WD40 repeat-containing protein [General 100.0
KOG0282503 consensus mRNA splicing factor [Function unknown] 100.0
KOG0284464 consensus Polyadenylation factor I complex, subuni 100.0
KOG0285460 consensus Pleiotropic regulator 1 [RNA processing 100.0
KOG2048691 consensus WD40 repeat protein [General function pr 100.0
KOG0645312 consensus WD40 repeat protein [General function pr 100.0
KOG0263707 consensus Transcription initiation factor TFIID, s 100.0
cd00200289 WD40 WD40 domain, found in a number of eukaryotic 100.0
KOG0284464 consensus Polyadenylation factor I complex, subuni 100.0
KOG0281499 consensus Beta-TrCP (transducin repeats containing 100.0
KOG0266456 consensus WD40 repeat-containing protein [General 100.0
KOG1445 1012 consensus Tumor-specific antigen (contains WD repe 99.97
KOG0282503 consensus mRNA splicing factor [Function unknown] 99.97
KOG0640430 consensus mRNA cleavage stimulating factor complex 99.97
KOG0278334 consensus Serine/threonine kinase receptor-associa 99.97
KOG0316307 consensus Conserved WD40 repeat-containing protein 99.97
KOG0281499 consensus Beta-TrCP (transducin repeats containing 99.97
PLN00181793 protein SPA1-RELATED; Provisional 99.97
cd00200289 WD40 WD40 domain, found in a number of eukaryotic 99.97
KOG0275508 consensus Conserved WD40 repeat-containing protein 99.97
KOG1407313 consensus WD40 repeat protein [Function unknown] 99.97
KOG0310487 consensus Conserved WD40 repeat-containing protein 99.97
PLN00181793 protein SPA1-RELATED; Provisional 99.97
KOG0641350 consensus WD40 repeat protein [General function pr 99.97
KOG0288459 consensus WD40 repeat protein TipD [General functi 99.97
KOG0973 942 consensus Histone transcription regulator HIRA, WD 99.96
KOG0643327 consensus Translation initiation factor 3, subunit 99.96
KOG0278334 consensus Serine/threonine kinase receptor-associa 99.96
KOG1446311 consensus Histone H3 (Lys4) methyltransferase comp 99.96
KOG0643327 consensus Translation initiation factor 3, subunit 99.96
KOG0283712 consensus WD40 repeat-containing protein [Function 99.96
KOG0313423 consensus Microtubule binding protein YTM1 (contai 99.96
PTZ00421493 coronin; Provisional 99.96
KOG0973 942 consensus Histone transcription regulator HIRA, WD 99.96
KOG0640430 consensus mRNA cleavage stimulating factor complex 99.96
KOG0274537 consensus Cdc4 and related F-box and WD-40 protein 99.96
KOG0310 487 consensus Conserved WD40 repeat-containing protein 99.95
KOG1446311 consensus Histone H3 (Lys4) methyltransferase comp 99.95
KOG0305484 consensus Anaphase promoting complex, Cdc20, Cdh1, 99.95
KOG1407313 consensus WD40 repeat protein [Function unknown] 99.95
KOG0772 641 consensus Uncharacterized conserved protein, conta 99.95
KOG0299479 consensus U3 snoRNP-associated protein (contains W 99.95
KOG0283712 consensus WD40 repeat-containing protein [Function 99.95
KOG0772641 consensus Uncharacterized conserved protein, conta 99.95
KOG0300481 consensus WD40 repeat-containing protein [Function 99.95
PTZ00420568 coronin; Provisional 99.95
KOG0277311 consensus Peroxisomal targeting signal type 2 rece 99.95
KOG0647347 consensus mRNA export protein (contains WD40 repea 99.95
KOG0313423 consensus Microtubule binding protein YTM1 (contai 99.95
KOG2096420 consensus WD40 repeat protein [General function pr 99.94
KOG0288459 consensus WD40 repeat protein TipD [General functi 99.94
KOG0641350 consensus WD40 repeat protein [General function pr 99.94
PTZ00421493 coronin; Provisional 99.94
KOG0294362 consensus WD40 repeat-containing protein [Function 99.94
KOG0268433 consensus Sof1-like rRNA processing protein (conta 99.94
KOG0308735 consensus Conserved WD40 repeat-containing protein 99.94
KOG1963 792 consensus WD40 repeat protein [General function pr 99.94
KOG0301745 consensus Phospholipase A2-activating protein (con 99.94
KOG0299479 consensus U3 snoRNP-associated protein (contains W 99.94
KOG0274537 consensus Cdc4 and related F-box and WD-40 protein 99.94
KOG0647347 consensus mRNA export protein (contains WD40 repea 99.94
KOG0308735 consensus Conserved WD40 repeat-containing protein 99.94
KOG0289506 consensus mRNA splicing factor [General function p 99.94
KOG0289506 consensus mRNA splicing factor [General function p 99.94
KOG0268433 consensus Sof1-like rRNA processing protein (conta 99.94
KOG0305484 consensus Anaphase promoting complex, Cdc20, Cdh1, 99.94
KOG0277311 consensus Peroxisomal targeting signal type 2 rece 99.93
KOG2096420 consensus WD40 repeat protein [General function pr 99.93
KOG1274 933 consensus WD40 repeat protein [General function pr 99.93
KOG1445 1012 consensus Tumor-specific antigen (contains WD repe 99.93
KOG1036323 consensus Mitotic spindle checkpoint protein BUB3, 99.93
KOG0294362 consensus WD40 repeat-containing protein [Function 99.93
PTZ00420568 coronin; Provisional 99.93
KOG0300481 consensus WD40 repeat-containing protein [Function 99.92
KOG0639705 consensus Transducin-like enhancer of split protei 99.92
KOG1332299 consensus Vesicle coat complex COPII, subunit SEC1 99.92
KOG1963 792 consensus WD40 repeat protein [General function pr 99.92
KOG1274 933 consensus WD40 repeat protein [General function pr 99.92
KOG0264422 consensus Nucleosome remodeling factor, subunit CA 99.92
KOG0301 745 consensus Phospholipase A2-activating protein (con 99.92
KOG1538 1081 consensus Uncharacterized conserved protein WDR10, 99.91
TIGR03866300 PQQ_ABC_repeats PQQ-dependent catabolism-associate 99.91
KOG1273405 consensus WD40 repeat protein [General function pr 99.91
TIGR03866300 PQQ_ABC_repeats PQQ-dependent catabolism-associate 99.91
KOG2055514 consensus WD40 repeat protein [General function pr 99.91
KOG0646476 consensus WD40 repeat protein [General function pr 99.91
KOG1332299 consensus Vesicle coat complex COPII, subunit SEC1 99.9
KOG1036323 consensus Mitotic spindle checkpoint protein BUB3, 99.9
KOG0646476 consensus WD40 repeat protein [General function pr 99.9
KOG0639705 consensus Transducin-like enhancer of split protei 99.9
KOG4283397 consensus Transcription-coupled repair protein CSA 99.9
KOG2055514 consensus WD40 repeat protein [General function pr 99.9
KOG4328498 consensus WD40 protein [Function unknown] 99.89
KOG0650733 consensus WD40 repeat nucleolar protein Bop1, invo 99.89
KOG4283397 consensus Transcription-coupled repair protein CSA 99.89
KOG1273405 consensus WD40 repeat protein [General function pr 99.89
KOG0264422 consensus Nucleosome remodeling factor, subunit CA 99.89
KOG0650733 consensus WD40 repeat nucleolar protein Bop1, invo 99.89
KOG0267 825 consensus Microtubule severing protein katanin p80 99.88
KOG0269 839 consensus WD40 repeat-containing protein [Function 99.86
KOG0321720 consensus WD40 repeat-containing protein L2DTL [Fu 99.86
KOG1538 1081 consensus Uncharacterized conserved protein WDR10, 99.86
KOG0267825 consensus Microtubule severing protein katanin p80 99.86
KOG1009434 consensus Chromatin assembly complex 1 subunit B/C 99.86
KOG1034385 consensus Transcriptional repressor EED/ESC/FIE, r 99.85
KOG0321 720 consensus WD40 repeat-containing protein L2DTL [Fu 99.85
KOG2445361 consensus Nuclear pore complex component (sc Seh1) 99.85
KOG0270463 consensus WD40 repeat-containing protein [Function 99.85
KOG0269 839 consensus WD40 repeat-containing protein [Function 99.85
KOG2445361 consensus Nuclear pore complex component (sc Seh1) 99.85
COG2319466 FOG: WD40 repeat [General function prediction only 99.84
COG2319466 FOG: WD40 repeat [General function prediction only 99.84
KOG1034385 consensus Transcriptional repressor EED/ESC/FIE, r 99.84
KOG1912 1062 consensus WD40 repeat protein [General function pr 99.83
KOG4497447 consensus Uncharacterized conserved protein WDR8, 99.83
KOG4328498 consensus WD40 protein [Function unknown] 99.83
KOG0307 1049 consensus Vesicle coat complex COPII, subunit SEC3 99.83
KOG4378 673 consensus Nuclear protein COP1 [Signal transductio 99.83
KOG4378673 consensus Nuclear protein COP1 [Signal transductio 99.83
KOG1009434 consensus Chromatin assembly complex 1 subunit B/C 99.82
KOG2919406 consensus Guanine nucleotide-binding protein [Gene 99.81
KOG0302440 consensus Ribosome Assembly protein [General funct 99.81
KOG1524 737 consensus WD40 repeat-containing protein CHE-2 [Ge 99.81
KOG4497447 consensus Uncharacterized conserved protein WDR8, 99.8
KOG0303472 consensus Actin-binding protein Coronin, contains 99.8
KOG1912 1062 consensus WD40 repeat protein [General function pr 99.8
KOG2919406 consensus Guanine nucleotide-binding protein [Gene 99.79
KOG0270463 consensus WD40 repeat-containing protein [Function 99.79
KOG0302440 consensus Ribosome Assembly protein [General funct 99.78
KOG0644 1113 consensus Uncharacterized conserved protein, conta 99.78
KOG1524737 consensus WD40 repeat-containing protein CHE-2 [Ge 99.77
KOG0642577 consensus Cell-cycle nuclear protein, contains WD- 99.77
KOG1334559 consensus WD40 repeat protein [General function pr 99.76
KOG0307 1049 consensus Vesicle coat complex COPII, subunit SEC3 99.76
KOG0303472 consensus Actin-binding protein Coronin, contains 99.76
KOG4227609 consensus WD40 repeat protein [General function pr 99.75
KOG0322323 consensus G-protein beta subunit-like protein GNB1 99.75
KOG0644 1113 consensus Uncharacterized conserved protein, conta 99.74
KOG0649325 consensus WD40 repeat protein [General function pr 99.74
KOG1007370 consensus WD repeat protein TSSC1, WD repeat super 99.74
KOG0649325 consensus WD40 repeat protein [General function pr 99.74
PRK11028330 6-phosphogluconolactonase; Provisional 99.74
KOG2110 391 consensus Uncharacterized conserved protein, conta 99.73
KOG1188376 consensus WD40 repeat protein [General function pr 99.73
KOG2110391 consensus Uncharacterized conserved protein, conta 99.73
KOG1310758 consensus WD40 repeat protein [General function pr 99.73
KOG1188376 consensus WD40 repeat protein [General function pr 99.72
KOG0322323 consensus G-protein beta subunit-like protein GNB1 99.72
PRK11028330 6-phosphogluconolactonase; Provisional 99.72
KOG0642577 consensus Cell-cycle nuclear protein, contains WD- 99.72
KOG1007370 consensus WD repeat protein TSSC1, WD repeat super 99.72
KOG4227609 consensus WD40 repeat protein [General function pr 99.72
KOG0290364 consensus Conserved WD40 repeat-containing protein 99.71
KOG0771398 consensus Prolactin regulatory element-binding pro 99.69
COG4946668 Uncharacterized protein related to the periplasmic 99.68
PRK01742429 tolB translocation protein TolB; Provisional 99.67
PF02239369 Cytochrom_D1: Cytochrome D1 heme domain; PDB: 1NNO 99.67
PF02239369 Cytochrom_D1: Cytochrome D1 heme domain; PDB: 1NNO 99.67
KOG15171387 consensus Guanine nucleotide binding protein MIP1 99.67
KOG0771398 consensus Prolactin regulatory element-binding pro 99.66
KOG1587555 consensus Cytoplasmic dynein intermediate chain [C 99.65
KOG12401431 consensus Protein kinase containing WD40 repeats [ 99.63
KOG0290364 consensus Conserved WD40 repeat-containing protein 99.63
KOG2394 636 consensus WD40 protein DMR-N9 [General function pr 99.62
KOG1523361 consensus Actin-related protein Arp2/3 complex, su 99.62
KOG15171387 consensus Guanine nucleotide binding protein MIP1 99.62
KOG0974 967 consensus WD-repeat protein WDR6, WD repeat superf 99.62
PRK01742429 tolB translocation protein TolB; Provisional 99.62
KOG1334559 consensus WD40 repeat protein [General function pr 99.61
KOG1587555 consensus Cytoplasmic dynein intermediate chain [C 99.61
KOG0974 967 consensus WD-repeat protein WDR6, WD repeat superf 99.61
KOG2139445 consensus WD40 repeat protein [General function pr 99.6
KOG2111346 consensus Uncharacterized conserved protein, conta 99.6
KOG12401431 consensus Protein kinase containing WD40 repeats [ 99.6
PF04762 928 IKI3: IKI3 family; InterPro: IPR006849 Members of 99.6
COG4946668 Uncharacterized protein related to the periplasmic 99.6
KOG2139445 consensus WD40 repeat protein [General function pr 99.59
PRK03629429 tolB translocation protein TolB; Provisional 99.57
KOG1310758 consensus WD40 repeat protein [General function pr 99.57
PRK05137435 tolB translocation protein TolB; Provisional 99.56
KOG2111346 consensus Uncharacterized conserved protein, conta 99.56
KOG18321516 consensus HIV-1 Vpr-binding protein [Cell cycle co 99.56
PRK03629429 tolB translocation protein TolB; Provisional 99.55
KOG2321703 consensus WD40 repeat protein [General function pr 99.55
KOG1523361 consensus Actin-related protein Arp2/3 complex, su 99.55
KOG2041 1189 consensus WD40 repeat protein [General function pr 99.54
KOG1272545 consensus WD40-repeat-containing subunit of the 18 99.54
PRK04922433 tolB translocation protein TolB; Provisional 99.53
KOG1272545 consensus WD40-repeat-containing subunit of the 18 99.53
PRK04922433 tolB translocation protein TolB; Provisional 99.53
KOG2315566 consensus Predicted translation initiation factor 99.53
PRK02889427 tolB translocation protein TolB; Provisional 99.52
PRK02889427 tolB translocation protein TolB; Provisional 99.51
COG5354561 Uncharacterized protein, contains Trp-Asp (WD) rep 99.51
PF10282345 Lactonase: Lactonase, 7-bladed beta-propeller; Int 99.51
KOG2394636 consensus WD40 protein DMR-N9 [General function pr 99.51
KOG3881412 consensus Uncharacterized conserved protein [Funct 99.5
KOG2041 1189 consensus WD40 repeat protein [General function pr 99.5
KOG2315566 consensus Predicted translation initiation factor 99.49
PF04762 928 IKI3: IKI3 family; InterPro: IPR006849 Members of 99.49
PRK05137435 tolB translocation protein TolB; Provisional 99.49
TIGR02658352 TTQ_MADH_Hv methylamine dehydrogenase heavy chain. 99.46
COG5354561 Uncharacterized protein, contains Trp-Asp (WD) rep 99.45
COG2706346 3-carboxymuconate cyclase [Carbohydrate transport 99.45
KOG2314698 consensus Translation initiation factor 3, subunit 99.44
KOG2321703 consensus WD40 repeat protein [General function pr 99.44
TIGR02658352 TTQ_MADH_Hv methylamine dehydrogenase heavy chain. 99.4
PRK01029428 tolB translocation protein TolB; Provisional 99.4
KOG1409404 consensus Uncharacterized conserved protein, conta 99.39
PF10282345 Lactonase: Lactonase, 7-bladed beta-propeller; Int 99.39
PRK01029428 tolB translocation protein TolB; Provisional 99.38
PRK00178430 tolB translocation protein TolB; Provisional 99.37
PRK04792448 tolB translocation protein TolB; Provisional 99.37
PRK04792448 tolB translocation protein TolB; Provisional 99.35
PRK00178430 tolB translocation protein TolB; Provisional 99.35
PF08662194 eIF2A: Eukaryotic translation initiation factor eI 99.33
KOG1354433 consensus Serine/threonine protein phosphatase 2A, 99.33
COG2706346 3-carboxymuconate cyclase [Carbohydrate transport 99.33
KOG2314698 consensus Translation initiation factor 3, subunit 99.33
TIGR02800417 propeller_TolB tol-pal system beta propeller repea 99.33
TIGR02800417 propeller_TolB tol-pal system beta propeller repea 99.32
KOG1354433 consensus Serine/threonine protein phosphatase 2A, 99.32
KOG3881412 consensus Uncharacterized conserved protein [Funct 99.31
PF08662194 eIF2A: Eukaryotic translation initiation factor eI 99.3
KOG1409404 consensus Uncharacterized conserved protein, conta 99.29
KOG4547541 consensus WD40 repeat-containing protein [General 99.28
TIGR03300377 assembly_YfgL outer membrane assembly lipoprotein 99.21
TIGR03300377 assembly_YfgL outer membrane assembly lipoprotein 99.19
KOG4547541 consensus WD40 repeat-containing protein [General 99.17
PLN02919 1057 haloacid dehalogenase-like hydrolase family protei 99.09
PRK04043419 tolB translocation protein TolB; Provisional 99.08
PLN029191057 haloacid dehalogenase-like hydrolase family protei 99.07
KOG0280339 consensus Uncharacterized conserved protein [Amino 99.04
KOG18971096 consensus Damage-specific DNA binding complex, sub 98.99
PF15492282 Nbas_N: Neuroblastoma-amplified sequence, N termin 98.98
KOG3617 1416 consensus WD40 and TPR repeat-containing protein [ 98.97
KOG41901034 consensus Uncharacterized conserved protein [Funct 98.95
KOG10642439 consensus RAVE (regulator of V-ATPase assembly) co 98.95
KOG0280339 consensus Uncharacterized conserved protein [Amino 98.94
PRK11138394 outer membrane biogenesis protein BamB; Provisiona 98.93
PRK04043419 tolB translocation protein TolB; Provisional 98.93
KOG41901034 consensus Uncharacterized conserved protein [Funct 98.91
KOG10642439 consensus RAVE (regulator of V-ATPase assembly) co 98.9
KOG1897 1096 consensus Damage-specific DNA binding complex, sub 98.89
PF07433305 DUF1513: Protein of unknown function (DUF1513); In 98.85
PF07433305 DUF1513: Protein of unknown function (DUF1513); In 98.82
KOG3914390 consensus WD repeat protein WDR4 [Function unknown 98.82
PRK11138394 outer membrane biogenesis protein BamB; Provisiona 98.8
PF15492282 Nbas_N: Neuroblastoma-amplified sequence, N termin 98.79
KOG3617 1416 consensus WD40 and TPR repeat-containing protein [ 98.79
KOG3914390 consensus WD repeat protein WDR4 [Function unknown 98.75
PF08450246 SGL: SMP-30/Gluconolaconase/LRE-like region; Inter 98.74
PF06433342 Me-amine-dh_H: Methylamine dehydrogenase heavy cha 98.74
PF08450246 SGL: SMP-30/Gluconolaconase/LRE-like region; Inter 98.73
KOG4532344 consensus WD40-like repeat containing protein [Gen 98.73
KOG0309 1081 consensus Conserved WD40 repeat-containing protein 98.72
PF13360238 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 98.72
KOG18321516 consensus HIV-1 Vpr-binding protein [Cell cycle co 98.71
COG5170460 CDC55 Serine/threonine protein phosphatase 2A, reg 98.7
PF06433342 Me-amine-dh_H: Methylamine dehydrogenase heavy cha 98.68
KOG0309 1081 consensus Conserved WD40 repeat-containing protein 98.66
PF13360238 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 98.63
COG5170460 CDC55 Serine/threonine protein phosphatase 2A, reg 98.62
PRK02888 635 nitrous-oxide reductase; Validated 98.61
KOG4532344 consensus WD40-like repeat containing protein [Gen 98.61
PF00930353 DPPIV_N: Dipeptidyl peptidase IV (DPP IV) N-termin 98.6
PRK02888635 nitrous-oxide reductase; Validated 98.57
KOG1920 1265 consensus IkappaB kinase complex, IKAP component [ 98.56
KOG4649354 consensus PQQ (pyrrolo-quinoline quinone) repeat p 98.56
KOG4649354 consensus PQQ (pyrrolo-quinoline quinone) repeat p 98.56
KOG4714319 consensus Nucleoporin [Nuclear structure] 98.53
KOG0882 558 consensus Cyclophilin-related peptidyl-prolyl cis- 98.52
PF00930353 DPPIV_N: Dipeptidyl peptidase IV (DPP IV) N-termin 98.52
PF10607145 CLTH: CTLH/CRA C-terminal to LisH motif domain; In 98.51
KOG1645463 consensus RING-finger-containing E3 ubiquitin liga 98.49
KOG1920 1265 consensus IkappaB kinase complex, IKAP component [ 98.46
PF0040039 WD40: WD domain, G-beta repeat; InterPro: IPR01978 98.46
KOG0882558 consensus Cyclophilin-related peptidyl-prolyl cis- 98.46
KOG2695425 consensus WD40 repeat protein [General function pr 98.44
KOG3621726 consensus WD40 repeat-containing protein [General 98.44
PF14583386 Pectate_lyase22: Oligogalacturonate lyase; PDB: 3C 98.42
KOG1275 1118 consensus PAB-dependent poly(A) ribonuclease, subu 98.39
KOG4714319 consensus Nucleoporin [Nuclear structure] 98.38
PF0040039 WD40: WD domain, G-beta repeat; InterPro: IPR01978 98.38
PF14583386 Pectate_lyase22: Oligogalacturonate lyase; PDB: 3C 98.32
KOG1645463 consensus RING-finger-containing E3 ubiquitin liga 98.27
cd00216488 PQQ_DH Dehydrogenases with pyrrolo-quinoline quino 98.21
smart0066858 CTLH C-terminal to LisH motif. Alpha-helical motif 98.2
KOG2695425 consensus WD40 repeat protein [General function pr 98.19
KOG2066 846 consensus Vacuolar assembly/sorting protein VPS41 98.13
PRK13616591 lipoprotein LpqB; Provisional 98.12
KOG2114 933 consensus Vacuolar assembly/sorting protein PEP5/V 98.11
KOG1275 1118 consensus PAB-dependent poly(A) ribonuclease, subu 98.11
cd00216488 PQQ_DH Dehydrogenases with pyrrolo-quinoline quino 98.1
KOG2066 846 consensus Vacuolar assembly/sorting protein VPS41 98.08
PF11768 545 DUF3312: Protein of unknown function (DUF3312); In 98.06
PF02897414 Peptidase_S9_N: Prolyl oligopeptidase, N-terminal 98.05
COG0823425 TolB Periplasmic component of the Tol biopolymer t 98.04
KOG2114 933 consensus Vacuolar assembly/sorting protein PEP5/V 98.04
PF06977248 SdiA-regulated: SdiA-regulated; InterPro: IPR00972 98.02
TIGR03075527 PQQ_enz_alc_DH PQQ-dependent dehydrogenase, methan 97.98
COG0823425 TolB Periplasmic component of the Tol biopolymer t 97.97
PF04053443 Coatomer_WDAD: Coatomer WD associated region ; Int 97.95
PF11768545 DUF3312: Protein of unknown function (DUF3312); In 97.93
COG3490366 Uncharacterized protein conserved in bacteria [Fun 97.88
KOG2659228 consensus LisH motif-containing protein [Cytoskele 97.86
PF06977248 SdiA-regulated: SdiA-regulated; InterPro: IPR00972 97.84
TIGR03075527 PQQ_enz_alc_DH PQQ-dependent dehydrogenase, methan 97.83
PF04053 443 Coatomer_WDAD: Coatomer WD associated region ; Int 97.82
KOG3621 726 consensus WD40 repeat-containing protein [General 97.82
COG3391381 Uncharacterized conserved protein [Function unknow 97.82
PF08596395 Lgl_C: Lethal giant larvae(Lgl) like, C-terminal; 97.82
PF02897414 Peptidase_S9_N: Prolyl oligopeptidase, N-terminal 97.81
PF04841410 Vps16_N: Vps16, N-terminal region; InterPro: IPR00 97.8
PF08596395 Lgl_C: Lethal giant larvae(Lgl) like, C-terminal; 97.78
PRK13616591 lipoprotein LpqB; Provisional 97.73
COG3391381 Uncharacterized conserved protein [Function unknow 97.62
COG3490366 Uncharacterized protein conserved in bacteria [Fun 97.57
PF00780275 CNH: CNH domain; InterPro: IPR001180 Based on sequ 97.53
PF04841410 Vps16_N: Vps16, N-terminal region; InterPro: IPR00 97.52
PF00780275 CNH: CNH domain; InterPro: IPR001180 Based on sequ 97.51
COG3386307 Gluconolactonase [Carbohydrate transport and metab 97.49
KOG1008783 consensus Uncharacterized conserved protein, conta 97.44
KOG1008 783 consensus Uncharacterized conserved protein, conta 97.42
COG3386307 Gluconolactonase [Carbohydrate transport and metab 97.4
PF08553794 VID27: VID27 cytoplasmic protein; InterPro: IPR013 97.38
PF08553794 VID27: VID27 cytoplasmic protein; InterPro: IPR013 97.36
TIGR03074764 PQQ_membr_DH membrane-bound PQQ-dependent dehydrog 97.29
PF10647253 Gmad1: Lipoprotein LpqB beta-propeller domain; Int 97.22
PRK10115686 protease 2; Provisional 97.22
PF14655415 RAB3GAP2_N: Rab3 GTPase-activating protein regulat 97.21
PF14655415 RAB3GAP2_N: Rab3 GTPase-activating protein regulat 97.18
PRK10115686 protease 2; Provisional 97.18
PF14870302 PSII_BNR: Photosynthesis system II assembly factor 97.05
PF03178321 CPSF_A: CPSF A subunit region; InterPro: IPR004871 97.05
PF03178321 CPSF_A: CPSF A subunit region; InterPro: IPR004871 97.04
KOG4640665 consensus Anaphase-promoting complex (APC), subuni 97.03
PF10647253 Gmad1: Lipoprotein LpqB beta-propeller domain; Int 96.99
KOG2395644 consensus Protein involved in vacuole import and d 96.98
KOG0396389 consensus Uncharacterized conserved protein [Funct 96.96
PF05096264 Glu_cyclase_2: Glutamine cyclotransferase; InterPr 96.94
smart0032040 WD40 WD40 repeats. Note that these repeats are per 96.89
PHA02713557 hypothetical protein; Provisional 96.87
KOG4640 665 consensus Anaphase-promoting complex (APC), subuni 96.85
PF07995331 GSDH: Glucose / Sorbosone dehydrogenase; InterPro: 96.82
PF14783111 BBS2_Mid: Ciliary BBSome complex subunit 2, middle 96.81
PRK13684334 Ycf48-like protein; Provisional 96.76
KOG2395644 consensus Protein involved in vacuole import and d 96.76
smart0032040 WD40 WD40 repeats. Note that these repeats are per 96.71
PF07995331 GSDH: Glucose / Sorbosone dehydrogenase; InterPro: 96.68
PF14783111 BBS2_Mid: Ciliary BBSome complex subunit 2, middle 96.48
PF14870302 PSII_BNR: Photosynthesis system II assembly factor 96.47
PF14727418 PHTB1_N: PTHB1 N-terminus 96.45
KOG2079 1206 consensus Vacuolar assembly/sorting protein VPS8 [ 96.42
PHA02713557 hypothetical protein; Provisional 96.3
KOG4441571 consensus Proteins containing BTB/POZ and Kelch do 96.22
KOG4441571 consensus Proteins containing BTB/POZ and Kelch do 96.21
COG3204316 Uncharacterized protein conserved in bacteria [Fun 96.19
KOG2079 1206 consensus Vacuolar assembly/sorting protein VPS8 [ 96.18
PF15390 671 DUF4613: Domain of unknown function (DUF4613) 96.12
COG3204316 Uncharacterized protein conserved in bacteria [Fun 96.06
PF05694461 SBP56: 56kDa selenium binding protein (SBP56); Int 96.06
PF05694461 SBP56: 56kDa selenium binding protein (SBP56); Int 95.93
KOG4499310 consensus Ca2+-binding protein Regucalcin/SMP30 [I 95.78
PF05096264 Glu_cyclase_2: Glutamine cyclotransferase; InterPr 95.71
PF1289447 Apc4_WD40: Anaphase-promoting complex subunit 4 WD 95.61
PRK13684334 Ycf48-like protein; Provisional 95.5
PF15390 671 DUF4613: Domain of unknown function (DUF4613) 95.43
TIGR03074764 PQQ_membr_DH membrane-bound PQQ-dependent dehydrog 95.39
PF1289447 Apc4_WD40: Anaphase-promoting complex subunit 4 WD 95.39
KOG4499310 consensus Ca2+-binding protein Regucalcin/SMP30 [I 95.18
KOG2444238 consensus WD40 repeat protein [General function pr 95.15
PF12234 631 Rav1p_C: RAVE protein 1 C terminal; InterPro: IPR0 94.85
TIGR02604367 Piru_Ver_Nterm putative membrane-bound dehydrogena 94.81
COG4257353 Vgb Streptogramin lyase [Defense mechanisms] 94.59
PHA03098534 kelch-like protein; Provisional 94.57
PHA03098534 kelch-like protein; Provisional 94.48
PF14727418 PHTB1_N: PTHB1 N-terminus 94.28
PF03022287 MRJP: Major royal jelly protein; InterPro: IPR0035 94.26
KOG18981205 consensus Splicing factor 3b, subunit 3 [RNA proce 94.25
PF12234631 Rav1p_C: RAVE protein 1 C terminal; InterPro: IPR0 94.18
KOG2280 829 consensus Vacuolar assembly/sorting protein VPS16 94.14
COG1520370 FOG: WD40-like repeat [Function unknown] 94.11
PF10168717 Nup88: Nuclear pore component; InterPro: IPR019321 94.05
KOG2444238 consensus WD40 repeat protein [General function pr 94.03
PF11725 1774 AvrE: Pathogenicity factor; InterPro: IPR021085 Th 93.99
PF10168 717 Nup88: Nuclear pore component; InterPro: IPR019321 93.89
PF14761215 HPS3_N: Hermansky-Pudlak syndrome 3 93.89
TIGR03118336 PEPCTERM_chp_1 conserved hypothetical protein TIGR 93.86
PHA02790480 Kelch-like protein; Provisional 93.85
KOG1898 1205 consensus Splicing factor 3b, subunit 3 [RNA proce 93.85
PLN00033398 photosystem II stability/assembly factor; Provisio 93.72
COG4257353 Vgb Streptogramin lyase [Defense mechanisms] 93.65
PF14761215 HPS3_N: Hermansky-Pudlak syndrome 3 93.61
KOG3630 1405 consensus Nuclear pore complex, Nup214/CAN compone 93.53
COG3823262 Glutamine cyclotransferase [Posttranslational modi 93.51
COG5276370 Uncharacterized conserved protein [Function unknow 93.34
TIGR02604367 Piru_Ver_Nterm putative membrane-bound dehydrogena 93.33
KOG2377 657 consensus Uncharacterized conserved protein [Funct 93.15
PF10214 765 Rrn6: RNA polymerase I-specific transcription-init 93.08
KOG1900 1311 consensus Nuclear pore complex, Nup155 component ( 93.07
COG4590 733 ABC-type uncharacterized transport system, permeas 92.98
TIGR03118336 PEPCTERM_chp_1 conserved hypothetical protein TIGR 92.96
KOG1916 1283 consensus Nuclear protein, contains WD40 repeats [ 92.81
PHA02790480 Kelch-like protein; Provisional 92.09
COG3292671 Predicted periplasmic ligand-binding sensor domain 91.95
TIGR03606454 non_repeat_PQQ dehydrogenase, PQQ-dependent, s-GDH 91.91
PF08728 717 CRT10: CRT10; InterPro: IPR014839 CRT10 is a trans 91.78
KOG2280829 consensus Vacuolar assembly/sorting protein VPS16 91.72
PF1031343 DUF2415: Uncharacterised protein domain (DUF2415); 91.64
PLN00033398 photosystem II stability/assembly factor; Provisio 91.62
KOG2377657 consensus Uncharacterized conserved protein [Funct 91.45
TIGR03548323 mutarot_permut cyclically-permuted mutatrotase fam 91.23
KOG1916 1283 consensus Nuclear protein, contains WD40 repeats [ 91.09
PF13449326 Phytase-like: Esterase-like activity of phytase 90.95
KOG3630 1405 consensus Nuclear pore complex, Nup214/CAN compone 90.83
PF0767639 PD40: WD40-like Beta Propeller Repeat; InterPro: I 90.69
PF03022287 MRJP: Major royal jelly protein; InterPro: IPR0035 90.41
COG1520370 FOG: WD40-like repeat [Function unknown] 89.93
PF10433504 MMS1_N: Mono-functional DNA-alkylating methyl meth 89.74
PRK14131376 N-acetylneuraminic acid mutarotase; Provisional 89.61
COG3823262 Glutamine cyclotransferase [Posttranslational modi 89.53
TIGR03548323 mutarot_permut cyclically-permuted mutatrotase fam 89.46
PF1031343 DUF2415: Uncharacterised protein domain (DUF2415); 89.36
KOG1900 1311 consensus Nuclear pore complex, Nup155 component ( 89.35
PF14781136 BBS2_N: Ciliary BBSome complex subunit 2, N-termin 89.23
KOG1983 993 consensus Tomosyn and related SNARE-interacting pr 88.84
KOG2817394 consensus Predicted E3 ubiquitin ligase [Posttrans 88.68
PF13449326 Phytase-like: Esterase-like activity of phytase 88.56
COG5167776 VID27 Protein involved in vacuole import and degra 88.49
KOG4460 741 consensus Nuclear pore complex, Nup88/rNup84 compo 87.89
PLN02193470 nitrile-specifier protein 87.62
PLN02193470 nitrile-specifier protein 87.52
KOG2247 615 consensus WD40 repeat-containing protein [General 87.4
PF07569219 Hira: TUP1-like enhancer of split; InterPro: IPR01 87.39
PF12657173 TFIIIC_delta: Transcription factor IIIC subunit de 87.2
KOG4659 1899 consensus Uncharacterized conserved protein (Rhs f 86.94
PF11725 1774 AvrE: Pathogenicity factor; InterPro: IPR021085 Th 86.94
TIGR03606 454 non_repeat_PQQ dehydrogenase, PQQ-dependent, s-GDH 86.61
PF07250243 Glyoxal_oxid_N: Glyoxal oxidase N-terminus; InterP 86.56
PRK13613599 lipoprotein LpqB; Provisional 86.45
PF07569219 Hira: TUP1-like enhancer of split; InterPro: IPR01 86.37
PRK13614573 lipoprotein LpqB; Provisional 86.28
COG5276370 Uncharacterized conserved protein [Function unknow 85.68
PRK13615557 lipoprotein LpqB; Provisional 85.6
PLN02153341 epithiospecifier protein 85.38
PLN02153341 epithiospecifier protein 85.33
PF05935477 Arylsulfotrans: Arylsulfotransferase (ASST); Inter 85.16
PF08728717 CRT10: CRT10; InterPro: IPR014839 CRT10 is a trans 84.93
PRK13614573 lipoprotein LpqB; Provisional 84.69
COG4590 733 ABC-type uncharacterized transport system, permeas 84.62
COG3292671 Predicted periplasmic ligand-binding sensor domain 84.24
PF12657173 TFIIIC_delta: Transcription factor IIIC subunit de 83.91
KOG1983 993 consensus Tomosyn and related SNARE-interacting pr 83.58
>KOG0293 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
Probab=100.00  E-value=9.9e-72  Score=549.15  Aligned_cols=472  Identities=21%  Similarity=0.297  Sum_probs=401.5

Q ss_pred             CccccccCcccc---HHHHHHHhhCCChHHHHHhhccCCCCCCcccceeEEEeeeehhhhhhcCCcchHHHHHHHHhhcc
Q 001490            2 HRLERESRFYFD---MKFFEDMILDGKWEDVEQYLSSFTKVDDNRYSTKIYFEIRKQNFFEALDGHDIAKALNILKKDLK   78 (1068)
Q Consensus         2 ~~le~esg~~~~---~~~~~~~il~G~w~~~~~~l~~~~~~~~~~~~~~~~f~i~~q~~lE~l~~~~~~~A~~~L~~~l~   78 (1068)
                      .+||.|||+.++   ++.|.++||+|+|+.++..+..+...++...+ ++.||+.||+|||+|..|....|+.+||++..
T Consensus        38 ~~lE~es~ll~~tat~klf~q~vlqg~w~q~v~~~~~i~~~de~~~~-ea~fLv~kQ~fLEf~k~~~is~al~~l~~~~~  116 (519)
T KOG0293|consen   38 PLLEWESGLLIPTATTKLFDQQVLQGQWDQQVMSLVRISFEDERNRK-EAMFLVNKQIFLEFLKTGSISHALPVLRNPVL  116 (519)
T ss_pred             hhhHHhhCcccccchHHHHHHHHHcccHHHHHHHHhhccCcchhhhH-HHHHHHHHHHHHHHHhhccHhhhhHhhhcchh
Confidence            469999999984   99999999999999999999988766666544 48999999999999999999999999999999


Q ss_pred             ccCCCCHHHHHHHHhhhcccCccChhhhhhhcCChHHHHHHHHHHHHhhhccCccccccccCCCcchhHHHHHHHhhccc
Q 001490           79 DFAPGNEELFKELAQLLTLDDIRDHELLSKYYGDALSARKNMMLELKQIIEANPILQGKLKFPSIKRQRLRRLINQSLNW  158 (1068)
Q Consensus        79 p~~~~~~~~~~~l~~ll~~~~~~~~~~~~~~~~~~~~~r~~l~~~l~~~~~~~~~~~~~~~~~~~p~~rL~~ll~qa~~~  158 (1068)
                      +| .++.+++|+|+.-|..++...+.+... .......|.+|+++|+++|||++|         ||++||++||+||+.|
T Consensus       117 ~l-r~~~kk~~el~~sll~sn~~~~ne~~~-~~~~~n~R~~ll~elskyi~p~il---------lP~rRLehLl~qAv~~  185 (519)
T KOG0293|consen  117 YL-RKNKKKFHELASSLLVSNDQFSNEENT-TAQLNNERDKLLDELSKYIPPNIL---------LPKRRLEHLLEQAVKY  185 (519)
T ss_pred             hh-hhhHHHHHHHHHHHhccccccccccch-hhhhchhHHHHHHHHHhhCCHhhc---------CChHHHHHHHHHHHHH
Confidence            99 679999999998777765332222221 123367899999999999999999         9999999999999999


Q ss_pred             chhcccCCCCCCCCCcceeecccCCCCCCccCCCCCCCCCCCCCCCCCCcccccCCcccccccccccccCCCCCCccccc
Q 001490          159 QHVHCANPQPNPDINTLFVDHVCQLQETDFSGQSSESNALPPQTTQSPSSWNFSSSMLTDSAVSFVALSLSDPTNKAVTM  238 (1068)
Q Consensus       159 Q~~~c~~~~~~~~~~sl~~d~~c~~~~~~~~~~~~~~~~~p~~~~~~~~~~~~~~s~~~~~~~~~~~~~~~~~~~~~~~~  238 (1068)
                      |+++|+||| +.+..|||.||.|++      .|+      |+++.|                                  
T Consensus       186 Q~d~cvyhn-sldsvsll~Dh~c~~------~qi------p~qt~q----------------------------------  218 (519)
T KOG0293|consen  186 QRDSCVYHN-SLDSVSLLSDHFCGR------LQI------PSQTWQ----------------------------------  218 (519)
T ss_pred             HHhHhHHhc-ccchhhhhhhcccCc------ccC------Cchhhh----------------------------------
Confidence            999999999 777789999999998      663      666654                                  


Q ss_pred             cCCCCCCCCcCCccccccCCCCceeeecCccCCCCCccCCCCccccccccccCCCccCCCccceeeecccCCCCceEEEE
Q 001490          239 DRPEDSDILSEKSPVRILNEQASTVTYPGVSLKNIPDYSPKSSLKKEMFQSFGETSFSDFPKTVAQTLIEGSSSPMSMDF  318 (1068)
Q Consensus       239 ~~~~~~~~~~~~~~~r~~~~~~~~~~~p~~~~~s~~~fsP~~s~~~~~~~~~~~~~~~~~p~~~~~~l~~h~~~V~~v~~  318 (1068)
                                                                                        +|..|+++||.+.|
T Consensus       219 ------------------------------------------------------------------il~~htdEVWfl~F  232 (519)
T KOG0293|consen  219 ------------------------------------------------------------------ILQDHTDEVWFLQF  232 (519)
T ss_pred             ------------------------------------------------------------------hHhhCCCcEEEEEE
Confidence                                                                              46889999999999


Q ss_pred             cCCCCeEEEEEcCcCcEEEEecCCCcceeeeeeeeeeccccccceeeeeecCCCcceEEEEECCCCCEEEEEeCCcEEEE
Q 001490          319 HPVQHTLLLVGTNVGDTGLWDVNSGQKLFIRNFKVWDIGACSMLFKTALVRDPGVSVNRVVWSPDGSLLGVAYSKHIVQL  398 (1068)
Q Consensus       319 spdg~~lla~gs~dg~v~iwd~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~h~~~V~~~~~spdg~~las~~~d~~i~v  398 (1068)
                      |++|+ +||+++.|.+..||++.....+.-                ...+.+|..+|..+.||||.+||++|+.+..+.+
T Consensus       233 S~nGk-yLAsaSkD~Taiiw~v~~d~~~kl----------------~~tlvgh~~~V~yi~wSPDdryLlaCg~~e~~~l  295 (519)
T KOG0293|consen  233 SHNGK-YLASASKDSTAIIWIVVYDVHFKL----------------KKTLVGHSQPVSYIMWSPDDRYLLACGFDEVLSL  295 (519)
T ss_pred             cCCCe-eEeeccCCceEEEEEEecCcceee----------------eeeeecccCceEEEEECCCCCeEEecCchHheee
Confidence            99998 679999999999999865444221                1128899999999999999999999999999999


Q ss_pred             EEccCCCcccceEEEccccccEEEEEEcCCCCcEEEEEEeCCCcEEEEECCCCceeeEeccCC-CcEEEEeeeecCCccE
Q 001490          399 YAYHGGSDARQQLEIDAHVGNVNDLAFSAPCKQISVITCGDDKTIKVWDAVTGSRTYSFEGHG-APVYSLCPHAKENIHF  477 (1068)
Q Consensus       399 wd~~~~~~~~~~~~~~~h~~~v~~l~~s~d~~~~~l~s~~~d~~i~iwd~~~~~~~~~~~~h~-~~v~~i~~~~~~~~~~  477 (1068)
                      ||+.+|.......  .+|...+.+++|.|||.  .+++|+.|++|..||+. |..+..+++-. ..|.++++.+  ||++
T Consensus       296 wDv~tgd~~~~y~--~~~~~S~~sc~W~pDg~--~~V~Gs~dr~i~~wdlD-gn~~~~W~gvr~~~v~dlait~--Dgk~  368 (519)
T KOG0293|consen  296 WDVDTGDLRHLYP--SGLGFSVSSCAWCPDGF--RFVTGSPDRTIIMWDLD-GNILGNWEGVRDPKVHDLAITY--DGKY  368 (519)
T ss_pred             ccCCcchhhhhcc--cCcCCCcceeEEccCCc--eeEecCCCCcEEEecCC-cchhhcccccccceeEEEEEcC--CCcE
Confidence            9999998765332  24668999999999999  79999999999999964 55566665543 5688888855  8899


Q ss_pred             EEEEEcCCcEEEEeCCCCCceEEecCCCCcEEEEEEccCCCEEEEEeeCCCCceeEEEEeCCCCeeeeEEeccccccCCe
Q 001490          478 IFSISVDGKIKAWLYDSLGARVDYDAPGLGCTRMAYSANGRRLFSCGTSKEGESFLVEWNESEGAIKRTYQGLQLQHNSV  557 (1068)
Q Consensus       478 l~s~s~dg~i~vwd~~~~~~~~~~~~~~~~i~~~~~s~d~~~l~~~~~~~~~~~~i~~wd~~~~~~~~~~~~~~~~~~~v  557 (1068)
                      +++.+.|..|++++..+..... +.....+|++++.|.|++++++.-.    +..+.+||++....++++.||.+....|
T Consensus       369 vl~v~~d~~i~l~~~e~~~dr~-lise~~~its~~iS~d~k~~LvnL~----~qei~LWDl~e~~lv~kY~Ghkq~~fiI  443 (519)
T KOG0293|consen  369 VLLVTVDKKIRLYNREARVDRG-LISEEQPITSFSISKDGKLALVNLQ----DQEIHLWDLEENKLVRKYFGHKQGHFII  443 (519)
T ss_pred             EEEEecccceeeechhhhhhhc-cccccCceeEEEEcCCCcEEEEEcc----cCeeEEeecchhhHHHHhhcccccceEE
Confidence            9999999999999988766554 3344568999999999999988765    4459999999999999999999666667


Q ss_pred             EEEEEecCCCEEEEEECCCeEEEEEcCCCeEEEEEeCCCCCCCCceEEEec-CCCEEEEEECCCeEEEEECCC
Q 001490          558 SVVHFDTAKDQILAAGDDHVIKIWDMNKVQLLTTIDAGGGLPENPRICFNK-NGTLLAVIANENRIKILETPE  629 (1068)
Q Consensus       558 ~~~~~~~~~~~l~~~s~dg~i~iwd~~~~~~~~~~~~~~~~~~v~~v~~s~-~~~~l~~~~~dg~i~iwd~~~  629 (1068)
                      .++.-..+..++++||+|+.|+||+..+|+++..+.+|..  .|++|+|+| +..++|++++||+|+||-...
T Consensus       444 rSCFgg~~~~fiaSGSED~kvyIWhr~sgkll~~LsGHs~--~vNcVswNP~~p~m~ASasDDgtIRIWg~~~  514 (519)
T KOG0293|consen  444 RSCFGGGNDKFIASGSEDSKVYIWHRISGKLLAVLSGHSK--TVNCVSWNPADPEMFASASDDGTIRIWGPSD  514 (519)
T ss_pred             EeccCCCCcceEEecCCCceEEEEEccCCceeEeecCCcc--eeeEEecCCCCHHHhhccCCCCeEEEecCCc
Confidence            7766666778999999999999999999999999998865  599999999 677899999999999998663



>KOG0319 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification] Back     alignment and domain information
>KOG0319 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification] Back     alignment and domain information
>KOG0318 consensus WD40 repeat stress protein/actin interacting protein [Cytoskeleton] Back     alignment and domain information
>KOG0318 consensus WD40 repeat stress protein/actin interacting protein [Cytoskeleton] Back     alignment and domain information
>KOG0291 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification] Back     alignment and domain information
>KOG0291 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification] Back     alignment and domain information
>KOG0275 consensus Conserved WD40 repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG0306 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification] Back     alignment and domain information
>KOG0306 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification] Back     alignment and domain information
>KOG0271 consensus Notchless-like WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0271 consensus Notchless-like WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG1408 consensus WD40 repeat protein [Function unknown] Back     alignment and domain information
>KOG1408 consensus WD40 repeat protein [Function unknown] Back     alignment and domain information
>KOG0272 consensus U4/U6 small nuclear ribonucleoprotein Prp4 (contains WD40 repeats) [RNA processing and modification] Back     alignment and domain information
>KOG1063 consensus RNA polymerase II elongator complex, subunit ELP2, WD repeat superfamily [Chromatin structure and dynamics; Transcription] Back     alignment and domain information
>KOG1539 consensus WD repeat protein [General function prediction only] Back     alignment and domain information
>KOG0279 consensus G protein beta subunit-like protein [Signal transduction mechanisms] Back     alignment and domain information
>KOG0272 consensus U4/U6 small nuclear ribonucleoprotein Prp4 (contains WD40 repeats) [RNA processing and modification] Back     alignment and domain information
>KOG1063 consensus RNA polymerase II elongator complex, subunit ELP2, WD repeat superfamily [Chromatin structure and dynamics; Transcription] Back     alignment and domain information
>KOG0286 consensus G-protein beta subunit [General function prediction only] Back     alignment and domain information
>KOG0276 consensus Vesicle coat complex COPI, beta' subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1539 consensus WD repeat protein [General function prediction only] Back     alignment and domain information
>KOG0286 consensus G-protein beta subunit [General function prediction only] Back     alignment and domain information
>KOG0315 consensus G-protein beta subunit-like protein (contains WD40 repeats) [General function prediction only] Back     alignment and domain information
>KOG0279 consensus G protein beta subunit-like protein [Signal transduction mechanisms] Back     alignment and domain information
>KOG0276 consensus Vesicle coat complex COPI, beta' subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0292 consensus Vesicle coat complex COPI, alpha subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0273 consensus Beta-transducin family (WD-40 repeat) protein [Chromatin structure and dynamics] Back     alignment and domain information
>KOG0295 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG2106 consensus Uncharacterized conserved protein, contains HELP and WD40 domains [Function unknown] Back     alignment and domain information
>KOG0296 consensus Angio-associated migratory cell protein (contains WD40 repeats) [Function unknown] Back     alignment and domain information
>KOG0296 consensus Angio-associated migratory cell protein (contains WD40 repeats) [Function unknown] Back     alignment and domain information
>KOG0315 consensus G-protein beta subunit-like protein (contains WD40 repeats) [General function prediction only] Back     alignment and domain information
>KOG0285 consensus Pleiotropic regulator 1 [RNA processing and modification] Back     alignment and domain information
>KOG2048 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0645 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0292 consensus Vesicle coat complex COPI, alpha subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG2106 consensus Uncharacterized conserved protein, contains HELP and WD40 domains [Function unknown] Back     alignment and domain information
>KOG0273 consensus Beta-transducin family (WD-40 repeat) protein [Chromatin structure and dynamics] Back     alignment and domain information
>KOG0316 consensus Conserved WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0263 consensus Transcription initiation factor TFIID, subunit TAF5 (also component of histone acetyltransferase SAGA) [Transcription] Back     alignment and domain information
>KOG0265 consensus U5 snRNP-specific protein-like factor and related proteins [RNA processing and modification] Back     alignment and domain information
>KOG0293 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0295 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0265 consensus U5 snRNP-specific protein-like factor and related proteins [RNA processing and modification] Back     alignment and domain information
>KOG0266 consensus WD40 repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG0282 consensus mRNA splicing factor [Function unknown] Back     alignment and domain information
>KOG0284 consensus Polyadenylation factor I complex, subunit PFS2 [RNA processing and modification] Back     alignment and domain information
>KOG0285 consensus Pleiotropic regulator 1 [RNA processing and modification] Back     alignment and domain information
>KOG2048 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0645 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0263 consensus Transcription initiation factor TFIID, subunit TAF5 (also component of histone acetyltransferase SAGA) [Transcription] Back     alignment and domain information
>cd00200 WD40 WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and botto Back     alignment and domain information
>KOG0284 consensus Polyadenylation factor I complex, subunit PFS2 [RNA processing and modification] Back     alignment and domain information
>KOG0281 consensus Beta-TrCP (transducin repeats containing)/Slimb proteins [Function unknown] Back     alignment and domain information
>KOG0266 consensus WD40 repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG1445 consensus Tumor-specific antigen (contains WD repeats) [Cytoskeleton] Back     alignment and domain information
>KOG0282 consensus mRNA splicing factor [Function unknown] Back     alignment and domain information
>KOG0640 consensus mRNA cleavage stimulating factor complex; subunit 1 [RNA processing and modification] Back     alignment and domain information
>KOG0278 consensus Serine/threonine kinase receptor-associated protein [Lipid transport and metabolism] Back     alignment and domain information
>KOG0316 consensus Conserved WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0281 consensus Beta-TrCP (transducin repeats containing)/Slimb proteins [Function unknown] Back     alignment and domain information
>PLN00181 protein SPA1-RELATED; Provisional Back     alignment and domain information
>cd00200 WD40 WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and botto Back     alignment and domain information
>KOG0275 consensus Conserved WD40 repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG1407 consensus WD40 repeat protein [Function unknown] Back     alignment and domain information
>KOG0310 consensus Conserved WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>PLN00181 protein SPA1-RELATED; Provisional Back     alignment and domain information
>KOG0641 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0288 consensus WD40 repeat protein TipD [General function prediction only] Back     alignment and domain information
>KOG0973 consensus Histone transcription regulator HIRA, WD repeat superfamily [Cell cycle control, cell division, chromosome partitioning; Transcription] Back     alignment and domain information
>KOG0643 consensus Translation initiation factor 3, subunit i (eIF-3i)/TGF-beta receptor-interacting protein (TRIP-1) [Translation, ribosomal structure and biogenesis; Signal transduction mechanisms] Back     alignment and domain information
>KOG0278 consensus Serine/threonine kinase receptor-associated protein [Lipid transport and metabolism] Back     alignment and domain information
>KOG1446 consensus Histone H3 (Lys4) methyltransferase complex and RNA cleavage factor II complex, subunit SWD2 [RNA processing and modification; Chromatin structure and dynamics; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0643 consensus Translation initiation factor 3, subunit i (eIF-3i)/TGF-beta receptor-interacting protein (TRIP-1) [Translation, ribosomal structure and biogenesis; Signal transduction mechanisms] Back     alignment and domain information
>KOG0283 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0313 consensus Microtubule binding protein YTM1 (contains WD40 repeats) [Cytoskeleton] Back     alignment and domain information
>PTZ00421 coronin; Provisional Back     alignment and domain information
>KOG0973 consensus Histone transcription regulator HIRA, WD repeat superfamily [Cell cycle control, cell division, chromosome partitioning; Transcription] Back     alignment and domain information
>KOG0640 consensus mRNA cleavage stimulating factor complex; subunit 1 [RNA processing and modification] Back     alignment and domain information
>KOG0274 consensus Cdc4 and related F-box and WD-40 proteins [General function prediction only] Back     alignment and domain information
>KOG0310 consensus Conserved WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG1446 consensus Histone H3 (Lys4) methyltransferase complex and RNA cleavage factor II complex, subunit SWD2 [RNA processing and modification; Chromatin structure and dynamics; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0305 consensus Anaphase promoting complex, Cdc20, Cdh1, and Ama1 subunits [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1407 consensus WD40 repeat protein [Function unknown] Back     alignment and domain information
>KOG0772 consensus Uncharacterized conserved protein, contains WD40 repeat [Function unknown] Back     alignment and domain information
>KOG0299 consensus U3 snoRNP-associated protein (contains WD40 repeats) [RNA processing and modification] Back     alignment and domain information
>KOG0283 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0772 consensus Uncharacterized conserved protein, contains WD40 repeat [Function unknown] Back     alignment and domain information
>KOG0300 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>PTZ00420 coronin; Provisional Back     alignment and domain information
>KOG0277 consensus Peroxisomal targeting signal type 2 receptor [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0647 consensus mRNA export protein (contains WD40 repeats) [RNA processing and modification] Back     alignment and domain information
>KOG0313 consensus Microtubule binding protein YTM1 (contains WD40 repeats) [Cytoskeleton] Back     alignment and domain information
>KOG2096 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0288 consensus WD40 repeat protein TipD [General function prediction only] Back     alignment and domain information
>KOG0641 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PTZ00421 coronin; Provisional Back     alignment and domain information
>KOG0294 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0268 consensus Sof1-like rRNA processing protein (contains WD40 repeats) [RNA processing and modification] Back     alignment and domain information
>KOG0308 consensus Conserved WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG1963 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0301 consensus Phospholipase A2-activating protein (contains WD40 repeats) [Lipid transport and metabolism] Back     alignment and domain information
>KOG0299 consensus U3 snoRNP-associated protein (contains WD40 repeats) [RNA processing and modification] Back     alignment and domain information
>KOG0274 consensus Cdc4 and related F-box and WD-40 proteins [General function prediction only] Back     alignment and domain information
>KOG0647 consensus mRNA export protein (contains WD40 repeats) [RNA processing and modification] Back     alignment and domain information
>KOG0308 consensus Conserved WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0289 consensus mRNA splicing factor [General function prediction only] Back     alignment and domain information
>KOG0289 consensus mRNA splicing factor [General function prediction only] Back     alignment and domain information
>KOG0268 consensus Sof1-like rRNA processing protein (contains WD40 repeats) [RNA processing and modification] Back     alignment and domain information
>KOG0305 consensus Anaphase promoting complex, Cdc20, Cdh1, and Ama1 subunits [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0277 consensus Peroxisomal targeting signal type 2 receptor [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG2096 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG1274 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG1445 consensus Tumor-specific antigen (contains WD repeats) [Cytoskeleton] Back     alignment and domain information
>KOG1036 consensus Mitotic spindle checkpoint protein BUB3, WD repeat superfamily [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0294 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>PTZ00420 coronin; Provisional Back     alignment and domain information
>KOG0300 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0639 consensus Transducin-like enhancer of split protein (contains WD40 repeats) [Chromatin structure and dynamics] Back     alignment and domain information
>KOG1332 consensus Vesicle coat complex COPII, subunit SEC13 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1963 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG1274 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0264 consensus Nucleosome remodeling factor, subunit CAF1/NURF55/MSI1 [Chromatin structure and dynamics] Back     alignment and domain information
>KOG0301 consensus Phospholipase A2-activating protein (contains WD40 repeats) [Lipid transport and metabolism] Back     alignment and domain information
>KOG1538 consensus Uncharacterized conserved protein WDR10, contains WD40 repeats [General function prediction only] Back     alignment and domain information
>TIGR03866 PQQ_ABC_repeats PQQ-dependent catabolism-associated beta-propeller protein Back     alignment and domain information
>KOG1273 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>TIGR03866 PQQ_ABC_repeats PQQ-dependent catabolism-associated beta-propeller protein Back     alignment and domain information
>KOG2055 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0646 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG1332 consensus Vesicle coat complex COPII, subunit SEC13 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1036 consensus Mitotic spindle checkpoint protein BUB3, WD repeat superfamily [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0646 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0639 consensus Transducin-like enhancer of split protein (contains WD40 repeats) [Chromatin structure and dynamics] Back     alignment and domain information
>KOG4283 consensus Transcription-coupled repair protein CSA, contains WD40 domain [Transcription; Replication, recombination and repair] Back     alignment and domain information
>KOG2055 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG4328 consensus WD40 protein [Function unknown] Back     alignment and domain information
>KOG0650 consensus WD40 repeat nucleolar protein Bop1, involved in ribosome biogenesis [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG4283 consensus Transcription-coupled repair protein CSA, contains WD40 domain [Transcription; Replication, recombination and repair] Back     alignment and domain information
>KOG1273 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0264 consensus Nucleosome remodeling factor, subunit CAF1/NURF55/MSI1 [Chromatin structure and dynamics] Back     alignment and domain information
>KOG0650 consensus WD40 repeat nucleolar protein Bop1, involved in ribosome biogenesis [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG0267 consensus Microtubule severing protein katanin p80 subunit B (contains WD40 repeats) [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0269 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0321 consensus WD40 repeat-containing protein L2DTL [Function unknown] Back     alignment and domain information
>KOG1538 consensus Uncharacterized conserved protein WDR10, contains WD40 repeats [General function prediction only] Back     alignment and domain information
>KOG0267 consensus Microtubule severing protein katanin p80 subunit B (contains WD40 repeats) [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG1009 consensus Chromatin assembly complex 1 subunit B/CAC2 (contains WD40 repeats) [Chromatin structure and dynamics; Replication, recombination and repair] Back     alignment and domain information
>KOG1034 consensus Transcriptional repressor EED/ESC/FIE, required for transcriptional silencing, WD repeat superfamily [Transcription] Back     alignment and domain information
>KOG0321 consensus WD40 repeat-containing protein L2DTL [Function unknown] Back     alignment and domain information
>KOG2445 consensus Nuclear pore complex component (sc Seh1) [Nuclear structure; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0270 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0269 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG2445 consensus Nuclear pore complex component (sc Seh1) [Nuclear structure; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>COG2319 FOG: WD40 repeat [General function prediction only] Back     alignment and domain information
>COG2319 FOG: WD40 repeat [General function prediction only] Back     alignment and domain information
>KOG1034 consensus Transcriptional repressor EED/ESC/FIE, required for transcriptional silencing, WD repeat superfamily [Transcription] Back     alignment and domain information
>KOG1912 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG4497 consensus Uncharacterized conserved protein WDR8, contains WD repeats [General function prediction only] Back     alignment and domain information
>KOG4328 consensus WD40 protein [Function unknown] Back     alignment and domain information
>KOG0307 consensus Vesicle coat complex COPII, subunit SEC31 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG4378 consensus Nuclear protein COP1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG4378 consensus Nuclear protein COP1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG1009 consensus Chromatin assembly complex 1 subunit B/CAC2 (contains WD40 repeats) [Chromatin structure and dynamics; Replication, recombination and repair] Back     alignment and domain information
>KOG2919 consensus Guanine nucleotide-binding protein [General function prediction only] Back     alignment and domain information
>KOG0302 consensus Ribosome Assembly protein [General function prediction only] Back     alignment and domain information
>KOG1524 consensus WD40 repeat-containing protein CHE-2 [General function prediction only] Back     alignment and domain information
>KOG4497 consensus Uncharacterized conserved protein WDR8, contains WD repeats [General function prediction only] Back     alignment and domain information
>KOG0303 consensus Actin-binding protein Coronin, contains WD40 repeats [Cytoskeleton] Back     alignment and domain information
>KOG1912 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG2919 consensus Guanine nucleotide-binding protein [General function prediction only] Back     alignment and domain information
>KOG0270 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0302 consensus Ribosome Assembly protein [General function prediction only] Back     alignment and domain information
>KOG0644 consensus Uncharacterized conserved protein, contains WD40 repeat and BROMO domains [General function prediction only] Back     alignment and domain information
>KOG1524 consensus WD40 repeat-containing protein CHE-2 [General function prediction only] Back     alignment and domain information
>KOG0642 consensus Cell-cycle nuclear protein, contains WD-40 repeats [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG1334 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0307 consensus Vesicle coat complex COPII, subunit SEC31 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0303 consensus Actin-binding protein Coronin, contains WD40 repeats [Cytoskeleton] Back     alignment and domain information
>KOG4227 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0322 consensus G-protein beta subunit-like protein GNB1L, contains WD repeats [General function prediction only] Back     alignment and domain information
>KOG0644 consensus Uncharacterized conserved protein, contains WD40 repeat and BROMO domains [General function prediction only] Back     alignment and domain information
>KOG0649 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG1007 consensus WD repeat protein TSSC1, WD repeat superfamily [Function unknown] Back     alignment and domain information
>KOG0649 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PRK11028 6-phosphogluconolactonase; Provisional Back     alignment and domain information
>KOG2110 consensus Uncharacterized conserved protein, contains WD40 repeats [Function unknown] Back     alignment and domain information
>KOG1188 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG2110 consensus Uncharacterized conserved protein, contains WD40 repeats [Function unknown] Back     alignment and domain information
>KOG1310 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG1188 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0322 consensus G-protein beta subunit-like protein GNB1L, contains WD repeats [General function prediction only] Back     alignment and domain information
>PRK11028 6-phosphogluconolactonase; Provisional Back     alignment and domain information
>KOG0642 consensus Cell-cycle nuclear protein, contains WD-40 repeats [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG1007 consensus WD repeat protein TSSC1, WD repeat superfamily [Function unknown] Back     alignment and domain information
>KOG4227 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0290 consensus Conserved WD40 repeat-containing protein AN11 [Function unknown] Back     alignment and domain information
>KOG0771 consensus Prolactin regulatory element-binding protein/Protein transport protein SEC12p [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>COG4946 Uncharacterized protein related to the periplasmic component of the Tol biopolymer transport system [Function unknown] Back     alignment and domain information
>PRK01742 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PF02239 Cytochrom_D1: Cytochrome D1 heme domain; PDB: 1NNO_B 1HZU_A 1N15_B 1N50_A 1GJQ_A 1BL9_B 1NIR_B 1N90_B 1HZV_A 1AOQ_A Back     alignment and domain information
>PF02239 Cytochrom_D1: Cytochrome D1 heme domain; PDB: 1NNO_B 1HZU_A 1N15_B 1N50_A 1GJQ_A 1BL9_B 1NIR_B 1N90_B 1HZV_A 1AOQ_A Back     alignment and domain information
>KOG1517 consensus Guanine nucleotide binding protein MIP1 [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0771 consensus Prolactin regulatory element-binding protein/Protein transport protein SEC12p [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1587 consensus Cytoplasmic dynein intermediate chain [Cytoskeleton] Back     alignment and domain information
>KOG1240 consensus Protein kinase containing WD40 repeats [Signal transduction mechanisms] Back     alignment and domain information
>KOG0290 consensus Conserved WD40 repeat-containing protein AN11 [Function unknown] Back     alignment and domain information
>KOG2394 consensus WD40 protein DMR-N9 [General function prediction only] Back     alignment and domain information
>KOG1523 consensus Actin-related protein Arp2/3 complex, subunit ARPC1/p41-ARC [Cytoskeleton] Back     alignment and domain information
>KOG1517 consensus Guanine nucleotide binding protein MIP1 [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0974 consensus WD-repeat protein WDR6, WD repeat superfamily [General function prediction only] Back     alignment and domain information
>PRK01742 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG1334 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG1587 consensus Cytoplasmic dynein intermediate chain [Cytoskeleton] Back     alignment and domain information
>KOG0974 consensus WD-repeat protein WDR6, WD repeat superfamily [General function prediction only] Back     alignment and domain information
>KOG2139 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG2111 consensus Uncharacterized conserved protein, contains WD40 repeats [Function unknown] Back     alignment and domain information
>KOG1240 consensus Protein kinase containing WD40 repeats [Signal transduction mechanisms] Back     alignment and domain information
>PF04762 IKI3: IKI3 family; InterPro: IPR006849 Members of this family are components of the elongator multi-subunit component of a novel RNA polymerase II holoenzyme for transcriptional elongation [] Back     alignment and domain information
>COG4946 Uncharacterized protein related to the periplasmic component of the Tol biopolymer transport system [Function unknown] Back     alignment and domain information
>KOG2139 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PRK03629 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG1310 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PRK05137 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG2111 consensus Uncharacterized conserved protein, contains WD40 repeats [Function unknown] Back     alignment and domain information
>KOG1832 consensus HIV-1 Vpr-binding protein [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PRK03629 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG2321 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG1523 consensus Actin-related protein Arp2/3 complex, subunit ARPC1/p41-ARC [Cytoskeleton] Back     alignment and domain information
>KOG2041 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG1272 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification] Back     alignment and domain information
>PRK04922 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG1272 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification] Back     alignment and domain information
>PRK04922 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG2315 consensus Predicted translation initiation factor related to eIF-3a [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK02889 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK02889 tolB translocation protein TolB; Provisional Back     alignment and domain information
>COG5354 Uncharacterized protein, contains Trp-Asp (WD) repeat [General function prediction only] Back     alignment and domain information
>PF10282 Lactonase: Lactonase, 7-bladed beta-propeller; InterPro: IPR019405 6-phosphogluconolactonases (6PGL) 3 Back     alignment and domain information
>KOG2394 consensus WD40 protein DMR-N9 [General function prediction only] Back     alignment and domain information
>KOG3881 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2041 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG2315 consensus Predicted translation initiation factor related to eIF-3a [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PF04762 IKI3: IKI3 family; InterPro: IPR006849 Members of this family are components of the elongator multi-subunit component of a novel RNA polymerase II holoenzyme for transcriptional elongation [] Back     alignment and domain information
>PRK05137 tolB translocation protein TolB; Provisional Back     alignment and domain information
>TIGR02658 TTQ_MADH_Hv methylamine dehydrogenase heavy chain Back     alignment and domain information
>COG5354 Uncharacterized protein, contains Trp-Asp (WD) repeat [General function prediction only] Back     alignment and domain information
>COG2706 3-carboxymuconate cyclase [Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG2314 consensus Translation initiation factor 3, subunit b (eIF-3b) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG2321 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>TIGR02658 TTQ_MADH_Hv methylamine dehydrogenase heavy chain Back     alignment and domain information
>PRK01029 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG1409 consensus Uncharacterized conserved protein, contains WD40 repeats and FYVE domains [Function unknown] Back     alignment and domain information
>PF10282 Lactonase: Lactonase, 7-bladed beta-propeller; InterPro: IPR019405 6-phosphogluconolactonases (6PGL) 3 Back     alignment and domain information
>PRK01029 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK00178 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK04792 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK04792 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK00178 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PF08662 eIF2A: Eukaryotic translation initiation factor eIF2A; InterPro: IPR013979 This entry contains beta propellor domains found in eukaryotic translation initiation factors and TolB domain-containing proteins Back     alignment and domain information
>KOG1354 consensus Serine/threonine protein phosphatase 2A, regulatory subunit [Signal transduction mechanisms] Back     alignment and domain information
>COG2706 3-carboxymuconate cyclase [Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG2314 consensus Translation initiation factor 3, subunit b (eIF-3b) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>TIGR02800 propeller_TolB tol-pal system beta propeller repeat protein TolB Back     alignment and domain information
>TIGR02800 propeller_TolB tol-pal system beta propeller repeat protein TolB Back     alignment and domain information
>KOG1354 consensus Serine/threonine protein phosphatase 2A, regulatory subunit [Signal transduction mechanisms] Back     alignment and domain information
>KOG3881 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF08662 eIF2A: Eukaryotic translation initiation factor eIF2A; InterPro: IPR013979 This entry contains beta propellor domains found in eukaryotic translation initiation factors and TolB domain-containing proteins Back     alignment and domain information
>KOG1409 consensus Uncharacterized conserved protein, contains WD40 repeats and FYVE domains [Function unknown] Back     alignment and domain information
>KOG4547 consensus WD40 repeat-containing protein [General function prediction only] Back     alignment and domain information
>TIGR03300 assembly_YfgL outer membrane assembly lipoprotein YfgL Back     alignment and domain information
>TIGR03300 assembly_YfgL outer membrane assembly lipoprotein YfgL Back     alignment and domain information
>KOG4547 consensus WD40 repeat-containing protein [General function prediction only] Back     alignment and domain information
>PLN02919 haloacid dehalogenase-like hydrolase family protein Back     alignment and domain information
>PRK04043 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PLN02919 haloacid dehalogenase-like hydrolase family protein Back     alignment and domain information
>KOG0280 consensus Uncharacterized conserved protein [Amino acid transport and metabolism] Back     alignment and domain information
>KOG1897 consensus Damage-specific DNA binding complex, subunit DDB1 [Replication, recombination and repair] Back     alignment and domain information
>PF15492 Nbas_N: Neuroblastoma-amplified sequence, N terminal Back     alignment and domain information
>KOG3617 consensus WD40 and TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG4190 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1064 consensus RAVE (regulator of V-ATPase assembly) complex subunit RAV1/DMX protein, WD repeat superfamily [General function prediction only] Back     alignment and domain information
>KOG0280 consensus Uncharacterized conserved protein [Amino acid transport and metabolism] Back     alignment and domain information
>PRK11138 outer membrane biogenesis protein BamB; Provisional Back     alignment and domain information
>PRK04043 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG4190 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1064 consensus RAVE (regulator of V-ATPase assembly) complex subunit RAV1/DMX protein, WD repeat superfamily [General function prediction only] Back     alignment and domain information
>KOG1897 consensus Damage-specific DNA binding complex, subunit DDB1 [Replication, recombination and repair] Back     alignment and domain information
>PF07433 DUF1513: Protein of unknown function (DUF1513); InterPro: IPR008311 There are currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function Back     alignment and domain information
>PF07433 DUF1513: Protein of unknown function (DUF1513); InterPro: IPR008311 There are currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function Back     alignment and domain information
>KOG3914 consensus WD repeat protein WDR4 [Function unknown] Back     alignment and domain information
>PRK11138 outer membrane biogenesis protein BamB; Provisional Back     alignment and domain information
>PF15492 Nbas_N: Neuroblastoma-amplified sequence, N terminal Back     alignment and domain information
>KOG3617 consensus WD40 and TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG3914 consensus WD repeat protein WDR4 [Function unknown] Back     alignment and domain information
>PF08450 SGL: SMP-30/Gluconolaconase/LRE-like region; InterPro: IPR013658 This family describes a region that is found in proteins expressed by a variety of eukaryotic and prokaryotic species Back     alignment and domain information
>PF06433 Me-amine-dh_H: Methylamine dehydrogenase heavy chain (MADH); InterPro: IPR009451 Methylamine dehydrogenase (1 Back     alignment and domain information
>PF08450 SGL: SMP-30/Gluconolaconase/LRE-like region; InterPro: IPR013658 This family describes a region that is found in proteins expressed by a variety of eukaryotic and prokaryotic species Back     alignment and domain information
>KOG4532 consensus WD40-like repeat containing protein [General function prediction only] Back     alignment and domain information
>KOG0309 consensus Conserved WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>PF13360 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 3Q54_A 2YH3_A 3PRW_A 3P1L_A 3Q7M_A 3Q7O_A 3Q7N_A Back     alignment and domain information
>KOG1832 consensus HIV-1 Vpr-binding protein [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>COG5170 CDC55 Serine/threonine protein phosphatase 2A, regulatory subunit [Signal transduction mechanisms] Back     alignment and domain information
>PF06433 Me-amine-dh_H: Methylamine dehydrogenase heavy chain (MADH); InterPro: IPR009451 Methylamine dehydrogenase (1 Back     alignment and domain information
>KOG0309 consensus Conserved WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>PF13360 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 3Q54_A 2YH3_A 3PRW_A 3P1L_A 3Q7M_A 3Q7O_A 3Q7N_A Back     alignment and domain information
>COG5170 CDC55 Serine/threonine protein phosphatase 2A, regulatory subunit [Signal transduction mechanisms] Back     alignment and domain information
>PRK02888 nitrous-oxide reductase; Validated Back     alignment and domain information
>KOG4532 consensus WD40-like repeat containing protein [General function prediction only] Back     alignment and domain information
>PF00930 DPPIV_N: Dipeptidyl peptidase IV (DPP IV) N-terminal region; InterPro: IPR002469 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>PRK02888 nitrous-oxide reductase; Validated Back     alignment and domain information
>KOG1920 consensus IkappaB kinase complex, IKAP component [Transcription] Back     alignment and domain information
>KOG4649 consensus PQQ (pyrrolo-quinoline quinone) repeat protein [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>KOG4649 consensus PQQ (pyrrolo-quinoline quinone) repeat protein [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>KOG4714 consensus Nucleoporin [Nuclear structure] Back     alignment and domain information
>KOG0882 consensus Cyclophilin-related peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF00930 DPPIV_N: Dipeptidyl peptidase IV (DPP IV) N-terminal region; InterPro: IPR002469 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>PF10607 CLTH: CTLH/CRA C-terminal to LisH motif domain; InterPro: IPR019589 This entry represents the CRA (or CT11-RanBPM) domain, which is a protein-protein interaction domain present in crown eukaryotes (plants, animals, fungi) and which is found in Ran-binding proteins such as Ran-binding protein 9 (RanBP9 or RanBPM) and RanBP10 Back     alignment and domain information
>KOG1645 consensus RING-finger-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1920 consensus IkappaB kinase complex, IKAP component [Transcription] Back     alignment and domain information
>PF00400 WD40: WD domain, G-beta repeat; InterPro: IPR019781 WD-40 repeats (also known as WD or beta-transducin repeats) are short ~40 amino acid motifs, often terminating in a Trp-Asp (W-D) dipeptide Back     alignment and domain information
>KOG0882 consensus Cyclophilin-related peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2695 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG3621 consensus WD40 repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF14583 Pectate_lyase22: Oligogalacturonate lyase; PDB: 3C5M_C 3PE7_A Back     alignment and domain information
>KOG1275 consensus PAB-dependent poly(A) ribonuclease, subunit PAN2 [Replication, recombination and repair] Back     alignment and domain information
>KOG4714 consensus Nucleoporin [Nuclear structure] Back     alignment and domain information
>PF00400 WD40: WD domain, G-beta repeat; InterPro: IPR019781 WD-40 repeats (also known as WD or beta-transducin repeats) are short ~40 amino acid motifs, often terminating in a Trp-Asp (W-D) dipeptide Back     alignment and domain information
>PF14583 Pectate_lyase22: Oligogalacturonate lyase; PDB: 3C5M_C 3PE7_A Back     alignment and domain information
>KOG1645 consensus RING-finger-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd00216 PQQ_DH Dehydrogenases with pyrrolo-quinoline quinone (PQQ) as cofactor, like ethanol, methanol, and membrane bound glucose dehydrogenases Back     alignment and domain information
>smart00668 CTLH C-terminal to LisH motif Back     alignment and domain information
>KOG2695 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG2066 consensus Vacuolar assembly/sorting protein VPS41 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PRK13616 lipoprotein LpqB; Provisional Back     alignment and domain information
>KOG2114 consensus Vacuolar assembly/sorting protein PEP5/VPS11 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1275 consensus PAB-dependent poly(A) ribonuclease, subunit PAN2 [Replication, recombination and repair] Back     alignment and domain information
>cd00216 PQQ_DH Dehydrogenases with pyrrolo-quinoline quinone (PQQ) as cofactor, like ethanol, methanol, and membrane bound glucose dehydrogenases Back     alignment and domain information
>KOG2066 consensus Vacuolar assembly/sorting protein VPS41 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF11768 DUF3312: Protein of unknown function (DUF3312); InterPro: IPR024511 This is a eukaryotic family of uncharacterised proteins that contain WD40 repeats Back     alignment and domain information
>PF02897 Peptidase_S9_N: Prolyl oligopeptidase, N-terminal beta-propeller domain; InterPro: IPR004106 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>COG0823 TolB Periplasmic component of the Tol biopolymer transport system [Intracellular trafficking and secretion] Back     alignment and domain information
>KOG2114 consensus Vacuolar assembly/sorting protein PEP5/VPS11 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF06977 SdiA-regulated: SdiA-regulated; InterPro: IPR009722 This entry represents a conserved region approximately 100 residues long within a number of hypothetical bacterial proteins that may be regulated by SdiA, a member of the LuxR family of transcriptional regulators [] Back     alignment and domain information
>TIGR03075 PQQ_enz_alc_DH PQQ-dependent dehydrogenase, methanol/ethanol family Back     alignment and domain information
>COG0823 TolB Periplasmic component of the Tol biopolymer transport system [Intracellular trafficking and secretion] Back     alignment and domain information
>PF04053 Coatomer_WDAD: Coatomer WD associated region ; InterPro: IPR006692 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>PF11768 DUF3312: Protein of unknown function (DUF3312); InterPro: IPR024511 This is a eukaryotic family of uncharacterised proteins that contain WD40 repeats Back     alignment and domain information
>COG3490 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>KOG2659 consensus LisH motif-containing protein [Cytoskeleton] Back     alignment and domain information
>PF06977 SdiA-regulated: SdiA-regulated; InterPro: IPR009722 This entry represents a conserved region approximately 100 residues long within a number of hypothetical bacterial proteins that may be regulated by SdiA, a member of the LuxR family of transcriptional regulators [] Back     alignment and domain information
>TIGR03075 PQQ_enz_alc_DH PQQ-dependent dehydrogenase, methanol/ethanol family Back     alignment and domain information
>PF04053 Coatomer_WDAD: Coatomer WD associated region ; InterPro: IPR006692 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>KOG3621 consensus WD40 repeat-containing protein [General function prediction only] Back     alignment and domain information
>COG3391 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF08596 Lgl_C: Lethal giant larvae(Lgl) like, C-terminal; InterPro: IPR013905 The Lethal giant larvae (Lgl) tumour suppressor protein is conserved from yeast to mammals Back     alignment and domain information
>PF02897 Peptidase_S9_N: Prolyl oligopeptidase, N-terminal beta-propeller domain; InterPro: IPR004106 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>PF04841 Vps16_N: Vps16, N-terminal region; InterPro: IPR006926 This protein forms part of the Class C vacuolar protein sorting (Vps) complex Back     alignment and domain information
>PF08596 Lgl_C: Lethal giant larvae(Lgl) like, C-terminal; InterPro: IPR013905 The Lethal giant larvae (Lgl) tumour suppressor protein is conserved from yeast to mammals Back     alignment and domain information
>PRK13616 lipoprotein LpqB; Provisional Back     alignment and domain information
>COG3391 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG3490 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF00780 CNH: CNH domain; InterPro: IPR001180 Based on sequence similarities a domain of homology has been identified in the following proteins []: Citron and Citron kinase Back     alignment and domain information
>PF04841 Vps16_N: Vps16, N-terminal region; InterPro: IPR006926 This protein forms part of the Class C vacuolar protein sorting (Vps) complex Back     alignment and domain information
>PF00780 CNH: CNH domain; InterPro: IPR001180 Based on sequence similarities a domain of homology has been identified in the following proteins []: Citron and Citron kinase Back     alignment and domain information
>COG3386 Gluconolactonase [Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG1008 consensus Uncharacterized conserved protein, contains WD40 repeats [Function unknown] Back     alignment and domain information
>KOG1008 consensus Uncharacterized conserved protein, contains WD40 repeats [Function unknown] Back     alignment and domain information
>COG3386 Gluconolactonase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PF08553 VID27: VID27 cytoplasmic protein; InterPro: IPR013863 This entry represents fungal and plant proteins and contains many hypothetical proteins Back     alignment and domain information
>PF08553 VID27: VID27 cytoplasmic protein; InterPro: IPR013863 This entry represents fungal and plant proteins and contains many hypothetical proteins Back     alignment and domain information
>TIGR03074 PQQ_membr_DH membrane-bound PQQ-dependent dehydrogenase, glucose/quinate/shikimate family Back     alignment and domain information
>PF10647 Gmad1: Lipoprotein LpqB beta-propeller domain; InterPro: IPR018910 The Gmad1 domain is found associated with IPR019606 from INTERPRO, in bacterial spore formation Back     alignment and domain information
>PRK10115 protease 2; Provisional Back     alignment and domain information
>PF14655 RAB3GAP2_N: Rab3 GTPase-activating protein regulatory subunit N-terminus Back     alignment and domain information
>PF14655 RAB3GAP2_N: Rab3 GTPase-activating protein regulatory subunit N-terminus Back     alignment and domain information
>PRK10115 protease 2; Provisional Back     alignment and domain information
>PF14870 PSII_BNR: Photosynthesis system II assembly factor YCF48; PDB: 2XBG_A Back     alignment and domain information
>PF03178 CPSF_A: CPSF A subunit region; InterPro: IPR004871 This family includes a region that lies towards the C terminus of the cleavage and polyadenylation specificity factor (CPSF) A (160 kDa) subunit Back     alignment and domain information
>PF03178 CPSF_A: CPSF A subunit region; InterPro: IPR004871 This family includes a region that lies towards the C terminus of the cleavage and polyadenylation specificity factor (CPSF) A (160 kDa) subunit Back     alignment and domain information
>KOG4640 consensus Anaphase-promoting complex (APC), subunit 4 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF10647 Gmad1: Lipoprotein LpqB beta-propeller domain; InterPro: IPR018910 The Gmad1 domain is found associated with IPR019606 from INTERPRO, in bacterial spore formation Back     alignment and domain information
>KOG2395 consensus Protein involved in vacuole import and degradation [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0396 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF05096 Glu_cyclase_2: Glutamine cyclotransferase; InterPro: IPR007788 This family of enzymes 2 Back     alignment and domain information
>smart00320 WD40 WD40 repeats Back     alignment and domain information
>PHA02713 hypothetical protein; Provisional Back     alignment and domain information
>KOG4640 consensus Anaphase-promoting complex (APC), subunit 4 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF07995 GSDH: Glucose / Sorbosone dehydrogenase; InterPro: IPR012938 Proteins containing this domain are thought to be glucose/sorbosone dehydrogenases Back     alignment and domain information
>PF14783 BBS2_Mid: Ciliary BBSome complex subunit 2, middle region Back     alignment and domain information
>PRK13684 Ycf48-like protein; Provisional Back     alignment and domain information
>KOG2395 consensus Protein involved in vacuole import and degradation [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>smart00320 WD40 WD40 repeats Back     alignment and domain information
>PF07995 GSDH: Glucose / Sorbosone dehydrogenase; InterPro: IPR012938 Proteins containing this domain are thought to be glucose/sorbosone dehydrogenases Back     alignment and domain information
>PF14783 BBS2_Mid: Ciliary BBSome complex subunit 2, middle region Back     alignment and domain information
>PF14870 PSII_BNR: Photosynthesis system II assembly factor YCF48; PDB: 2XBG_A Back     alignment and domain information
>PF14727 PHTB1_N: PTHB1 N-terminus Back     alignment and domain information
>KOG2079 consensus Vacuolar assembly/sorting protein VPS8 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PHA02713 hypothetical protein; Provisional Back     alignment and domain information
>KOG4441 consensus Proteins containing BTB/POZ and Kelch domains, involved in regulatory/signal transduction processes [Signal transduction mechanisms; General function prediction only] Back     alignment and domain information
>KOG4441 consensus Proteins containing BTB/POZ and Kelch domains, involved in regulatory/signal transduction processes [Signal transduction mechanisms; General function prediction only] Back     alignment and domain information
>COG3204 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>KOG2079 consensus Vacuolar assembly/sorting protein VPS8 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF15390 DUF4613: Domain of unknown function (DUF4613) Back     alignment and domain information
>COG3204 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF05694 SBP56: 56kDa selenium binding protein (SBP56); InterPro: IPR008826 This family consists of several eukaryotic selenium binding proteins as well as three sequences from archaea Back     alignment and domain information
>PF05694 SBP56: 56kDa selenium binding protein (SBP56); InterPro: IPR008826 This family consists of several eukaryotic selenium binding proteins as well as three sequences from archaea Back     alignment and domain information
>KOG4499 consensus Ca2+-binding protein Regucalcin/SMP30 [Inorganic ion transport and metabolism; Signal transduction mechanisms] Back     alignment and domain information
>PF05096 Glu_cyclase_2: Glutamine cyclotransferase; InterPro: IPR007788 This family of enzymes 2 Back     alignment and domain information
>PF12894 Apc4_WD40: Anaphase-promoting complex subunit 4 WD40 domain Back     alignment and domain information
>PRK13684 Ycf48-like protein; Provisional Back     alignment and domain information
>PF15390 DUF4613: Domain of unknown function (DUF4613) Back     alignment and domain information
>TIGR03074 PQQ_membr_DH membrane-bound PQQ-dependent dehydrogenase, glucose/quinate/shikimate family Back     alignment and domain information
>PF12894 Apc4_WD40: Anaphase-promoting complex subunit 4 WD40 domain Back     alignment and domain information
>KOG4499 consensus Ca2+-binding protein Regucalcin/SMP30 [Inorganic ion transport and metabolism; Signal transduction mechanisms] Back     alignment and domain information
>KOG2444 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PF12234 Rav1p_C: RAVE protein 1 C terminal; InterPro: IPR022033 This domain family is found in eukaryotes, and is typically between 621 and 644 amino acids in length Back     alignment and domain information
>TIGR02604 Piru_Ver_Nterm putative membrane-bound dehydrogenase domain Back     alignment and domain information
>COG4257 Vgb Streptogramin lyase [Defense mechanisms] Back     alignment and domain information
>PHA03098 kelch-like protein; Provisional Back     alignment and domain information
>PHA03098 kelch-like protein; Provisional Back     alignment and domain information
>PF14727 PHTB1_N: PTHB1 N-terminus Back     alignment and domain information
>PF03022 MRJP: Major royal jelly protein; InterPro: IPR003534 The major royal jelly proteins (MRJPs) comprise 12 Back     alignment and domain information
>KOG1898 consensus Splicing factor 3b, subunit 3 [RNA processing and modification] Back     alignment and domain information
>PF12234 Rav1p_C: RAVE protein 1 C terminal; InterPro: IPR022033 This domain family is found in eukaryotes, and is typically between 621 and 644 amino acids in length Back     alignment and domain information
>KOG2280 consensus Vacuolar assembly/sorting protein VPS16 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>COG1520 FOG: WD40-like repeat [Function unknown] Back     alignment and domain information
>PF10168 Nup88: Nuclear pore component; InterPro: IPR019321 Nup88 can be divided into two structural domains; the N-terminal two-thirds of the protein have no obvious structural motifs Back     alignment and domain information
>KOG2444 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PF11725 AvrE: Pathogenicity factor; InterPro: IPR021085 This family is secreted by Gram-negative Gammaproteobacteria such as Pseudomonas syringae of tomato and Erwinia amylovora (Fire blight bacteria), amongst others Back     alignment and domain information
>PF10168 Nup88: Nuclear pore component; InterPro: IPR019321 Nup88 can be divided into two structural domains; the N-terminal two-thirds of the protein have no obvious structural motifs Back     alignment and domain information
>PF14761 HPS3_N: Hermansky-Pudlak syndrome 3 Back     alignment and domain information
>TIGR03118 PEPCTERM_chp_1 conserved hypothetical protein TIGR03118 Back     alignment and domain information
>PHA02790 Kelch-like protein; Provisional Back     alignment and domain information
>KOG1898 consensus Splicing factor 3b, subunit 3 [RNA processing and modification] Back     alignment and domain information
>PLN00033 photosystem II stability/assembly factor; Provisional Back     alignment and domain information
>COG4257 Vgb Streptogramin lyase [Defense mechanisms] Back     alignment and domain information
>PF14761 HPS3_N: Hermansky-Pudlak syndrome 3 Back     alignment and domain information
>KOG3630 consensus Nuclear pore complex, Nup214/CAN component [Nuclear structure; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>COG3823 Glutamine cyclotransferase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5276 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>TIGR02604 Piru_Ver_Nterm putative membrane-bound dehydrogenase domain Back     alignment and domain information
>KOG2377 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF10214 Rrn6: RNA polymerase I-specific transcription-initiation factor; InterPro: IPR019350 RNA polymerase I-specific transcription-initiation factor Rrn6 and Rrn7 represent components of a multisubunit transcription factor essential for the initiation of rDNA transcription by Pol I [] Back     alignment and domain information
>KOG1900 consensus Nuclear pore complex, Nup155 component (D Nup154, sc Nup157/Nup170) [Nuclear structure; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>COG4590 ABC-type uncharacterized transport system, permease component [General function prediction only] Back     alignment and domain information
>TIGR03118 PEPCTERM_chp_1 conserved hypothetical protein TIGR03118 Back     alignment and domain information
>KOG1916 consensus Nuclear protein, contains WD40 repeats [General function prediction only] Back     alignment and domain information
>PHA02790 Kelch-like protein; Provisional Back     alignment and domain information
>COG3292 Predicted periplasmic ligand-binding sensor domain [Signal transduction mechanisms] Back     alignment and domain information
>TIGR03606 non_repeat_PQQ dehydrogenase, PQQ-dependent, s-GDH family Back     alignment and domain information
>PF08728 CRT10: CRT10; InterPro: IPR014839 CRT10 is a transcriptional regulator of ribonucleotide reductase (RNR) genes [] Back     alignment and domain information
>KOG2280 consensus Vacuolar assembly/sorting protein VPS16 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF10313 DUF2415: Uncharacterised protein domain (DUF2415); InterPro: IPR019417 This entry represents a short (30 residues) domain of unknown function found in a family of fungal proteins Back     alignment and domain information
>PLN00033 photosystem II stability/assembly factor; Provisional Back     alignment and domain information
>KOG2377 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>TIGR03548 mutarot_permut cyclically-permuted mutatrotase family protein Back     alignment and domain information
>KOG1916 consensus Nuclear protein, contains WD40 repeats [General function prediction only] Back     alignment and domain information
>PF13449 Phytase-like: Esterase-like activity of phytase Back     alignment and domain information
>KOG3630 consensus Nuclear pore complex, Nup214/CAN component [Nuclear structure; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF07676 PD40: WD40-like Beta Propeller Repeat; InterPro: IPR011659 WD-40 repeats (also known as WD or beta-transducin repeats) are short ~40 amino acid motifs, often terminating in a Trp-Asp (W-D) dipeptide Back     alignment and domain information
>PF03022 MRJP: Major royal jelly protein; InterPro: IPR003534 The major royal jelly proteins (MRJPs) comprise 12 Back     alignment and domain information
>COG1520 FOG: WD40-like repeat [Function unknown] Back     alignment and domain information
>PF10433 MMS1_N: Mono-functional DNA-alkylating methyl methanesulfonate N-term; PDB: 2B5M_A 4A0K_C 4A0B_C 3I7L_A 2B5N_C 3I8E_A 4A09_A 4A0A_A 3EI4_C 2B5L_A Back     alignment and domain information
>PRK14131 N-acetylneuraminic acid mutarotase; Provisional Back     alignment and domain information
>COG3823 Glutamine cyclotransferase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR03548 mutarot_permut cyclically-permuted mutatrotase family protein Back     alignment and domain information
>PF10313 DUF2415: Uncharacterised protein domain (DUF2415); InterPro: IPR019417 This entry represents a short (30 residues) domain of unknown function found in a family of fungal proteins Back     alignment and domain information
>KOG1900 consensus Nuclear pore complex, Nup155 component (D Nup154, sc Nup157/Nup170) [Nuclear structure; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF14781 BBS2_N: Ciliary BBSome complex subunit 2, N-terminal Back     alignment and domain information
>KOG1983 consensus Tomosyn and related SNARE-interacting proteins [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG2817 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13449 Phytase-like: Esterase-like activity of phytase Back     alignment and domain information
>COG5167 VID27 Protein involved in vacuole import and degradation [Intracellular trafficking and secretion] Back     alignment and domain information
>KOG4460 consensus Nuclear pore complex, Nup88/rNup84 component [Nuclear structure; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PLN02193 nitrile-specifier protein Back     alignment and domain information
>PLN02193 nitrile-specifier protein Back     alignment and domain information
>KOG2247 consensus WD40 repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF07569 Hira: TUP1-like enhancer of split; InterPro: IPR011494 The Hira proteins are found in a range of eukaryotes and are implicated in the assembly of repressive chromatin Back     alignment and domain information
>PF12657 TFIIIC_delta: Transcription factor IIIC subunit delta N-term; InterPro: IPR024761 This entry represents a domain found towards the N terminus of the 90 kDa subunit of transcription factor IIIC (also known as subunit 9 in yeast []) Back     alignment and domain information
>KOG4659 consensus Uncharacterized conserved protein (Rhs family) [Function unknown] Back     alignment and domain information
>PF11725 AvrE: Pathogenicity factor; InterPro: IPR021085 This family is secreted by Gram-negative Gammaproteobacteria such as Pseudomonas syringae of tomato and Erwinia amylovora (Fire blight bacteria), amongst others Back     alignment and domain information
>TIGR03606 non_repeat_PQQ dehydrogenase, PQQ-dependent, s-GDH family Back     alignment and domain information
>PF07250 Glyoxal_oxid_N: Glyoxal oxidase N-terminus; InterPro: IPR009880 This entry represents the N terminus (approximately 300 residues) of a number of plant and fungal glyoxal oxidase enzymes Back     alignment and domain information
>PRK13613 lipoprotein LpqB; Provisional Back     alignment and domain information
>PF07569 Hira: TUP1-like enhancer of split; InterPro: IPR011494 The Hira proteins are found in a range of eukaryotes and are implicated in the assembly of repressive chromatin Back     alignment and domain information
>PRK13614 lipoprotein LpqB; Provisional Back     alignment and domain information
>COG5276 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK13615 lipoprotein LpqB; Provisional Back     alignment and domain information
>PLN02153 epithiospecifier protein Back     alignment and domain information
>PLN02153 epithiospecifier protein Back     alignment and domain information
>PF05935 Arylsulfotrans: Arylsulfotransferase (ASST); InterPro: IPR010262 This family consists of several bacterial arylsulphotransferase proteins Back     alignment and domain information
>PF08728 CRT10: CRT10; InterPro: IPR014839 CRT10 is a transcriptional regulator of ribonucleotide reductase (RNR) genes [] Back     alignment and domain information
>PRK13614 lipoprotein LpqB; Provisional Back     alignment and domain information
>COG4590 ABC-type uncharacterized transport system, permease component [General function prediction only] Back     alignment and domain information
>COG3292 Predicted periplasmic ligand-binding sensor domain [Signal transduction mechanisms] Back     alignment and domain information
>PF12657 TFIIIC_delta: Transcription factor IIIC subunit delta N-term; InterPro: IPR024761 This entry represents a domain found towards the N terminus of the 90 kDa subunit of transcription factor IIIC (also known as subunit 9 in yeast []) Back     alignment and domain information
>KOG1983 consensus Tomosyn and related SNARE-interacting proteins [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query1068
2ymu_A577 Structure Of A Highly Repetitive Propeller Structur 9e-13
2ymu_A 577 Structure Of A Highly Repetitive Propeller Structur 2e-04
2xl2_A334 Wdr5 In Complex With An Rbbp5 Peptide Recruited To 7e-10
2xl2_A334 Wdr5 In Complex With An Rbbp5 Peptide Recruited To 1e-07
2gnq_A336 Structure Of Wdr5 Length = 336 8e-10
2gnq_A336 Structure Of Wdr5 Length = 336 8e-08
3emh_A318 Structural Basis Of Wdr5-Mll Interaction Length = 3 1e-09
3emh_A318 Structural Basis Of Wdr5-Mll Interaction Length = 3 2e-07
4a7j_A318 Symmetric Dimethylation Of H3 Arginine 2 Is A Novel 1e-09
4a7j_A318 Symmetric Dimethylation Of H3 Arginine 2 Is A Novel 8e-08
2h9m_A313 Wdr5 In Complex With Unmodified H3k4 Peptide Length 1e-09
2h9m_A313 Wdr5 In Complex With Unmodified H3k4 Peptide Length 8e-08
2h68_A312 Histone H3 Recognition And Presentation By The Wdr5 2e-09
2h68_A312 Histone H3 Recognition And Presentation By The Wdr5 1e-07
2g99_A308 Structural Basis For The Specific Recognition Of Me 2e-09
2g99_A308 Structural Basis For The Specific Recognition Of Me 3e-07
3smr_A312 Crystal Structure Of Human Wd Repeat Domain 5 With 2e-09
3smr_A312 Crystal Structure Of Human Wd Repeat Domain 5 With 1e-07
2h9l_A329 Wdr5delta23 Length = 329 2e-09
2h9l_A329 Wdr5delta23 Length = 329 1e-07
2cnx_A315 Wdr5 And Histone H3 Lysine 4 Dimethyl Complex At 2. 2e-09
2cnx_A315 Wdr5 And Histone H3 Lysine 4 Dimethyl Complex At 2. 4e-07
3psl_A318 Fine-Tuning The Stimulation Of Mll1 Methyltransfera 2e-09
3psl_A318 Fine-Tuning The Stimulation Of Mll1 Methyltransfera 1e-07
2g9a_A311 Structural Basis For The Specific Recognition Of Me 2e-09
2g9a_A311 Structural Basis For The Specific Recognition Of Me 5e-07
2h13_A317 Crystal Structure Of Wdr5HISTONE H3 COMPLEX Length 2e-09
2h13_A317 Crystal Structure Of Wdr5HISTONE H3 COMPLEX Length 1e-07
3mxx_A315 Crystal Structure Of Wdr5 Mutant (S62a) Length = 31 2e-09
3mxx_A315 Crystal Structure Of Wdr5 Mutant (S62a) Length = 31 9e-07
3n0d_A315 Crystal Structure Of Wdr5 Mutant (W330f) Length = 3 2e-09
3n0d_A315 Crystal Structure Of Wdr5 Mutant (W330f) Length = 3 5e-07
3n0e_A315 Crystal Structure Of Wdr5 Mutant (W330y) Length = 3 3e-09
3n0e_A315 Crystal Structure Of Wdr5 Mutant (W330y) Length = 3 5e-07
2co0_A315 Wdr5 And Unmodified Histone H3 Complex At 2.25 Angs 5e-09
2co0_A315 Wdr5 And Unmodified Histone H3 Complex At 2.25 Angs 2e-06
2aq5_A402 Crystal Structure Of Murine Coronin-1 Length = 402 3e-07
2b4e_A402 Crystal Structure Of Murine Coronin-1: Monoclinic F 4e-07
3shf_A1256 Crystal Structure Of The R265s Mutant Of Full-Lengt 2e-06
3sfz_A1249 Crystal Structure Of Full-Length Murine Apaf-1 Leng 2e-06
4aow_A340 Crystal Structure Of The Human Rack1 Protein At A R 6e-06
2zkq_a317 Structure Of A Mammalian Ribosomal 40s Subunit With 7e-06
1vyh_C410 Paf-Ah Holoenzyme: Lis1ALFA2 Length = 410 1e-05
2ovp_B445 Structure Of The Skp1-Fbw7 Complex Length = 445 1e-05
2ovp_B445 Structure Of The Skp1-Fbw7 Complex Length = 445 2e-04
3iza_B1263 Structure Of An Apoptosome-Procaspase-9 Card Comple 8e-05
3mks_B464 Crystal Structure Of Yeast Cdc4SKP1 IN COMPLEX WITH 1e-04
1erj_A393 Crystal Structure Of The C-Terminal Wd40 Domain Of 1e-04
1nex_B464 Crystal Structure Of Scskp1-Sccdc4-Cpd Peptide Comp 1e-04
3ow8_A321 Crystal Structure Of The Wd Repeat-Containing Prote 7e-04
3dm0_A694 Maltose Binding Protein Fusion With Rack1 From A. T 7e-04
3fm0_A345 Crystal Structure Of Wd40 Protein Ciao1 Length = 34 9e-04
>pdb|2YMU|A Chain A, Structure Of A Highly Repetitive Propeller Structure Length = 577 Back     alignment and structure

Iteration: 1

Score = 72.8 bits (177), Expect = 9e-13, Method: Compositional matrix adjust. Identities = 131/554 (23%), Positives = 231/554 (41%), Gaps = 95/554 (17%) Query: 374 SVNRVVWSPDGSLLGVAYSKHIVQLYAYHGGSDARQQLE-IDAHVGNVNDLAFSAPCKQI 432 SV V +SPDG + A V+L+ +G Q L+ + H +V +AFS P Q Sbjct: 59 SVWGVAFSPDGQTIASASDDKTVKLWNRNG-----QLLQTLTGHSSSVRGVAFS-PDGQ- 111 Query: 433 SVITCGDDKTIKVWDAVTGSRTYSFEGHGAPVYSLC--PHAKENIHFIFSISVDGKIKAW 490 ++ + DDKT+K+W+ G + GH + V+ + P + I S S D +K W Sbjct: 112 TIASASDDKTVKLWNR-NGQLLQTLTGHSSSVWGVAFSPDGQT----IASASDDKTVKLW 166 Query: 491 LYDS--LGARVDYDAPGLGCTRMAYSANGRRLFSCGTSKEGESFLVEWNESEGAIKRTYQ 548 + L + + G +A+S +G+ + S K + WN G + +T Sbjct: 167 NRNGQLLQTLTGHSSSVWG---VAFSPDGQTIASASDDKT----VKLWNR-NGQLLQTLT 218 Query: 549 GLQLQHNSVSVVHFDTAKDQILAAGDDHVIKIWDMNKVQLLTTIDAGGG-------LPEN 601 G +SV V F I +A DD +K+W+ N QLL T+ P+ Sbjct: 219 G---HSSSVRGVAFSPDGQTIASASDDKTVKLWNRNG-QLLQTLTGHSSSVNGVAFRPDG 274 Query: 602 PRIC----------FNKNGTLLAVIANENR--IKILETPESNSVDAAGVLSDN----LRK 645 I +N+NG LL + + + +P+ ++ +A SD+ L Sbjct: 275 QTIASASDDKTVKLWNRNGQLLQTLTGHSSSVWGVAFSPDGQTIASA---SDDKTVKLWN 331 Query: 646 LSVNPISTVTGAGIANGSVSVNEDPKEDVKPEISVEAENKSEVEKPLFARPSECQSLLLP 705 + + T+TG + V+ + D + I+ +++K+ L+ R + LL Sbjct: 332 RNGQHLQTLTGHSSSVWGVAFSPDGQT-----IASASDDKTV---KLWNRNGQ---LLQT 380 Query: 706 SKVKANKISRLTYNNGGQAIFALASNGVHLMWRWPRNDLTLSTEATTKVPPRLYQPRHGP 765 ++ + + ++ GQ I + + + +W R+G Sbjct: 381 LTGHSSSVRGVAFSPDGQTIASASDDKTVKLWN-----------------------RNG- 416 Query: 766 QFMVNDTTDSNSQEAVPCFALSKNDAYLFSASGGVISLYIVMTFKTILTIMPPSPTATSL 825 Q + T S+S V A S +D + SAS + + T+ S + + Sbjct: 417 QLLQTLTGHSSS---VWGVAFSPDDQTIASASDDKTVKLWNRNGQLLQTLTGHSSSVRGV 473 Query: 826 AFNPHDNNVIAIGMDDSTILIYNARSSEVISKLEGHSKRVTGLVFSDALNILVSSGGDAQ 885 AF+P D IA DD T+ ++N R+ +++ L GHS V G+ FS + S+ D Sbjct: 474 AFSP-DGQTIASASDDKTVKLWN-RNGQLLQTLTGHSSSVRGVAFSPDGQTIASASDDKT 531 Query: 886 IFVWDVDGWGIQTC 899 + +W+ +G +QT Sbjct: 532 VKLWNRNGQLLQTL 545
>pdb|2YMU|A Chain A, Structure Of A Highly Repetitive Propeller Structure Length = 577 Back     alignment and structure
>pdb|2XL2|A Chain A, Wdr5 In Complex With An Rbbp5 Peptide Recruited To Novel Site Length = 334 Back     alignment and structure
>pdb|2XL2|A Chain A, Wdr5 In Complex With An Rbbp5 Peptide Recruited To Novel Site Length = 334 Back     alignment and structure
>pdb|2GNQ|A Chain A, Structure Of Wdr5 Length = 336 Back     alignment and structure
>pdb|2GNQ|A Chain A, Structure Of Wdr5 Length = 336 Back     alignment and structure
>pdb|3EMH|A Chain A, Structural Basis Of Wdr5-Mll Interaction Length = 318 Back     alignment and structure
>pdb|3EMH|A Chain A, Structural Basis Of Wdr5-Mll Interaction Length = 318 Back     alignment and structure
>pdb|4A7J|A Chain A, Symmetric Dimethylation Of H3 Arginine 2 Is A Novel Histone Mark That Supports Euchromatin Maintenance Length = 318 Back     alignment and structure
>pdb|4A7J|A Chain A, Symmetric Dimethylation Of H3 Arginine 2 Is A Novel Histone Mark That Supports Euchromatin Maintenance Length = 318 Back     alignment and structure
>pdb|2H9M|A Chain A, Wdr5 In Complex With Unmodified H3k4 Peptide Length = 313 Back     alignment and structure
>pdb|2H9M|A Chain A, Wdr5 In Complex With Unmodified H3k4 Peptide Length = 313 Back     alignment and structure
>pdb|2H68|A Chain A, Histone H3 Recognition And Presentation By The Wdr5 Module Of The Mll1 Complex Length = 312 Back     alignment and structure
>pdb|2H68|A Chain A, Histone H3 Recognition And Presentation By The Wdr5 Module Of The Mll1 Complex Length = 312 Back     alignment and structure
>pdb|2G99|A Chain A, Structural Basis For The Specific Recognition Of Methylated Histone H3 Lysine 4 By The Wd-40 Protein Wdr5 Length = 308 Back     alignment and structure
>pdb|2G99|A Chain A, Structural Basis For The Specific Recognition Of Methylated Histone H3 Lysine 4 By The Wd-40 Protein Wdr5 Length = 308 Back     alignment and structure
>pdb|3SMR|A Chain A, Crystal Structure Of Human Wd Repeat Domain 5 With Compound Length = 312 Back     alignment and structure
>pdb|3SMR|A Chain A, Crystal Structure Of Human Wd Repeat Domain 5 With Compound Length = 312 Back     alignment and structure
>pdb|2H9L|A Chain A, Wdr5delta23 Length = 329 Back     alignment and structure
>pdb|2H9L|A Chain A, Wdr5delta23 Length = 329 Back     alignment and structure
>pdb|2CNX|A Chain A, Wdr5 And Histone H3 Lysine 4 Dimethyl Complex At 2.1 Angstrom Length = 315 Back     alignment and structure
>pdb|2CNX|A Chain A, Wdr5 And Histone H3 Lysine 4 Dimethyl Complex At 2.1 Angstrom Length = 315 Back     alignment and structure
>pdb|3PSL|A Chain A, Fine-Tuning The Stimulation Of Mll1 Methyltransferase Activity By A Histone H3 Based Peptide Mimetic Length = 318 Back     alignment and structure
>pdb|3PSL|A Chain A, Fine-Tuning The Stimulation Of Mll1 Methyltransferase Activity By A Histone H3 Based Peptide Mimetic Length = 318 Back     alignment and structure
>pdb|2G9A|A Chain A, Structural Basis For The Specific Recognition Of Methylated Histone H3 Lysine 4 By The Wd-40 Protein Wdr5 Length = 311 Back     alignment and structure
>pdb|2G9A|A Chain A, Structural Basis For The Specific Recognition Of Methylated Histone H3 Lysine 4 By The Wd-40 Protein Wdr5 Length = 311 Back     alignment and structure
>pdb|2H13|A Chain A, Crystal Structure Of Wdr5HISTONE H3 COMPLEX Length = 317 Back     alignment and structure
>pdb|2H13|A Chain A, Crystal Structure Of Wdr5HISTONE H3 COMPLEX Length = 317 Back     alignment and structure
>pdb|3MXX|A Chain A, Crystal Structure Of Wdr5 Mutant (S62a) Length = 315 Back     alignment and structure
>pdb|3MXX|A Chain A, Crystal Structure Of Wdr5 Mutant (S62a) Length = 315 Back     alignment and structure
>pdb|3N0D|A Chain A, Crystal Structure Of Wdr5 Mutant (W330f) Length = 315 Back     alignment and structure
>pdb|3N0D|A Chain A, Crystal Structure Of Wdr5 Mutant (W330f) Length = 315 Back     alignment and structure
>pdb|3N0E|A Chain A, Crystal Structure Of Wdr5 Mutant (W330y) Length = 315 Back     alignment and structure
>pdb|3N0E|A Chain A, Crystal Structure Of Wdr5 Mutant (W330y) Length = 315 Back     alignment and structure
>pdb|2CO0|A Chain A, Wdr5 And Unmodified Histone H3 Complex At 2.25 Angstrom Length = 315 Back     alignment and structure
>pdb|2CO0|A Chain A, Wdr5 And Unmodified Histone H3 Complex At 2.25 Angstrom Length = 315 Back     alignment and structure
>pdb|2AQ5|A Chain A, Crystal Structure Of Murine Coronin-1 Length = 402 Back     alignment and structure
>pdb|2B4E|A Chain A, Crystal Structure Of Murine Coronin-1: Monoclinic Form Length = 402 Back     alignment and structure
>pdb|3SHF|A Chain A, Crystal Structure Of The R265s Mutant Of Full-Length Murine Apaf-1 Length = 1256 Back     alignment and structure
>pdb|3SFZ|A Chain A, Crystal Structure Of Full-Length Murine Apaf-1 Length = 1249 Back     alignment and structure
>pdb|4AOW|A Chain A, Crystal Structure Of The Human Rack1 Protein At A Resolution Of 2.45 Angstrom Length = 340 Back     alignment and structure
>pdb|2ZKQ|AA Chain a, Structure Of A Mammalian Ribosomal 40s Subunit Within An 80s Complex Obtained By Docking Homology Models Of The Rna And Proteins Into An 8.7 A Cryo-Em Map Length = 317 Back     alignment and structure
>pdb|1VYH|C Chain C, Paf-Ah Holoenzyme: Lis1ALFA2 Length = 410 Back     alignment and structure
>pdb|2OVP|B Chain B, Structure Of The Skp1-Fbw7 Complex Length = 445 Back     alignment and structure
>pdb|2OVP|B Chain B, Structure Of The Skp1-Fbw7 Complex Length = 445 Back     alignment and structure
>pdb|3MKS|B Chain B, Crystal Structure Of Yeast Cdc4SKP1 IN COMPLEX WITH AN ALLOSTERIC Inhibitor Scf-I2 Length = 464 Back     alignment and structure
>pdb|1ERJ|A Chain A, Crystal Structure Of The C-Terminal Wd40 Domain Of Tup1 Length = 393 Back     alignment and structure
>pdb|1NEX|B Chain B, Crystal Structure Of Scskp1-Sccdc4-Cpd Peptide Complex Length = 464 Back     alignment and structure
>pdb|3OW8|A Chain A, Crystal Structure Of The Wd Repeat-Containing Protein 61 Length = 321 Back     alignment and structure
>pdb|3DM0|A Chain A, Maltose Binding Protein Fusion With Rack1 From A. Thaliana Length = 694 Back     alignment and structure
>pdb|3FM0|A Chain A, Crystal Structure Of Wd40 Protein Ciao1 Length = 345 Back     alignment and structure

Structure Templates Detected by HHsearch ?

No hit with probability above 80.00


Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 1068
d1tbga_340 b.69.4.1 (A:) beta1-subunit of the signal-transduc 4e-16
d1tbga_340 b.69.4.1 (A:) beta1-subunit of the signal-transduc 5e-15
d1tbga_340 b.69.4.1 (A:) beta1-subunit of the signal-transduc 1e-14
d1tbga_340 b.69.4.1 (A:) beta1-subunit of the signal-transduc 2e-10
d1tbga_340 b.69.4.1 (A:) beta1-subunit of the signal-transduc 3e-09
d1tbga_340 b.69.4.1 (A:) beta1-subunit of the signal-transduc 3e-09
d1tbga_340 b.69.4.1 (A:) beta1-subunit of the signal-transduc 3e-09
d1tbga_340 b.69.4.1 (A:) beta1-subunit of the signal-transduc 9e-06
d1vyhc1317 b.69.4.1 (C:92-408) Platelet-activating factor ace 6e-15
d1vyhc1317 b.69.4.1 (C:92-408) Platelet-activating factor ace 1e-14
d1vyhc1317 b.69.4.1 (C:92-408) Platelet-activating factor ace 1e-14
d1vyhc1317 b.69.4.1 (C:92-408) Platelet-activating factor ace 3e-14
d1vyhc1317 b.69.4.1 (C:92-408) Platelet-activating factor ace 5e-09
d1vyhc1317 b.69.4.1 (C:92-408) Platelet-activating factor ace 3e-06
d1vyhc1 317 b.69.4.1 (C:92-408) Platelet-activating factor ace 1e-05
d1erja_388 b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yea 8e-14
d1erja_388 b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yea 1e-13
d1erja_388 b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yea 7e-12
d1erja_388 b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yea 1e-07
d1erja_388 b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yea 5e-06
d1erja_388 b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yea 5e-04
d1erja_ 388 b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yea 0.002
d1k8kc_ 371 b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 1e-12
d1k8kc_371 b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 1e-11
d1k8kc_371 b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 5e-06
d1k8kc_371 b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 3e-04
d1k8kc_371 b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 0.002
d1nexb2355 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker' 1e-11
d1nexb2355 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker' 4e-09
d1nexb2 355 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker' 2e-06
d1nexb2355 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker' 2e-06
d1nexb2355 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker' 0.002
d2ovrb2342 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing 4e-10
d2ovrb2342 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing 4e-09
d2ovrb2342 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing 4e-09
d2ovrb2342 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing 2e-06
d2ovrb2 342 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing 7e-04
d1jmxb_346 b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase 5e-10
d1jmxb_346 b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase 6e-08
d1jmxb_346 b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase 0.004
d1p22a2293 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (be 2e-09
d1p22a2293 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (be 6e-08
d1p22a2293 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (be 7e-06
d1p22a2293 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (be 4e-05
d1pgua1325 b.69.4.1 (A:2-326) Actin interacting protein 1 {Ba 3e-09
d1pgua1325 b.69.4.1 (A:2-326) Actin interacting protein 1 {Ba 1e-06
d1pgua1325 b.69.4.1 (A:2-326) Actin interacting protein 1 {Ba 2e-06
d1pgua1325 b.69.4.1 (A:2-326) Actin interacting protein 1 {Ba 6e-06
d1gxra_337 b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Hum 9e-09
d1gxra_337 b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Hum 1e-08
d1gxra_337 b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Hum 2e-07
d1gxra_337 b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Hum 5e-06
d1gxra_337 b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Hum 2e-05
d1gxra_337 b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Hum 0.001
d1gxra_337 b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Hum 0.002
d1pgua2287 b.69.4.1 (A:327-613) Actin interacting protein 1 { 1e-08
d1pgua2287 b.69.4.1 (A:327-613) Actin interacting protein 1 { 3e-06
d1pgua2287 b.69.4.1 (A:327-613) Actin interacting protein 1 { 3e-05
d1pgua2287 b.69.4.1 (A:327-613) Actin interacting protein 1 { 3e-04
d1pgua2287 b.69.4.1 (A:327-613) Actin interacting protein 1 { 6e-04
d1pgua2287 b.69.4.1 (A:327-613) Actin interacting protein 1 { 0.002
d1pbyb_337 b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase 6e-08
d1pbyb_337 b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase 3e-07
d1pbyb_337 b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase 8e-05
d1pbyb_337 b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase 0.003
d1pbyb_337 b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase 0.004
d1nr0a1311 b.69.4.1 (A:2-312) Actin interacting protein 1 {Ne 6e-08
d1nr0a1311 b.69.4.1 (A:2-312) Actin interacting protein 1 {Ne 1e-06
d1nr0a1311 b.69.4.1 (A:2-312) Actin interacting protein 1 {Ne 1e-06
d1nr0a1311 b.69.4.1 (A:2-312) Actin interacting protein 1 {Ne 5e-06
d1nr0a2299 b.69.4.1 (A:313-611) Actin interacting protein 1 { 1e-07
d1nr0a2299 b.69.4.1 (A:313-611) Actin interacting protein 1 { 5e-05
d1nr0a2299 b.69.4.1 (A:313-611) Actin interacting protein 1 { 1e-04
d1nr0a2299 b.69.4.1 (A:313-611) Actin interacting protein 1 { 3e-04
d1nr0a2299 b.69.4.1 (A:313-611) Actin interacting protein 1 { 6e-04
d1sq9a_393 b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Bake 2e-07
d1sq9a_393 b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Bake 6e-07
d1sq9a_393 b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Bake 7e-06
d1sq9a_393 b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Bake 1e-04
d2bbkh_355 b.69.2.1 (H:) Methylamine dehydrogenase, H-chain { 3e-07
d2bbkh_355 b.69.2.1 (H:) Methylamine dehydrogenase, H-chain { 2e-06
d2bbkh_355 b.69.2.1 (H:) Methylamine dehydrogenase, H-chain { 0.001
d1yfqa_342 b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Bake 4e-07
d1yfqa_342 b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Bake 5e-06
d1yfqa_342 b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Bake 7e-06
d1yfqa_342 b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Bake 2e-05
d1yfqa_ 342 b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Bake 3e-04
d1k32a3360 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Ar 8e-06
d1k32a3360 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Ar 9e-06
d1k32a3360 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Ar 4e-05
d1k32a3360 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Ar 5e-04
d1qksa2432 b.70.2.1 (A:136-567) C-terminal (heme d1) domain o 9e-06
d1qksa2 432 b.70.2.1 (A:136-567) C-terminal (heme d1) domain o 0.003
d1mdah_368 b.69.2.1 (H:) Methylamine dehydrogenase, H-chain { 3e-05
d1mdah_368 b.69.2.1 (H:) Methylamine dehydrogenase, H-chain { 8e-05
d1mdah_368 b.69.2.1 (H:) Methylamine dehydrogenase, H-chain { 4e-04
d1hzua2426 b.70.2.1 (A:118-543) C-terminal (heme d1) domain o 1e-04
d1hzua2 426 b.70.2.1 (A:118-543) C-terminal (heme d1) domain o 4e-04
d1l0qa2301 b.69.2.3 (A:1-301) Surface layer protein {Archaeon 0.001
d1l0qa2301 b.69.2.3 (A:1-301) Surface layer protein {Archaeon 0.002
d1ri6a_333 b.69.11.1 (A:) Putative isomerase YbhE {Escherichi 0.004
>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Length = 340 Back     information, alignment and structure

class: All beta proteins
fold: 7-bladed beta-propeller
superfamily: WD40 repeat-like
family: WD40-repeat
domain: beta1-subunit of the signal-transducing G protein heterotrimer
species: Cow (Bos taurus) [TaxId: 9913]
 Score = 78.6 bits (192), Expect = 4e-16
 Identities = 25/139 (17%), Positives = 46/139 (33%), Gaps = 8/139 (5%)

Query: 352 KVWDIGACSMLFKTALVRDPGVSVNRVVWSPDGSLLGVAYSKHIVQLYAYHGGSDARQQL 411
           K+WD+                  +N + + P+G+           +L+      +     
Sbjct: 209 KLWDVREGMCRQT---FTGHESDINAICFFPNGNAFATGSDDATCRLFDLRADQELMTYS 265

Query: 412 EIDAHVGNVNDLAFSAPCKQISVITCGDDKTIKVWDAVTGSRTYSFEGHGAPVYSLCPHA 471
             +   G +  ++FS   + +  +   DD    VWDA+   R     GH   V  L    
Sbjct: 266 HDNIICG-ITSVSFSKSGRLL--LAGYDDFNCNVWDALKADRAGVLAGHDNRVSCLGVTD 322

Query: 472 KENIHFIFSISVDGKIKAW 490
                 + + S D  +K W
Sbjct: 323 DGM--AVATGSWDSFLKIW 339


>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Length = 340 Back     information, alignment and structure
>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Length = 340 Back     information, alignment and structure
>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Length = 340 Back     information, alignment and structure
>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Length = 340 Back     information, alignment and structure
>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Length = 340 Back     information, alignment and structure
>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Length = 340 Back     information, alignment and structure
>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Length = 340 Back     information, alignment and structure
>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Length = 317 Back     information, alignment and structure
>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Length = 317 Back     information, alignment and structure
>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Length = 317 Back     information, alignment and structure
>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Length = 317 Back     information, alignment and structure
>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Length = 317 Back     information, alignment and structure
>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Length = 317 Back     information, alignment and structure
>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Length = 317 Back     information, alignment and structure
>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 388 Back     information, alignment and structure
>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 388 Back     information, alignment and structure
>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 388 Back     information, alignment and structure
>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 388 Back     information, alignment and structure
>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 388 Back     information, alignment and structure
>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 388 Back     information, alignment and structure
>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 388 Back     information, alignment and structure
>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} Length = 371 Back     information, alignment and structure
>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} Length = 371 Back     information, alignment and structure
>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} Length = 371 Back     information, alignment and structure
>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} Length = 371 Back     information, alignment and structure
>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} Length = 371 Back     information, alignment and structure
>d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 355 Back     information, alignment and structure
>d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 355 Back     information, alignment and structure
>d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 355 Back     information, alignment and structure
>d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 355 Back     information, alignment and structure
>d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 355 Back     information, alignment and structure
>d2ovrb2 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Length = 342 Back     information, alignment and structure
>d2ovrb2 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Length = 342 Back     information, alignment and structure
>d2ovrb2 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Length = 342 Back     information, alignment and structure
>d2ovrb2 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Length = 342 Back     information, alignment and structure
>d2ovrb2 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Length = 342 Back     information, alignment and structure
>d1jmxb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Pseudomonas putida [TaxId: 303]} Length = 346 Back     information, alignment and structure
>d1jmxb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Pseudomonas putida [TaxId: 303]} Length = 346 Back     information, alignment and structure
>d1jmxb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Pseudomonas putida [TaxId: 303]} Length = 346 Back     information, alignment and structure
>d1p22a2 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} Length = 293 Back     information, alignment and structure
>d1p22a2 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} Length = 293 Back     information, alignment and structure
>d1p22a2 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} Length = 293 Back     information, alignment and structure
>d1p22a2 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} Length = 293 Back     information, alignment and structure
>d1pgua1 b.69.4.1 (A:2-326) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 325 Back     information, alignment and structure
>d1pgua1 b.69.4.1 (A:2-326) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 325 Back     information, alignment and structure
>d1pgua1 b.69.4.1 (A:2-326) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 325 Back     information, alignment and structure
>d1pgua1 b.69.4.1 (A:2-326) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 325 Back     information, alignment and structure
>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 337 Back     information, alignment and structure
>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 337 Back     information, alignment and structure
>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 337 Back     information, alignment and structure
>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 337 Back     information, alignment and structure
>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 337 Back     information, alignment and structure
>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 337 Back     information, alignment and structure
>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 337 Back     information, alignment and structure
>d1pgua2 b.69.4.1 (A:327-613) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 287 Back     information, alignment and structure
>d1pgua2 b.69.4.1 (A:327-613) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 287 Back     information, alignment and structure
>d1pgua2 b.69.4.1 (A:327-613) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 287 Back     information, alignment and structure
>d1pgua2 b.69.4.1 (A:327-613) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 287 Back     information, alignment and structure
>d1pgua2 b.69.4.1 (A:327-613) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 287 Back     information, alignment and structure
>d1pgua2 b.69.4.1 (A:327-613) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 287 Back     information, alignment and structure
>d1pbyb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Paracoccus denitrificans [TaxId: 266]} Length = 337 Back     information, alignment and structure
>d1pbyb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Paracoccus denitrificans [TaxId: 266]} Length = 337 Back     information, alignment and structure
>d1pbyb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Paracoccus denitrificans [TaxId: 266]} Length = 337 Back     information, alignment and structure
>d1pbyb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Paracoccus denitrificans [TaxId: 266]} Length = 337 Back     information, alignment and structure
>d1pbyb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Paracoccus denitrificans [TaxId: 266]} Length = 337 Back     information, alignment and structure
>d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 311 Back     information, alignment and structure
>d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 311 Back     information, alignment and structure
>d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 311 Back     information, alignment and structure
>d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 311 Back     information, alignment and structure
>d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 299 Back     information, alignment and structure
>d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 299 Back     information, alignment and structure
>d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 299 Back     information, alignment and structure
>d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 299 Back     information, alignment and structure
>d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 299 Back     information, alignment and structure
>d1sq9a_ b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 393 Back     information, alignment and structure
>d1sq9a_ b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 393 Back     information, alignment and structure
>d1sq9a_ b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 393 Back     information, alignment and structure
>d1sq9a_ b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 393 Back     information, alignment and structure
>d2bbkh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Length = 355 Back     information, alignment and structure
>d2bbkh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Length = 355 Back     information, alignment and structure
>d2bbkh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Length = 355 Back     information, alignment and structure
>d1yfqa_ b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 342 Back     information, alignment and structure
>d1yfqa_ b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 342 Back     information, alignment and structure
>d1yfqa_ b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 342 Back     information, alignment and structure
>d1yfqa_ b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 342 Back     information, alignment and structure
>d1yfqa_ b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 342 Back     information, alignment and structure
>d1k32a3 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Length = 360 Back     information, alignment and structure
>d1k32a3 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Length = 360 Back     information, alignment and structure
>d1k32a3 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Length = 360 Back     information, alignment and structure
>d1k32a3 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Length = 360 Back     information, alignment and structure
>d1qksa2 b.70.2.1 (A:136-567) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Paracoccus denitrificans [TaxId: 266]} Length = 432 Back     information, alignment and structure
>d1qksa2 b.70.2.1 (A:136-567) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Paracoccus denitrificans [TaxId: 266]} Length = 432 Back     information, alignment and structure
>d1mdah_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Length = 368 Back     information, alignment and structure
>d1mdah_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Length = 368 Back     information, alignment and structure
>d1mdah_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Length = 368 Back     information, alignment and structure
>d1hzua2 b.70.2.1 (A:118-543) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Pseudomonas aeruginosa [TaxId: 287]} Length = 426 Back     information, alignment and structure
>d1hzua2 b.70.2.1 (A:118-543) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Pseudomonas aeruginosa [TaxId: 287]} Length = 426 Back     information, alignment and structure
>d1l0qa2 b.69.2.3 (A:1-301) Surface layer protein {Archaeon Methanosarcina mazei [TaxId: 2209]} Length = 301 Back     information, alignment and structure
>d1l0qa2 b.69.2.3 (A:1-301) Surface layer protein {Archaeon Methanosarcina mazei [TaxId: 2209]} Length = 301 Back     information, alignment and structure
>d1ri6a_ b.69.11.1 (A:) Putative isomerase YbhE {Escherichia coli [TaxId: 562]} Length = 333 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query1068
d1gxra_337 Groucho/tle1, C-terminal domain {Human (Homo sapie 100.0
d1vyhc1317 Platelet-activating factor acetylhydrolase IB subu 100.0
d1erja_388 Tup1, C-terminal domain {Baker's yeast (Saccharomy 100.0
d1nr0a1311 Actin interacting protein 1 {Nematode (Caenorhabdi 100.0
d1gxra_337 Groucho/tle1, C-terminal domain {Human (Homo sapie 100.0
d1vyhc1317 Platelet-activating factor acetylhydrolase IB subu 100.0
d1erja_388 Tup1, C-terminal domain {Baker's yeast (Saccharomy 100.0
d1tbga_340 beta1-subunit of the signal-transducing G protein 100.0
d1nexb2355 Cdc4 propeller domain {Baker's yeast (Saccharomyce 100.0
d1nexb2355 Cdc4 propeller domain {Baker's yeast (Saccharomyce 100.0
d1k8kc_371 Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taur 100.0
d1tbga_340 beta1-subunit of the signal-transducing G protein 100.0
d1nr0a2299 Actin interacting protein 1 {Nematode (Caenorhabdi 100.0
d2ovrb2342 F-box/WD repeat-containing protein 7, FBXW7 {Human 100.0
d1nr0a1311 Actin interacting protein 1 {Nematode (Caenorhabdi 100.0
d2ovrb2342 F-box/WD repeat-containing protein 7, FBXW7 {Human 100.0
d1k8kc_371 Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taur 100.0
d1nr0a2299 Actin interacting protein 1 {Nematode (Caenorhabdi 100.0
d1pgua1325 Actin interacting protein 1 {Baker's yeast (Saccha 100.0
d1pgua1325 Actin interacting protein 1 {Baker's yeast (Saccha 100.0
d1qksa2432 C-terminal (heme d1) domain of cytochrome cd1-nitr 100.0
d1hzua2426 C-terminal (heme d1) domain of cytochrome cd1-nitr 100.0
d1sq9a_393 Antiviral protein Ski8 (Ski8p) {Baker's yeast (Sac 100.0
d1sq9a_393 Antiviral protein Ski8 (Ski8p) {Baker's yeast (Sac 100.0
d1p22a2293 F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Hom 100.0
d1yfqa_342 Cell cycle arrest protein BUB3 {Baker's yeast (Sac 100.0
d1pgua2287 Actin interacting protein 1 {Baker's yeast (Saccha 100.0
d1pgua2287 Actin interacting protein 1 {Baker's yeast (Saccha 100.0
d1qksa2432 C-terminal (heme d1) domain of cytochrome cd1-nitr 100.0
d1hzua2426 C-terminal (heme d1) domain of cytochrome cd1-nitr 100.0
d1yfqa_342 Cell cycle arrest protein BUB3 {Baker's yeast (Sac 100.0
d1p22a2293 F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Hom 100.0
d1k32a3360 Tricorn protease domain 2 {Archaeon Thermoplasma a 99.98
d1k32a3360 Tricorn protease domain 2 {Archaeon Thermoplasma a 99.97
d1l0qa2301 Surface layer protein {Archaeon Methanosarcina maz 99.95
d1pbyb_337 Quinohemoprotein amine dehydrogenase B chain {Para 99.95
d1pbyb_337 Quinohemoprotein amine dehydrogenase B chain {Para 99.94
d1jmxb_346 Quinohemoprotein amine dehydrogenase B chain {Pseu 99.94
d1l0qa2301 Surface layer protein {Archaeon Methanosarcina maz 99.94
d2madh_373 Methylamine dehydrogenase, H-chain {Gram negative 99.94
d1jmxb_346 Quinohemoprotein amine dehydrogenase B chain {Pseu 99.93
d2madh_373 Methylamine dehydrogenase, H-chain {Gram negative 99.93
d2bbkh_355 Methylamine dehydrogenase, H-chain {Paracoccus den 99.9
d1ri6a_333 Putative isomerase YbhE {Escherichia coli [TaxId: 99.89
d1ri6a_333 Putative isomerase YbhE {Escherichia coli [TaxId: 99.88
d2bbkh_355 Methylamine dehydrogenase, H-chain {Paracoccus den 99.88
d2bgra1470 Dipeptidyl peptidase IV/CD26, N-terminal domain {P 99.83
d2bgra1470 Dipeptidyl peptidase IV/CD26, N-terminal domain {P 99.78
d1mdah_368 Methylamine dehydrogenase, H-chain {Paracoccus den 99.78
d1mdah_368 Methylamine dehydrogenase, H-chain {Paracoccus den 99.77
d1qnia2441 Nitrous oxide reductase, N-terminal domain {Pseudo 99.69
d1qnia2441 Nitrous oxide reductase, N-terminal domain {Pseudo 99.61
d1jofa_365 3-carboxy-cis,cis-mucoante lactonizing enzyme {Neu 99.6
d1xfda1465 Dipeptidyl aminopeptidase-like protein 6, DPP6, N- 99.58
d1jofa_365 3-carboxy-cis,cis-mucoante lactonizing enzyme {Neu 99.57
d2p4oa1302 Hypothetical protein All0351 homologue {Nostoc pun 99.44
d2hqsa1269 TolB, C-terminal domain {Escherichia coli [TaxId: 99.43
d1rwia_260 Serine/threonine-protein kinase PknD {Mycobacteriu 99.38
d2hqsa1269 TolB, C-terminal domain {Escherichia coli [TaxId: 99.38
d1pjxa_314 Diisopropylfluorophosphatase (phosphotriesterase, 99.35
d2p4oa1302 Hypothetical protein All0351 homologue {Nostoc pun 99.35
d1xfda1465 Dipeptidyl aminopeptidase-like protein 6, DPP6, N- 99.31
d1rwia_260 Serine/threonine-protein kinase PknD {Mycobacteriu 99.31
d1pjxa_314 Diisopropylfluorophosphatase (phosphotriesterase, 99.25
d1q7fa_279 Brain tumor cg10719-pa {Fruit fly (Drosophila mela 99.13
d2dg1a1319 Lactonase Drp35 {Staphylococcus aureus [TaxId: 128 99.11
d1k32a2281 Tricorn protease N-terminal domain {Archaeon Therm 99.01
d1k32a2281 Tricorn protease N-terminal domain {Archaeon Therm 98.78
d2dg1a1319 Lactonase Drp35 {Staphylococcus aureus [TaxId: 128 98.73
d2ghsa1295 Regucalcin {Agrobacterium tumefaciens [TaxId: 358] 98.32
d2ghsa1295 Regucalcin {Agrobacterium tumefaciens [TaxId: 358] 98.26
d1fwxa2459 Nitrous oxide reductase, N-terminal domain {Paraco 98.15
d1kb0a2573 Quinoprotein alcohol dehydrogenase, N-terminal dom 98.07
d1k3ia3387 Galactose oxidase, central domain {Fungi (Fusarium 98.02
d1kb0a2573 Quinoprotein alcohol dehydrogenase, N-terminal dom 97.96
d2ad6a1571 Methanol dehydrogenase, heavy chain {Methylophilus 97.82
d1kv9a2560 Quinoprotein alcohol dehydrogenase, N-terminal dom 97.8
d1w6sa_596 Methanol dehydrogenase, heavy chain {Methylobacter 97.8
d1qfma1430 Prolyl oligopeptidase, N-terminal domain {Pig (Sus 97.64
d1w6sa_596 Methanol dehydrogenase, heavy chain {Methylobacter 97.52
d1kv9a2560 Quinoprotein alcohol dehydrogenase, N-terminal dom 97.42
d1fwxa2459 Nitrous oxide reductase, N-terminal domain {Paraco 97.29
d1ijqa1266 Low density lipoprotein (LDL) receptor {Human (Hom 97.27
d1k3ia3387 Galactose oxidase, central domain {Fungi (Fusarium 97.26
d1npea_263 Nidogen {Mouse (Mus musculus) [TaxId: 10090]} 97.11
d2ad6a1571 Methanol dehydrogenase, heavy chain {Methylophilus 96.96
d1utca2327 Clathrin heavy-chain terminal domain {Rat (Rattus 96.8
d1qfma1430 Prolyl oligopeptidase, N-terminal domain {Pig (Sus 96.75
d1flga_582 Ethanol dehydrogenase {Pseudomonas aeruginosa [Tax 96.46
d1utca2327 Clathrin heavy-chain terminal domain {Rat (Rattus 96.34
d1flga_582 Ethanol dehydrogenase {Pseudomonas aeruginosa [Tax 95.69
d1crua_450 Soluble quinoprotein glucose dehydrogenase {Acinet 88.27
d1xipa_381 Nucleoporin NUP159 {Baker's yeast (Saccharomyces c 80.12
>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All beta proteins
fold: 7-bladed beta-propeller
superfamily: WD40 repeat-like
family: WD40-repeat
domain: Groucho/tle1, C-terminal domain
species: Human (Homo sapiens) [TaxId: 9606]
Probab=100.00  E-value=5.5e-41  Score=283.89  Aligned_cols=293  Identities=13%  Similarity=0.165  Sum_probs=247.5

Q ss_pred             CEEEECCCCCCCCEEEEECCCCCEEEEEECCCCCEEEEECCCCCCEEEEEEEEEECCCCCCCEEEEEECCCCCCEEEEEE
Q ss_conf             12442135888956989718987599998286747999568986113420134313423421254331499866699999
Q 001490          301 TVAQTLIEGSSSPMSMDFHPVQHTLLLVGTNVGDTGLWDVNSGQKLFIRNFKVWDIGACSMLFKTALVRDPGVSVNRVVW  380 (1068)
Q Consensus       301 ~~~~~l~~h~~~V~~i~~spdg~~lla~g~~dg~v~iwd~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~h~~~V~~i~~  380 (1068)
                      +.+++| +|.+.|+|++|||+|+ +||+|+ ||.|+|||+.++.....              .......+|...|.+++|
T Consensus        43 ~~~~~~-~H~~~V~~v~fs~~g~-~latg~-dg~V~iWd~~~~~~~~~--------------~~~~~~~~h~~~I~~v~~  105 (337)
T d1gxra_          43 RQINTL-NHGEVVCAVTISNPTR-HVYTGG-KGCVKVWDISHPGNKSP--------------VSQLDCLNRDNYIRSCKL  105 (337)
T ss_dssp             EEEEEE-CCSSCCCEEEECSSSS-EEEEEC-BSEEEEEETTSTTCCSC--------------SEEEECSCTTSBEEEEEE
T ss_pred             EEEEEC-CCCCCEEEEEECCCCC-EEEEEE-CCEEEEEECCCCCCCCE--------------EEEEEECCCCCCEEEEEE
T ss_conf             499987-9999289999989999-999997-99889977367763311--------------687640488996899998


Q ss_pred             CCCCCEEEEEECCCEEEEEECCCCCCCCCEEEECCCCCCEEEEEECCCCCCEEEEEEECCCCEEEEECCCCCEEEEECCC
Q ss_conf             99999889995896899998368976421089735235587999718999179999928993999978999624695268
Q 001490          381 SPDGSLLGVAYSKHIVQLYAYHGGSDARQQLEIDAHVGNVNDLAFSAPCKQISVITCGDDKTIKVWDAVTGSRTYSFEGH  460 (1068)
Q Consensus       381 spdg~~las~~~dg~i~iwd~~~~~~~~~~~~~~~h~~~V~~i~~s~d~~~~~l~s~~~d~~i~iwd~~~~~~~~~~~~h  460 (1068)
                      +||+++|++++.|+.|++||+..... .....+..|...+.+++|+|++.  ++++++.|+.|++|++.+++......+|
T Consensus       106 s~dg~~l~s~~~dg~i~iwd~~~~~~-~~~~~~~~~~~~v~~~~~~~~~~--~l~s~~~d~~i~~~~~~~~~~~~~~~~~  182 (337)
T d1gxra_         106 LPDGCTLIVGGEASTLSIWDLAAPTP-RIKAELTSSAPACYALAISPDSK--VCFSCCSDGNIAVWDLHNQTLVRQFQGH  182 (337)
T ss_dssp             CTTSSEEEEEESSSEEEEEECCCC---EEEEEEECSSSCEEEEEECTTSS--EEEEEETTSCEEEEETTTTEEEEEECCC
T ss_pred             CCCCCEEEEEECCCCCCCCCCCCCCC-CCCCCCCCCCCCCCCCCCCCCCC--CCCCCCCCCCCCCCCCCCCCCCCCCCCC
T ss_conf             67998898861233211111111111-11111111111111111111111--1111111111111111111111111111


Q ss_pred             CCCEEEEEEEECCCCCEEEEEECCCCEEEEECCCCCCEEEECCCCCCEEEEEECCCCCEEEEEEECCCCCEEEEEEECCC
Q ss_conf             97679986310189319999985891999958899816872489971899998149988999960888940499994788
Q 001490          461 GAPVYSLCPHAKENIHFIFSISVDGKIKAWLYDSLGARVDYDAPGLGCTRMAYSANGRRLFSCGTSKEGESFLVEWNESE  540 (1068)
Q Consensus       461 ~~~v~~i~~~~~~~~~~l~s~~~dg~i~iwd~~~~~~~~~~~~~~~~i~~i~~s~d~~~l~~~~~~~~~~~~i~iwd~~~  540 (1068)
                      ...+.+++|++  ++..+++++.|+.+++||+++......+ .+...+.+++|+|+++++++++.    ++.+++||+.+
T Consensus       183 ~~~v~~l~~s~--~~~~~~~~~~d~~v~i~d~~~~~~~~~~-~~~~~i~~l~~~~~~~~l~~~~~----d~~i~i~d~~~  255 (337)
T d1gxra_         183 TDGASCIDISN--DGTKLWTGGLDNTVRSWDLREGRQLQQH-DFTSQIFSLGYCPTGEWLAVGME----SSNVEVLHVNK  255 (337)
T ss_dssp             SSCEEEEEECT--TSSEEEEEETTSEEEEEETTTTEEEEEE-ECSSCEEEEEECTTSSEEEEEET----TSCEEEEETTS
T ss_pred             CCCCCCCCCCC--CCCCCCCCCCCCCCCCCCCCCCEEECCC-CCCCCEEEEEECCCCCCCCEECC----CCCCCCCCCCC
T ss_conf             11111012344--4321122356655321111110000024-66661579997153030000002----56421111111


Q ss_pred             CEEEEEEECCCCCCCCEEEEEEECCCCEEEEEECCCEEEEEECCCCEEEEEEECCCCCCCCCEEEEECCCCEEEEEECCC
Q ss_conf             70556874233456873799991399989999789909999958980799990899989975299915999999998899
Q 001490          541 GAIKRTYQGLQLQHNSVSVVHFDTAKDQILAAGDDHVIKIWDMNKVQLLTTIDAGGGLPENPRICFNKNGTLLAVIANEN  620 (1068)
Q Consensus       541 ~~~~~~~~~~~~~~~~i~~i~~~~~~~~l~~~s~dg~i~iwd~~~~~~~~~~~~~~~~~~v~~v~~s~~~~~l~~~~~dg  620 (1068)
                      +... ....|.   ..|.+++|+|+++++++++.||.|++||..+++.+......   ..|.+++|+|++++|++++.|+
T Consensus       256 ~~~~-~~~~~~---~~i~~v~~s~~g~~l~s~s~Dg~i~iwd~~~~~~~~~~~~~---~~v~~~~~s~d~~~l~t~s~D~  328 (337)
T d1gxra_         256 PDKY-QLHLHE---SCVLSLKFAYCGKWFVSTGKDNLLNAWRTPYGASIFQSKES---SSVLSCDISVDDKYIVTGSGDK  328 (337)
T ss_dssp             SCEE-EECCCS---SCEEEEEECTTSSEEEEEETTSEEEEEETTTCCEEEEEECS---SCEEEEEECTTSCEEEEEETTS
T ss_pred             CCCC-CCCCCC---CCCCEEEECCCCCEEEEEECCCEEEEEECCCCCEEEECCCC---CCEEEEEEECCCCEEEEEECCC
T ss_conf             1100-001245---65416999899999999948996999989999799992699---9879999927999999990899


Q ss_pred             EEEEEEC
Q ss_conf             1999987
Q 001490          621 RIKILET  627 (1068)
Q Consensus       621 ~i~iwd~  627 (1068)
                      .|++|++
T Consensus       329 ~I~vWdl  335 (337)
T d1gxra_         329 KATVYEV  335 (337)
T ss_dssp             CEEEEEE
T ss_pred             EEEEEEE
T ss_conf             6999977



>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d2ovrb2 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d2ovrb2 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1pgua1 b.69.4.1 (A:2-326) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1pgua1 b.69.4.1 (A:2-326) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1qksa2 b.70.2.1 (A:136-567) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1hzua2 b.70.2.1 (A:118-543) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1sq9a_ b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1sq9a_ b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1p22a2 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yfqa_ b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1pgua2 b.69.4.1 (A:327-613) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1pgua2 b.69.4.1 (A:327-613) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1qksa2 b.70.2.1 (A:136-567) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1hzua2 b.70.2.1 (A:118-543) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1yfqa_ b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1p22a2 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k32a3 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1k32a3 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1l0qa2 b.69.2.3 (A:1-301) Surface layer protein {Archaeon Methanosarcina mazei [TaxId: 2209]} Back     information, alignment and structure
>d1pbyb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1pbyb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1jmxb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1l0qa2 b.69.2.3 (A:1-301) Surface layer protein {Archaeon Methanosarcina mazei [TaxId: 2209]} Back     information, alignment and structure
>d2madh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Gram negative methylotrophic bacteria (Thiobacillus versutus) [TaxId: 34007]} Back     information, alignment and structure
>d1jmxb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d2madh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Gram negative methylotrophic bacteria (Thiobacillus versutus) [TaxId: 34007]} Back     information, alignment and structure
>d2bbkh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1ri6a_ b.69.11.1 (A:) Putative isomerase YbhE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ri6a_ b.69.11.1 (A:) Putative isomerase YbhE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2bbkh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d2bgra1 b.70.3.1 (A:39-508) Dipeptidyl peptidase IV/CD26, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d2bgra1 b.70.3.1 (A:39-508) Dipeptidyl peptidase IV/CD26, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1mdah_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1mdah_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1qnia2 b.69.3.1 (A:10-450) Nitrous oxide reductase, N-terminal domain {Pseudomonas nautica [TaxId: 2743]} Back     information, alignment and structure
>d1qnia2 b.69.3.1 (A:10-450) Nitrous oxide reductase, N-terminal domain {Pseudomonas nautica [TaxId: 2743]} Back     information, alignment and structure
>d1jofa_ b.69.10.1 (A:) 3-carboxy-cis,cis-mucoante lactonizing enzyme {Neurospora crassa [TaxId: 5141]} Back     information, alignment and structure
>d1xfda1 b.70.3.1 (A:127-591) Dipeptidyl aminopeptidase-like protein 6, DPP6, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jofa_ b.69.10.1 (A:) 3-carboxy-cis,cis-mucoante lactonizing enzyme {Neurospora crassa [TaxId: 5141]} Back     information, alignment and structure
>d2p4oa1 b.68.6.3 (A:4-305) Hypothetical protein All0351 homologue {Nostoc punctiforme [TaxId: 272131]} Back     information, alignment and structure
>d2hqsa1 b.68.4.1 (A:163-431) TolB, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1rwia_ b.68.9.1 (A:) Serine/threonine-protein kinase PknD {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2hqsa1 b.68.4.1 (A:163-431) TolB, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1pjxa_ b.68.6.1 (A:) Diisopropylfluorophosphatase (phosphotriesterase, DFP) {Squid (Loligo vulgaris) [TaxId: 6622]} Back     information, alignment and structure
>d2p4oa1 b.68.6.3 (A:4-305) Hypothetical protein All0351 homologue {Nostoc punctiforme [TaxId: 272131]} Back     information, alignment and structure
>d1xfda1 b.70.3.1 (A:127-591) Dipeptidyl aminopeptidase-like protein 6, DPP6, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rwia_ b.68.9.1 (A:) Serine/threonine-protein kinase PknD {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1pjxa_ b.68.6.1 (A:) Diisopropylfluorophosphatase (phosphotriesterase, DFP) {Squid (Loligo vulgaris) [TaxId: 6622]} Back     information, alignment and structure
>d1q7fa_ b.68.9.1 (A:) Brain tumor cg10719-pa {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2dg1a1 b.68.6.1 (A:6-324) Lactonase Drp35 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1k32a2 b.68.7.1 (A:39-319) Tricorn protease N-terminal domain {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1k32a2 b.68.7.1 (A:39-319) Tricorn protease N-terminal domain {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d2dg1a1 b.68.6.1 (A:6-324) Lactonase Drp35 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d2ghsa1 b.68.6.1 (A:20-314) Regucalcin {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d2ghsa1 b.68.6.1 (A:20-314) Regucalcin {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1fwxa2 b.69.3.1 (A:8-451) Nitrous oxide reductase, N-terminal domain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1kb0a2 b.70.1.1 (A:1-573) Quinoprotein alcohol dehydrogenase, N-terminal domain {Comamonas testosteroni [TaxId: 285]} Back     information, alignment and structure
>d1k3ia3 b.69.1.1 (A:151-537) Galactose oxidase, central domain {Fungi (Fusarium sp.) [TaxId: 29916]} Back     information, alignment and structure
>d1kb0a2 b.70.1.1 (A:1-573) Quinoprotein alcohol dehydrogenase, N-terminal domain {Comamonas testosteroni [TaxId: 285]} Back     information, alignment and structure
>d2ad6a1 b.70.1.1 (A:1-571) Methanol dehydrogenase, heavy chain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} Back     information, alignment and structure
>d1kv9a2 b.70.1.1 (A:1-560) Quinoprotein alcohol dehydrogenase, N-terminal domain {Pseudomonas putida, hk5 [TaxId: 303]} Back     information, alignment and structure
>d1w6sa_ b.70.1.1 (A:) Methanol dehydrogenase, heavy chain {Methylobacterium extorquens [TaxId: 408]} Back     information, alignment and structure
>d1qfma1 b.69.7.1 (A:1-430) Prolyl oligopeptidase, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1w6sa_ b.70.1.1 (A:) Methanol dehydrogenase, heavy chain {Methylobacterium extorquens [TaxId: 408]} Back     information, alignment and structure
>d1kv9a2 b.70.1.1 (A:1-560) Quinoprotein alcohol dehydrogenase, N-terminal domain {Pseudomonas putida, hk5 [TaxId: 303]} Back     information, alignment and structure
>d1fwxa2 b.69.3.1 (A:8-451) Nitrous oxide reductase, N-terminal domain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1ijqa1 b.68.5.1 (A:377-642) Low density lipoprotein (LDL) receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k3ia3 b.69.1.1 (A:151-537) Galactose oxidase, central domain {Fungi (Fusarium sp.) [TaxId: 29916]} Back     information, alignment and structure
>d1npea_ b.68.5.1 (A:) Nidogen {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2ad6a1 b.70.1.1 (A:1-571) Methanol dehydrogenase, heavy chain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} Back     information, alignment and structure
>d1utca2 b.69.6.1 (A:4-330) Clathrin heavy-chain terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1qfma1 b.69.7.1 (A:1-430) Prolyl oligopeptidase, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1flga_ b.70.1.1 (A:) Ethanol dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1utca2 b.69.6.1 (A:4-330) Clathrin heavy-chain terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1flga_ b.70.1.1 (A:) Ethanol dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1crua_ b.68.2.1 (A:) Soluble quinoprotein glucose dehydrogenase {Acinetobacter calcoaceticus [TaxId: 471]} Back     information, alignment and structure
>d1xipa_ b.69.14.1 (A:) Nucleoporin NUP159 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure