Citrus Sinensis ID: 001501
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
|
|
Close Homologs for Annotation Transfer
Close Homologs in SWISS-PROT Database Detected by BLAST 
Original result of BLAST against SWISS-PROT Database
| ID | Alignment graph | Length |
Definition |
RBH(Q2H) |
RBH(H2Q) |
Q cover |
H cover |
Identity |
E-value |
| Query | 1066 | 2.2.26 [Sep-21-2011] | |||||||
| Q9FJR0 | 1254 | Regulator of nonsense tra | yes | no | 0.728 | 0.619 | 0.860 | 0.0 | |
| Q92900 | 1129 | Regulator of nonsense tra | yes | no | 0.709 | 0.669 | 0.589 | 0.0 | |
| Q9EPU0 | 1124 | Regulator of nonsense tra | yes | no | 0.705 | 0.669 | 0.589 | 0.0 | |
| Q98TR3 | 1097 | Putative regulator of non | N/A | no | 0.632 | 0.614 | 0.618 | 0.0 | |
| Q9HEH1 | 1093 | Regulator of nonsense tra | N/A | no | 0.565 | 0.551 | 0.661 | 0.0 | |
| Q9VYS3 | 1180 | Regulator of nonsense tra | yes | no | 0.561 | 0.507 | 0.646 | 0.0 | |
| Q09820 | 925 | ATP-dependent helicase up | yes | no | 0.563 | 0.649 | 0.597 | 0.0 | |
| P30771 | 971 | ATP-dependent helicase NA | yes | no | 0.557 | 0.611 | 0.590 | 0.0 | |
| O76512 | 1069 | Regulator of nonsense tra | yes | no | 0.549 | 0.548 | 0.575 | 0.0 | |
| Q54I89 | 1331 | Regulator of nonsense tra | yes | no | 0.568 | 0.455 | 0.571 | 0.0 |
| >sp|Q9FJR0|RENT1_ARATH Regulator of nonsense transcripts 1 homolog OS=Arabidopsis thaliana GN=UPF1 PE=1 SV=2 | Back alignment and function desciption |
|---|
Score = 1395 bits (3610), Expect = 0.0, Method: Compositional matrix adjust.
Identities = 687/798 (86%), Positives = 730/798 (91%), Gaps = 21/798 (2%)
Query: 240 MMKESQSKDNVTIRWDIGLNKKRVAYFVFPKEDNELRLVPGDELRLRYSGDAAHPAWQSV 299
MMKESQSK+N+T+RWDIGLNKKRVAYFVFPKE+NELRLVPGDELRLRYSGDA HP+WQSV
Sbjct: 338 MMKESQSKENLTVRWDIGLNKKRVAYFVFPKEENELRLVPGDELRLRYSGDAVHPSWQSV 397
Query: 300 GHVIKLTAQEEVALELRASQGVPVDINHGFSVDFVWKSTSFDRMQGAMKTFAVDETSVSG 359
GHVIKLTAQEEVALELRA+QGVP+D+NHGFSVDFVWKSTSFDRMQGAMK FAVDETSVSG
Sbjct: 398 GHVIKLTAQEEVALELRANQGVPIDVNHGFSVDFVWKSTSFDRMQGAMKNFAVDETSVSG 457
Query: 360 YIYHHLLGHEVEVQMVRNTLPRRFGAPGLPELNASQVFAVKSVLQRPISLIQGPPGTGKT 419
YIYH LLGHEVE QMVRNTLPRRFG PGLPELNASQV AVKSVLQ+PISLIQGPPGTGKT
Sbjct: 458 YIYHQLLGHEVEAQMVRNTLPRRFGVPGLPELNASQVNAVKSVLQKPISLIQGPPGTGKT 517
Query: 420 VTSAAIVYHMAKQGQGQVLVCAPSNVAVDQLAEKISATGLKVVRLCAKSREAVSSPVEHL 479
VTSAAIVYHMAKQGQGQVLVCAPSNVAVDQLAEKISATGLKVVRLCAKSREAVSSPVE+L
Sbjct: 518 VTSAAIVYHMAKQGQGQVLVCAPSNVAVDQLAEKISATGLKVVRLCAKSREAVSSPVEYL 577
Query: 480 TLHYQVRHLDTSEKSELHKLQQLKDEQGELSSSDEKKYKALKRATEREISQSADVICCTC 539
TLHYQVRHLDTSEKSELHKLQQLKDEQGELSSSDEKKYK LKRATEREI+QSADVICCTC
Sbjct: 578 TLHYQVRHLDTSEKSELHKLQQLKDEQGELSSSDEKKYKNLKRATEREITQSADVICCTC 637
Query: 540 VGAGDPRLANFRFRQVLIDESTQATEPECLIPLVLGAKQVVLVGDHCQLGPVIMCKKAAR 599
VGA D RL+NFRFRQVLIDESTQATEPECLIPLVLG KQVVLVGDHCQLGPVIMCKKAAR
Sbjct: 638 VGAADLRLSNFRFRQVLIDESTQATEPECLIPLVLGVKQVVLVGDHCQLGPVIMCKKAAR 697
Query: 600 AGLAQSLFERLVLLGLKPIRLQVQYRMHPSLSEFPSNSFYEGTLQNGVTINERQSSGIDF 659
AGLAQSLFERLV LG+KPIRLQVQYRMHP+LSEFPSNSFYEGTLQNGVTI ERQ++GIDF
Sbjct: 698 AGLAQSLFERLVTLGIKPIRLQVQYRMHPALSEFPSNSFYEGTLQNGVTIIERQTTGIDF 757
Query: 660 PWPVPNRPMFFYVQMGQEEISASGTSYLNRTEAANVEKIVTTFLRSGVVPSQIGVITPYE 719
PWPVPNRPMFFYVQ+GQEEISASGTSYLNRTEAANVEK+VT FL+SGVVPSQIGVITPYE
Sbjct: 758 PWPVPNRPMFFYVQLGQEEISASGTSYLNRTEAANVEKLVTAFLKSGVVPSQIGVITPYE 817
Query: 720 GQRAYIVNYMSRNGALRQQLYKEIEVASVDSFQGREKDYIILSCVRSNEHQGIGFLNDPR 779
GQRAYIVNYM+RNG+LRQQLYKEIEVASVDSFQGREKDYIILSCVRSNEHQGIGFLNDPR
Sbjct: 818 GQRAYIVNYMARNGSLRQQLYKEIEVASVDSFQGREKDYIILSCVRSNEHQGIGFLNDPR 877
Query: 780 RLNVALTRARYGIVILGNPKVLSKQPLWNGLLTHYKEHECLVEGPLNNLKQSMVQFQKPK 839
RLNVALTRARYGIVILGNPKVLSKQPLWNGLLTHYKEHECLVEGPLNNLKQSMVQFQKP+
Sbjct: 878 RLNVALTRARYGIVILGNPKVLSKQPLWNGLLTHYKEHECLVEGPLNNLKQSMVQFQKPR 937
Query: 840 KIYNDRRLFFGAGPGIVPND-ISTSNPNAD---RRGSRARGYMPPGPPNGTHKPGLHPAG 895
KIYNDRRLF+G G G++ ND + NPNAD RG Y+P GPPNG +PGLHPAG
Sbjct: 938 KIYNDRRLFYGGGAGMIGNDNFGSGNPNADRRGSRGRAGGSYLPSGPPNGA-RPGLHPAG 996
Query: 896 FPMPRVPLPPFQGGPPSQPYAIPSRGAVHGPVGAVHHVPPPGSRGFGAGRGSAGAPIGSH 955
+P+PRVPL PF GGPPSQPYAIP+R GPVGAV H P PG+ GFGAGRG++ +G H
Sbjct: 997 YPIPRVPLSPFPGGPPSQPYAIPTR----GPVGAVPHAPQPGNHGFGAGRGTS---VGGH 1049
Query: 956 LQHQQNTQQPIGTIGSTFNFPSLENSNSQPSVGGPLTQPGFVNNMPVQGPSQTFRDGFSV 1015
L HQQ TQ +GTIG + NFP L++ NSQPS GGPL+QPG+ SQ FRDGFS+
Sbjct: 1050 LPHQQATQHNVGTIGPSLNFP-LDSPNSQPSPGGPLSQPGY--------GSQAFRDGFSM 1100
Query: 1016 GSMSQDFLGDDFKSQGSH 1033
G +SQDFL DD KSQGSH
Sbjct: 1101 GGISQDFLADDIKSQGSH 1118
|
Eliminates the production of nonsense-containing RNAs. Arabidopsis thaliana (taxid: 3702) EC: 3EC: .EC: 6EC: .EC: 4EC: .EC: - |
| >sp|Q92900|RENT1_HUMAN Regulator of nonsense transcripts 1 OS=Homo sapiens GN=UPF1 PE=1 SV=2 | Back alignment and function description |
|---|
| >sp|Q9EPU0|RENT1_MOUSE Regulator of nonsense transcripts 1 OS=Mus musculus GN=Upf1 PE=1 SV=2 | Back alignment and function description |
|---|
| >sp|Q98TR3|RENT1_TAKRU Putative regulator of nonsense transcripts 1 OS=Takifugu rubripes GN=rent1 PE=3 SV=1 | Back alignment and function description |
|---|
| >sp|Q9HEH1|RENT1_NEUCR Regulator of nonsense transcripts 1 homolog OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=2E4.130 PE=3 SV=1 | Back alignment and function description |
|---|
| >sp|Q9VYS3|RENT1_DROME Regulator of nonsense transcripts 1 homolog OS=Drosophila melanogaster GN=Upf1 PE=1 SV=2 | Back alignment and function description |
|---|
| >sp|Q09820|RENT1_SCHPO ATP-dependent helicase upf1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=upf1 PE=3 SV=2 | Back alignment and function description |
|---|
| >sp|P30771|NAM7_YEAST ATP-dependent helicase NAM7 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NAM7 PE=1 SV=1 | Back alignment and function description |
|---|
| >sp|O76512|RENT1_CAEEL Regulator of nonsense transcripts 1 OS=Caenorhabditis elegans GN=smg-2 PE=1 SV=1 | Back alignment and function description |
|---|
| >sp|Q54I89|RENT1_DICDI Regulator of nonsense transcripts 1 OS=Dictyostelium discoideum GN=upf1 PE=3 SV=1 | Back alignment and function description |
|---|
Close Homologs in the Non-Redundant Database Detected by BLAST
Original result of BLAST against Nonredundant Database
| GI | Alignment Graph | Length |
Definition |
Q cover |
H cover |
Identity |
E-value |
| Query | 1066 | ||||||
| 359474491 | 1267 | PREDICTED: regulator of nonsense transcr | 0.745 | 0.627 | 0.952 | 0.0 | |
| 255575790 | 1280 | nonsense-mediated mRNA decay protein, pu | 0.745 | 0.621 | 0.948 | 0.0 | |
| 356497066 | 1266 | PREDICTED: regulator of nonsense transcr | 0.740 | 0.623 | 0.918 | 0.0 | |
| 449511522 | 1268 | PREDICTED: regulator of nonsense transcr | 0.744 | 0.626 | 0.922 | 0.0 | |
| 357482277 | 1253 | Regulator of nonsense transcripts-like p | 0.742 | 0.631 | 0.922 | 0.0 | |
| 356541331 | 1270 | PREDICTED: regulator of nonsense transcr | 0.737 | 0.618 | 0.912 | 0.0 | |
| 224138824 | 1256 | predicted protein [Populus trichocarpa] | 0.733 | 0.622 | 0.916 | 0.0 | |
| 224126379 | 1242 | predicted protein [Populus trichocarpa] | 0.717 | 0.615 | 0.898 | 0.0 | |
| 50509972 | 1277 | putative type 1 RNA helicase [Oryza sati | 0.743 | 0.620 | 0.873 | 0.0 | |
| 218199657 | 1277 | hypothetical protein OsI_26082 [Oryza sa | 0.743 | 0.620 | 0.873 | 0.0 |
| >gi|359474491|ref|XP_002279304.2| PREDICTED: regulator of nonsense transcripts 1 homolog [Vitis vinifera] gi|297742168|emb|CBI33955.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
Score = 1572 bits (4071), Expect = 0.0, Method: Compositional matrix adjust.
Identities = 762/800 (95%), Positives = 780/800 (97%), Gaps = 5/800 (0%)
Query: 240 MMKESQSKDNVTIRWDIGLNKKRVAYFVFPKEDNELRLVPGDELRLRYSGDAAHPAWQSV 299
MMKESQSKDNVTIRWDIGLNKKR+AYFVFPKEDNELRLVPGDELRLRYSGDAAHPAWQSV
Sbjct: 323 MMKESQSKDNVTIRWDIGLNKKRIAYFVFPKEDNELRLVPGDELRLRYSGDAAHPAWQSV 382
Query: 300 GHVIKLTAQEEVALELRASQGVPVDINHGFSVDFVWKSTSFDRMQGAMKTFAVDETSVSG 359
GHVIKLTAQEEVALELRASQGVPVD+NHGFSVDFVWKSTSFDRMQGAMKTFAVDETSVSG
Sbjct: 383 GHVIKLTAQEEVALELRASQGVPVDVNHGFSVDFVWKSTSFDRMQGAMKTFAVDETSVSG 442
Query: 360 YIYHHLLGHEVEVQMVRNTLPRRFGAPGLPELNASQVFAVKSVLQRPISLIQGPPGTGKT 419
YIYHHLLGHEVEVQMVRNTLPRRFGAPGLPELNASQVFAVKSVLQ+PISLIQGPPGTGKT
Sbjct: 443 YIYHHLLGHEVEVQMVRNTLPRRFGAPGLPELNASQVFAVKSVLQKPISLIQGPPGTGKT 502
Query: 420 VTSAAIVYHMAKQGQGQVLVCAPSNVAVDQLAEKISATGLKVVRLCAKSREAVSSPVEHL 479
VTSAAIVYHMAKQGQGQVLVCAPSNVAVDQLAEKISATGLKVVRLCAKSREAVSSPVEHL
Sbjct: 503 VTSAAIVYHMAKQGQGQVLVCAPSNVAVDQLAEKISATGLKVVRLCAKSREAVSSPVEHL 562
Query: 480 TLHYQVRHLDTSEKSELHKLQQLKDEQGELSSSDEKKYKALKRATEREISQSADVICCTC 539
TLHYQVRHLDTSEKSELHKLQQLKDEQGELSSSDEKKYKALKRATEREISQSADVICCTC
Sbjct: 563 TLHYQVRHLDTSEKSELHKLQQLKDEQGELSSSDEKKYKALKRATEREISQSADVICCTC 622
Query: 540 VGAGDPRLANFRFRQVLIDESTQATEPECLIPLVLGAKQVVLVGDHCQLGPVIMCKKAAR 599
VGAGDPRLANFRFRQVLIDESTQATEPECLIPLVLG KQVVLVGDHCQLGPVIMCKKAAR
Sbjct: 623 VGAGDPRLANFRFRQVLIDESTQATEPECLIPLVLGVKQVVLVGDHCQLGPVIMCKKAAR 682
Query: 600 AGLAQSLFERLVLLGLKPIRLQVQYRMHPSLSEFPSNSFYEGTLQNGVTINERQSSGIDF 659
AGLAQSLFERLVLLG+KPIRLQVQYRMHPSLSEFPSNSFYEGTLQNGVTINERQSSGIDF
Sbjct: 683 AGLAQSLFERLVLLGVKPIRLQVQYRMHPSLSEFPSNSFYEGTLQNGVTINERQSSGIDF 742
Query: 660 PWPVPNRPMFFYVQMGQEEISASGTSYLNRTEAANVEKIVTTFLRSGVVPSQIGVITPYE 719
PWPVPNRPMFFYVQMGQEEISASGTSYLNRTEAANVEKIVTTFLRSGVVPSQIGVITPYE
Sbjct: 743 PWPVPNRPMFFYVQMGQEEISASGTSYLNRTEAANVEKIVTTFLRSGVVPSQIGVITPYE 802
Query: 720 GQRAYIVNYMSRNGALRQQLYKEIEVASVDSFQGREKDYIILSCVRSNEHQGIGFLNDPR 779
GQRAYIVNYMSRNGALRQQLYKEIEVASVDSFQGREKDYIILSCVRSNEHQGIGFLNDPR
Sbjct: 803 GQRAYIVNYMSRNGALRQQLYKEIEVASVDSFQGREKDYIILSCVRSNEHQGIGFLNDPR 862
Query: 780 RLNVALTRARYGIVILGNPKVLSKQPLWNGLLTHYKEHECLVEGPLNNLKQSMVQFQKPK 839
RLNVALTRARYGIVILGNPKVLSKQPLWN LLTHYKEHECLVEGPLNNLKQSMVQFQKPK
Sbjct: 863 RLNVALTRARYGIVILGNPKVLSKQPLWNSLLTHYKEHECLVEGPLNNLKQSMVQFQKPK 922
Query: 840 KIYNDRRLFFGAGPGIVPND----ISTSNPNADRRGSRARG-YMPPGPPNGTHKPGLHPA 894
KIYNDRRLFFG GPGIVPND +++S+P+ADRR SR RG YMP GPPNGTHKPG+HPA
Sbjct: 923 KIYNDRRLFFGGGPGIVPNDNFGTVTSSSPSADRRSSRGRGSYMPSGPPNGTHKPGVHPA 982
Query: 895 GFPMPRVPLPPFQGGPPSQPYAIPSRGAVHGPVGAVHHVPPPGSRGFGAGRGSAGAPIGS 954
GFPMPRVPLPPF GGPPSQPYAIP+RGAVHGPVGAV HVPPPGSRGFGAGRG+AGAPIGS
Sbjct: 983 GFPMPRVPLPPFHGGPPSQPYAIPTRGAVHGPVGAVPHVPPPGSRGFGAGRGNAGAPIGS 1042
Query: 955 HLQHQQNTQQPIGTIGSTFNFPSLENSNSQPSVGGPLTQPGFVNNMPVQGPSQTFRDGFS 1014
HL HQQ +QQ +G +GSTFNFP+LEN NSQPSVGGPL+QPGFV NMPVQGPSQTFRDGFS
Sbjct: 1043 HLPHQQGSQQAVGNLGSTFNFPALENPNSQPSVGGPLSQPGFVTNMPVQGPSQTFRDGFS 1102
Query: 1015 VGSMSQDFLGDDFKSQGSHV 1034
+G MSQDFLGDDFKSQGSHV
Sbjct: 1103 IGGMSQDFLGDDFKSQGSHV 1122
|
Source: Vitis vinifera Species: Vitis vinifera Genus: Vitis Family: Vitaceae Order: Vitales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|255575790|ref|XP_002528794.1| nonsense-mediated mRNA decay protein, putative [Ricinus communis] gi|223531797|gb|EEF33616.1| nonsense-mediated mRNA decay protein, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|356497066|ref|XP_003517385.1| PREDICTED: regulator of nonsense transcripts 1 homolog [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|449511522|ref|XP_004163978.1| PREDICTED: regulator of nonsense transcripts 1 homolog [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|357482277|ref|XP_003611424.1| Regulator of nonsense transcripts-like protein [Medicago truncatula] gi|355512759|gb|AES94382.1| Regulator of nonsense transcripts-like protein [Medicago truncatula] | Back alignment and taxonomy information |
|---|
| >gi|356541331|ref|XP_003539131.1| PREDICTED: regulator of nonsense transcripts 1 homolog [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|224138824|ref|XP_002326699.1| predicted protein [Populus trichocarpa] gi|222834021|gb|EEE72498.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|224126379|ref|XP_002329539.1| predicted protein [Populus trichocarpa] gi|222870248|gb|EEF07379.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|50509972|dbj|BAD30435.1| putative type 1 RNA helicase [Oryza sativa Japonica Group] gi|222637078|gb|EEE67210.1| hypothetical protein OsJ_24327 [Oryza sativa Japonica Group] | Back alignment and taxonomy information |
|---|
| >gi|218199657|gb|EEC82084.1| hypothetical protein OsI_26082 [Oryza sativa Indica Group] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST
Original result of BLAST against Gene Ontology (AMIGO)
| ID |
Alignment graph |
Length |
Definition |
Q cover |
H cover |
Identity |
E-value |
| Query | 1066 | ||||||
| TAIR|locus:2171007 | 1254 | LBA1 "LOW-LEVEL BETA-AMYLASE 1 | 0.728 | 0.619 | 0.845 | 0.0 | |
| UNIPROTKB|E1C0J4 | 1117 | UPF1 "Uncharacterized protein" | 0.630 | 0.601 | 0.657 | 2e-301 | |
| MGI|MGI:107995 | 1124 | Upf1 "UPF1 regulator of nonsen | 0.562 | 0.533 | 0.706 | 1.3e-299 | |
| ZFIN|ZDB-GENE-040426-2836 | 1100 | upf1 "upf1 regulator of nonsen | 0.622 | 0.603 | 0.661 | 2.6e-299 | |
| UNIPROTKB|E1C0J3 | 1128 | UPF1 "Uncharacterized protein" | 0.630 | 0.595 | 0.646 | 2.4e-298 | |
| UNIPROTKB|Q92900 | 1129 | UPF1 "Regulator of nonsense tr | 0.618 | 0.583 | 0.651 | 1.3e-297 | |
| UNIPROTKB|E1BEK9 | 1127 | UPF1 "Uncharacterized protein" | 0.618 | 0.584 | 0.653 | 1.3e-297 | |
| UNIPROTKB|E2RL81 | 1130 | UPF1 "Uncharacterized protein" | 0.618 | 0.583 | 0.653 | 1.3e-297 | |
| FB|FBgn0030354 | 1180 | Upf1 "Upf1" [Drosophila melano | 0.616 | 0.556 | 0.607 | 1.8e-262 | |
| UNIPROTKB|G4ND47 | 1105 | MGG_00976 "Regulator-nonsense | 0.593 | 0.572 | 0.634 | 2.3e-262 |
| TAIR|locus:2171007 LBA1 "LOW-LEVEL BETA-AMYLASE 1" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 3472 (1227.3 bits), Expect = 0., Sum P(2) = 0.
Identities = 675/798 (84%), Positives = 715/798 (89%)
Query: 240 MMKESQSKDNVTIRWDIGLNKKRVAYFVFPKEDNELRLVPGDELRLRYSGDAAHPAWQSV 299
MMKESQSK+N+T+RWDIGLNKKRVAYFVFPKE+NELRLVPGDELRLRYSGDA HP+WQSV
Sbjct: 338 MMKESQSKENLTVRWDIGLNKKRVAYFVFPKEENELRLVPGDELRLRYSGDAVHPSWQSV 397
Query: 300 GHVIKLTAQEEVALELRASQGVPVDINHGFSVDFVWKSTSFDRMQGAMKTFAVDETSVSG 359
GHVIKLTAQEEVALELRA+QGVP+D+NHGFSVDFVWKSTSFDRMQGAMK FAVDETSVSG
Sbjct: 398 GHVIKLTAQEEVALELRANQGVPIDVNHGFSVDFVWKSTSFDRMQGAMKNFAVDETSVSG 457
Query: 360 YIYHHLLGHEVEVQMVRNTLPRRFGAPGLPELNASQVFAVKSVLQRPISLIQGPPGTGKT 419
YIYH LLGHEVE QMVRNTLPRRFG PGLPELNASQV AVKSVLQ+PISLIQGPPGTGKT
Sbjct: 458 YIYHQLLGHEVEAQMVRNTLPRRFGVPGLPELNASQVNAVKSVLQKPISLIQGPPGTGKT 517
Query: 420 VTSAAIVYHMAKQGQGQVLVCAPSNVAVDQLAEKISATGLKVVRLCAKSREAVSSPVEHL 479
VTSAAIVYHMAKQGQGQVLVCAPSNVAVDQLAEKISATGLKVVRLCAKSREAVSSPVE+L
Sbjct: 518 VTSAAIVYHMAKQGQGQVLVCAPSNVAVDQLAEKISATGLKVVRLCAKSREAVSSPVEYL 577
Query: 480 TLHYQVRHLDTSEKSELHKLQQLKDEQGELSSSDEKKYKALKRATEREISQSADVICCTC 539
TLHYQVRHLDTSEKSELHKLQQLKDEQGELSSSDEKKYK LKRATEREI+QSADVICCTC
Sbjct: 578 TLHYQVRHLDTSEKSELHKLQQLKDEQGELSSSDEKKYKNLKRATEREITQSADVICCTC 637
Query: 540 VGAGDPRLANFRFRQVLIDESTQATEPECLIPLVLGAKQVVLVGDHCQLGPVIMCKKAAR 599
VGA D RL+NFRFRQVLIDESTQATEPECLIPLVLG KQVVLVGDHCQLGPVIMCKKAAR
Sbjct: 638 VGAADLRLSNFRFRQVLIDESTQATEPECLIPLVLGVKQVVLVGDHCQLGPVIMCKKAAR 697
Query: 600 AGLAQSLFERLVLLGLKPIRLQVQYRMHPSLSEFPSNSFYEGTLQNGVTINERQSSGIDF 659
AGLAQSLFERLV LG+KPIRLQVQYRMHP+LSEFPSNSFYEGTLQNGVTI ERQ++GIDF
Sbjct: 698 AGLAQSLFERLVTLGIKPIRLQVQYRMHPALSEFPSNSFYEGTLQNGVTIIERQTTGIDF 757
Query: 660 PWPVPNRPMFFYVQMGQEEISASGTSYLNRTEAANVEKIVTTFLRSGVVPSQIGVITPYE 719
PWPVPNRPMFFYVQ+GQEEISASGTSYLNRTEAANVEK+VT FL+SGVVPSQIGVITPYE
Sbjct: 758 PWPVPNRPMFFYVQLGQEEISASGTSYLNRTEAANVEKLVTAFLKSGVVPSQIGVITPYE 817
Query: 720 GQRAYIVNYMSRNGALRQQLYKEIEVASVDSFQGREKDYIILSCVRSNEHQGIGFLNDPR 779
GQRAYIVNYM+RNG+LRQQLYKEIEVASVDSFQGREKDYIILSCVRSNEHQGIGFLNDPR
Sbjct: 818 GQRAYIVNYMARNGSLRQQLYKEIEVASVDSFQGREKDYIILSCVRSNEHQGIGFLNDPR 877
Query: 780 RLNVALTRARYGIVILGNPKVLSKQPLWNGLLTHYKEHECLVEGPLNNLKQSMVQFQKPK 839
RLNVALTRARYGIVILGNPKVLSKQPLWNGLLTHYKEHECLVEGPLNNLKQSMVQFQKP+
Sbjct: 878 RLNVALTRARYGIVILGNPKVLSKQPLWNGLLTHYKEHECLVEGPLNNLKQSMVQFQKPR 937
Query: 840 KIYNDRRLFFGAGPGIVPND-ISTSNPNADRRGSRARG---YMPPGPPNGTHKPGLHPAG 895
KIYNDRRLF+G G G++ ND + NPNADRRGSR R Y+P GPPNG +PGLHPAG
Sbjct: 938 KIYNDRRLFYGGGAGMIGNDNFGSGNPNADRRGSRGRAGGSYLPSGPPNGA-RPGLHPAG 996
Query: 896 FPMPRVPLPPFQGGPPSQPYAIPSRXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIGSH 955
+P+PRVPL PF GGPPSQPYAIP+R +G H
Sbjct: 997 YPIPRVPLSPFPGGPPSQPYAIPTRGPVGAVPHAPQPGNHGFGAGRGTS-------VGGH 1049
Query: 956 LQHQQNTQQPIGTIGSTFNFPSLENSNSQPSVGGPLTQPGFVNNMPVQGPSQTFRDGFSV 1015
L HQQ TQ +GTIG + NFP L++ NSQPS GGPL+QPG+ G SQ FRDGFS+
Sbjct: 1050 LPHQQATQHNVGTIGPSLNFP-LDSPNSQPSPGGPLSQPGY-------G-SQAFRDGFSM 1100
Query: 1016 GSMSQDFLGDDFKSQGSH 1033
G +SQDFL DD KSQGSH
Sbjct: 1101 GGISQDFLADDIKSQGSH 1118
|
|
| UNIPROTKB|E1C0J4 UPF1 "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:107995 Upf1 "UPF1 regulator of nonsense transcripts homolog (yeast)" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-040426-2836 upf1 "upf1 regulator of nonsense transcripts homolog (yeast)" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E1C0J3 UPF1 "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q92900 UPF1 "Regulator of nonsense transcripts 1" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E1BEK9 UPF1 "Uncharacterized protein" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E2RL81 UPF1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| FB|FBgn0030354 Upf1 "Upf1" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|G4ND47 MGG_00976 "Regulator-nonsense transcripts 1" [Magnaporthe oryzae 70-15 (taxid:242507)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Annotation Transfer from SWISS-PROT Entries
Original result of BLAST against SWISS-PROT
| ID | Name | Annotated EC number | Identity | Query coverage | Hit coverage | RBH(Q2H) | RBH(H2Q) |
| Q9FJR0 | RENT1_ARATH | 3, ., 6, ., 4, ., - | 0.8609 | 0.7288 | 0.6196 | yes | no |
| Q92900 | RENT1_HUMAN | 3, ., 6, ., 4, ., - | 0.5894 | 0.7091 | 0.6696 | yes | no |
| Q9EPU0 | RENT1_MOUSE | 3, ., 6, ., 4, ., - | 0.5890 | 0.7054 | 0.6690 | yes | no |
EC Number Prediction by Ezypred Server
Original result from Ezypred Server
Fail to connect to Ezypred Server
EC Number Prediction by EFICAz Software
| Prediction Level | EC number | Confidence of Prediction |
| 3rd Layer | 3.6.4.12 | LOW CONFIDENCE prediction! |
| 3rd Layer | 3.6.4 | 0.691 |
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING
Original result from the STRING server
Fail to connect to STRING server
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST
Original result of RPS-BLAST against CDD database part I
| ID | Alignment Graph | Length |
Definition |
E-value |
| Query | 1066 | |||
| COG1112 | 767 | COG1112, COG1112, Superfamily I DNA and RNA helica | 1e-101 | |
| TIGR00376 | 637 | TIGR00376, TIGR00376, DNA helicase, putative | 1e-86 | |
| pfam13087 | 195 | pfam13087, AAA_12, AAA domain | 1e-81 | |
| pfam13086 | 220 | pfam13086, AAA_11, AAA domain | 5e-71 | |
| pfam09416 | 152 | pfam09416, UPF1_Zn_bind, RNA helicase (UPF2 intera | 2e-63 | |
| pfam13245 | 73 | pfam13245, AAA_19, Part of AAA domain | 2e-11 | |
| TIGR01447 | 586 | TIGR01447, recD, exodeoxyribonuclease V, alpha sub | 5e-09 | |
| pfam13604 | 195 | pfam13604, AAA_30, AAA domain | 1e-08 | |
| pfam04851 | 100 | pfam04851, ResIII, Type III restriction enzyme, re | 8e-08 | |
| smart00487 | 201 | smart00487, DEXDc, DEAD-like helicases superfamily | 2e-07 | |
| cd00046 | 144 | cd00046, DEXDc, DEAD-like helicases superfamily | 2e-06 | |
| TIGR01448 | 720 | TIGR01448, recD_rel, helicase, putative, RecD/TraA | 1e-05 | |
| PRK10875 | 615 | PRK10875, recD, exonuclease V subunit alpha; Provi | 1e-04 | |
| COG1061 | 442 | COG1061, SSL2, DNA or RNA helicases of superfamily | 3e-04 | |
| pfam09770 | 804 | pfam09770, PAT1, Topoisomerase II-associated prote | 0.002 | |
| TIGR00643 | 630 | TIGR00643, recG, ATP-dependent DNA helicase RecG | 0.002 | |
| COG1199 | 654 | COG1199, DinG, Rad3-related DNA helicases [Transcr | 0.003 | |
| TIGR00959 | 428 | TIGR00959, ffh, signal recognition particle protei | 0.004 |
| >gnl|CDD|224037 COG1112, COG1112, Superfamily I DNA and RNA helicases and helicase subunits [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
Score = 335 bits (859), Expect = e-101
Identities = 170/598 (28%), Positives = 263/598 (43%), Gaps = 32/598 (5%)
Query: 248 DNVTIRWDIGLNKKRVAYFVFP-KEDNELR-------LVPGDELRLRYSGDAAHPAWQSV 299
+ I + L K P E E+R L + + LR + + +
Sbjct: 182 AGLLIEYLKRLRKVLDKIIPPPLFEKEEVRVDIVENLLELSESILLRRELELLS-KFALI 240
Query: 300 GHVIKLTAQEEVALELRASQG---VPVDINHGFSVDFVWKSTSFDRMQGAMKTFAVDE-T 355
+ L + E+ V +++ + + R+ F + +
Sbjct: 241 LKRL-LESLFEILRGKDLPIKLLDVELELVEINKELDNEQKLAVKRLLSLNDLFLIHQGP 299
Query: 356 SVSGYIYHHLLGHEVEVQMVRNTLPRRFGAPGLPELNASQVFAVKSVLQRPISLIQGPPG 415
+G + + + N L A ++ ++V++ + I P
Sbjct: 300 FGTGKTRSVTILELIIELLENNKLKILPTAESNAAVDNLLRRLKRTVIKVELLRIGHPSR 359
Query: 416 TGKTVTSAAIVYHMAKQGQGQVLVCAPSNVAVDQLAEKISATGLKVVRLCAKSREAVSSP 475
K + + + K + A +D++ ++ G +++R AK RE +
Sbjct: 360 VLKKLKLDTLEELLEKHEIPGNKIAA-----LDKVIRELREEGERIIREIAKLRERLERK 414
Query: 476 VEHLTLHYQVRHLDTSEKSELHKLQQLKDEQGELSSSDEKKYKALKRATEREISQSADVI 535
H V K + L E K+ + LK+ +I ++ADV+
Sbjct: 415 RLDKISHLNVALRGILPALN--KSEALWISLEEKQKKILKELRRLKKKAVTKILEAADVV 472
Query: 536 CCTCVGAGDPRLANFRFRQVLIDESTQATEPECLIPLVLGAKQVVLVGDHCQLGPVIMCK 595
T AG L + F V+IDE++QATEP LI L AK+V+LVGDH QL P + K
Sbjct: 473 LSTLSIAGFSILKKYEFDYVIIDEASQATEPSALIALSR-AKKVILVGDHKQLPPTVFFK 531
Query: 596 KAARAGLAQSLFERLVLLGL-KPIRLQVQYRMHPSLSEFPSNSFYEGTLQNGVTINERQS 654
+++ GL+ SLFERL+ G L+VQYRMHP + F S FY G L+ +
Sbjct: 532 ESSPEGLSASLFERLIDNGPEVVYLLRVQYRMHPDIIAFSSKVFYNGRLEVHTSFLAFTL 591
Query: 655 SGIDFPWPVPNRPMFFYVQMGQEEISASGTSYLNRTEAANVEKIVTTFLRSGVVPSQIGV 714
+ P V + P+ FY +G EE S S LN EA V+ IV L+ G+ + IGV
Sbjct: 592 LDGEIPEVVISNPLEFYDTLGAEEFFES-KSKLNELEAEIVKVIVDELLKDGLEENDIGV 650
Query: 715 ITPYEGQRAYIVNYMSRNGALRQQLYKEIEVASVDSFQGREKDYIILSCVRSN-EHQGIG 773
I+PY Q + I ++ G K +EV +VD FQGREKD IILS VRSN + IG
Sbjct: 651 ISPYRAQVSLIRRLLNEAG-------KGVEVGTVDGFQGREKDVIILSLVRSNDDKGEIG 703
Query: 774 FLNDPRRLNVALTRARYGIVILGNPKVLSKQPLWNGLLTHYKEHECLVEGPLNNLKQS 831
FL DPRRLNVALTRA+ ++++G+ L PL+ L+ K L E L +L+ +
Sbjct: 704 FLGDPRRLNVALTRAKRKLIVVGSSSTLESDPLYKRLINDLKRKGLLAELNLLDLRLT 761
|
Length = 767 |
| >gnl|CDD|232945 TIGR00376, TIGR00376, DNA helicase, putative | Back alignment and domain information |
|---|
| >gnl|CDD|221913 pfam13087, AAA_12, AAA domain | Back alignment and domain information |
|---|
| >gnl|CDD|221912 pfam13086, AAA_11, AAA domain | Back alignment and domain information |
|---|
| >gnl|CDD|192286 pfam09416, UPF1_Zn_bind, RNA helicase (UPF2 interacting domain) | Back alignment and domain information |
|---|
| >gnl|CDD|222005 pfam13245, AAA_19, Part of AAA domain | Back alignment and domain information |
|---|
| >gnl|CDD|233417 TIGR01447, recD, exodeoxyribonuclease V, alpha subunit | Back alignment and domain information |
|---|
| >gnl|CDD|222258 pfam13604, AAA_30, AAA domain | Back alignment and domain information |
|---|
| >gnl|CDD|218292 pfam04851, ResIII, Type III restriction enzyme, res subunit | Back alignment and domain information |
|---|
| >gnl|CDD|214692 smart00487, DEXDc, DEAD-like helicases superfamily | Back alignment and domain information |
|---|
| >gnl|CDD|238005 cd00046, DEXDc, DEAD-like helicases superfamily | Back alignment and domain information |
|---|
| >gnl|CDD|233418 TIGR01448, recD_rel, helicase, putative, RecD/TraA family | Back alignment and domain information |
|---|
| >gnl|CDD|236783 PRK10875, recD, exonuclease V subunit alpha; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223989 COG1061, SSL2, DNA or RNA helicases of superfamily II [Transcription / DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >gnl|CDD|220392 pfam09770, PAT1, Topoisomerase II-associated protein PAT1 | Back alignment and domain information |
|---|
| >gnl|CDD|233069 TIGR00643, recG, ATP-dependent DNA helicase RecG | Back alignment and domain information |
|---|
| >gnl|CDD|224120 COG1199, DinG, Rad3-related DNA helicases [Transcription / DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >gnl|CDD|233210 TIGR00959, ffh, signal recognition particle protein | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch
Original result of HHsearch against CDD database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 1066 | |||
| KOG1802 | 935 | consensus RNA helicase nonsense mRNA reducing fact | 100.0 | |
| TIGR00376 | 637 | DNA helicase, putative. The gene product may repre | 100.0 | |
| KOG1803 | 649 | consensus DNA helicase [Replication, recombination | 100.0 | |
| KOG1805 | 1100 | consensus DNA replication helicase [Replication, r | 100.0 | |
| KOG1807 | 1025 | consensus Helicases [Replication, recombination an | 100.0 | |
| COG1112 | 767 | Superfamily I DNA and RNA helicases and helicase s | 100.0 | |
| PF09416 | 152 | UPF1_Zn_bind: RNA helicase (UPF2 interacting domai | 100.0 | |
| KOG1801 | 827 | consensus tRNA-splicing endonuclease positive effe | 100.0 | |
| KOG1804 | 775 | consensus RNA helicase [RNA processing and modific | 100.0 | |
| PF13087 | 200 | AAA_12: AAA domain; PDB: 2XZO_A 2WJY_A 2WJV_A 2XZP | 100.0 | |
| PF13086 | 236 | AAA_11: AAA domain; PDB: 2XZL_A 2XZO_A 2WJY_A 2WJV | 99.97 | |
| TIGR01075 | 715 | uvrD DNA helicase II. Designed to identify uvrD me | 99.97 | |
| PRK11773 | 721 | uvrD DNA-dependent helicase II; Provisional | 99.97 | |
| TIGR01073 | 726 | pcrA ATP-dependent DNA helicase PcrA. Designed to | 99.97 | |
| PRK10919 | 672 | ATP-dependent DNA helicase Rep; Provisional | 99.97 | |
| PRK10875 | 615 | recD exonuclease V subunit alpha; Provisional | 99.96 | |
| PRK11054 | 684 | helD DNA helicase IV; Provisional | 99.96 | |
| TIGR01447 | 586 | recD exodeoxyribonuclease V, alpha subunit. This f | 99.96 | |
| KOG1806 | 1320 | consensus DEAD box containing helicases [Replicati | 99.95 | |
| TIGR01074 | 664 | rep ATP-dependent DNA helicase Rep. Designed to id | 99.94 | |
| TIGR01448 | 720 | recD_rel helicase, putative, RecD/TraA family. Thi | 99.94 | |
| COG0210 | 655 | UvrD Superfamily I DNA and RNA helicases [DNA repl | 99.93 | |
| TIGR02768 | 744 | TraA_Ti Ti-type conjugative transfer relaxase TraA | 99.9 | |
| TIGR00609 | 1087 | recB exodeoxyribonuclease V, beta subunit. All pro | 99.9 | |
| COG1074 | 1139 | RecB ATP-dependent exoDNAse (exonuclease V) beta s | 99.89 | |
| TIGR02785 | 1232 | addA_Gpos recombination helicase AddA, Firmicutes | 99.89 | |
| PRK13826 | 1102 | Dtr system oriT relaxase; Provisional | 99.88 | |
| PRK13909 | 910 | putative recombination protein RecB; Provisional | 99.87 | |
| PRK13889 | 988 | conjugal transfer relaxase TraA; Provisional | 99.87 | |
| PRK10876 | 1181 | recB exonuclease V subunit beta; Provisional | 99.86 | |
| TIGR02784 | 1141 | addA_alphas double-strand break repair helicase Ad | 99.84 | |
| PF13604 | 196 | AAA_30: AAA domain; PDB: 1W36_G 3K70_G 3UPU_B 3GPL | 99.78 | |
| PRK13709 | 1747 | conjugal transfer nickase/helicase TraI; Provision | 99.77 | |
| PRK14712 | 1623 | conjugal transfer nickase/helicase TraI; Provision | 99.77 | |
| COG3973 | 747 | Superfamily I DNA and RNA helicases [General funct | 99.71 | |
| TIGR02760 | 1960 | TraI_TIGR conjugative transfer relaxase protein Tr | 99.68 | |
| PF01443 | 234 | Viral_helicase1: Viral (Superfamily 1) RNA helicas | 99.65 | |
| PF00580 | 315 | UvrD-helicase: UvrD/REP helicase N-terminal domain | 99.59 | |
| TIGR02760 | 1960 | TraI_TIGR conjugative transfer relaxase protein Tr | 99.53 | |
| COG0507 | 696 | RecD ATP-dependent exoDNAse (exonuclease V), alpha | 99.5 | |
| PF09848 | 352 | DUF2075: Uncharacterized conserved protein (DUF207 | 99.47 | |
| COG3972 | 660 | Superfamily I DNA and RNA helicases [General funct | 99.44 | |
| PF13361 | 351 | UvrD_C: UvrD-like helicase C-terminal domain; PDB: | 99.3 | |
| PF05970 | 364 | PIF1: PIF1-like helicase; InterPro: IPR010285 This | 99.27 | |
| PF13245 | 76 | AAA_19: Part of AAA domain | 99.23 | |
| PRK10536 | 262 | hypothetical protein; Provisional | 98.91 | |
| PF02562 | 205 | PhoH: PhoH-like protein; InterPro: IPR003714 PhoH | 98.9 | |
| TIGR02773 | 1158 | addB_Gpos ATP-dependent nuclease subunit B. DNA re | 98.88 | |
| smart00487 | 201 | DEXDc DEAD-like helicases superfamily. | 98.75 | |
| KOG1804 | 775 | consensus RNA helicase [RNA processing and modific | 98.7 | |
| cd00046 | 144 | DEXDc DEAD-like helicases superfamily. A diverse f | 98.53 | |
| PRK10590 | 456 | ATP-dependent RNA helicase RhlE; Provisional | 98.52 | |
| PF13538 | 104 | UvrD_C_2: UvrD-like helicase C-terminal domain; PD | 98.5 | |
| PF00270 | 169 | DEAD: DEAD/DEAH box helicase; InterPro: IPR011545 | 98.41 | |
| PRK04537 | 572 | ATP-dependent RNA helicase RhlB; Provisional | 98.37 | |
| KOG2108 | 853 | consensus 3'-5' DNA helicase [Replication, recombi | 98.31 | |
| PRK11634 | 629 | ATP-dependent RNA helicase DeaD; Provisional | 98.31 | |
| cd00268 | 203 | DEADc DEAD-box helicases. A diverse family of prot | 98.27 | |
| TIGR00580 | 926 | mfd transcription-repair coupling factor (mfd). Al | 98.21 | |
| PHA02558 | 501 | uvsW UvsW helicase; Provisional | 98.19 | |
| PRK11192 | 434 | ATP-dependent RNA helicase SrmB; Provisional | 98.14 | |
| PRK10689 | 1147 | transcription-repair coupling factor; Provisional | 98.11 | |
| PRK05580 | 679 | primosome assembly protein PriA; Validated | 98.1 | |
| PTZ00424 | 401 | helicase 45; Provisional | 98.04 | |
| PRK11776 | 460 | ATP-dependent RNA helicase DbpA; Provisional | 98.02 | |
| PRK10917 | 681 | ATP-dependent DNA helicase RecG; Provisional | 97.97 | |
| TIGR00643 | 630 | recG ATP-dependent DNA helicase RecG. | 97.96 | |
| PRK02362 | 737 | ski2-like helicase; Provisional | 97.95 | |
| PRK00254 | 720 | ski2-like helicase; Provisional | 97.91 | |
| PF07652 | 148 | Flavi_DEAD: Flavivirus DEAD domain ; InterPro: IPR | 97.85 | |
| PRK04837 | 423 | ATP-dependent RNA helicase RhlB; Provisional | 97.85 | |
| PRK01172 | 674 | ski2-like helicase; Provisional | 97.85 | |
| PF04851 | 184 | ResIII: Type III restriction enzyme, res subunit; | 97.83 | |
| COG1702 | 348 | PhoH Phosphate starvation-inducible protein PhoH, | 97.79 | |
| COG1061 | 442 | SSL2 DNA or RNA helicases of superfamily II [Trans | 97.78 | |
| PTZ00110 | 545 | helicase; Provisional | 97.73 | |
| COG1875 | 436 | NYN ribonuclease and ATPase of PhoH family domains | 97.73 | |
| PRK13766 | 773 | Hef nuclease; Provisional | 97.7 | |
| PRK11448 | 1123 | hsdR type I restriction enzyme EcoKI subunit R; Pr | 97.67 | |
| TIGR03817 | 742 | DECH_helic helicase/secretion neighborhood putativ | 97.66 | |
| PRK01297 | 475 | ATP-dependent RNA helicase RhlB; Provisional | 97.65 | |
| TIGR01054 | 1171 | rgy reverse gyrase. Generally, these gyrases are e | 97.59 | |
| COG1204 | 766 | Superfamily II helicase [General function predicti | 97.57 | |
| PRK09401 | 1176 | reverse gyrase; Reviewed | 97.56 | |
| TIGR00603 | 732 | rad25 DNA repair helicase rad25. All proteins in t | 97.55 | |
| PRK08181 | 269 | transposase; Validated | 97.53 | |
| TIGR00614 | 470 | recQ_fam ATP-dependent DNA helicase, RecQ family. | 97.51 | |
| TIGR03117 | 636 | cas_csf4 CRISPR-associated DEAD/DEAH-box helicase | 97.49 | |
| PLN00206 | 518 | DEAD-box ATP-dependent RNA helicase; Provisional | 97.48 | |
| PHA02653 | 675 | RNA helicase NPH-II; Provisional | 97.48 | |
| PRK14712 | 1623 | conjugal transfer nickase/helicase TraI; Provision | 97.45 | |
| smart00488 | 289 | DEXDc2 DEAD-like helicases superfamily. | 97.45 | |
| smart00489 | 289 | DEXDc3 DEAD-like helicases superfamily. | 97.45 | |
| PRK06526 | 254 | transposase; Provisional | 97.45 | |
| PF13401 | 131 | AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S | 97.41 | |
| PRK14974 | 336 | cell division protein FtsY; Provisional | 97.39 | |
| PF05127 | 177 | Helicase_RecD: Helicase; InterPro: IPR007807 This | 97.38 | |
| TIGR00348 | 667 | hsdR type I site-specific deoxyribonuclease, HsdR | 97.38 | |
| PRK14701 | 1638 | reverse gyrase; Provisional | 97.35 | |
| TIGR00595 | 505 | priA primosomal protein N'. All proteins in this f | 97.35 | |
| TIGR01389 | 591 | recQ ATP-dependent DNA helicase RecQ. The ATP-depe | 97.34 | |
| PRK13767 | 876 | ATP-dependent helicase; Provisional | 97.32 | |
| PRK04296 | 190 | thymidine kinase; Provisional | 97.3 | |
| PRK11664 | 812 | ATP-dependent RNA helicase HrpB; Provisional | 97.29 | |
| TIGR01970 | 819 | DEAH_box_HrpB ATP-dependent helicase HrpB. This mo | 97.29 | |
| PRK11057 | 607 | ATP-dependent DNA helicase RecQ; Provisional | 97.24 | |
| PF00448 | 196 | SRP54: SRP54-type protein, GTPase domain; InterPro | 97.24 | |
| COG4098 | 441 | comFA Superfamily II DNA/RNA helicase required for | 97.19 | |
| TIGR01587 | 358 | cas3_core CRISPR-associated helicase Cas3. This mo | 97.19 | |
| KOG0952 | 1230 | consensus DNA/RNA helicase MER3/SLH1, DEAD-box sup | 97.17 | |
| TIGR00604 | 705 | rad3 DNA repair helicase (rad3). All proteins in t | 97.16 | |
| COG1110 | 1187 | Reverse gyrase [DNA replication, recombination, an | 97.14 | |
| COG1200 | 677 | RecG RecG-like helicase [DNA replication, recombin | 97.13 | |
| COG4096 | 875 | HsdR Type I site-specific restriction-modification | 97.12 | |
| COG1198 | 730 | PriA Primosomal protein N' (replication factor Y) | 97.08 | |
| PF00176 | 299 | SNF2_N: SNF2 family N-terminal domain; InterPro: I | 97.05 | |
| TIGR01967 | 1283 | DEAH_box_HrpA ATP-dependent helicase HrpA. This mo | 97.05 | |
| KOG2108 | 853 | consensus 3'-5' DNA helicase [Replication, recombi | 97.02 | |
| PRK07246 | 820 | bifunctional ATP-dependent DNA helicase/DNA polyme | 97.0 | |
| PRK08084 | 235 | DNA replication initiation factor; Provisional | 96.99 | |
| KOG0354 | 746 | consensus DEAD-box like helicase [General function | 96.97 | |
| PF02399 | 824 | Herpes_ori_bp: Origin of replication binding prote | 96.96 | |
| PF13173 | 128 | AAA_14: AAA domain | 96.9 | |
| PRK08074 | 928 | bifunctional ATP-dependent DNA helicase/DNA polyme | 96.85 | |
| PRK14722 | 374 | flhF flagellar biosynthesis regulator FlhF; Provis | 96.8 | |
| TIGR01407 | 850 | dinG_rel DnaQ family exonuclease/DinG family helic | 96.8 | |
| PRK13709 | 1747 | conjugal transfer nickase/helicase TraI; Provision | 96.8 | |
| TIGR03158 | 357 | cas3_cyano CRISPR-associated helicase, Cyano-type. | 96.74 | |
| TIGR02621 | 844 | cas3_GSU0051 CRISPR-associated helicase Cas3, Anae | 96.72 | |
| cd00009 | 151 | AAA The AAA+ (ATPases Associated with a wide varie | 96.7 | |
| PRK12723 | 388 | flagellar biosynthesis regulator FlhF; Provisional | 96.67 | |
| TIGR03499 | 282 | FlhF flagellar biosynthetic protein FlhF. | 96.67 | |
| COG1111 | 542 | MPH1 ERCC4-like helicases [DNA replication, recomb | 96.67 | |
| PRK00771 | 437 | signal recognition particle protein Srp54; Provisi | 96.67 | |
| PRK12377 | 248 | putative replication protein; Provisional | 96.64 | |
| PHA03311 | 828 | helicase-primase subunit BBLF4; Provisional | 96.6 | |
| PRK11747 | 697 | dinG ATP-dependent DNA helicase DinG; Provisional | 96.59 | |
| cd01124 | 187 | KaiC KaiC is a circadian clock protein primarily f | 96.55 | |
| PRK11889 | 436 | flhF flagellar biosynthesis regulator FlhF; Provis | 96.5 | |
| PRK07952 | 244 | DNA replication protein DnaC; Validated | 96.49 | |
| COG4889 | 1518 | Predicted helicase [General function prediction on | 96.47 | |
| TIGR03015 | 269 | pepcterm_ATPase putative secretion ATPase, PEP-CTE | 96.45 | |
| TIGR01425 | 429 | SRP54_euk signal recognition particle protein SRP5 | 96.44 | |
| PRK12899 | 970 | secA preprotein translocase subunit SecA; Reviewed | 96.44 | |
| PRK11131 | 1294 | ATP-dependent RNA helicase HrpA; Provisional | 96.44 | |
| COG0513 | 513 | SrmB Superfamily II DNA and RNA helicases [DNA rep | 96.42 | |
| PRK12898 | 656 | secA preprotein translocase subunit SecA; Reviewed | 96.4 | |
| PRK07003 | 830 | DNA polymerase III subunits gamma and tau; Validat | 96.3 | |
| COG1199 | 654 | DinG Rad3-related DNA helicases [Transcription / D | 96.26 | |
| PRK05703 | 424 | flhF flagellar biosynthesis regulator FlhF; Valida | 96.25 | |
| PRK04914 | 956 | ATP-dependent helicase HepA; Validated | 96.21 | |
| COG1643 | 845 | HrpA HrpA-like helicases [DNA replication, recombi | 96.13 | |
| PRK12323 | 700 | DNA polymerase III subunits gamma and tau; Provisi | 96.1 | |
| PRK14956 | 484 | DNA polymerase III subunits gamma and tau; Provisi | 96.09 | |
| PRK07994 | 647 | DNA polymerase III subunits gamma and tau; Validat | 96.08 | |
| PRK14958 | 509 | DNA polymerase III subunits gamma and tau; Provisi | 96.04 | |
| TIGR03714 | 762 | secA2 accessory Sec system translocase SecA2. Memb | 95.98 | |
| smart00382 | 148 | AAA ATPases associated with a variety of cellular | 95.96 | |
| PLN03137 | 1195 | ATP-dependent DNA helicase; Q4-like; Provisional | 95.92 | |
| TIGR00064 | 272 | ftsY signal recognition particle-docking protein F | 95.9 | |
| PRK14087 | 450 | dnaA chromosomal replication initiation protein; P | 95.89 | |
| COG2256 | 436 | MGS1 ATPase related to the helicase subunit of the | 95.82 | |
| PHA03333 | 752 | putative ATPase subunit of terminase; Provisional | 95.82 | |
| COG1205 | 851 | Distinct helicase family with a unique C-terminal | 95.82 | |
| PRK14088 | 440 | dnaA chromosomal replication initiation protein; P | 95.78 | |
| COG1484 | 254 | DnaC DNA replication protein [DNA replication, rec | 95.77 | |
| KOG0989 | 346 | consensus Replication factor C, subunit RFC4 [Repl | 95.73 | |
| PF06745 | 226 | KaiC: KaiC; InterPro: IPR014774 This entry represe | 95.73 | |
| PRK14952 | 584 | DNA polymerase III subunits gamma and tau; Provisi | 95.69 | |
| PRK14949 | 944 | DNA polymerase III subunits gamma and tau; Provisi | 95.63 | |
| KOG0330 | 476 | consensus ATP-dependent RNA helicase [RNA processi | 95.59 | |
| PF01695 | 178 | IstB_IS21: IstB-like ATP binding protein; InterPro | 95.59 | |
| TIGR02774 | 1076 | rexB_recomb ATP-dependent nuclease subunit B. DNA | 95.58 | |
| KOG2028 | 554 | consensus ATPase related to the helicase subunit o | 95.58 | |
| PRK12727 | 559 | flagellar biosynthesis regulator FlhF; Provisional | 95.55 | |
| PRK14963 | 504 | DNA polymerase III subunits gamma and tau; Provisi | 95.55 | |
| KOG0987 | 540 | consensus DNA helicase PIF1/RRM3 [Cell cycle contr | 95.55 | |
| PRK12422 | 445 | chromosomal replication initiation protein; Provis | 95.54 | |
| PRK10416 | 318 | signal recognition particle-docking protein FtsY; | 95.49 | |
| TIGR00708 | 173 | cobA cob(I)alamin adenosyltransferase. Alternate n | 95.46 | |
| PRK14960 | 702 | DNA polymerase III subunits gamma and tau; Provisi | 95.41 | |
| cd01129 | 264 | PulE-GspE PulE/GspE The type II secretory pathway | 95.37 | |
| COG1197 | 1139 | Mfd Transcription-repair coupling factor (superfam | 95.34 | |
| KOG1924 | 1102 | consensus RhoA GTPase effector DIA/Diaphanous [Sig | 95.33 | |
| TIGR03877 | 237 | thermo_KaiC_1 KaiC domain protein, Ph0284 family. | 95.33 | |
| cd01131 | 198 | PilT Pilus retraction ATPase PilT. PilT is a nucle | 95.3 | |
| PRK08116 | 268 | hypothetical protein; Validated | 95.28 | |
| PLN03142 | 1033 | Probable chromatin-remodeling complex ATPase chain | 95.26 | |
| PRK09200 | 790 | preprotein translocase subunit SecA; Reviewed | 95.26 | |
| cd03115 | 173 | SRP The signal recognition particle (SRP) mediates | 95.25 | |
| PRK08691 | 709 | DNA polymerase III subunits gamma and tau; Validat | 95.24 | |
| PRK14948 | 620 | DNA polymerase III subunits gamma and tau; Provisi | 95.24 | |
| PRK05973 | 237 | replicative DNA helicase; Provisional | 95.22 | |
| cd00561 | 159 | CobA_CobO_BtuR ATP:corrinoid adenosyltransferase B | 95.22 | |
| PRK05563 | 559 | DNA polymerase III subunits gamma and tau; Validat | 95.17 | |
| PRK14951 | 618 | DNA polymerase III subunits gamma and tau; Provisi | 95.16 | |
| PRK14969 | 527 | DNA polymerase III subunits gamma and tau; Provisi | 95.15 | |
| PF00004 | 132 | AAA: ATPase family associated with various cellula | 95.14 | |
| COG0552 | 340 | FtsY Signal recognition particle GTPase [Intracell | 95.13 | |
| cd01120 | 165 | RecA-like_NTPases RecA-like NTPases. This family i | 95.08 | |
| PRK08533 | 230 | flagellar accessory protein FlaH; Reviewed | 95.07 | |
| PRK09183 | 259 | transposase/IS protein; Provisional | 95.01 | |
| TIGR03880 | 224 | KaiC_arch_3 KaiC domain protein, AF_0351 family. T | 94.99 | |
| PF13191 | 185 | AAA_16: AAA ATPase domain; PDB: 2V1U_A. | 94.95 | |
| KOG0951 | 1674 | consensus RNA helicase BRR2, DEAD-box superfamily | 94.92 | |
| TIGR03878 | 259 | thermo_KaiC_2 KaiC domain protein, AF_0795 family. | 94.91 | |
| PRK10867 | 433 | signal recognition particle protein; Provisional | 94.84 | |
| PRK13833 | 323 | conjugal transfer protein TrbB; Provisional | 94.83 | |
| PRK13894 | 319 | conjugal transfer ATPase TrbB; Provisional | 94.82 | |
| KOG0744 | 423 | consensus AAA+-type ATPase [Posttranslational modi | 94.81 | |
| PRK13104 | 896 | secA preprotein translocase subunit SecA; Reviewed | 94.79 | |
| COG2805 | 353 | PilT Tfp pilus assembly protein, pilus retraction | 94.77 | |
| TIGR00963 | 745 | secA preprotein translocase, SecA subunit. The pro | 94.77 | |
| PRK07764 | 824 | DNA polymerase III subunits gamma and tau; Validat | 94.77 | |
| PRK09694 | 878 | helicase Cas3; Provisional | 94.76 | |
| PRK14964 | 491 | DNA polymerase III subunits gamma and tau; Provisi | 94.73 | |
| smart00763 | 361 | AAA_PrkA PrkA AAA domain. This is a family of PrkA | 94.73 | |
| COG1419 | 407 | FlhF Flagellar GTP-binding protein [Cell motility | 94.72 | |
| PRK06067 | 234 | flagellar accessory protein FlaH; Validated | 94.71 | |
| KOG0333 | 673 | consensus U5 snRNP-like RNA helicase subunit [RNA | 94.64 | |
| PRK06835 | 329 | DNA replication protein DnaC; Validated | 94.63 | |
| PRK04328 | 249 | hypothetical protein; Provisional | 94.62 | |
| PRK06893 | 229 | DNA replication initiation factor; Validated | 94.62 | |
| PF13481 | 193 | AAA_25: AAA domain; PDB: 1G8Y_J 1OLO_A 1NLF_C. | 94.61 | |
| TIGR02782 | 299 | TrbB_P P-type conjugative transfer ATPase TrbB. Th | 94.59 | |
| KOG0780 | 483 | consensus Signal recognition particle, subunit Srp | 94.59 | |
| PF02689 | 818 | Herpes_Helicase: Helicase; InterPro: IPR003840 Thi | 94.57 | |
| PRK09112 | 351 | DNA polymerase III subunit delta'; Validated | 94.53 | |
| COG0556 | 663 | UvrB Helicase subunit of the DNA excision repair c | 94.52 | |
| PRK14086 | 617 | dnaA chromosomal replication initiation protein; P | 94.51 | |
| KOG0335 | 482 | consensus ATP-dependent RNA helicase [RNA processi | 94.51 | |
| PRK10436 | 462 | hypothetical protein; Provisional | 94.51 | |
| cd01122 | 271 | GP4d_helicase GP4d_helicase is a homohexameric 5'- | 94.5 | |
| PRK08903 | 227 | DnaA regulatory inactivator Hda; Validated | 94.49 | |
| COG0541 | 451 | Ffh Signal recognition particle GTPase [Intracellu | 94.49 | |
| TIGR03420 | 226 | DnaA_homol_Hda DnaA regulatory inactivator Hda. Me | 94.49 | |
| TIGR02533 | 486 | type_II_gspE general secretory pathway protein E. | 94.41 | |
| TIGR00959 | 428 | ffh signal recognition particle protein. This mode | 94.4 | |
| TIGR02928 | 365 | orc1/cdc6 family replication initiation protein. M | 94.39 | |
| PRK06851 | 367 | hypothetical protein; Provisional | 94.39 | |
| PF05729 | 166 | NACHT: NACHT domain | 94.38 | |
| PHA03368 | 738 | DNA packaging terminase subunit 1; Provisional | 94.37 | |
| KOG0922 | 674 | consensus DEAH-box RNA helicase [RNA processing an | 94.32 | |
| PRK08727 | 233 | hypothetical protein; Validated | 94.3 | |
| PRK13341 | 725 | recombination factor protein RarA/unknown domain f | 94.28 | |
| COG2804 | 500 | PulE Type II secretory pathway, ATPase PulE/Tfp pi | 94.25 | |
| KOG0991 | 333 | consensus Replication factor C, subunit RFC2 [Repl | 94.25 | |
| TIGR02655 | 484 | circ_KaiC circadian clock protein KaiC. Members of | 94.24 | |
| PRK07133 | 725 | DNA polymerase III subunits gamma and tau; Validat | 94.22 | |
| TIGR02655 | 484 | circ_KaiC circadian clock protein KaiC. Members of | 94.22 | |
| PRK06921 | 266 | hypothetical protein; Provisional | 94.19 | |
| PRK09751 | 1490 | putative ATP-dependent helicase Lhr; Provisional | 94.18 | |
| PF13207 | 121 | AAA_17: AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6 | 94.17 | |
| PRK14873 | 665 | primosome assembly protein PriA; Provisional | 94.13 | |
| COG0467 | 260 | RAD55 RecA-superfamily ATPases implicated in signa | 94.11 | |
| PRK07940 | 394 | DNA polymerase III subunit delta'; Validated | 93.95 | |
| TIGR02237 | 209 | recomb_radB DNA repair and recombination protein R | 93.95 | |
| PRK05986 | 191 | cob(I)alamin adenolsyltransferase/cobinamide ATP-d | 93.9 | |
| TIGR02525 | 372 | plasmid_TraJ plasmid transfer ATPase TraJ. Members | 93.89 | |
| TIGR03881 | 229 | KaiC_arch_4 KaiC domain protein, PAE1156 family. M | 93.89 | |
| PRK12726 | 407 | flagellar biosynthesis regulator FlhF; Provisional | 93.89 | |
| PRK12326 | 764 | preprotein translocase subunit SecA; Reviewed | 93.86 | |
| PRK14965 | 576 | DNA polymerase III subunits gamma and tau; Provisi | 93.86 | |
| cd00984 | 242 | DnaB_C DnaB helicase C terminal domain. The hexame | 93.82 | |
| TIGR02538 | 564 | type_IV_pilB type IV-A pilus assembly ATPase PilB. | 93.76 | |
| PLN03025 | 319 | replication factor C subunit; Provisional | 93.76 | |
| PF07728 | 139 | AAA_5: AAA domain (dynein-related subfamily); Inte | 93.74 | |
| PRK00411 | 394 | cdc6 cell division control protein 6; Reviewed | 93.67 | |
| cd01394 | 218 | radB RadB. The archaeal protein radB shares simila | 93.61 | |
| PRK08451 | 535 | DNA polymerase III subunits gamma and tau; Validat | 93.6 | |
| PRK12724 | 432 | flagellar biosynthesis regulator FlhF; Provisional | 93.6 | |
| TIGR02881 | 261 | spore_V_K stage V sporulation protein K. Members o | 93.58 | |
| KOG4284 | 980 | consensus DEAD box protein [Transcription] | 93.56 | |
| COG1444 | 758 | Predicted P-loop ATPase fused to an acetyltransfer | 93.53 | |
| TIGR02640 | 262 | gas_vesic_GvpN gas vesicle protein GvpN. Members o | 93.47 | |
| TIGR01650 | 327 | PD_CobS cobaltochelatase, CobS subunit. This model | 93.44 | |
| PRK05642 | 234 | DNA replication initiation factor; Validated | 93.39 | |
| PF13671 | 143 | AAA_33: AAA domain; PDB: 1LTQ_A 2IA5_K 1RC8_A 1LY1 | 93.35 | |
| KOG1924 | 1102 | consensus RhoA GTPase effector DIA/Diaphanous [Sig | 93.34 | |
| TIGR01420 | 343 | pilT_fam pilus retraction protein PilT. This model | 93.32 | |
| cd01130 | 186 | VirB11-like_ATPase Type IV secretory pathway compo | 93.29 | |
| cd01983 | 99 | Fer4_NifH The Fer4_NifH superfamily contains a var | 93.25 | |
| TIGR02688 | 449 | conserved hypothetical protein TIGR02688. Members | 93.23 | |
| PRK09361 | 225 | radB DNA repair and recombination protein RadB; Pr | 93.17 | |
| KOG0781 | 587 | consensus Signal recognition particle receptor, al | 93.17 | |
| PRK05707 | 328 | DNA polymerase III subunit delta'; Validated | 93.1 | |
| PF05496 | 233 | RuvB_N: Holliday junction DNA helicase ruvB N-term | 93.1 | |
| PRK07471 | 365 | DNA polymerase III subunit delta'; Validated | 93.04 | |
| PF02492 | 178 | cobW: CobW/HypB/UreG, nucleotide-binding domain; I | 92.89 | |
| PRK06731 | 270 | flhF flagellar biosynthesis regulator FlhF; Valida | 92.81 | |
| PRK08769 | 319 | DNA polymerase III subunit delta'; Validated | 92.75 | |
| ) proteins. It has been suggested that torsins play a role in effectively managing protein folding and that possible breakdown in a neuroprotective mechanism that is, in part, mediated by torsins may be responsible for the neuronal dysfunction associated with dystonia [].; GO: 0005524 ATP binding, 0051085 chaperone mediated protein folding requiring cofactor" target="_blank" href="http://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=PF06309">PF06309 | 127 | Torsin: Torsin; InterPro: IPR010448 This family co | 92.74 | |
| PRK12402 | 337 | replication factor C small subunit 2; Reviewed | 92.73 | |
| PHA00350 | 399 | putative assembly protein | 92.73 | |
| PRK11823 | 446 | DNA repair protein RadA; Provisional | 92.72 | |
| COG0507 | 696 | RecD ATP-dependent exoDNAse (exonuclease V), alpha | 92.67 | |
| KOG0743 | 457 | consensus AAA+-type ATPase [Posttranslational modi | 92.67 | |
| cd00544 | 169 | CobU Adenosylcobinamide kinase / adenosylcobinamid | 92.66 | |
| PF00308 | 219 | Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013 | 92.66 | |
| PF00437 | 270 | T2SE: Type II/IV secretion system protein; InterPr | 92.65 | |
| PRK08058 | 329 | DNA polymerase III subunit delta'; Validated | 92.63 | |
| cd01121 | 372 | Sms Sms (bacterial radA) DNA repair protein. This | 92.61 | |
| PF13238 | 129 | AAA_18: AAA domain; PDB: 3IIK_A 3IIJ_A 3IIL_A 1RKB | 92.59 | |
| PRK09302 | 509 | circadian clock protein KaiC; Reviewed | 92.59 | |
| PRK14959 | 624 | DNA polymerase III subunits gamma and tau; Provisi | 92.56 | |
| TIGR02880 | 284 | cbbX_cfxQ probable Rubsico expression protein CbbX | 92.53 | |
| TIGR00635 | 305 | ruvB Holliday junction DNA helicase, RuvB subunit. | 92.52 | |
| KOG0923 | 902 | consensus mRNA splicing factor ATP-dependent RNA h | 92.5 | |
| PRK08939 | 306 | primosomal protein DnaI; Reviewed | 92.48 | |
| TIGR02012 | 321 | tigrfam_recA protein RecA. This model describes or | 92.47 | |
| PRK00149 | 450 | dnaA chromosomal replication initiation protein; R | 92.38 | |
| COG1201 | 814 | Lhr Lhr-like helicases [General function predictio | 92.29 | |
| TIGR02524 | 358 | dot_icm_DotB Dot/Icm secretion system ATPase DotB. | 92.24 | |
| PRK09302 | 509 | circadian clock protein KaiC; Reviewed | 92.09 | |
| cd00983 | 325 | recA RecA is a bacterial enzyme which has roles in | 92.08 | |
| PRK11331 | 459 | 5-methylcytosine-specific restriction enzyme subun | 92.08 | |
| KOG0921 | 1282 | consensus Dosage compensation complex, subunit MLE | 92.07 | |
| cd02019 | 69 | NK Nucleoside/nucleotide kinase (NK) is a protein | 92.07 | |
| KOG0345 | 567 | consensus ATP-dependent RNA helicase [RNA processi | 92.05 | |
| PRK04195 | 482 | replication factor C large subunit; Provisional | 92.03 | |
| PRK07399 | 314 | DNA polymerase III subunit delta'; Validated | 91.97 | |
| PRK06851 | 367 | hypothetical protein; Provisional | 91.9 | |
| COG1474 | 366 | CDC6 Cdc6-related protein, AAA superfamily ATPase | 91.83 | |
| PRK13768 | 253 | GTPase; Provisional | 91.81 | |
| PRK14723 | 767 | flhF flagellar biosynthesis regulator FlhF; Provis | 91.8 | |
| PTZ00112 | 1164 | origin recognition complex 1 protein; Provisional | 91.77 | |
| KOG0331 | 519 | consensus ATP-dependent RNA helicase [RNA processi | 91.72 | |
| PF12846 | 304 | AAA_10: AAA-like domain | 91.72 | |
| TIGR00416 | 454 | sms DNA repair protein RadA. The gene protuct code | 91.7 | |
| COG2019 | 189 | AdkA Archaeal adenylate kinase [Nucleotide transpo | 91.69 | |
| PF03266 | 168 | NTPase_1: NTPase; InterPro: IPR004948 This entry r | 91.66 | |
| PHA02544 | 316 | 44 clamp loader, small subunit; Provisional | 91.62 | |
| PHA00729 | 226 | NTP-binding motif containing protein | 91.59 | |
| CHL00181 | 287 | cbbX CbbX; Provisional | 91.58 | |
| KOG0342 | 543 | consensus ATP-dependent RNA helicase pitchoune [RN | 91.51 | |
| PRK06995 | 484 | flhF flagellar biosynthesis regulator FlhF; Valida | 91.49 | |
| PF03205 | 140 | MobB: Molybdopterin guanine dinucleotide synthesis | 91.47 | |
| TIGR01359 | 183 | UMP_CMP_kin_fam UMP-CMP kinase family. This subfam | 91.4 | |
| KOG0339 | 731 | consensus ATP-dependent RNA helicase [RNA processi | 91.4 | |
| PRK13531 | 498 | regulatory ATPase RavA; Provisional | 91.32 | |
| PRK00080 | 328 | ruvB Holliday junction DNA helicase RuvB; Reviewed | 91.31 | |
| PF05673 | 249 | DUF815: Protein of unknown function (DUF815); Inte | 91.29 | |
| TIGR01360 | 188 | aden_kin_iso1 adenylate kinase, isozyme 1 subfamil | 91.26 | |
| PF00910 | 107 | RNA_helicase: RNA helicase; InterPro: IPR000605 He | 91.23 | |
| TIGR00362 | 405 | DnaA chromosomal replication initiator protein Dna | 91.21 | |
| TIGR00750 | 300 | lao LAO/AO transport system ATPase. Mutations have | 91.12 | |
| PF03308 | 266 | ArgK: ArgK protein; InterPro: IPR005129 Bacterial | 91.02 | |
| cd03114 | 148 | ArgK-like The function of this protein family is u | 91.0 | |
| TIGR00176 | 155 | mobB molybdopterin-guanine dinucleotide biosynthes | 90.87 | |
| PF01078 | 206 | Mg_chelatase: Magnesium chelatase, subunit ChlI; I | 90.86 | |
| cd01125 | 239 | repA Hexameric Replicative Helicase RepA. RepA is | 90.84 | |
| PF13555 | 62 | AAA_29: P-loop containing region of AAA domain | 90.8 | |
| PF03215 | 519 | Rad17: Rad17 cell cycle checkpoint protein | 90.72 | |
| cd01393 | 226 | recA_like RecA is a bacterial enzyme which has rol | 90.67 | |
| TIGR01242 | 364 | 26Sp45 26S proteasome subunit P45 family. Many pro | 90.66 | |
| COG1102 | 179 | Cmk Cytidylate kinase [Nucleotide transport and me | 90.6 | |
| KOG1131 | 755 | consensus RNA polymerase II transcription initiati | 90.58 | |
| KOG0389 | 941 | consensus SNF2 family DNA-dependent ATPase [Chroma | 90.58 | |
| PRK06871 | 325 | DNA polymerase III subunit delta'; Validated | 90.46 | |
| COG4581 | 1041 | Superfamily II RNA helicase [DNA replication, reco | 90.41 | |
| PRK09354 | 349 | recA recombinase A; Provisional | 90.41 | |
| PRK03992 | 389 | proteasome-activating nucleotidase; Provisional | 90.39 | |
| PRK13342 | 413 | recombination factor protein RarA; Reviewed | 90.36 | |
| PRK08233 | 182 | hypothetical protein; Provisional | 90.34 | |
| PRK05800 | 170 | cobU adenosylcobinamide kinase/adenosylcobinamide- | 90.34 | |
| PF04665 | 241 | Pox_A32: Poxvirus A32 protein; InterPro: IPR006758 | 90.32 | |
| PRK09435 | 332 | membrane ATPase/protein kinase; Provisional | 90.29 | |
| PRK00440 | 319 | rfc replication factor C small subunit; Reviewed | 90.26 | |
| KOG0385 | 971 | consensus Chromatin remodeling complex WSTF-ISWI, | 90.25 | |
| TIGR03689 | 512 | pup_AAA proteasome ATPase. In the Actinobacteria, | 90.14 | |
| PRK12904 | 830 | preprotein translocase subunit SecA; Reviewed | 90.11 | |
| COG3854 | 308 | SpoIIIAA ncharacterized protein conserved in bacte | 90.09 | |
| PRK12608 | 380 | transcription termination factor Rho; Provisional | 90.08 | |
| PRK05541 | 176 | adenylylsulfate kinase; Provisional | 90.06 | |
| PRK13103 | 913 | secA preprotein translocase subunit SecA; Reviewed | 90.03 | |
| PRK13900 | 332 | type IV secretion system ATPase VirB11; Provisiona | 89.96 | |
| TIGR00767 | 415 | rho transcription termination factor Rho. Members | 89.92 | |
| cd02021 | 150 | GntK Gluconate kinase (GntK) catalyzes the phospho | 89.84 | |
| PTZ00361 | 438 | 26 proteosome regulatory subunit 4-like protein; P | 89.83 | |
| PRK14962 | 472 | DNA polymerase III subunits gamma and tau; Provisi | 89.82 | |
| KOG0348 | 708 | consensus ATP-dependent RNA helicase [RNA processi | 89.82 | |
| KOG0328 | 400 | consensus Predicted ATP-dependent RNA helicase FAL | 89.82 | |
| PRK08118 | 167 | topology modulation protein; Reviewed | 89.77 | |
| PRK13764 | 602 | ATPase; Provisional | 89.71 | |
| PHA02244 | 383 | ATPase-like protein | 89.69 | |
| COG1222 | 406 | RPT1 ATP-dependent 26S proteasome regulatory subun | 89.67 | |
| PRK14961 | 363 | DNA polymerase III subunits gamma and tau; Provisi | 89.58 | |
| cd02034 | 116 | CooC The accessory protein CooC, which contains a | 89.57 | |
| PRK13107 | 908 | preprotein translocase subunit SecA; Reviewed | 89.49 | |
| PF13521 | 163 | AAA_28: AAA domain; PDB: 1LW7_A. | 89.49 | |
| cd02117 | 212 | NifH_like This family contains the NifH (iron prot | 89.42 | |
| PF03029 | 238 | ATP_bind_1: Conserved hypothetical ATP binding pro | 89.41 | |
| cd01123 | 235 | Rad51_DMC1_radA Rad51_DMC1_radA,B. This group of r | 89.28 | |
| PRK14530 | 215 | adenylate kinase; Provisional | 89.25 | |
| PF07726 | 131 | AAA_3: ATPase family associated with various cellu | 89.23 | |
| PTZ00301 | 210 | uridine kinase; Provisional | 89.22 | |
| COG1618 | 179 | Predicted nucleotide kinase [Nucleotide transport | 89.21 | |
| PRK12906 | 796 | secA preprotein translocase subunit SecA; Reviewed | 89.17 | |
| KOG1970 | 634 | consensus Checkpoint RAD17-RFC complex, RAD17/RAD2 | 89.16 | |
| COG3857 | 1108 | AddB ATP-dependent nuclease, subunit B [DNA replic | 89.11 | |
| PRK03839 | 180 | putative kinase; Provisional | 89.1 | |
| PRK10463 | 290 | hydrogenase nickel incorporation protein HypB; Pro | 89.09 | |
| cd02023 | 198 | UMPK Uridine monophosphate kinase (UMPK, EC 2.7.1. | 89.07 | |
| PRK00889 | 175 | adenylylsulfate kinase; Provisional | 89.05 | |
| COG0714 | 329 | MoxR-like ATPases [General function prediction onl | 89.05 | |
| COG4088 | 261 | Predicted nucleotide kinase [Nucleotide transport | 89.0 | |
| PRK06762 | 166 | hypothetical protein; Provisional | 88.99 | |
| PRK05298 | 652 | excinuclease ABC subunit B; Provisional | 88.95 | |
| TIGR00631 | 655 | uvrb excinuclease ABC, B subunit. This family is b | 88.95 | |
| TIGR03574 | 249 | selen_PSTK L-seryl-tRNA(Sec) kinase, archaeal. Mem | 88.94 | |
| PRK00131 | 175 | aroK shikimate kinase; Reviewed | 88.92 | |
| TIGR00665 | 434 | DnaB replicative DNA helicase. This model describe | 88.87 | |
| KOG0390 | 776 | consensus DNA repair protein, SNF2 family [Replica | 88.84 | |
| cd02028 | 179 | UMPK_like Uridine monophosphate kinase_like (UMPK_ | 88.82 | |
| PRK14531 | 183 | adenylate kinase; Provisional | 88.79 | |
| PRK06620 | 214 | hypothetical protein; Validated | 88.75 | |
| COG5192 | 1077 | BMS1 GTP-binding protein required for 40S ribosome | 88.71 | |
| KOG1533 | 290 | consensus Predicted GTPase [General function predi | 88.71 | |
| TIGR02322 | 179 | phosphon_PhnN phosphonate metabolism protein/1,5-b | 88.7 | |
| cd01428 | 194 | ADK Adenylate kinase (ADK) catalyzes the reversibl | 88.68 | |
| TIGR00150 | 133 | HI0065_YjeE ATPase, YjeE family. Members of this f | 88.65 | |
| KOG0951 | 1674 | consensus RNA helicase BRR2, DEAD-box superfamily | 88.63 | |
| COG1703 | 323 | ArgK Putative periplasmic protein kinase ArgK and | 88.52 | |
| COG0378 | 202 | HypB Ni2+-binding GTPase involved in regulation of | 88.45 | |
| PRK04040 | 188 | adenylate kinase; Provisional | 88.36 | |
| PRK14532 | 188 | adenylate kinase; Provisional | 88.35 | |
| PRK06964 | 342 | DNA polymerase III subunit delta'; Validated | 88.26 | |
| TIGR01313 | 163 | therm_gnt_kin carbohydrate kinase, thermoresistant | 88.22 | |
| PRK13851 | 344 | type IV secretion system protein VirB11; Provision | 88.19 | |
| PRK08154 | 309 | anaerobic benzoate catabolism transcriptional regu | 88.14 | |
| COG4178 | 604 | ABC-type uncharacterized transport system, permeas | 88.13 | |
| cd02027 | 149 | APSK Adenosine 5'-phosphosulfate kinase (APSK) cat | 88.09 | |
| cd02025 | 220 | PanK Pantothenate kinase (PanK) catalyzes the phos | 88.01 | |
| COG1202 | 830 | Superfamily II helicase, archaea-specific [General | 87.99 | |
| cd00227 | 175 | CPT Chloramphenicol (Cm) phosphotransferase (CPT). | 87.98 | |
| PRK06645 | 507 | DNA polymerase III subunits gamma and tau; Validat | 87.96 | |
| PRK04301 | 317 | radA DNA repair and recombination protein RadA; Va | 87.9 | |
| PRK06696 | 223 | uridine kinase; Validated | 87.9 | |
| TIGR00041 | 195 | DTMP_kinase thymidylate kinase. Function: phosphor | 87.89 | |
| TIGR03600 | 421 | phage_DnaB phage replicative helicase, DnaB family | 87.88 | |
| PLN02200 | 234 | adenylate kinase family protein | 87.84 | |
| PRK02496 | 184 | adk adenylate kinase; Provisional | 87.8 | |
| cd02020 | 147 | CMPK Cytidine monophosphate kinase (CMPK) catalyze | 87.77 | |
| PRK14494 | 229 | putative molybdopterin-guanine dinucleotide biosyn | 87.76 | |
| cd03116 | 159 | MobB Molybdenum is an essential trace element in t | 87.72 | |
| PRK07667 | 193 | uridine kinase; Provisional | 87.69 | |
| PRK10751 | 173 | molybdopterin-guanine dinucleotide biosynthesis pr | 87.68 | |
| PRK14493 | 274 | putative bifunctional molybdopterin-guanine dinucl | 87.65 | |
| PRK14527 | 191 | adenylate kinase; Provisional | 87.64 | |
| TIGR02858 | 270 | spore_III_AA stage III sporulation protein AA. Mem | 87.63 | |
| PRK05480 | 209 | uridine/cytidine kinase; Provisional | 87.63 | |
| PTZ00454 | 398 | 26S protease regulatory subunit 6B-like protein; P | 87.63 | |
| PF00406 | 151 | ADK: Adenylate kinase; InterPro: IPR000850 Adenyla | 87.46 | |
| cd00550 | 254 | ArsA_ATPase Oxyanion-translocating ATPase (ArsA). | 87.45 | |
| PRK14489 | 366 | putative bifunctional molybdopterin-guanine dinucl | 87.29 | |
| PRK14528 | 186 | adenylate kinase; Provisional | 87.29 | |
| COG3911 | 183 | Predicted ATPase [General function prediction only | 87.28 | |
| PRK07261 | 171 | topology modulation protein; Provisional | 87.26 | |
| PF00485 | 194 | PRK: Phosphoribulokinase / Uridine kinase family; | 87.12 | |
| cd02037 | 169 | MRP-like MRP (Multiple Resistance and pH adaptatio | 87.07 | |
| cd02040 | 270 | NifH NifH gene encodes component II (iron protein) | 87.05 | |
| COG1936 | 180 | Predicted nucleotide kinase (related to CMP and AM | 87.04 | |
| TIGR02236 | 310 | recomb_radA DNA repair and recombination protein R | 87.03 | |
| PLN00020 | 413 | ribulose bisphosphate carboxylase/oxygenase activa | 87.02 | |
| PF02374 | 305 | ArsA_ATPase: Anion-transporting ATPase; PDB: 2WOO_ | 86.95 | |
| PRK00279 | 215 | adk adenylate kinase; Reviewed | 86.91 | |
| KOG0926 | 1172 | consensus DEAH-box RNA helicase [RNA processing an | 86.89 | |
| PF01656 | 195 | CbiA: CobQ/CobB/MinD/ParA nucleotide binding domai | 86.87 | |
| KOG0733 | 802 | consensus Nuclear AAA ATPase (VCP subfamily) [Post | 86.76 | |
| PRK06547 | 172 | hypothetical protein; Provisional | 86.73 | |
| KOG0953 | 700 | consensus Mitochondrial RNA helicase SUV3, DEAD-bo | 86.72 | |
| TIGR02397 | 355 | dnaX_nterm DNA polymerase III, subunit gamma and t | 86.67 | |
| PRK14957 | 546 | DNA polymerase III subunits gamma and tau; Provisi | 86.61 | |
| TIGR00764 | 608 | lon_rel lon-related putative ATP-dependent proteas | 86.46 | |
| PF06068 | 398 | TIP49: TIP49 C-terminus; InterPro: IPR010339 This | 86.46 | |
| TIGR01241 | 495 | FtsH_fam ATP-dependent metalloprotease FtsH. HflB( | 86.4 | |
| PF03796 | 259 | DnaB_C: DnaB-like helicase C terminal domain; Inte | 86.39 | |
| PRK05748 | 448 | replicative DNA helicase; Provisional | 86.39 | |
| TIGR01351 | 210 | adk adenylate kinases. Adenylate kinase (EC 2.7.4. | 86.35 | |
| PF08433 | 270 | KTI12: Chromatin associated protein KTI12 ; InterP | 86.32 | |
| COG4962 | 355 | CpaF Flp pilus assembly protein, ATPase CpaF [Intr | 86.31 | |
| PHA02624 | 647 | large T antigen; Provisional | 86.31 | |
| COG0610 | 962 | Type I site-specific restriction-modification syst | 86.26 | |
| cd01672 | 200 | TMPK Thymidine monophosphate kinase (TMPK), also k | 86.26 | |
| COG2255 | 332 | RuvB Holliday junction resolvasome, helicase subun | 86.22 | |
| PF00931 | 287 | NB-ARC: NB-ARC domain; InterPro: IPR002182 This is | 86.21 | |
| PF13476 | 202 | AAA_23: AAA domain; PDB: 3AV0_B 3AUY_B 3AUX_A 2O5V | 86.18 | |
| COG0470 | 325 | HolB ATPase involved in DNA replication [DNA repli | 86.11 | |
| KOG0731 | 774 | consensus AAA+-type ATPase containing the peptidas | 86.1 | |
| KOG0338 | 691 | consensus ATP-dependent RNA helicase [RNA processi | 85.9 | |
| TIGR02016 | 296 | BchX chlorophyllide reductase iron protein subunit | 85.86 | |
| PF01580 | 205 | FtsK_SpoIIIE: FtsK/SpoIIIE family; InterPro: IPR00 | 85.83 | |
| PRK05439 | 311 | pantothenate kinase; Provisional | 85.81 | |
| PRK13765 | 637 | ATP-dependent protease Lon; Provisional | 85.79 | |
| CHL00195 | 489 | ycf46 Ycf46; Provisional | 85.72 | |
| PRK13407 | 334 | bchI magnesium chelatase subunit I; Provisional | 85.68 | |
| PRK13947 | 171 | shikimate kinase; Provisional | 85.65 | |
| KOG0651 | 388 | consensus 26S proteasome regulatory complex, ATPas | 85.64 | |
| PRK13235 | 274 | nifH nitrogenase reductase; Reviewed | 85.61 | |
| PHA00547 | 337 | hypothetical protein | 85.6 |
| >KOG1802 consensus RNA helicase nonsense mRNA reducing factor (pNORF1) [RNA processing and modification] | Back alignment and domain information |
|---|
Probab=100.00 E-value=3.5e-180 Score=1522.98 Aligned_cols=788 Identities=69% Similarity=1.101 Sum_probs=734.6
Q ss_pred cccccccccCCCccCcccCCccCCcccccccCCCCCCceEEcCCCccCceeeCCCCCCCcchhhhhhhhcccceeeecCC
Q 001501 118 MAGLSFEETGDDVEGFEYGKADFTEHACRYCGVSNPACVVRCNVPSCRKWFCNSRGNTSGSHIVNHLVRAKHKEVCLHKD 197 (1066)
Q Consensus 118 ~~~~~~~~~~~~~~~~~~~~~~~~~~~c~ycg~~~~~~~~~c~~~~c~kwfcn~~~~~~~shi~~hlv~~~~~~~~lh~~ 197 (1066)
+.++.|||-..+. ...+ +.++|+|+|+||||++|.||++|++ |+|||||+|++|++||||+||||++||+|+||+|
T Consensus 38 ~~e~~fee~~~~~-~~~~-~~~~~~~~c~Ycgi~~p~~v~kc~~--c~Kwfcn~r~gtsgshIv~hlvra~hk~v~lh~d 113 (935)
T KOG1802|consen 38 VGEVLFEECLVEK-NRAR-EQKLPEHACAYCGISEPACVIKCNT--CGKWFCNSRGGTSGSHIVNHLVRAKHKEVSLHKD 113 (935)
T ss_pred cchhhhhhhcccc-cccc-ccccchhhhhhccCCCchheeeccc--cCceeecCCCCCchhHHHHHHHHhhhheeEeccC
Confidence 8899999855543 2334 5689999999999999999999999 9999999999999999999999999999999999
Q ss_pred CCCcccceeeecccccccccccceeccCCceEEEeechhhhH--------------------------------------
Q 001501 198 SPLGETILECYNCGCRNVFLLGFISAKTESVVVLLCREPCLN-------------------------------------- 239 (1066)
Q Consensus 198 ~~~~~~~lecy~~~~~nvf~lgf~~~~~~~~~~~~~r~~~~~-------------------------------------- 239 (1066)
+++|||+||||+||++|||+|||||+|+|+|||++||+||++
T Consensus 114 s~lget~lecyncg~~nvf~lGFi~~ksd~VVvllcr~pcas~s~~kd~Nwd~~qw~~li~dr~~l~wivk~pseqe~~~ 193 (935)
T KOG1802|consen 114 SPLGETVLECYNCGSRNVFLLGFIPAKSDSVVVLLCRQPCASRSNLKDMNWDLSQWQPLIEDRCLLSWIVKVPSEQEQLR 193 (935)
T ss_pred CCCCcceEEeeccCcchhhhhcccccccCceEEEEecCcccccccCCCcCCChhhccchhhhhcccchhccCCcchhhhh
Confidence 999999999999999999999999999999999999999986
Q ss_pred -----------------------------------------------------------------HhhhccccccEEEEE
Q 001501 240 -----------------------------------------------------------------MMKESQSKDNVTIRW 254 (1066)
Q Consensus 240 -----------------------------------------------------------------~~~e~~~~~~~~~~~ 254 (1066)
.+||||+++++++||
T Consensus 194 aR~iT~qqi~~~eelwr~np~at~~dl~kP~~d~~~~hv~~ry~da~~y~~vf~pliklea~ydk~~Kes~~q~~~tvRW 273 (935)
T KOG1802|consen 194 ARKITAQQIVKLEELWRKNPSATLEDLDKPGEDEEPPHVQLRYEDAYEYQNVFSPLIKLEADYDKRLKESQTQENGTVRW 273 (935)
T ss_pred hccccHHHHHHHHhhhccCCccchhhcCCcccccCCCcccccccchHHHhhhcchhhhhhhhhhhhhhhhcccccceEEe
Confidence 699999999999999
Q ss_pred EecCCCeEEEEEEccCCCCCCCCCCCCEEEEEeCCCCCCCcceEEEEEEEecc--ccEEEEEeccCCCCCcccCCCceEE
Q 001501 255 DIGLNKKRVAYFVFPKEDNELRLVPGDELRLRYSGDAAHPAWQSVGHVIKLTA--QEEVALELRASQGVPVDINHGFSVD 332 (1066)
Q Consensus 255 ~~~l~~k~~~~~~~~~~~~~~~l~~GD~v~l~~~~~~~~~~~~~~g~V~~i~~--~~~v~l~l~~~~~~p~~~~~~~~v~ 332 (1066)
+++||+|+++||.+++.+.++++..||+++|+|++. ....|.++|+|+++++ ++|+.||++.....|.+.+++|.|+
T Consensus 274 ~~gLnkk~~a~f~~~k~~~e~kl~~GdE~~L~y~~~-~~~~w~~~g~v~~~pd~~~dE~~lEl~~~~~~p~e~~~~Ftvd 352 (935)
T KOG1802|consen 274 DIGLNKKRLAYFTLPKLDSELKLAIGDEIRLTYSGG-LVLPWNGIGSVLKIPDNNGDEVKLELEFSQDPPIEVTHGFTVD 352 (935)
T ss_pred eeccccceEEEEecCCCcchhccccCCeeEEEecCC-cCCcccccceEEecCCCCcceeEEEeecCCCCCcccccceEEE
Confidence 999999999999999998999999999999999998 5566999999999998 6999999999999999999999999
Q ss_pred EeeccchHHHHHHHHHHHHHhhcchhhhhhhhhcCCchhhhhhccCCCCCCCCCCCCCCCHHHHHHHHHHhcCCcEEEEC
Q 001501 333 FVWKSTSFDRMQGAMKTFAVDETSVSGYIYHHLLGHEVEVQMVRNTLPRRFGAPGLPELNASQVFAVKSVLQRPISLIQG 412 (1066)
Q Consensus 333 ~~~~~~s~~R~~~AL~~~~~~e~~~~~~i~~~llg~~~~~~~~~~~lp~~~~~~~~~~LN~sQ~~AV~~aL~~~l~LIqG 412 (1066)
|+|+.++|+||+.||+.|+.|+.+++.|+|+.+||+++++..++..+|+.|+.|++++||.+|..||+++|+++++||||
T Consensus 353 ~vwk~ts~drm~~alk~la~D~~~vs~y~y~klLgh~~~~~~~k~~LP~~~s~~~lpkLN~SQ~~AV~~VL~rplsLIQG 432 (935)
T KOG1802|consen 353 FVWKSTSFDRMQLALKLLAVDEKKVSGYLYHKLLGHPVEDSSLKKLLPRRFSVPNLPKLNASQSNAVKHVLQRPLSLIQG 432 (935)
T ss_pred EEEcCccHHHHHHHHHHhhhccccchhhhhhHHhcCcchhhhhcccCchhhcCCCchhhchHHHHHHHHHHcCCceeeec
Confidence 99999999999999999999999999999999999999999899999999999999999999999999999999999999
Q ss_pred CCCCcHhHHHHHHHHHHHHcCCCeEEEEcCcHHHHHHHHHHHHhcCCeEEEeccccccccCCcchhhhHHHHHhhccchh
Q 001501 413 PPGTGKTVTSAAIVYHMAKQGQGQVLVCAPSNVAVDQLAEKISATGLKVVRLCAKSREAVSSPVEHLTLHYQVRHLDTSE 492 (1066)
Q Consensus 413 PPGTGKTtTla~iI~~Llk~~~~rILV~ApSN~AvD~L~eRL~~~gl~ivRlg~~sre~i~~~~~~l~l~~~i~~~~~~~ 492 (1066)
|||||||.|+++||++|+++...+||||||||.|||+|+|+|++.|++|||+++++||.++++++++++|.+++.+..
T Consensus 433 PPGTGKTvtsa~IVyhl~~~~~~~VLvcApSNiAVDqLaeKIh~tgLKVvRl~aksRE~~~S~vs~L~lh~~~~~~~~-- 510 (935)
T KOG1802|consen 433 PPGTGKTVTSATIVYHLARQHAGPVLVCAPSNIAVDQLAEKIHKTGLKVVRLCAKSREDIESDVSFLSLHEQLRNMDK-- 510 (935)
T ss_pred CCCCCceehhHHHHHHHHHhcCCceEEEcccchhHHHHHHHHHhcCceEeeeehhhhhhccCCccHHHHHHHHhccCc--
Confidence 999999999999999999998889999999999999999999999999999999999999999999999999999886
Q ss_pred HHHHHHHHHhhhhhccCChhHHHHHHHHHHHHHHHHHhccccccccccccCCccccCCCCCEEEEECCCCCChhhhhhhc
Q 001501 493 KSELHKLQQLKDEQGELSSSDEKKYKALKRATEREISQSADVICCTCVGAGDPRLANFRFRQVLIDESTQATEPECLIPL 572 (1066)
Q Consensus 493 ~~~L~kl~~lk~~~~~ls~~~~kr~~~l~~~~~~~iL~~a~VI~~T~~~a~~~~L~~~~Fd~VIIDEAsQ~tE~e~LIpL 572 (1066)
.+|+++.+++++.++++..++++|..+++..+++++..|+||||||++|++.+|.+++|+.||||||.|++||+|||||
T Consensus 511 -pELq~l~klkde~gelS~sD~~k~~~lk~~~e~ell~~AdVIccTcv~Agd~rl~~~kfr~VLiDEaTQatEpe~LiPl 589 (935)
T KOG1802|consen 511 -PELQKLLKLKDEGGELSSSDEKKYRKLKRAAEKELLNQADVICCTCVGAGDRRLSKFKFRTVLIDEATQATEPECLIPL 589 (935)
T ss_pred -HHHHHHHhhhhhcccccchhhHHHHHHHHHHHHHHHhhcCEEEEecccccchhhccccccEEEEecccccCCcchhhhh
Confidence 8899999999999999999999999999999999999999999999999999999999999999999999999999999
Q ss_pred cccCceEEEeCCccCCCceeecHHHHhhcchHHHHHHHHHcCCcceEeeeeeccCCCCCCccccccccCccccccccccc
Q 001501 573 VLGAKQVVLVGDHCQLGPVIMCKKAARAGLAQSLFERLVLLGLKPIRLQVQYRMHPSLSEFPSNSFYEGTLQNGVTINER 652 (1066)
Q Consensus 573 ~~~~krlILVGD~~QLpPvv~s~~a~~~gl~~SLFeRL~~~g~~~i~L~~qYRm~p~I~~f~s~~FY~g~L~~~~~~~~r 652 (1066)
.++++++||||||+||+|++++++++.++|.+||||||+..|..+++|.+||||||.|++|++++||+|.|+++++..+|
T Consensus 590 vlG~kq~VlVGDh~QLgpvi~~kK~a~Agl~qsLferli~lg~~P~~L~vQYRmhP~lSefpsn~fY~G~LqnGVT~~~R 669 (935)
T KOG1802|consen 590 VLGAKQLVLVGDHKQLGPVIMCKKAATAGLSQSLFERLISLGIKPIRLQVQYRMHPALSEFPSNMFYEGELQNGVTEIER 669 (935)
T ss_pred hhcceeEEEeccccccCceeeeHHHHHhHHHHHHHHHHHhccCCceEEEEeeeeChhhhhcchhhhccchhhcCcchhhh
Confidence 99999999999999999999999999999999999999999999999999999999999999999999999999999999
Q ss_pred ccCCCCCCCCCCCCCeEEEEecCceeecccCCCcCCHHHHHHHHHHHHHHHHCCCCCCcEEEEecchhHHHHHHHHHHhc
Q 001501 653 QSSGIDFPWPVPNRPMFFYVQMGQEEISASGTSYLNRTEAANVEKIVTTFLRSGVVPSQIGVITPYEGQRAYIVNYMSRN 732 (1066)
Q Consensus 653 ~~~~~~~~~p~~~~P~~f~~~~g~ee~~~~~~S~~N~~EA~~V~~iV~~Ll~~gv~~~dIgIITPY~aQv~~L~~~L~~~ 732 (1066)
...+++++||.++.|++|+...|.||+..+|+||.|+.||..++++|+.|++.|+.+++|||||||.+|+.+|.++|...
T Consensus 670 ~~~g~~~pwp~p~~pl~fy~~~g~eeisasGtSf~Nr~Ea~~~ekii~~l~~~gv~~~qIGVITpYegQr~~i~~ym~~~ 749 (935)
T KOG1802|consen 670 SPLGVDFPWPQPDKPLFFYVCYGQEEISASGTSFLNRTEAANCEKIITKLLKSGVKPSQIGVITPYEGQRSYIVNYMQTN 749 (935)
T ss_pred ccCCCCCCCCCCCCccceEEeccceeeeccccceecHHHHHHHHHHHHHHHHcCCCHHHeeeecccchhHHHHHHHHHhc
Confidence 99999999999999999999999999999999999999999999999999999999999999999999999999999999
Q ss_pred cchhhhccCCeEEeecccCCCccccEEEEEccccCCCCCcCCCCCCCceeeechhhccceEEEeccccccCChhHHHHHH
Q 001501 733 GALRQQLYKEIEVASVDSFQGREKDYIILSCVRSNEHQGIGFLNDPRRLNVALTRARYGIVILGNPKVLSKQPLWNGLLT 812 (1066)
Q Consensus 733 ~~~~~~~~~~V~V~TVdsfQG~E~DvVIlS~VRSn~~~~iGFL~d~RRLNVALTRAK~~LiIVGn~~~Ls~~~~W~~ll~ 812 (1066)
+.+...++..|+|+|||+|||+|+|+||+||||+|...+|||+.|+|||||||||||++|+||||+.+|+++++|.++|.
T Consensus 750 gsl~~~ly~~veVasVDaFQGrEKdfIIlSCVRsn~~qgIGFl~d~RRlNVaLTRaK~glvivGN~~~L~k~~LW~~li~ 829 (935)
T KOG1802|consen 750 GSLHKDLYKEVEVASVDAFQGREKDFIILSCVRSNEHQGIGFLNDPRRLNVALTRAKYGLVIVGNPKVLRKHPLWGHLIT 829 (935)
T ss_pred CccccchhheeEEEeeccccCcccceEEEEEeecccccccccccCchhhhhhhhhcccceEEecCHHHhhhchHHHHHHH
Confidence 99999999999999999999999999999999999999999999999999999999999999999999999999999999
Q ss_pred HHHhcCeeecCCCcchhhhhhhcccCccccccccccccCCCCCC-CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q 001501 813 HYKEHECLVEGPLNNLKQSMVQFQKPKKIYNDRRLFFGAGPGIV-PNDISTSNPNADRRGSRARGYMPPGPPNGTHKPGL 891 (1066)
Q Consensus 813 ~~~~~~~lv~g~l~~l~~s~~~~~~p~~~~~~~~~~~~~~~~~~-~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ 891 (1066)
|+++++++++|++++++++++++.+|.+..+.++...+...... .......++....+.++.+.|.+.....+...
T Consensus 830 h~~eke~l~eg~ln~l~~~~~~l~kp~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~s~~~~y~~~~n~~~~~~--- 906 (935)
T KOG1802|consen 830 HYKEKEVLVEGPLNNLKPSLLQLLKPQKLKNFKEKQKGFMNKSKIKDKSHSFNPSASNRPSRLSSYLNSGNLFGMSK--- 906 (935)
T ss_pred HhhcccceeecchhhhhhhhhhhcCCchhhhhhhhhhhhhhhcccccccccCCcchhccccccchhccccCcccccC---
Confidence 99999999999999999999999999999998877654432222 22222444555555555556655544443321
Q ss_pred CCCCCCCCCCCCCCCCCCCCCCCCCC
Q 001501 892 HPAGFPMPRVPLPPFQGGPPSQPYAI 917 (1066)
Q Consensus 892 ~~~~~~~~~~~~p~~~~~p~~~~~~~ 917 (1066)
++.......+-|....+||.++++-
T Consensus 907 -~~~~~~~~~~~~~~~~~~~~~~~~~ 931 (935)
T KOG1802|consen 907 -LAQYFNKNVPIPANMVGPPSQKAAR 931 (935)
T ss_pred -hhhccccCCCCchhhcCCCcccccc
Confidence 2334444555555666666665543
|
|
| >TIGR00376 DNA helicase, putative | Back alignment and domain information |
|---|
| >KOG1803 consensus DNA helicase [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >KOG1805 consensus DNA replication helicase [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >KOG1807 consensus Helicases [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >COG1112 Superfamily I DNA and RNA helicases and helicase subunits [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PF09416 UPF1_Zn_bind: RNA helicase (UPF2 interacting domain); InterPro: IPR018999 UPF1 (or regulator of nonsense transcripts 1 homologue) is an essential RNA helicase that detects mRNAs containing premature stop codons and triggers their degradation | Back alignment and domain information |
|---|
| >KOG1801 consensus tRNA-splicing endonuclease positive effector (SEN1) [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG1804 consensus RNA helicase [RNA processing and modification] | Back alignment and domain information |
|---|
| >PF13087 AAA_12: AAA domain; PDB: 2XZO_A 2WJY_A 2WJV_A 2XZP_A 2GK6_A 2GK7_A 2GJK_A 2XZL_A | Back alignment and domain information |
|---|
| >PF13086 AAA_11: AAA domain; PDB: 2XZL_A 2XZO_A 2WJY_A 2WJV_A 2XZP_A 2GK6_A 2GK7_A 2GJK_A | Back alignment and domain information |
|---|
| >TIGR01075 uvrD DNA helicase II | Back alignment and domain information |
|---|
| >PRK11773 uvrD DNA-dependent helicase II; Provisional | Back alignment and domain information |
|---|
| >TIGR01073 pcrA ATP-dependent DNA helicase PcrA | Back alignment and domain information |
|---|
| >PRK10919 ATP-dependent DNA helicase Rep; Provisional | Back alignment and domain information |
|---|
| >PRK10875 recD exonuclease V subunit alpha; Provisional | Back alignment and domain information |
|---|
| >PRK11054 helD DNA helicase IV; Provisional | Back alignment and domain information |
|---|
| >TIGR01447 recD exodeoxyribonuclease V, alpha subunit | Back alignment and domain information |
|---|
| >KOG1806 consensus DEAD box containing helicases [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >TIGR01074 rep ATP-dependent DNA helicase Rep | Back alignment and domain information |
|---|
| >TIGR01448 recD_rel helicase, putative, RecD/TraA family | Back alignment and domain information |
|---|
| >COG0210 UvrD Superfamily I DNA and RNA helicases [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >TIGR02768 TraA_Ti Ti-type conjugative transfer relaxase TraA | Back alignment and domain information |
|---|
| >TIGR00609 recB exodeoxyribonuclease V, beta subunit | Back alignment and domain information |
|---|
| >COG1074 RecB ATP-dependent exoDNAse (exonuclease V) beta subunit (contains helicase and exonuclease domains) [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >TIGR02785 addA_Gpos recombination helicase AddA, Firmicutes type | Back alignment and domain information |
|---|
| >PRK13826 Dtr system oriT relaxase; Provisional | Back alignment and domain information |
|---|
| >PRK13909 putative recombination protein RecB; Provisional | Back alignment and domain information |
|---|
| >PRK13889 conjugal transfer relaxase TraA; Provisional | Back alignment and domain information |
|---|
| >PRK10876 recB exonuclease V subunit beta; Provisional | Back alignment and domain information |
|---|
| >TIGR02784 addA_alphas double-strand break repair helicase AddA, alphaproteobacterial type | Back alignment and domain information |
|---|
| >PF13604 AAA_30: AAA domain; PDB: 1W36_G 3K70_G 3UPU_B 3GPL_A 3E1S_A 3GP8_A | Back alignment and domain information |
|---|
| >PRK13709 conjugal transfer nickase/helicase TraI; Provisional | Back alignment and domain information |
|---|
| >PRK14712 conjugal transfer nickase/helicase TraI; Provisional | Back alignment and domain information |
|---|
| >COG3973 Superfamily I DNA and RNA helicases [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR02760 TraI_TIGR conjugative transfer relaxase protein TraI | Back alignment and domain information |
|---|
| >PF01443 Viral_helicase1: Viral (Superfamily 1) RNA helicase; InterPro: IPR000606 This entry includes RNA and DNA helicases | Back alignment and domain information |
|---|
| >PF00580 UvrD-helicase: UvrD/REP helicase N-terminal domain; InterPro: IPR000212 Members of this family are helicases that catalyse ATP dependent unwinding of double stranded DNA to single stranded DNA | Back alignment and domain information |
|---|
| >TIGR02760 TraI_TIGR conjugative transfer relaxase protein TraI | Back alignment and domain information |
|---|
| >COG0507 RecD ATP-dependent exoDNAse (exonuclease V), alpha subunit - helicase superfamily I member [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PF09848 DUF2075: Uncharacterized conserved protein (DUF2075); InterPro: IPR018647 This domain, found in putative ATP/GTP binding proteins, has no known function | Back alignment and domain information |
|---|
| >COG3972 Superfamily I DNA and RNA helicases [General function prediction only] | Back alignment and domain information |
|---|
| >PF13361 UvrD_C: UvrD-like helicase C-terminal domain; PDB: 1UAA_B 3U4Q_A 3U44_A 1W36_B 3K70_B 2IS6_B 3LFU_A 2IS2_B 2IS1_B 2IS4_A | Back alignment and domain information |
|---|
| >PF05970 PIF1: PIF1-like helicase; InterPro: IPR010285 This entry represents PIF1 helicase and related proteins | Back alignment and domain information |
|---|
| >PF13245 AAA_19: Part of AAA domain | Back alignment and domain information |
|---|
| >PRK10536 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PF02562 PhoH: PhoH-like protein; InterPro: IPR003714 PhoH is a cytoplasmic protein and predicted ATPase that is induced by phosphate starvation and belongings to the phosphate regulon (pho) in Escherichia coli [] | Back alignment and domain information |
|---|
| >TIGR02773 addB_Gpos ATP-dependent nuclease subunit B | Back alignment and domain information |
|---|
| >smart00487 DEXDc DEAD-like helicases superfamily | Back alignment and domain information |
|---|
| >KOG1804 consensus RNA helicase [RNA processing and modification] | Back alignment and domain information |
|---|
| >cd00046 DEXDc DEAD-like helicases superfamily | Back alignment and domain information |
|---|
| >PRK10590 ATP-dependent RNA helicase RhlE; Provisional | Back alignment and domain information |
|---|
| >PF13538 UvrD_C_2: UvrD-like helicase C-terminal domain; PDB: 1W36_G 3K70_G 3DMN_A 3UPU_B 3GPL_A 3E1S_A 3GP8_A | Back alignment and domain information |
|---|
| >PF00270 DEAD: DEAD/DEAH box helicase; InterPro: IPR011545 Members of this family include the DEAD and DEAH box helicases | Back alignment and domain information |
|---|
| >PRK04537 ATP-dependent RNA helicase RhlB; Provisional | Back alignment and domain information |
|---|
| >KOG2108 consensus 3'-5' DNA helicase [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >PRK11634 ATP-dependent RNA helicase DeaD; Provisional | Back alignment and domain information |
|---|
| >cd00268 DEADc DEAD-box helicases | Back alignment and domain information |
|---|
| >TIGR00580 mfd transcription-repair coupling factor (mfd) | Back alignment and domain information |
|---|
| >PHA02558 uvsW UvsW helicase; Provisional | Back alignment and domain information |
|---|
| >PRK11192 ATP-dependent RNA helicase SrmB; Provisional | Back alignment and domain information |
|---|
| >PRK10689 transcription-repair coupling factor; Provisional | Back alignment and domain information |
|---|
| >PRK05580 primosome assembly protein PriA; Validated | Back alignment and domain information |
|---|
| >PTZ00424 helicase 45; Provisional | Back alignment and domain information |
|---|
| >PRK11776 ATP-dependent RNA helicase DbpA; Provisional | Back alignment and domain information |
|---|
| >PRK10917 ATP-dependent DNA helicase RecG; Provisional | Back alignment and domain information |
|---|
| >TIGR00643 recG ATP-dependent DNA helicase RecG | Back alignment and domain information |
|---|
| >PRK02362 ski2-like helicase; Provisional | Back alignment and domain information |
|---|
| >PRK00254 ski2-like helicase; Provisional | Back alignment and domain information |
|---|
| >PF07652 Flavi_DEAD: Flavivirus DEAD domain ; InterPro: IPR011492 This is the Flavivirus DEAD domain | Back alignment and domain information |
|---|
| >PRK04837 ATP-dependent RNA helicase RhlB; Provisional | Back alignment and domain information |
|---|
| >PRK01172 ski2-like helicase; Provisional | Back alignment and domain information |
|---|
| >PF04851 ResIII: Type III restriction enzyme, res subunit; InterPro: IPR006935 This entry represents a domain found in the N terminus of several proteins, including helicases, the R subunit (HsdR) of type I restriction endonucleases (3 | Back alignment and domain information |
|---|
| >COG1702 PhoH Phosphate starvation-inducible protein PhoH, predicted ATPase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >COG1061 SSL2 DNA or RNA helicases of superfamily II [Transcription / DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PTZ00110 helicase; Provisional | Back alignment and domain information |
|---|
| >COG1875 NYN ribonuclease and ATPase of PhoH family domains [General function prediction only] | Back alignment and domain information |
|---|
| >PRK13766 Hef nuclease; Provisional | Back alignment and domain information |
|---|
| >PRK11448 hsdR type I restriction enzyme EcoKI subunit R; Provisional | Back alignment and domain information |
|---|
| >TIGR03817 DECH_helic helicase/secretion neighborhood putative DEAH-box helicase | Back alignment and domain information |
|---|
| >PRK01297 ATP-dependent RNA helicase RhlB; Provisional | Back alignment and domain information |
|---|
| >TIGR01054 rgy reverse gyrase | Back alignment and domain information |
|---|
| >COG1204 Superfamily II helicase [General function prediction only] | Back alignment and domain information |
|---|
| >PRK09401 reverse gyrase; Reviewed | Back alignment and domain information |
|---|
| >TIGR00603 rad25 DNA repair helicase rad25 | Back alignment and domain information |
|---|
| >PRK08181 transposase; Validated | Back alignment and domain information |
|---|
| >TIGR00614 recQ_fam ATP-dependent DNA helicase, RecQ family | Back alignment and domain information |
|---|
| >TIGR03117 cas_csf4 CRISPR-associated DEAD/DEAH-box helicase Csf4 | Back alignment and domain information |
|---|
| >PLN00206 DEAD-box ATP-dependent RNA helicase; Provisional | Back alignment and domain information |
|---|
| >PHA02653 RNA helicase NPH-II; Provisional | Back alignment and domain information |
|---|
| >PRK14712 conjugal transfer nickase/helicase TraI; Provisional | Back alignment and domain information |
|---|
| >smart00488 DEXDc2 DEAD-like helicases superfamily | Back alignment and domain information |
|---|
| >smart00489 DEXDc3 DEAD-like helicases superfamily | Back alignment and domain information |
|---|
| >PRK06526 transposase; Provisional | Back alignment and domain information |
|---|
| >PF13401 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S_B | Back alignment and domain information |
|---|
| >PRK14974 cell division protein FtsY; Provisional | Back alignment and domain information |
|---|
| >PF05127 Helicase_RecD: Helicase; InterPro: IPR007807 This domain is about 350 amino acid residues long and appears to have a P-loop motif, suggesting this is an ATPase | Back alignment and domain information |
|---|
| >TIGR00348 hsdR type I site-specific deoxyribonuclease, HsdR family | Back alignment and domain information |
|---|
| >PRK14701 reverse gyrase; Provisional | Back alignment and domain information |
|---|
| >TIGR00595 priA primosomal protein N' | Back alignment and domain information |
|---|
| >TIGR01389 recQ ATP-dependent DNA helicase RecQ | Back alignment and domain information |
|---|
| >PRK13767 ATP-dependent helicase; Provisional | Back alignment and domain information |
|---|
| >PRK04296 thymidine kinase; Provisional | Back alignment and domain information |
|---|
| >PRK11664 ATP-dependent RNA helicase HrpB; Provisional | Back alignment and domain information |
|---|
| >TIGR01970 DEAH_box_HrpB ATP-dependent helicase HrpB | Back alignment and domain information |
|---|
| >PRK11057 ATP-dependent DNA helicase RecQ; Provisional | Back alignment and domain information |
|---|
| >PF00448 SRP54: SRP54-type protein, GTPase domain; InterPro: IPR000897 The signal recognition particle (SRP) is a multimeric protein, which along with its conjugate receptor (SR), is involved in targeting secretory proteins to the rough endoplasmic reticulum (RER) membrane in eukaryotes, or to the plasma membrane in prokaryotes [, ] | Back alignment and domain information |
|---|
| >COG4098 comFA Superfamily II DNA/RNA helicase required for DNA uptake (late competence protein) [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >TIGR01587 cas3_core CRISPR-associated helicase Cas3 | Back alignment and domain information |
|---|
| >KOG0952 consensus DNA/RNA helicase MER3/SLH1, DEAD-box superfamily [RNA processing and modification] | Back alignment and domain information |
|---|
| >TIGR00604 rad3 DNA repair helicase (rad3) | Back alignment and domain information |
|---|
| >COG1110 Reverse gyrase [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >COG1200 RecG RecG-like helicase [DNA replication, recombination, and repair / Transcription] | Back alignment and domain information |
|---|
| >COG4096 HsdR Type I site-specific restriction-modification system, R (restriction) subunit and related helicases [Defense mechanisms] | Back alignment and domain information |
|---|
| >COG1198 PriA Primosomal protein N' (replication factor Y) - superfamily II helicase [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PF00176 SNF2_N: SNF2 family N-terminal domain; InterPro: IPR000330 This domain is found in proteins involved in a variety of processes including transcription regulation (e | Back alignment and domain information |
|---|
| >TIGR01967 DEAH_box_HrpA ATP-dependent helicase HrpA | Back alignment and domain information |
|---|
| >KOG2108 consensus 3'-5' DNA helicase [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >PRK07246 bifunctional ATP-dependent DNA helicase/DNA polymerase III subunit epsilon; Validated | Back alignment and domain information |
|---|
| >PRK08084 DNA replication initiation factor; Provisional | Back alignment and domain information |
|---|
| >KOG0354 consensus DEAD-box like helicase [General function prediction only] | Back alignment and domain information |
|---|
| >PF02399 Herpes_ori_bp: Origin of replication binding protein; InterPro: IPR003450 This entry represents replication origin binding protein | Back alignment and domain information |
|---|
| >PF13173 AAA_14: AAA domain | Back alignment and domain information |
|---|
| >PRK08074 bifunctional ATP-dependent DNA helicase/DNA polymerase III subunit epsilon; Validated | Back alignment and domain information |
|---|
| >PRK14722 flhF flagellar biosynthesis regulator FlhF; Provisional | Back alignment and domain information |
|---|
| >TIGR01407 dinG_rel DnaQ family exonuclease/DinG family helicase, putative | Back alignment and domain information |
|---|
| >PRK13709 conjugal transfer nickase/helicase TraI; Provisional | Back alignment and domain information |
|---|
| >TIGR03158 cas3_cyano CRISPR-associated helicase, Cyano-type | Back alignment and domain information |
|---|
| >TIGR02621 cas3_GSU0051 CRISPR-associated helicase Cas3, Anaes-subtype | Back alignment and domain information |
|---|
| >cd00009 AAA The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold | Back alignment and domain information |
|---|
| >PRK12723 flagellar biosynthesis regulator FlhF; Provisional | Back alignment and domain information |
|---|
| >TIGR03499 FlhF flagellar biosynthetic protein FlhF | Back alignment and domain information |
|---|
| >COG1111 MPH1 ERCC4-like helicases [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PRK00771 signal recognition particle protein Srp54; Provisional | Back alignment and domain information |
|---|
| >PRK12377 putative replication protein; Provisional | Back alignment and domain information |
|---|
| >PHA03311 helicase-primase subunit BBLF4; Provisional | Back alignment and domain information |
|---|
| >PRK11747 dinG ATP-dependent DNA helicase DinG; Provisional | Back alignment and domain information |
|---|
| >cd01124 KaiC KaiC is a circadian clock protein primarily found in cyanobacteria KaiC is a RecA-like ATPase, having both Walker A and Walker B motifs | Back alignment and domain information |
|---|
| >PRK11889 flhF flagellar biosynthesis regulator FlhF; Provisional | Back alignment and domain information |
|---|
| >PRK07952 DNA replication protein DnaC; Validated | Back alignment and domain information |
|---|
| >COG4889 Predicted helicase [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR03015 pepcterm_ATPase putative secretion ATPase, PEP-CTERM locus subfamily | Back alignment and domain information |
|---|
| >TIGR01425 SRP54_euk signal recognition particle protein SRP54 | Back alignment and domain information |
|---|
| >PRK12899 secA preprotein translocase subunit SecA; Reviewed | Back alignment and domain information |
|---|
| >PRK11131 ATP-dependent RNA helicase HrpA; Provisional | Back alignment and domain information |
|---|
| >COG0513 SrmB Superfamily II DNA and RNA helicases [DNA replication, recombination, and repair / Transcription / Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >PRK12898 secA preprotein translocase subunit SecA; Reviewed | Back alignment and domain information |
|---|
| >PRK07003 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >COG1199 DinG Rad3-related DNA helicases [Transcription / DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PRK05703 flhF flagellar biosynthesis regulator FlhF; Validated | Back alignment and domain information |
|---|
| >PRK04914 ATP-dependent helicase HepA; Validated | Back alignment and domain information |
|---|
| >COG1643 HrpA HrpA-like helicases [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PRK12323 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK14956 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK07994 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >PRK14958 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >TIGR03714 secA2 accessory Sec system translocase SecA2 | Back alignment and domain information |
|---|
| >smart00382 AAA ATPases associated with a variety of cellular activities | Back alignment and domain information |
|---|
| >PLN03137 ATP-dependent DNA helicase; Q4-like; Provisional | Back alignment and domain information |
|---|
| >TIGR00064 ftsY signal recognition particle-docking protein FtsY | Back alignment and domain information |
|---|
| >PRK14087 dnaA chromosomal replication initiation protein; Provisional | Back alignment and domain information |
|---|
| >COG2256 MGS1 ATPase related to the helicase subunit of the Holliday junction resolvase [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PHA03333 putative ATPase subunit of terminase; Provisional | Back alignment and domain information |
|---|
| >COG1205 Distinct helicase family with a unique C-terminal domain including a metal-binding cysteine cluster [General function prediction only] | Back alignment and domain information |
|---|
| >PRK14088 dnaA chromosomal replication initiation protein; Provisional | Back alignment and domain information |
|---|
| >COG1484 DnaC DNA replication protein [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >KOG0989 consensus Replication factor C, subunit RFC4 [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >PF06745 KaiC: KaiC; InterPro: IPR014774 This entry represents a domain within bacterial and archaeal proteins, most of which are hypothetical | Back alignment and domain information |
|---|
| >PRK14952 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK14949 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >KOG0330 consensus ATP-dependent RNA helicase [RNA processing and modification] | Back alignment and domain information |
|---|
| >PF01695 IstB_IS21: IstB-like ATP binding protein; InterPro: IPR002611 Proteins in this entry contain an ATP/GTP binding P-loop motif | Back alignment and domain information |
|---|
| >TIGR02774 rexB_recomb ATP-dependent nuclease subunit B | Back alignment and domain information |
|---|
| >KOG2028 consensus ATPase related to the helicase subunit of the Holliday junction resolvase [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >PRK12727 flagellar biosynthesis regulator FlhF; Provisional | Back alignment and domain information |
|---|
| >PRK14963 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >KOG0987 consensus DNA helicase PIF1/RRM3 [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >PRK12422 chromosomal replication initiation protein; Provisional | Back alignment and domain information |
|---|
| >PRK10416 signal recognition particle-docking protein FtsY; Provisional | Back alignment and domain information |
|---|
| >TIGR00708 cobA cob(I)alamin adenosyltransferase | Back alignment and domain information |
|---|
| >PRK14960 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >cd01129 PulE-GspE PulE/GspE The type II secretory pathway is the main terminal branch of the general secretory pathway (GSP) | Back alignment and domain information |
|---|
| >COG1197 Mfd Transcription-repair coupling factor (superfamily II helicase) [DNA replication, recombination, and repair / Transcription] | Back alignment and domain information |
|---|
| >KOG1924 consensus RhoA GTPase effector DIA/Diaphanous [Signal transduction mechanisms; Cytoskeleton] | Back alignment and domain information |
|---|
| >TIGR03877 thermo_KaiC_1 KaiC domain protein, Ph0284 family | Back alignment and domain information |
|---|
| >cd01131 PilT Pilus retraction ATPase PilT | Back alignment and domain information |
|---|
| >PRK08116 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >PLN03142 Probable chromatin-remodeling complex ATPase chain; Provisional | Back alignment and domain information |
|---|
| >PRK09200 preprotein translocase subunit SecA; Reviewed | Back alignment and domain information |
|---|
| >cd03115 SRP The signal recognition particle (SRP) mediates the transport to or across the plasma membrane in bacteria and the endoplasmic reticulum in eukaryotes | Back alignment and domain information |
|---|
| >PRK08691 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >PRK14948 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK05973 replicative DNA helicase; Provisional | Back alignment and domain information |
|---|
| >cd00561 CobA_CobO_BtuR ATP:corrinoid adenosyltransferase BtuR/CobO/CobP | Back alignment and domain information |
|---|
| >PRK05563 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >PRK14951 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK14969 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PF00004 AAA: ATPase family associated with various cellular activities (AAA); InterPro: IPR003959 AAA ATPases (ATPases Associated with diverse cellular Activities) form a large protein family and play a number of roles in the cell including cell-cycle regulation, protein proteolysis and disaggregation, organelle biogenesis and intracellular transport | Back alignment and domain information |
|---|
| >COG0552 FtsY Signal recognition particle GTPase [Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >cd01120 RecA-like_NTPases RecA-like NTPases | Back alignment and domain information |
|---|
| >PRK08533 flagellar accessory protein FlaH; Reviewed | Back alignment and domain information |
|---|
| >PRK09183 transposase/IS protein; Provisional | Back alignment and domain information |
|---|
| >TIGR03880 KaiC_arch_3 KaiC domain protein, AF_0351 family | Back alignment and domain information |
|---|
| >PF13191 AAA_16: AAA ATPase domain; PDB: 2V1U_A | Back alignment and domain information |
|---|
| >KOG0951 consensus RNA helicase BRR2, DEAD-box superfamily [RNA processing and modification] | Back alignment and domain information |
|---|
| >TIGR03878 thermo_KaiC_2 KaiC domain protein, AF_0795 family | Back alignment and domain information |
|---|
| >PRK10867 signal recognition particle protein; Provisional | Back alignment and domain information |
|---|
| >PRK13833 conjugal transfer protein TrbB; Provisional | Back alignment and domain information |
|---|
| >PRK13894 conjugal transfer ATPase TrbB; Provisional | Back alignment and domain information |
|---|
| >KOG0744 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK13104 secA preprotein translocase subunit SecA; Reviewed | Back alignment and domain information |
|---|
| >COG2805 PilT Tfp pilus assembly protein, pilus retraction ATPase PilT [Cell motility and secretion / Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >TIGR00963 secA preprotein translocase, SecA subunit | Back alignment and domain information |
|---|
| >PRK07764 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >PRK09694 helicase Cas3; Provisional | Back alignment and domain information |
|---|
| >PRK14964 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >smart00763 AAA_PrkA PrkA AAA domain | Back alignment and domain information |
|---|
| >COG1419 FlhF Flagellar GTP-binding protein [Cell motility and secretion] | Back alignment and domain information |
|---|
| >PRK06067 flagellar accessory protein FlaH; Validated | Back alignment and domain information |
|---|
| >KOG0333 consensus U5 snRNP-like RNA helicase subunit [RNA processing and modification] | Back alignment and domain information |
|---|
| >PRK06835 DNA replication protein DnaC; Validated | Back alignment and domain information |
|---|
| >PRK04328 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK06893 DNA replication initiation factor; Validated | Back alignment and domain information |
|---|
| >PF13481 AAA_25: AAA domain; PDB: 1G8Y_J 1OLO_A 1NLF_C | Back alignment and domain information |
|---|
| >TIGR02782 TrbB_P P-type conjugative transfer ATPase TrbB | Back alignment and domain information |
|---|
| >KOG0780 consensus Signal recognition particle, subunit Srp54 [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >PF02689 Herpes_Helicase: Helicase; InterPro: IPR003840 This entry consists of DNA helicases from a number of different organisms | Back alignment and domain information |
|---|
| >PRK09112 DNA polymerase III subunit delta'; Validated | Back alignment and domain information |
|---|
| >COG0556 UvrB Helicase subunit of the DNA excision repair complex [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PRK14086 dnaA chromosomal replication initiation protein; Provisional | Back alignment and domain information |
|---|
| >KOG0335 consensus ATP-dependent RNA helicase [RNA processing and modification] | Back alignment and domain information |
|---|
| >PRK10436 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >cd01122 GP4d_helicase GP4d_helicase is a homohexameric 5'-3' helicases | Back alignment and domain information |
|---|
| >PRK08903 DnaA regulatory inactivator Hda; Validated | Back alignment and domain information |
|---|
| >COG0541 Ffh Signal recognition particle GTPase [Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >TIGR03420 DnaA_homol_Hda DnaA regulatory inactivator Hda | Back alignment and domain information |
|---|
| >TIGR02533 type_II_gspE general secretory pathway protein E | Back alignment and domain information |
|---|
| >TIGR00959 ffh signal recognition particle protein | Back alignment and domain information |
|---|
| >TIGR02928 orc1/cdc6 family replication initiation protein | Back alignment and domain information |
|---|
| >PRK06851 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PF05729 NACHT: NACHT domain | Back alignment and domain information |
|---|
| >PHA03368 DNA packaging terminase subunit 1; Provisional | Back alignment and domain information |
|---|
| >KOG0922 consensus DEAH-box RNA helicase [RNA processing and modification] | Back alignment and domain information |
|---|
| >PRK08727 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >PRK13341 recombination factor protein RarA/unknown domain fusion protein; Reviewed | Back alignment and domain information |
|---|
| >COG2804 PulE Type II secretory pathway, ATPase PulE/Tfp pilus assembly pathway, ATPase PilB [Cell motility and secretion / Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >KOG0991 consensus Replication factor C, subunit RFC2 [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >TIGR02655 circ_KaiC circadian clock protein KaiC | Back alignment and domain information |
|---|
| >PRK07133 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >TIGR02655 circ_KaiC circadian clock protein KaiC | Back alignment and domain information |
|---|
| >PRK06921 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK09751 putative ATP-dependent helicase Lhr; Provisional | Back alignment and domain information |
|---|
| >PF13207 AAA_17: AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6_G 2QT1_A 2QSZ_A 2QSY_A 2QT0_A 2QG6_A 2P0E_A | Back alignment and domain information |
|---|
| >PRK14873 primosome assembly protein PriA; Provisional | Back alignment and domain information |
|---|
| >COG0467 RAD55 RecA-superfamily ATPases implicated in signal transduction [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PRK07940 DNA polymerase III subunit delta'; Validated | Back alignment and domain information |
|---|
| >TIGR02237 recomb_radB DNA repair and recombination protein RadB | Back alignment and domain information |
|---|
| >PRK05986 cob(I)alamin adenolsyltransferase/cobinamide ATP-dependent adenolsyltransferase; Validated | Back alignment and domain information |
|---|
| >TIGR02525 plasmid_TraJ plasmid transfer ATPase TraJ | Back alignment and domain information |
|---|
| >TIGR03881 KaiC_arch_4 KaiC domain protein, PAE1156 family | Back alignment and domain information |
|---|
| >PRK12726 flagellar biosynthesis regulator FlhF; Provisional | Back alignment and domain information |
|---|
| >PRK12326 preprotein translocase subunit SecA; Reviewed | Back alignment and domain information |
|---|
| >PRK14965 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >cd00984 DnaB_C DnaB helicase C terminal domain | Back alignment and domain information |
|---|
| >TIGR02538 type_IV_pilB type IV-A pilus assembly ATPase PilB | Back alignment and domain information |
|---|
| >PLN03025 replication factor C subunit; Provisional | Back alignment and domain information |
|---|
| >PF07728 AAA_5: AAA domain (dynein-related subfamily); InterPro: IPR011704 The ATPases Associated to a variety of cellular Activities (AAA) are a family distinguished by a highly conserved module of 230 amino acids [] | Back alignment and domain information |
|---|
| >PRK00411 cdc6 cell division control protein 6; Reviewed | Back alignment and domain information |
|---|
| >cd01394 radB RadB | Back alignment and domain information |
|---|
| >PRK08451 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >PRK12724 flagellar biosynthesis regulator FlhF; Provisional | Back alignment and domain information |
|---|
| >TIGR02881 spore_V_K stage V sporulation protein K | Back alignment and domain information |
|---|
| >KOG4284 consensus DEAD box protein [Transcription] | Back alignment and domain information |
|---|
| >COG1444 Predicted P-loop ATPase fused to an acetyltransferase [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR02640 gas_vesic_GvpN gas vesicle protein GvpN | Back alignment and domain information |
|---|
| >TIGR01650 PD_CobS cobaltochelatase, CobS subunit | Back alignment and domain information |
|---|
| >PRK05642 DNA replication initiation factor; Validated | Back alignment and domain information |
|---|
| >PF13671 AAA_33: AAA domain; PDB: 1LTQ_A 2IA5_K 1RC8_A 1LY1_A 1RRC_A 1RPZ_A 3ZVM_A 1YJ5_A 3ZVL_A 3U7E_B | Back alignment and domain information |
|---|
| >KOG1924 consensus RhoA GTPase effector DIA/Diaphanous [Signal transduction mechanisms; Cytoskeleton] | Back alignment and domain information |
|---|
| >TIGR01420 pilT_fam pilus retraction protein PilT | Back alignment and domain information |
|---|
| >cd01130 VirB11-like_ATPase Type IV secretory pathway component VirB11, and related ATPases | Back alignment and domain information |
|---|
| >cd01983 Fer4_NifH The Fer4_NifH superfamily contains a variety of proteins which share a common ATP-binding domain | Back alignment and domain information |
|---|
| >TIGR02688 conserved hypothetical protein TIGR02688 | Back alignment and domain information |
|---|
| >PRK09361 radB DNA repair and recombination protein RadB; Provisional | Back alignment and domain information |
|---|
| >KOG0781 consensus Signal recognition particle receptor, alpha subunit [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >PRK05707 DNA polymerase III subunit delta'; Validated | Back alignment and domain information |
|---|
| >PF05496 RuvB_N: Holliday junction DNA helicase ruvB N-terminus; InterPro: IPR008824 The RuvB protein makes up part of the RuvABC revolvasome which catalyses the resolution of Holliday junctions that arise during genetic recombination and DNA repair | Back alignment and domain information |
|---|
| >PRK07471 DNA polymerase III subunit delta'; Validated | Back alignment and domain information |
|---|
| >PF02492 cobW: CobW/HypB/UreG, nucleotide-binding domain; InterPro: IPR003495 Cobalamin (vitamin B12) is a structurally complex cofactor, consisting of a modified tetrapyrrole with a centrally chelated cobalt | Back alignment and domain information |
|---|
| >PRK06731 flhF flagellar biosynthesis regulator FlhF; Validated | Back alignment and domain information |
|---|
| >PRK08769 DNA polymerase III subunit delta'; Validated | Back alignment and domain information |
|---|
| >PF06309 Torsin: Torsin; InterPro: IPR010448 This family consists of several eukaryotic torsin proteins | Back alignment and domain information |
|---|
| >PRK12402 replication factor C small subunit 2; Reviewed | Back alignment and domain information |
|---|
| >PHA00350 putative assembly protein | Back alignment and domain information |
|---|
| >PRK11823 DNA repair protein RadA; Provisional | Back alignment and domain information |
|---|
| >COG0507 RecD ATP-dependent exoDNAse (exonuclease V), alpha subunit - helicase superfamily I member [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >KOG0743 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >cd00544 CobU Adenosylcobinamide kinase / adenosylcobinamide phosphate guanyltransferase (CobU) | Back alignment and domain information |
|---|
| >PF00308 Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013317 This entry represents the central domain of bacterial DnaA proteins [, , ] that play an important role in initiating and regulating chromosomal replication | Back alignment and domain information |
|---|
| >PF00437 T2SE: Type II/IV secretion system protein; InterPro: IPR001482 A number of bacterial proteins, some of which are involved in a general secretion pathway (GSP) for the export of proteins (also called the type II pathway) belong to this group [, ] | Back alignment and domain information |
|---|
| >PRK08058 DNA polymerase III subunit delta'; Validated | Back alignment and domain information |
|---|
| >cd01121 Sms Sms (bacterial radA) DNA repair protein | Back alignment and domain information |
|---|
| >PF13238 AAA_18: AAA domain; PDB: 3IIK_A 3IIJ_A 3IIL_A 1RKB_A 3IIM_A 2AXP_A 3KB2_A 1KHT_A 1NKS_A 3H86_C | Back alignment and domain information |
|---|
| >PRK09302 circadian clock protein KaiC; Reviewed | Back alignment and domain information |
|---|
| >PRK14959 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >TIGR02880 cbbX_cfxQ probable Rubsico expression protein CbbX | Back alignment and domain information |
|---|
| >TIGR00635 ruvB Holliday junction DNA helicase, RuvB subunit | Back alignment and domain information |
|---|
| >KOG0923 consensus mRNA splicing factor ATP-dependent RNA helicase [RNA processing and modification] | Back alignment and domain information |
|---|
| >PRK08939 primosomal protein DnaI; Reviewed | Back alignment and domain information |
|---|
| >TIGR02012 tigrfam_recA protein RecA | Back alignment and domain information |
|---|
| >PRK00149 dnaA chromosomal replication initiation protein; Reviewed | Back alignment and domain information |
|---|
| >COG1201 Lhr Lhr-like helicases [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR02524 dot_icm_DotB Dot/Icm secretion system ATPase DotB | Back alignment and domain information |
|---|
| >PRK09302 circadian clock protein KaiC; Reviewed | Back alignment and domain information |
|---|
| >cd00983 recA RecA is a bacterial enzyme which has roles in homologous recombination, DNA repair, and the induction of the SOS response | Back alignment and domain information |
|---|
| >PRK11331 5-methylcytosine-specific restriction enzyme subunit McrB; Provisional | Back alignment and domain information |
|---|
| >KOG0921 consensus Dosage compensation complex, subunit MLE [Transcription] | Back alignment and domain information |
|---|
| >cd02019 NK Nucleoside/nucleotide kinase (NK) is a protein superfamily consisting of multiple families of enzymes that share structural similarity and are functionally related to the catalysis of the reversible phosphate group transfer from nucleoside triphosphates to nucleosides/nucleotides, nucleoside monophosphates, or sugars | Back alignment and domain information |
|---|
| >KOG0345 consensus ATP-dependent RNA helicase [RNA processing and modification] | Back alignment and domain information |
|---|
| >PRK04195 replication factor C large subunit; Provisional | Back alignment and domain information |
|---|
| >PRK07399 DNA polymerase III subunit delta'; Validated | Back alignment and domain information |
|---|
| >PRK06851 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >COG1474 CDC6 Cdc6-related protein, AAA superfamily ATPase [DNA replication, recombination, and repair / Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK13768 GTPase; Provisional | Back alignment and domain information |
|---|
| >PRK14723 flhF flagellar biosynthesis regulator FlhF; Provisional | Back alignment and domain information |
|---|
| >PTZ00112 origin recognition complex 1 protein; Provisional | Back alignment and domain information |
|---|
| >KOG0331 consensus ATP-dependent RNA helicase [RNA processing and modification] | Back alignment and domain information |
|---|
| >PF12846 AAA_10: AAA-like domain | Back alignment and domain information |
|---|
| >TIGR00416 sms DNA repair protein RadA | Back alignment and domain information |
|---|
| >COG2019 AdkA Archaeal adenylate kinase [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >PF03266 NTPase_1: NTPase; InterPro: IPR004948 This entry represents a family of nucleoside-triphosphatases which have activity towards ATP, GTP, CTP, TTP and UTP and may hydrolyse nucleoside diphosphates with lower efficiency [] | Back alignment and domain information |
|---|
| >PHA02544 44 clamp loader, small subunit; Provisional | Back alignment and domain information |
|---|
| >PHA00729 NTP-binding motif containing protein | Back alignment and domain information |
|---|
| >CHL00181 cbbX CbbX; Provisional | Back alignment and domain information |
|---|
| >KOG0342 consensus ATP-dependent RNA helicase pitchoune [RNA processing and modification] | Back alignment and domain information |
|---|
| >PRK06995 flhF flagellar biosynthesis regulator FlhF; Validated | Back alignment and domain information |
|---|
| >PF03205 MobB: Molybdopterin guanine dinucleotide synthesis protein B; PDB: 2F1R_B 1P9N_A 1NP6_B 2NPI_A 1XJC_A | Back alignment and domain information |
|---|
| >TIGR01359 UMP_CMP_kin_fam UMP-CMP kinase family | Back alignment and domain information |
|---|
| >KOG0339 consensus ATP-dependent RNA helicase [RNA processing and modification] | Back alignment and domain information |
|---|
| >PRK13531 regulatory ATPase RavA; Provisional | Back alignment and domain information |
|---|
| >PRK00080 ruvB Holliday junction DNA helicase RuvB; Reviewed | Back alignment and domain information |
|---|
| >PF05673 DUF815: Protein of unknown function (DUF815); InterPro: IPR008533 This domain consists of several bacterial proteins of unknown function | Back alignment and domain information |
|---|
| >TIGR01360 aden_kin_iso1 adenylate kinase, isozyme 1 subfamily | Back alignment and domain information |
|---|
| >PF00910 RNA_helicase: RNA helicase; InterPro: IPR000605 Helicases have been classified in 5 superfamilies (SF1-SF5) | Back alignment and domain information |
|---|
| >TIGR00362 DnaA chromosomal replication initiator protein DnaA | Back alignment and domain information |
|---|
| >TIGR00750 lao LAO/AO transport system ATPase | Back alignment and domain information |
|---|
| >PF03308 ArgK: ArgK protein; InterPro: IPR005129 Bacterial periplasmic transport systems require the function of a specific substrate-binding protein, located in the periplasm, and several cytoplasmic membrane transport components | Back alignment and domain information |
|---|
| >cd03114 ArgK-like The function of this protein family is unkown | Back alignment and domain information |
|---|
| >TIGR00176 mobB molybdopterin-guanine dinucleotide biosynthesis protein MobB | Back alignment and domain information |
|---|
| >PF01078 Mg_chelatase: Magnesium chelatase, subunit ChlI; InterPro: IPR000523 Magnesium-chelatase is a three-component enzyme that catalyses the insertion of Mg2+ into protoporphyrin IX | Back alignment and domain information |
|---|
| >cd01125 repA Hexameric Replicative Helicase RepA | Back alignment and domain information |
|---|
| >PF13555 AAA_29: P-loop containing region of AAA domain | Back alignment and domain information |
|---|
| >PF03215 Rad17: Rad17 cell cycle checkpoint protein | Back alignment and domain information |
|---|
| >cd01393 recA_like RecA is a bacterial enzyme which has roles in homologous recombination, DNA repair, and the induction of the SOS response | Back alignment and domain information |
|---|
| >TIGR01242 26Sp45 26S proteasome subunit P45 family | Back alignment and domain information |
|---|
| >COG1102 Cmk Cytidylate kinase [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >KOG1131 consensus RNA polymerase II transcription initiation/nucleotide excision repair factor TFIIH, 5'-3' helicase subunit RAD3 [Transcription; Replication, recombination and repair] | Back alignment and domain information |
|---|
| >KOG0389 consensus SNF2 family DNA-dependent ATPase [Chromatin structure and dynamics] | Back alignment and domain information |
|---|
| >PRK06871 DNA polymerase III subunit delta'; Validated | Back alignment and domain information |
|---|
| >COG4581 Superfamily II RNA helicase [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PRK09354 recA recombinase A; Provisional | Back alignment and domain information |
|---|
| >PRK03992 proteasome-activating nucleotidase; Provisional | Back alignment and domain information |
|---|
| >PRK13342 recombination factor protein RarA; Reviewed | Back alignment and domain information |
|---|
| >PRK08233 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK05800 cobU adenosylcobinamide kinase/adenosylcobinamide-phosphate guanylyltransferase; Validated | Back alignment and domain information |
|---|
| >PF04665 Pox_A32: Poxvirus A32 protein; InterPro: IPR006758 This entry contains uncharacterised proteins belonging to the B354L family which include the pox virus A32 protein | Back alignment and domain information |
|---|
| >PRK09435 membrane ATPase/protein kinase; Provisional | Back alignment and domain information |
|---|
| >PRK00440 rfc replication factor C small subunit; Reviewed | Back alignment and domain information |
|---|
| >KOG0385 consensus Chromatin remodeling complex WSTF-ISWI, small subunit [Transcription] | Back alignment and domain information |
|---|
| >TIGR03689 pup_AAA proteasome ATPase | Back alignment and domain information |
|---|
| >PRK12904 preprotein translocase subunit SecA; Reviewed | Back alignment and domain information |
|---|
| >COG3854 SpoIIIAA ncharacterized protein conserved in bacteria [Function unknown] | Back alignment and domain information |
|---|
| >PRK12608 transcription termination factor Rho; Provisional | Back alignment and domain information |
|---|
| >PRK05541 adenylylsulfate kinase; Provisional | Back alignment and domain information |
|---|
| >PRK13103 secA preprotein translocase subunit SecA; Reviewed | Back alignment and domain information |
|---|
| >PRK13900 type IV secretion system ATPase VirB11; Provisional | Back alignment and domain information |
|---|
| >TIGR00767 rho transcription termination factor Rho | Back alignment and domain information |
|---|
| >cd02021 GntK Gluconate kinase (GntK) catalyzes the phosphoryl transfer from ATP to gluconate | Back alignment and domain information |
|---|
| >PTZ00361 26 proteosome regulatory subunit 4-like protein; Provisional | Back alignment and domain information |
|---|
| >PRK14962 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >KOG0348 consensus ATP-dependent RNA helicase [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG0328 consensus Predicted ATP-dependent RNA helicase FAL1, involved in rRNA maturation, DEAD-box superfamily [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >PRK08118 topology modulation protein; Reviewed | Back alignment and domain information |
|---|
| >PRK13764 ATPase; Provisional | Back alignment and domain information |
|---|
| >PHA02244 ATPase-like protein | Back alignment and domain information |
|---|
| >COG1222 RPT1 ATP-dependent 26S proteasome regulatory subunit [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK14961 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >cd02034 CooC The accessory protein CooC, which contains a nucleotide-binding domain (P-loop) near the N-terminus, participates in the maturation of the nickel center of carbon monoxide dehydrogenase (CODH) | Back alignment and domain information |
|---|
| >PRK13107 preprotein translocase subunit SecA; Reviewed | Back alignment and domain information |
|---|
| >PF13521 AAA_28: AAA domain; PDB: 1LW7_A | Back alignment and domain information |
|---|
| >cd02117 NifH_like This family contains the NifH (iron protein) of nitrogenase, L subunit (BchL/ChlL) of the protochlorophyllide reductase and the BchX subunit of the Chlorophyllide reductase | Back alignment and domain information |
|---|
| >PF03029 ATP_bind_1: Conserved hypothetical ATP binding protein; InterPro: IPR004130 Members of this family are found in a range of archaea and eukaryotes and have hypothesised ATP binding activity | Back alignment and domain information |
|---|
| >cd01123 Rad51_DMC1_radA Rad51_DMC1_radA,B | Back alignment and domain information |
|---|
| >PRK14530 adenylate kinase; Provisional | Back alignment and domain information |
|---|
| >PF07726 AAA_3: ATPase family associated with various cellular activities (AAA); InterPro: IPR011703 This entry includes some of the AAA proteins not detected by the IPR003959 from INTERPRO model | Back alignment and domain information |
|---|
| >PTZ00301 uridine kinase; Provisional | Back alignment and domain information |
|---|
| >COG1618 Predicted nucleotide kinase [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >PRK12906 secA preprotein translocase subunit SecA; Reviewed | Back alignment and domain information |
|---|
| >KOG1970 consensus Checkpoint RAD17-RFC complex, RAD17/RAD24 component [Cell cycle control, cell division, chromosome partitioning; Replication, recombination and repair] | Back alignment and domain information |
|---|
| >COG3857 AddB ATP-dependent nuclease, subunit B [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PRK03839 putative kinase; Provisional | Back alignment and domain information |
|---|
| >PRK10463 hydrogenase nickel incorporation protein HypB; Provisional | Back alignment and domain information |
|---|
| >cd02023 UMPK Uridine monophosphate kinase (UMPK, EC 2 | Back alignment and domain information |
|---|
| >PRK00889 adenylylsulfate kinase; Provisional | Back alignment and domain information |
|---|
| >COG0714 MoxR-like ATPases [General function prediction only] | Back alignment and domain information |
|---|
| >COG4088 Predicted nucleotide kinase [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >PRK06762 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK05298 excinuclease ABC subunit B; Provisional | Back alignment and domain information |
|---|
| >TIGR00631 uvrb excinuclease ABC, B subunit | Back alignment and domain information |
|---|
| >TIGR03574 selen_PSTK L-seryl-tRNA(Sec) kinase, archaeal | Back alignment and domain information |
|---|
| >PRK00131 aroK shikimate kinase; Reviewed | Back alignment and domain information |
|---|
| >TIGR00665 DnaB replicative DNA helicase | Back alignment and domain information |
|---|
| >KOG0390 consensus DNA repair protein, SNF2 family [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >cd02028 UMPK_like Uridine monophosphate kinase_like (UMPK_like) is a family of proteins highly similar to the uridine monophosphate kinase (UMPK, EC 2 | Back alignment and domain information |
|---|
| >PRK14531 adenylate kinase; Provisional | Back alignment and domain information |
|---|
| >PRK06620 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >COG5192 BMS1 GTP-binding protein required for 40S ribosome biogenesis [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >KOG1533 consensus Predicted GTPase [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR02322 phosphon_PhnN phosphonate metabolism protein/1,5-bisphosphokinase (PRPP-forming) PhnN | Back alignment and domain information |
|---|
| >cd01428 ADK Adenylate kinase (ADK) catalyzes the reversible phosphoryl transfer from adenosine triphosphates (ATP) to adenosine monophosphates (AMP) and to yield adenosine diphosphates (ADP) | Back alignment and domain information |
|---|
| >TIGR00150 HI0065_YjeE ATPase, YjeE family | Back alignment and domain information |
|---|
| >KOG0951 consensus RNA helicase BRR2, DEAD-box superfamily [RNA processing and modification] | Back alignment and domain information |
|---|
| >COG1703 ArgK Putative periplasmic protein kinase ArgK and related GTPases of G3E family [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >COG0378 HypB Ni2+-binding GTPase involved in regulation of expression and maturation of urease and hydrogenase [Posttranslational modification, protein turnover, chaperones / Transcription] | Back alignment and domain information |
|---|
| >PRK04040 adenylate kinase; Provisional | Back alignment and domain information |
|---|
| >PRK14532 adenylate kinase; Provisional | Back alignment and domain information |
|---|
| >PRK06964 DNA polymerase III subunit delta'; Validated | Back alignment and domain information |
|---|
| >TIGR01313 therm_gnt_kin carbohydrate kinase, thermoresistant glucokinase family | Back alignment and domain information |
|---|
| >PRK13851 type IV secretion system protein VirB11; Provisional | Back alignment and domain information |
|---|
| >PRK08154 anaerobic benzoate catabolism transcriptional regulator; Reviewed | Back alignment and domain information |
|---|
| >COG4178 ABC-type uncharacterized transport system, permease and ATPase components [General function prediction only] | Back alignment and domain information |
|---|
| >cd02027 APSK Adenosine 5'-phosphosulfate kinase (APSK) catalyzes the phosphorylation of adenosine 5'-phosphosulfate to form 3'-phosphoadenosine 5'-phosphosulfate (PAPS) | Back alignment and domain information |
|---|
| >cd02025 PanK Pantothenate kinase (PanK) catalyzes the phosphorylation of pantothenic acid to form 4'-phosphopantothenic, which is the first of five steps in coenzyme A (CoA) biosynthetic pathway | Back alignment and domain information |
|---|
| >COG1202 Superfamily II helicase, archaea-specific [General function prediction only] | Back alignment and domain information |
|---|
| >cd00227 CPT Chloramphenicol (Cm) phosphotransferase (CPT) | Back alignment and domain information |
|---|
| >PRK06645 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >PRK04301 radA DNA repair and recombination protein RadA; Validated | Back alignment and domain information |
|---|
| >PRK06696 uridine kinase; Validated | Back alignment and domain information |
|---|
| >TIGR00041 DTMP_kinase thymidylate kinase | Back alignment and domain information |
|---|
| >TIGR03600 phage_DnaB phage replicative helicase, DnaB family, HK022 subfamily | Back alignment and domain information |
|---|
| >PLN02200 adenylate kinase family protein | Back alignment and domain information |
|---|
| >PRK02496 adk adenylate kinase; Provisional | Back alignment and domain information |
|---|
| >cd02020 CMPK Cytidine monophosphate kinase (CMPK) catalyzes the reversible phosphorylation of cytidine monophosphate (CMP) to produce cytidine diphosphate (CDP), using ATP as the preferred phosphoryl donor | Back alignment and domain information |
|---|
| >PRK14494 putative molybdopterin-guanine dinucleotide biosynthesis protein MobB/FeS domain-containing protein protein; Provisional | Back alignment and domain information |
|---|
| >cd03116 MobB Molybdenum is an essential trace element in the form of molybdenum cofactor (Moco) which is associated with the metabolism of nitrogen, carbon and sulfur by redox active enzymes | Back alignment and domain information |
|---|
| >PRK07667 uridine kinase; Provisional | Back alignment and domain information |
|---|
| >PRK10751 molybdopterin-guanine dinucleotide biosynthesis protein B; Provisional | Back alignment and domain information |
|---|
| >PRK14493 putative bifunctional molybdopterin-guanine dinucleotide biosynthesis protein MobB/MoaE; Provisional | Back alignment and domain information |
|---|
| >PRK14527 adenylate kinase; Provisional | Back alignment and domain information |
|---|
| >TIGR02858 spore_III_AA stage III sporulation protein AA | Back alignment and domain information |
|---|
| >PRK05480 uridine/cytidine kinase; Provisional | Back alignment and domain information |
|---|
| >PTZ00454 26S protease regulatory subunit 6B-like protein; Provisional | Back alignment and domain information |
|---|
| >PF00406 ADK: Adenylate kinase; InterPro: IPR000850 Adenylate kinases (ADK) are phosphotransferases that catalyse the reversible reaction |
Back alignment and domain information |
|---|
| >cd00550 ArsA_ATPase Oxyanion-translocating ATPase (ArsA) | Back alignment and domain information |
|---|
| >PRK14489 putative bifunctional molybdopterin-guanine dinucleotide biosynthesis protein MobA/MobB; Provisional | Back alignment and domain information |
|---|
| >PRK14528 adenylate kinase; Provisional | Back alignment and domain information |
|---|
| >COG3911 Predicted ATPase [General function prediction only] | Back alignment and domain information |
|---|
| >PRK07261 topology modulation protein; Provisional | Back alignment and domain information |
|---|
| >PF00485 PRK: Phosphoribulokinase / Uridine kinase family; InterPro: IPR006083 Phosphoribulokinase (PRK) 2 | Back alignment and domain information |
|---|
| >cd02037 MRP-like MRP (Multiple Resistance and pH adaptation) is a homologue of the Fer4_NifH superfamily | Back alignment and domain information |
|---|
| >cd02040 NifH NifH gene encodes component II (iron protein) of nitrogenase | Back alignment and domain information |
|---|
| >COG1936 Predicted nucleotide kinase (related to CMP and AMP kinases) [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR02236 recomb_radA DNA repair and recombination protein RadA | Back alignment and domain information |
|---|
| >PLN00020 ribulose bisphosphate carboxylase/oxygenase activase -RuBisCO activase (RCA); Provisional | Back alignment and domain information |
|---|
| >PF02374 ArsA_ATPase: Anion-transporting ATPase; PDB: 2WOO_A 3IBG_B 3SJA_A 3H84_B 3SJD_A 3ZS9_A 3A37_A 2WOJ_A 3SJC_B 3A36_B | Back alignment and domain information |
|---|
| >PRK00279 adk adenylate kinase; Reviewed | Back alignment and domain information |
|---|
| >KOG0926 consensus DEAH-box RNA helicase [RNA processing and modification; Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >PF01656 CbiA: CobQ/CobB/MinD/ParA nucleotide binding domain; InterPro: IPR002586 This entry consists of various cobyrinic acid a,c-diamide synthases | Back alignment and domain information |
|---|
| >KOG0733 consensus Nuclear AAA ATPase (VCP subfamily) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK06547 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >KOG0953 consensus Mitochondrial RNA helicase SUV3, DEAD-box superfamily [RNA processing and modification] | Back alignment and domain information |
|---|
| >TIGR02397 dnaX_nterm DNA polymerase III, subunit gamma and tau | Back alignment and domain information |
|---|
| >PRK14957 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >TIGR00764 lon_rel lon-related putative ATP-dependent protease | Back alignment and domain information |
|---|
| >PF06068 TIP49: TIP49 C-terminus; InterPro: IPR010339 This family consists of the C-terminal region of several eukaryotic and archaeal RuvB-like 1 (Pontin or TIP49a) and RuvB-like 2 (Reptin or TIP49b) proteins | Back alignment and domain information |
|---|
| >TIGR01241 FtsH_fam ATP-dependent metalloprotease FtsH | Back alignment and domain information |
|---|
| >PF03796 DnaB_C: DnaB-like helicase C terminal domain; InterPro: IPR007694 The hexameric helicase DnaB unwinds the DNA duplex at the Escherichia coli chromosome replication fork | Back alignment and domain information |
|---|
| >PRK05748 replicative DNA helicase; Provisional | Back alignment and domain information |
|---|
| >TIGR01351 adk adenylate kinases | Back alignment and domain information |
|---|
| >PF08433 KTI12: Chromatin associated protein KTI12 ; InterPro: IPR013641 This is a family of chromatin associated proteins which interact with the Elongator complex, a component of the elongating form of RNA polymerase II [] | Back alignment and domain information |
|---|
| >COG4962 CpaF Flp pilus assembly protein, ATPase CpaF [Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >PHA02624 large T antigen; Provisional | Back alignment and domain information |
|---|
| >COG0610 Type I site-specific restriction-modification system, R (restriction) subunit and related helicases [Defense mechanisms] | Back alignment and domain information |
|---|
| >cd01672 TMPK Thymidine monophosphate kinase (TMPK), also known as thymidylate kinase, catalyzes the phosphorylation of thymidine monophosphate (TMP) to thymidine diphosphate (TDP) utilizing ATP as its preferred phophoryl donor | Back alignment and domain information |
|---|
| >COG2255 RuvB Holliday junction resolvasome, helicase subunit [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PF00931 NB-ARC: NB-ARC domain; InterPro: IPR002182 This is the NB-ARC domain, a novel signalling motif found in bacteria and eukaryotes, shared by plant resistance gene products and regulators of cell death in animals [] | Back alignment and domain information |
|---|
| >PF13476 AAA_23: AAA domain; PDB: 3AV0_B 3AUY_B 3AUX_A 2O5V_A 3QG5_B 3QF7_A 3THO_A | Back alignment and domain information |
|---|
| >COG0470 HolB ATPase involved in DNA replication [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >KOG0731 consensus AAA+-type ATPase containing the peptidase M41 domain [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0338 consensus ATP-dependent RNA helicase [RNA processing and modification] | Back alignment and domain information |
|---|
| >TIGR02016 BchX chlorophyllide reductase iron protein subunit X | Back alignment and domain information |
|---|
| >PF01580 FtsK_SpoIIIE: FtsK/SpoIIIE family; InterPro: IPR002543 The FtsK/SpoIIIE domain is found extensively in a wide variety of proteins from prokaryotes and plasmids [] some of which contain up to three copies | Back alignment and domain information |
|---|
| >PRK05439 pantothenate kinase; Provisional | Back alignment and domain information |
|---|
| >PRK13765 ATP-dependent protease Lon; Provisional | Back alignment and domain information |
|---|
| >CHL00195 ycf46 Ycf46; Provisional | Back alignment and domain information |
|---|
| >PRK13407 bchI magnesium chelatase subunit I; Provisional | Back alignment and domain information |
|---|
| >PRK13947 shikimate kinase; Provisional | Back alignment and domain information |
|---|
| >KOG0651 consensus 26S proteasome regulatory complex, ATPase RPT4 [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK13235 nifH nitrogenase reductase; Reviewed | Back alignment and domain information |
|---|
| >PHA00547 hypothetical protein | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST
Original result of BLAST against Protein Data Bank
| ID | Alignment Graph | Length |
Definition |
E-value | |
| Query | 1066 | ||||
| 2gjk_A | 624 | Structural And Functional Insights Into The Human U | 0.0 | ||
| 2xzo_A | 623 | Upf1 Helicase - Rna Complex Length = 623 | 0.0 | ||
| 2wjv_A | 800 | Crystal Structure Of The Complex Between Human Nons | 0.0 | ||
| 2xzl_A | 802 | Upf1-Rna Complex Length = 802 | 0.0 | ||
| 4b3g_A | 646 | Crystal Structure Of Ighmbp2 Helicase In Complex Wi | 9e-48 | ||
| 4b3f_X | 646 | Crystal Structure Of 1ghmbp2 Helicase Length = 646 | 9e-48 | ||
| 2iyk_A | 162 | Crystal Structure Of The Upf2-Interacting Domain Of | 1e-42 |
| >pdb|2GJK|A Chain A, Structural And Functional Insights Into The Human Upf1 Helicase Core Length = 624 | Back alignment and structure |
|
| >pdb|2XZO|A Chain A, Upf1 Helicase - Rna Complex Length = 623 | Back alignment and structure |
| >pdb|2WJV|A Chain A, Crystal Structure Of The Complex Between Human Nonsense Mediated Decay Factors Upf1 And Upf2 Length = 800 | Back alignment and structure |
| >pdb|2XZL|A Chain A, Upf1-Rna Complex Length = 802 | Back alignment and structure |
| >pdb|4B3G|A Chain A, Crystal Structure Of Ighmbp2 Helicase In Complex With Rna Length = 646 | Back alignment and structure |
| >pdb|4B3F|X Chain X, Crystal Structure Of 1ghmbp2 Helicase Length = 646 | Back alignment and structure |
| >pdb|2IYK|A Chain A, Crystal Structure Of The Upf2-Interacting Domain Of Nonsense Mediated Mrna Decay Factor Upf1 Length = 162 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST
Original result of RPS-BLAST against PDB70 database
| >2gk6_A Regulator of nonsense transcripts 1; UPF1, helicase, NMD, hydrolase; HET: ADP; 2.40A {Homo sapiens} PDB: 2gjk_A* 2gk7_A 2xzo_A* 2xzp_A Length = 624 | Back alignment and structure |
|---|
Score = 839 bits (2168), Expect = 0.0
Identities = 428/597 (71%), Positives = 512/597 (85%), Gaps = 5/597 (0%)
Query: 241 MKESQSKDNVTIRWDIGLNKKRVAYFVFPKEDNELRLVPGDELRLRYSGDAAHPAWQSVG 300
+KESQ++DN+T+RWD+GLNKKR+AYF PK D+++RL+ GDE+ LRY GD P W+ +G
Sbjct: 30 LKESQTQDNITVRWDLGLNKKRIAYFTLPKTDSDMRLMQGDEICLRYKGDL-APLWKGIG 88
Query: 301 HVIKL--TAQEEVALELRASQGVPVDINHGFSVDFVWKSTSFDRMQGAMKTFAVDETSVS 358
HVIK+ +E+A+ELR+S G PV++ H F VDFVWKSTSFDRMQ A+KTFAVDETSVS
Sbjct: 89 HVIKVPDNYGDEIAIELRSSVGAPVEVTHNFQVDFVWKSTSFDRMQSALKTFAVDETSVS 148
Query: 359 GYIYHHLLGHEVEVQMVRNTLPRRFGAPGLPELNASQVFAVKSVLQRPISLIQGPPGTGK 418
GYIYH LLGHEVE +++ LP+RF A GLP+LN SQV+AVK+VLQRP+SLIQGPPGTGK
Sbjct: 149 GYIYHKLLGHEVEDVIIKCQLPKRFTAQGLPDLNHSQVYAVKTVLQRPLSLIQGPPGTGK 208
Query: 419 TVTSAAIVYHMAKQGQGQVLVCAPSNVAVDQLAEKISATGLKVVRLCAKSREAVSSPVEH 478
TVTSA IVYH+A+QG G VLVCAPSN+AVDQL EKI TGLKVVRLCAKSREA+ SPV
Sbjct: 209 TVTSATIVYHLARQGNGPVLVCAPSNIAVDQLTEKIHQTGLKVVRLCAKSREAIDSPVSF 268
Query: 479 LTLHYQVRHLDTSEKSELHKLQQLKDEQGELSSSDEKKYKALKRATEREISQSADVICCT 538
L LH Q+R + EL KLQQLKDE GELSS+DEK+Y+ALKR ERE+ +ADVICCT
Sbjct: 269 LALHNQIR--NMDSMPELQKLQQLKDETGELSSADEKRYRALKRTAERELLMNADVICCT 326
Query: 539 CVGAGDPRLANFRFRQVLIDESTQATEPECLIPLVLGAKQVVLVGDHCQLGPVIMCKKAA 598
CVGAGDPRLA +FR +LIDESTQATEPEC++P+VLGAKQ++LVGDHCQLGPV+MCKKAA
Sbjct: 327 CVGAGDPRLAKMQFRSILIDESTQATEPECMVPVVLGAKQLILVGDHCQLGPVVMCKKAA 386
Query: 599 RAGLAQSLFERLVLLGLKPIRLQVQYRMHPSLSEFPSNSFYEGTLQNGVTINERQSSGID 658
+AGL+QSLFERLV+LG++PIRLQVQYRMHP+LS FPSN FYEG+LQNGVT +R G D
Sbjct: 387 KAGLSQSLFERLVVLGIRPIRLQVQYRMHPALSAFPSNIFYEGSLQNGVTAADRVKKGFD 446
Query: 659 FPWPVPNRPMFFYVQMGQEEISASGTSYLNRTEAANVEKIVTTFLRSGVVPSQIGVITPY 718
F WP P++PMFFYV GQEEI++SGTSYLNRTEAANVEKI T L++G P QIG+ITPY
Sbjct: 447 FQWPQPDKPMFFYVTQGQEEIASSGTSYLNRTEAANVEKITTKLLKAGAKPDQIGIITPY 506
Query: 719 EGQRAYIVNYMSRNGALRQQLYKEIEVASVDSFQGREKDYIILSCVRSNEHQGIGFLNDP 778
EGQR+Y+V YM +G+L +LY+E+E+ASVD+FQGREKD+IILSCVR+NEHQGIGFLNDP
Sbjct: 507 EGQRSYLVQYMQFSGSLHTKLYQEVEIASVDAFQGREKDFIILSCVRANEHQGIGFLNDP 566
Query: 779 RRLNVALTRARYGIVILGNPKVLSKQPLWNGLLTHYKEHECLVEGPLNNLKQSMVQF 835
RRLNVALTRARYG++I+GNPK LSKQPLWN LL +YKE + LVEGPLNNL++S++QF
Sbjct: 567 RRLNVALTRARYGVIIVGNPKALSKQPLWNHLLNYYKEQKVLVEGPLNNLRESLMQF 623
|
| >2wjy_A Regulator of nonsense transcripts 1; nonsense mediated decay, zinc-finger, ATP-binding, metal-BIN UPF2, UPF1, helicase, hydrolase; 2.50A {Homo sapiens} PDB: 2wjv_A 2iyk_A Length = 800 | Back alignment and structure |
|---|
| >2wjy_A Regulator of nonsense transcripts 1; nonsense mediated decay, zinc-finger, ATP-binding, metal-BIN UPF2, UPF1, helicase, hydrolase; 2.50A {Homo sapiens} PDB: 2wjv_A 2iyk_A Length = 800 | Back alignment and structure |
|---|
| >2xzl_A ATP-dependent helicase NAM7; hydrolase-RNA complex, NMD, RNA degradation, allosteric REGU; HET: ADP 1PE; 2.40A {Saccharomyces cerevisiae} Length = 802 | Back alignment and structure |
|---|
| >2xzl_A ATP-dependent helicase NAM7; hydrolase-RNA complex, NMD, RNA degradation, allosteric REGU; HET: ADP 1PE; 2.40A {Saccharomyces cerevisiae} Length = 802 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >3upu_A ATP-dependent DNA helicase DDA; RECA-like domain, SH3 domain, PIN-tower interface, coupling hydrolysis to DNA unwinding, ssDNA; 3.30A {Enterobacteria phage T4} Length = 459 | Back alignment and structure |
|---|
| >1w36_D RECD, exodeoxyribonuclease V alpha chain; recombination, helicase, hydrolase, DNA repair; HET: DNA; 3.1A {Escherichia coli} SCOP: c.37.1.19 c.37.1.19 PDB: 3k70_D* Length = 608 | Back alignment and structure |
|---|
| >3vkw_A Replicase large subunit; alpha/beta domain, helicase, transferase; 1.90A {Tomato mosaic virus} Length = 446 | Back alignment and structure |
|---|
| >3vkw_A Replicase large subunit; alpha/beta domain, helicase, transferase; 1.90A {Tomato mosaic virus} Length = 446 | Back alignment and structure |
|---|
| >3e1s_A Exodeoxyribonuclease V, subunit RECD; alpha and beta protein, ATP-binding, nucleotide-binding, HYD; 2.20A {Deinococcus radiodurans} PDB: 3gp8_A 3gpl_A* Length = 574 | Back alignment and structure |
|---|
| >2vl7_A XPD; helicase, unknown function; 2.25A {Sulfolobus tokodaii} Length = 540 | Back alignment and structure |
|---|
| >4a2w_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.70A {Anas platyrhynchos} Length = 936 | Back alignment and structure |
|---|
| >1m2v_B SEC24, protein transport protein SEC24, SEC24P, SEC24 protein, abnormal nuclear; zinc-finger, beta barrel, VWA domain, gelsolin domain,; 2.75A {Saccharomyces cerevisiae} SCOP: a.71.2.1 b.2.8.1 c.62.1.2 d.109.2.1 g.41.10.1 Length = 926 | Back alignment and structure |
|---|
| >1m2v_B SEC24, protein transport protein SEC24, SEC24P, SEC24 protein, abnormal nuclear; zinc-finger, beta barrel, VWA domain, gelsolin domain,; 2.75A {Saccharomyces cerevisiae} SCOP: a.71.2.1 b.2.8.1 c.62.1.2 d.109.2.1 g.41.10.1 Length = 926 | Back alignment and structure |
|---|
| >4a2q_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.40A {Anas platyrhynchos} Length = 797 | Back alignment and structure |
|---|
| >2fwr_A DNA repair protein RAD25; DNA unwinding, XPB, DNA binding protein; HET: DNA; 2.60A {Archaeoglobus fulgidus} SCOP: c.37.1.19 c.37.1.19 PDB: 2fzl_A* Length = 472 | Back alignment and structure |
|---|
| >4a2p_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.00A {Anas platyrhynchos} PDB: 4a36_A* Length = 556 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch
Original result of HHsearch against PDB70 database
No hit with probability above 80.00
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST
Original result of RPS-BLAST against SCOP70(version1.75) database
| ID | Alignment Graph | Length |
Definition |
E-value |
| 1066 | ||||
| d1w36d1 | 359 | c.37.1.19 (D:2-360) Exodeoxyribonuclease V alpha c | 3e-19 | |
| d1svma_ | 362 | c.37.1.20 (A:) Papillomavirus large T antigen heli | 4e-06 | |
| d2bmfa2 | 305 | c.37.1.14 (A:178-482) Dengue virus helicase {Dengu | 1e-05 | |
| d1uaaa1 | 306 | c.37.1.19 (A:2-307) DEXX box DNA helicase {Escheri | 5e-05 | |
| g1qhh.1 | 623 | c.37.1.19 (A:,B:,C:,D:) DEXX box DNA helicase {Bac | 2e-04 | |
| d1pjra1 | 318 | c.37.1.19 (A:1-318) DEXX box DNA helicase {Bacillu | 2e-04 | |
| d1a1va1 | 136 | c.37.1.14 (A:190-325) HCV helicase domain {Human h | 7e-04 | |
| d2i3ba1 | 189 | c.37.1.11 (A:1-189) Cancer-related NTPase, C1orf57 | 0.001 | |
| d1w36d2 | 246 | c.37.1.19 (D:361-606) Exodeoxyribonuclease V alpha | 0.002 |
| >d1w36d1 c.37.1.19 (D:2-360) Exodeoxyribonuclease V alpha chain (RecD) {Escherichia coli [TaxId: 562]} Length = 359 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: P-loop containing nucleoside triphosphate hydrolases superfamily: P-loop containing nucleoside triphosphate hydrolases family: Tandem AAA-ATPase domain domain: Exodeoxyribonuclease V alpha chain (RecD) species: Escherichia coli [TaxId: 562]
Score = 88.4 bits (218), Expect = 3e-19
Identities = 46/250 (18%), Positives = 83/250 (33%), Gaps = 59/250 (23%)
Query: 347 MKTFAVDETSVSGYIYHHLLGHEVEVQMVRNTLPRRFGAPGLPELNASQVFAVKSVLQRP 406
+ +E +V+ + EV+ ++ TL + F + Q A L R
Sbjct: 108 LNRMWCNERTVARFFNEVNHAIEVDEALLAQTLDKLFPVS---DEINWQKVAAAVALTRR 164
Query: 407 ISLIQGPPGTGKTVTSAAIVYHMAKQGQGQ---VLVCAPSNVAVDQLAEKISATGLKVVR 463
IS+I G PGTGKT T A ++ + + G+ + + AP+ A +L E G + +
Sbjct: 165 ISVISGGPGTGKTTTVAKLLAALIQMADGERCRIRLAAPTGKAAARLTES---LGKALRQ 221
Query: 464 LCAKSREAVSSPVEHLTLHYQVRHLDTSEKSELHKLQQLKDEQGELSSSDEKKYKALKRA 523
L + P + TLH + S++ H
Sbjct: 222 LPLTDEQKKRIPEDASTLHRLLGAQPGSQRLRHHAGN----------------------- 258
Query: 524 TEREISQSADVICCTCVGAGDPRLANFRFRQVLIDESTQATEPECLIPL--VLGAKQVVL 581
+++DE++ P + + +V+
Sbjct: 259 -------------------------PLHLDVLVVDEASMIDLPMMSRLIDALPDHARVIF 293
Query: 582 VGDHCQLGPV 591
+GD QL V
Sbjct: 294 LGDRDQLASV 303
|
| >d1svma_ c.37.1.20 (A:) Papillomavirus large T antigen helicase domain {Simian virus 40 [TaxId: 10633]} Length = 362 | Back information, alignment and structure |
|---|
| >d2bmfa2 c.37.1.14 (A:178-482) Dengue virus helicase {Dengue virus type 2 [TaxId: 11060]} Length = 305 | Back information, alignment and structure |
|---|
| >d1uaaa1 c.37.1.19 (A:2-307) DEXX box DNA helicase {Escherichia coli, RepD [TaxId: 562]} Length = 306 | Back information, alignment and structure |
|---|
| >d1pjra1 c.37.1.19 (A:1-318) DEXX box DNA helicase {Bacillus stearothermophilus, PcrA [TaxId: 1422]} Length = 318 | Back information, alignment and structure |
|---|
| >d1a1va1 c.37.1.14 (A:190-325) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} Length = 136 | Back information, alignment and structure |
|---|
| >d2i3ba1 c.37.1.11 (A:1-189) Cancer-related NTPase, C1orf57 {Human (Homo sapiens) [TaxId: 9606]} Length = 189 | Back information, alignment and structure |
|---|
| >d1w36d2 c.37.1.19 (D:361-606) Exodeoxyribonuclease V alpha chain (RecD) {Escherichia coli [TaxId: 562]} Length = 246 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch
Original result of HHsearch against SCOP70(version1.75) database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 1066 | |||
| g1qhh.1 | 623 | DEXX box DNA helicase {Bacillus stearothermophilus | 100.0 | |
| d1w36d1 | 359 | Exodeoxyribonuclease V alpha chain (RecD) {Escheri | 99.95 | |
| d1uaaa1 | 306 | DEXX box DNA helicase {Escherichia coli, RepD [Tax | 99.91 | |
| d1pjra1 | 318 | DEXX box DNA helicase {Bacillus stearothermophilus | 99.89 | |
| d1w36b1 | 485 | Exodeoxyribonuclease V beta chain (RecB), N-termin | 99.78 | |
| d1w36b2 | 395 | Exodeoxyribonuclease V beta chain (RecB), N-termin | 99.35 | |
| d1pjra2 | 333 | DEXX box DNA helicase {Bacillus stearothermophilus | 99.22 | |
| d1uaaa2 | 333 | DEXX box DNA helicase {Escherichia coli, RepD [Tax | 99.14 | |
| d1gkub1 | 237 | Helicase-like "domain" of reverse gyrase {Archaeon | 98.86 | |
| d1w36d2 | 246 | Exodeoxyribonuclease V alpha chain (RecD) {Escheri | 98.84 | |
| d1rifa_ | 282 | DNA helicase UvsW {Bacteriophage T4 [TaxId: 10665] | 98.82 | |
| d1wp9a1 | 200 | putative ATP-dependent RNA helicase PF2015 {Pyroco | 98.79 | |
| d2fz4a1 | 206 | DNA repair protein RAD25 {Archaeoglobus fulgidus [ | 98.79 | |
| d1gm5a3 | 264 | RecG helicase domain {Thermotoga maritima [TaxId: | 98.53 | |
| d1hv8a1 | 208 | Putative DEAD box RNA helicase {Archaeon Methanoco | 98.5 | |
| d2p6ra3 | 202 | Hel308 helicase {Archaeoglobus fulgidus [TaxId: 22 | 98.4 | |
| d2eyqa3 | 233 | Transcription-repair coupling factor, TRCF {Escher | 98.4 | |
| d1yksa1 | 140 | YFV helicase domain {Yellow fever virus [TaxId: 11 | 98.33 | |
| d2bmfa2 | 305 | Dengue virus helicase {Dengue virus type 2 [TaxId: | 98.32 | |
| d1oywa2 | 206 | RecQ helicase domain {Escherichia coli [TaxId: 562 | 98.29 | |
| d1wrba1 | 238 | putative ATP-dependent RNA helicase VlgB {Flatworm | 98.28 | |
| d1a1va1 | 136 | HCV helicase domain {Human hepatitis C virus (HCV) | 98.24 | |
| d1qdea_ | 212 | Initiation factor 4a {Baker's yeast (Saccharomyces | 98.23 | |
| d2j0sa1 | 222 | Probable ATP-dependent RNA helicase DDX48 {Human ( | 98.21 | |
| d1veca_ | 206 | DEAD box RNA helicase rck/p54 {Human (Homo sapiens | 98.16 | |
| d2g9na1 | 218 | Initiation factor 4a {Human (Homo sapiens) [TaxId: | 98.15 | |
| d1z63a1 | 230 | Helicase of the SNF2/Rad54 hamily {Sulfolobus solf | 98.11 | |
| d1t6na_ | 207 | Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo | 98.1 | |
| d1s2ma1 | 206 | Putative ATP-dependent RNA helicase DHH1 {Baker's | 98.02 | |
| d1ls1a2 | 207 | GTPase domain of the signal sequence recognition p | 98.0 | |
| d1vmaa2 | 213 | GTPase domain of the signal recognition particle r | 97.91 | |
| d1w36c2 | 470 | Exodeoxyribonuclease V gamma chain (RecC), N-termi | 97.86 | |
| d1okkd2 | 207 | GTPase domain of the signal recognition particle r | 97.8 | |
| d1z3ix2 | 298 | Rad54-like, Rad54L {Zebra fish (Danio rerio) [TaxI | 97.74 | |
| d2qy9a2 | 211 | GTPase domain of the signal recognition particle r | 97.71 | |
| d1j8yf2 | 211 | GTPase domain of the signal sequence recognition p | 97.22 | |
| d1fnna2 | 276 | CDC6, N-domain {Archaeon Pyrobaculum aerophilum [T | 97.01 | |
| d2i3ba1 | 189 | Cancer-related NTPase, C1orf57 {Human (Homo sapien | 96.95 | |
| d1p9ra_ | 401 | Extracellular secretion NTPase EpsE {Vibrio choler | 96.73 | |
| d2gnoa2 | 198 | gamma subunit of DNA polymerase III, N-domain {The | 96.69 | |
| d1in4a2 | 238 | Holliday junction helicase RuvB {Thermotoga mariti | 96.66 | |
| d1sxja2 | 253 | Replication factor C1 {Baker's yeast (Saccharomyce | 96.63 | |
| d1np6a_ | 170 | Molybdopterin-guanine dinucleotide biosynthesis pr | 96.52 | |
| d1w5sa2 | 287 | CDC6-like protein APE0152, N-terminal domain {Aero | 96.49 | |
| d1iqpa2 | 231 | Replication factor C {Archaeon Pyrococcus furiosus | 96.32 | |
| d1l8qa2 | 213 | Chromosomal replication initiation factor DnaA {Aq | 96.27 | |
| d1d2na_ | 246 | Hexamerization domain of N-ethylmalemide-sensitive | 96.18 | |
| d1ixsb2 | 239 | Holliday junction helicase RuvB {Thermus thermophi | 96.17 | |
| d1q0ua_ | 209 | Probable DEAD box RNA helicase YqfR {Bacillus stea | 96.14 | |
| d1tf7a2 | 242 | Circadian clock protein KaiC {Synechococcus sp. st | 96.14 | |
| d1t5la1 | 413 | Nucleotide excision repair enzyme UvrB {Bacillus c | 96.12 | |
| d1sxjb2 | 224 | Replication factor C4 {Baker's yeast (Saccharomyce | 96.06 | |
| d1sxjc2 | 227 | Replication factor C3 {Baker's yeast (Saccharomyce | 96.06 | |
| d1khta_ | 190 | Adenylate kinase {Archaeon Methanococcus voltae [T | 96.03 | |
| d1sxje2 | 252 | Replication factor C5 {Baker's yeast (Saccharomyce | 95.99 | |
| d1sxjd2 | 237 | Replication factor C2 {Baker's yeast (Saccharomyce | 95.89 | |
| d1ofha_ | 309 | HslU {Haemophilus influenzae [TaxId: 727]} | 95.84 | |
| d2qm8a1 | 323 | Metallochaperone MeaB {Methylobacterium extorquens | 95.57 | |
| d1cr2a_ | 277 | Gene 4 protein (g4p, DNA primase), helicase domain | 95.57 | |
| d1gvnb_ | 273 | Plasmid maintenance system epsilon/zeta, toxin zet | 95.49 | |
| d1xjca_ | 165 | Molybdopterin-guanine dinucleotide biosynthesis pr | 95.46 | |
| d1lv7a_ | 256 | AAA domain of cell division protein FtsH {Escheric | 95.4 | |
| d1svma_ | 362 | Papillomavirus large T antigen helicase domain {Si | 95.36 | |
| d1tf7a1 | 242 | Circadian clock protein KaiC {Synechococcus sp. st | 95.23 | |
| d1rkba_ | 173 | Adenylate kinase {Human (Homo sapiens), isoenzyme | 95.12 | |
| d1ixza_ | 247 | AAA domain of cell division protein FtsH {Thermus | 95.03 | |
| d1e32a2 | 258 | Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu | 95.02 | |
| d1ihua2 | 279 | Arsenite-translocating ATPase ArsA {Escherichia co | 94.94 | |
| d1ihua1 | 296 | Arsenite-translocating ATPase ArsA {Escherichia co | 94.91 | |
| d2bdta1 | 176 | Hypothetical protein BH3686 {Bacillus halodurans [ | 94.81 | |
| d1c4oa1 | 408 | Nucleotide excision repair enzyme UvrB {Thermus th | 94.77 | |
| d1ckea_ | 225 | CMP kinase {Escherichia coli [TaxId: 562]} | 94.71 | |
| d1knqa_ | 171 | Gluconate kinase {Escherichia coli [TaxId: 562]} | 94.7 | |
| d1nksa_ | 194 | Adenylate kinase {Archaeon Sulfolobus acidocaldari | 94.65 | |
| d1nlfa_ | 274 | Hexameric replicative helicase repA {Escherichia c | 94.52 | |
| d1ly1a_ | 152 | Polynucleotide kinase, kinase domain {Bacteriophag | 94.51 | |
| d2p67a1 | 327 | LAO/AO transport system kinase ArgK {Escherichia c | 94.51 | |
| d1qhxa_ | 178 | Chloramphenicol phosphotransferase {Streptomyces v | 94.38 | |
| d1njfa_ | 239 | delta prime subunit of DNA polymerase III, N-domai | 94.31 | |
| d1xx6a1 | 141 | Thymidine kinase, TK1, N-terminal domain {Clostrid | 94.25 | |
| d1r7ra3 | 265 | Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu | 94.21 | |
| d1lw7a2 | 192 | Transcriptional regulator NadR, ribosylnicotinamid | 94.11 | |
| d1e9ra_ | 433 | Bacterial conjugative coupling protein TrwB {Esche | 94.07 | |
| d1rz3a_ | 198 | Hypothetical protein rbstp0775 {Bacillus stearothe | 93.97 | |
| d1u94a1 | 263 | RecA protein, ATPase-domain {Escherichia coli [Tax | 93.95 | |
| d1qf9a_ | 194 | UMP/CMP kinase {Dictyostelium discoideum [TaxId: 4 | 93.95 | |
| d1w44a_ | 321 | NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} | 93.94 | |
| d1g6oa_ | 323 | Hexameric traffic ATPase, HP0525 {Helicobacter pyl | 93.82 | |
| d1ny5a2 | 247 | Transcriptional activator sigm54 (NtrC1), C-termin | 93.81 | |
| d1kaga_ | 169 | Shikimate kinase (AroK) {Escherichia coli [TaxId: | 93.76 | |
| d1e6ca_ | 170 | Shikimate kinase (AroK) {Erwinia chrysanthemi [Tax | 93.73 | |
| d1bifa1 | 213 | 6-phosphofructo-2-kinase/fructose-2,6-bisphosphata | 93.69 | |
| d2b8ta1 | 139 | Thymidine kinase, TK1, N-terminal domain {Ureaplas | 93.63 | |
| d1odfa_ | 286 | Hypothetical protein Ygr205W {Baker's yeast (Sacch | 93.63 | |
| d1xbta1 | 133 | Thymidine kinase, TK1, N-terminal domain {Human (H | 93.63 | |
| d1ye8a1 | 178 | Hypothetical kinase-like protein Aq_1292 {Aquifex | 93.54 | |
| d2afhe1 | 289 | Nitrogenase iron protein {Azotobacter vinelandii [ | 93.52 | |
| d1zina1 | 182 | Adenylate kinase {Bacillus stearothermophilus [Tax | 93.47 | |
| d1g8pa_ | 333 | ATPase subunit of magnesium chelatase, BchI {Rhodo | 93.4 | |
| d1ukza_ | 196 | Uridylate kinase {Baker's yeast (Saccharomyces cer | 93.37 | |
| d1zp6a1 | 176 | Hypothetical protein Atu3015 {Agrobacterium tumefa | 93.36 | |
| d1m8pa3 | 183 | ATP sulfurylase C-terminal domain {Fungus (Penicil | 93.3 | |
| d2cdna1 | 181 | Adenylate kinase {Mycobacterium tuberculosis [TaxI | 93.22 | |
| d1viaa_ | 161 | Shikimate kinase (AroK) {Campylobacter jejuni [Tax | 93.12 | |
| d1zaka1 | 189 | Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} | 93.12 | |
| d1teva_ | 194 | UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606] | 93.09 | |
| d1jbka_ | 195 | ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} | 93.09 | |
| d1pzna2 | 254 | DNA repair protein Rad51, catalytic domain {Archae | 93.07 | |
| d3adka_ | 194 | Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} | 93.02 | |
| d1y63a_ | 174 | Probable kinase LmjF30.1890 {Leishmania major [Tax | 92.91 | |
| d1nija1 | 222 | Hypothetical protein YjiA, N-terminal domain {Esch | 92.9 | |
| d1ak2a1 | 190 | Adenylate kinase {Cow (Bos taurus), mitochondrial | 92.89 | |
| d1s3ga1 | 182 | Adenylate kinase {Bacillus globisporus [TaxId: 145 | 92.87 | |
| d1r6bx2 | 268 | ClpA, an Hsp100 chaperone, AAA+ modules {Escherich | 92.7 | |
| d2fnaa2 | 283 | Archaeal ATPase SSO1545 {Sulfolobus solfataricus [ | 92.54 | |
| d1akya1 | 180 | Adenylate kinase {Baker's yeast (Saccharomyces cer | 92.45 | |
| d1a5ta2 | 207 | delta prime subunit of DNA polymerase III, N-domai | 92.43 | |
| d1yrba1 | 244 | ATP(GTP)-binding protein PAB0955 {Pyrococcus abyss | 92.29 | |
| d2ak3a1 | 189 | Adenylate kinase {Cow (Bos taurus), mitochondrial | 92.2 | |
| d1n0wa_ | 242 | DNA repair protein Rad51, catalytic domain {Human | 92.18 | |
| d1q3ta_ | 223 | CMP kinase {Streptococcus pneumoniae [TaxId: 1313] | 92.17 | |
| d1xpua3 | 289 | Transcription termination factor Rho, ATPase domai | 92.13 | |
| d1cp2a_ | 269 | Nitrogenase iron protein {Clostridium pasteurianum | 92.08 | |
| d1e4va1 | 179 | Adenylate kinase {Escherichia coli [TaxId: 562]} | 92.07 | |
| d1mo6a1 | 269 | RecA protein, ATPase-domain {Mycobacterium tubercu | 92.07 | |
| d1szpa2 | 251 | DNA repair protein Rad51, catalytic domain {Baker' | 91.92 | |
| d1byia_ | 224 | Dethiobiotin synthetase {Escherichia coli [TaxId: | 91.63 | |
| d2iyva1 | 165 | Shikimate kinase (AroK) {Mycobacterium tuberculosi | 91.62 | |
| d1v5wa_ | 258 | Meiotic recombination protein DMC1/LIM15 homolog { | 91.59 | |
| d2i1qa2 | 258 | DNA repair protein Rad51, catalytic domain {Archae | 91.36 | |
| d1m7ga_ | 208 | Adenosine-5'phosphosulfate kinase (APS kinase) {Fu | 91.32 | |
| d1x6va3 | 195 | Adenosine-5'phosphosulfate kinase (APS kinase) {Hu | 91.29 | |
| d1xp8a1 | 268 | RecA protein, ATPase-domain {Deinococcus radiodura | 91.1 | |
| d1yj5a2 | 172 | 5' polynucleotide kinase-3' phosphatase, C-termina | 90.66 | |
| d1g41a_ | 443 | HslU {Haemophilus influenzae [TaxId: 727]} | 90.66 | |
| d1hyqa_ | 232 | Cell division regulator MinD {Archaeon Archaeoglob | 90.0 | |
| d4tmka_ | 210 | Thymidylate kinase {Escherichia coli [TaxId: 562]} | 89.4 | |
| d1uj2a_ | 213 | Uridine-cytidine kinase 2 {Human (Homo sapiens) [T | 88.89 | |
| d1g3qa_ | 237 | Cell division regulator MinD {Archaeon Pyrococcus | 88.87 | |
| d1gsia_ | 208 | Thymidylate kinase {Mycobacterium tuberculosis [Ta | 87.96 | |
| d1lvga_ | 190 | Guanylate kinase {Mouse (Mus musculus) [TaxId: 100 | 87.77 | |
| d1sq5a_ | 308 | Pantothenate kinase PanK {Escherichia coli [TaxId: | 87.46 | |
| d1qvra2 | 387 | ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 | 87.28 | |
| d1r6bx3 | 315 | ClpA, an Hsp100 chaperone, AAA+ modules {Escherich | 87.16 | |
| d1gkya_ | 186 | Guanylate kinase {Baker's yeast (Saccharomyces cer | 87.06 | |
| d1nn5a_ | 209 | Thymidylate kinase {Human (Homo sapiens) [TaxId: 9 | 86.93 | |
| d1znwa1 | 182 | Guanylate kinase {Mycobacterium tuberculosis [TaxI | 86.11 | |
| d1tuea_ | 205 | Replication protein E1 helicase domain {Human papi | 85.92 | |
| d2jdia3 | 285 | Central domain of alpha subunit of F1 ATP synthase | 84.87 | |
| d1qvra3 | 315 | ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 | 84.87 | |
| d1um8a_ | 364 | ClpX {Helicobacter pylori [TaxId: 210]} | 84.41 | |
| d2jdid3 | 276 | Central domain of beta subunit of F1 ATP synthase | 83.95 | |
| d1tf5a3 | 273 | Translocation ATPase SecA, nucleotide-binding doma | 83.74 | |
| d1s96a_ | 205 | Guanylate kinase {Escherichia coli [TaxId: 562]} | 83.44 | |
| g1f2t.1 | 292 | Rad50 {Archaeon Pyrococcus furiosus [TaxId: 2261]} | 82.04 | |
| d1nkta3 | 288 | Translocation ATPase SecA, nucleotide-binding doma | 81.99 | |
| d1a7ja_ | 288 | Phosphoribulokinase {Rhodobacter sphaeroides [TaxI | 81.69 | |
| d1kgda_ | 178 | Guanylate kinase-like domain of Cask {Human (Homo | 81.14 |
| >d1w36d1 c.37.1.19 (D:2-360) Exodeoxyribonuclease V alpha chain (RecD) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1uaaa1 c.37.1.19 (A:2-307) DEXX box DNA helicase {Escherichia coli, RepD [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1pjra1 c.37.1.19 (A:1-318) DEXX box DNA helicase {Bacillus stearothermophilus, PcrA [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1w36b1 c.37.1.19 (B:1-485) Exodeoxyribonuclease V beta chain (RecB), N-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1w36b2 c.37.1.19 (B:486-880) Exodeoxyribonuclease V beta chain (RecB), N-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1pjra2 c.37.1.19 (A:319-651) DEXX box DNA helicase {Bacillus stearothermophilus, PcrA [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1uaaa2 c.37.1.19 (A:308-640) DEXX box DNA helicase {Escherichia coli, RepD [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1gkub1 c.37.1.16 (B:1-250) Helicase-like "domain" of reverse gyrase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d1w36d2 c.37.1.19 (D:361-606) Exodeoxyribonuclease V alpha chain (RecD) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1rifa_ c.37.1.23 (A:) DNA helicase UvsW {Bacteriophage T4 [TaxId: 10665]} | Back information, alignment and structure |
|---|
| >d1wp9a1 c.37.1.19 (A:1-200) putative ATP-dependent RNA helicase PF2015 {Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d2fz4a1 c.37.1.19 (A:24-229) DNA repair protein RAD25 {Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d1gm5a3 c.37.1.19 (A:286-549) RecG helicase domain {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1hv8a1 c.37.1.19 (A:3-210) Putative DEAD box RNA helicase {Archaeon Methanococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d2p6ra3 c.37.1.19 (A:1-202) Hel308 helicase {Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d2eyqa3 c.37.1.19 (A:546-778) Transcription-repair coupling factor, TRCF {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1yksa1 c.37.1.14 (A:185-324) YFV helicase domain {Yellow fever virus [TaxId: 11089]} | Back information, alignment and structure |
|---|
| >d2bmfa2 c.37.1.14 (A:178-482) Dengue virus helicase {Dengue virus type 2 [TaxId: 11060]} | Back information, alignment and structure |
|---|
| >d1oywa2 c.37.1.19 (A:1-206) RecQ helicase domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1wrba1 c.37.1.19 (A:164-401) putative ATP-dependent RNA helicase VlgB {Flatworm (Dugesia japonica) [TaxId: 6161]} | Back information, alignment and structure |
|---|
| >d1a1va1 c.37.1.14 (A:190-325) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} | Back information, alignment and structure |
|---|
| >d1qdea_ c.37.1.19 (A:) Initiation factor 4a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2j0sa1 c.37.1.19 (A:22-243) Probable ATP-dependent RNA helicase DDX48 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1veca_ c.37.1.19 (A:) DEAD box RNA helicase rck/p54 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2g9na1 c.37.1.19 (A:21-238) Initiation factor 4a {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1z63a1 c.37.1.19 (A:432-661) Helicase of the SNF2/Rad54 hamily {Sulfolobus solfataricus [TaxId: 2287]} | Back information, alignment and structure |
|---|
| >d1t6na_ c.37.1.19 (A:) Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1s2ma1 c.37.1.19 (A:46-251) Putative ATP-dependent RNA helicase DHH1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1ls1a2 c.37.1.10 (A:89-295) GTPase domain of the signal sequence recognition protein Ffh {Thermus aquaticus [TaxId: 271]} | Back information, alignment and structure |
|---|
| >d1vmaa2 c.37.1.10 (A:82-294) GTPase domain of the signal recognition particle receptor FtsY {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1w36c2 c.37.1.19 (C:348-817) Exodeoxyribonuclease V gamma chain (RecC), N-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1okkd2 c.37.1.10 (D:97-303) GTPase domain of the signal recognition particle receptor FtsY {Thermus aquaticus [TaxId: 271]} | Back information, alignment and structure |
|---|
| >d1z3ix2 c.37.1.19 (X:92-389) Rad54-like, Rad54L {Zebra fish (Danio rerio) [TaxId: 7955]} | Back information, alignment and structure |
|---|
| >d2qy9a2 c.37.1.10 (A:285-495) GTPase domain of the signal recognition particle receptor FtsY {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1j8yf2 c.37.1.10 (F:87-297) GTPase domain of the signal sequence recognition protein Ffh {Archaeon Acidianus ambivalens [TaxId: 2283]} | Back information, alignment and structure |
|---|
| >d1fnna2 c.37.1.20 (A:1-276) CDC6, N-domain {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} | Back information, alignment and structure |
|---|
| >d2i3ba1 c.37.1.11 (A:1-189) Cancer-related NTPase, C1orf57 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1p9ra_ c.37.1.11 (A:) Extracellular secretion NTPase EpsE {Vibrio cholerae [TaxId: 666]} | Back information, alignment and structure |
|---|
| >d2gnoa2 c.37.1.20 (A:11-208) gamma subunit of DNA polymerase III, N-domain {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1in4a2 c.37.1.20 (A:17-254) Holliday junction helicase RuvB {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1sxja2 c.37.1.20 (A:295-547) Replication factor C1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1np6a_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1w5sa2 c.37.1.20 (A:7-293) CDC6-like protein APE0152, N-terminal domain {Aeropyrum pernix [TaxId: 56636]} | Back information, alignment and structure |
|---|
| >d1iqpa2 c.37.1.20 (A:2-232) Replication factor C {Archaeon Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d1l8qa2 c.37.1.20 (A:77-289) Chromosomal replication initiation factor DnaA {Aquifex aeolicus [TaxId: 63363]} | Back information, alignment and structure |
|---|
| >d1d2na_ c.37.1.20 (A:) Hexamerization domain of N-ethylmalemide-sensitive fusion (NSF) protein {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} | Back information, alignment and structure |
|---|
| >d1ixsb2 c.37.1.20 (B:4-242) Holliday junction helicase RuvB {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1q0ua_ c.37.1.19 (A:) Probable DEAD box RNA helicase YqfR {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1tf7a2 c.37.1.11 (A:256-497) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} | Back information, alignment and structure |
|---|
| >d1t5la1 c.37.1.19 (A:2-414) Nucleotide excision repair enzyme UvrB {Bacillus caldotenax [TaxId: 1395]} | Back information, alignment and structure |
|---|
| >d1sxjb2 c.37.1.20 (B:7-230) Replication factor C4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1sxjc2 c.37.1.20 (C:12-238) Replication factor C3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1khta_ c.37.1.1 (A:) Adenylate kinase {Archaeon Methanococcus voltae [TaxId: 2188]} | Back information, alignment and structure |
|---|
| >d1sxje2 c.37.1.20 (E:4-255) Replication factor C5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1sxjd2 c.37.1.20 (D:26-262) Replication factor C2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1ofha_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d2qm8a1 c.37.1.10 (A:5-327) Metallochaperone MeaB {Methylobacterium extorquens [TaxId: 408]} | Back information, alignment and structure |
|---|
| >d1cr2a_ c.37.1.11 (A:) Gene 4 protein (g4p, DNA primase), helicase domain {Bacteriophage T7 [TaxId: 10760]} | Back information, alignment and structure |
|---|
| >d1gvnb_ c.37.1.21 (B:) Plasmid maintenance system epsilon/zeta, toxin zeta subunit {Streptococcus pyogenes [TaxId: 1314]} | Back information, alignment and structure |
|---|
| >d1xjca_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1lv7a_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1svma_ c.37.1.20 (A:) Papillomavirus large T antigen helicase domain {Simian virus 40 [TaxId: 10633]} | Back information, alignment and structure |
|---|
| >d1tf7a1 c.37.1.11 (A:14-255) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} | Back information, alignment and structure |
|---|
| >d1rkba_ c.37.1.1 (A:) Adenylate kinase {Human (Homo sapiens), isoenzyme 6 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ixza_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1e32a2 c.37.1.20 (A:201-458) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1ihua2 c.37.1.10 (A:308-586) Arsenite-translocating ATPase ArsA {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1ihua1 c.37.1.10 (A:1-296) Arsenite-translocating ATPase ArsA {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2bdta1 c.37.1.25 (A:1-176) Hypothetical protein BH3686 {Bacillus halodurans [TaxId: 86665]} | Back information, alignment and structure |
|---|
| >d1c4oa1 c.37.1.19 (A:2-409) Nucleotide excision repair enzyme UvrB {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1ckea_ c.37.1.1 (A:) CMP kinase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1knqa_ c.37.1.17 (A:) Gluconate kinase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1nksa_ c.37.1.1 (A:) Adenylate kinase {Archaeon Sulfolobus acidocaldarius [TaxId: 2285]} | Back information, alignment and structure |
|---|
| >d1nlfa_ c.37.1.11 (A:) Hexameric replicative helicase repA {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1ly1a_ c.37.1.1 (A:) Polynucleotide kinase, kinase domain {Bacteriophage T4 [TaxId: 10665]} | Back information, alignment and structure |
|---|
| >d2p67a1 c.37.1.10 (A:1-327) LAO/AO transport system kinase ArgK {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1qhxa_ c.37.1.3 (A:) Chloramphenicol phosphotransferase {Streptomyces venezuelae [TaxId: 54571]} | Back information, alignment and structure |
|---|
| >d1njfa_ c.37.1.20 (A:) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1xx6a1 c.37.1.24 (A:2-142) Thymidine kinase, TK1, N-terminal domain {Clostridium acetobutylicum [TaxId: 1488]} | Back information, alignment and structure |
|---|
| >d1r7ra3 c.37.1.20 (A:471-735) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1lw7a2 c.37.1.1 (A:220-411) Transcriptional regulator NadR, ribosylnicotinamide kinase domain {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1e9ra_ c.37.1.11 (A:) Bacterial conjugative coupling protein TrwB {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1rz3a_ c.37.1.6 (A:) Hypothetical protein rbstp0775 {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1u94a1 c.37.1.11 (A:6-268) RecA protein, ATPase-domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1qf9a_ c.37.1.1 (A:) UMP/CMP kinase {Dictyostelium discoideum [TaxId: 44689]} | Back information, alignment and structure |
|---|
| >d1w44a_ c.37.1.11 (A:) NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} | Back information, alignment and structure |
|---|
| >d1g6oa_ c.37.1.11 (A:) Hexameric traffic ATPase, HP0525 {Helicobacter pylori [TaxId: 210]} | Back information, alignment and structure |
|---|
| >d1ny5a2 c.37.1.20 (A:138-384) Transcriptional activator sigm54 (NtrC1), C-terminal domain {Aquifex aeolicus [TaxId: 63363]} | Back information, alignment and structure |
|---|
| >d1kaga_ c.37.1.2 (A:) Shikimate kinase (AroK) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1e6ca_ c.37.1.2 (A:) Shikimate kinase (AroK) {Erwinia chrysanthemi [TaxId: 556]} | Back information, alignment and structure |
|---|
| >d1bifa1 c.37.1.7 (A:37-249) 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase, kinase domain {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d2b8ta1 c.37.1.24 (A:11-149) Thymidine kinase, TK1, N-terminal domain {Ureaplasma urealyticum [TaxId: 2130]} | Back information, alignment and structure |
|---|
| >d1odfa_ c.37.1.6 (A:) Hypothetical protein Ygr205W {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1xbta1 c.37.1.24 (A:18-150) Thymidine kinase, TK1, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ye8a1 c.37.1.11 (A:1-178) Hypothetical kinase-like protein Aq_1292 {Aquifex aeolicus [TaxId: 63363]} | Back information, alignment and structure |
|---|
| >d2afhe1 c.37.1.10 (E:1-289) Nitrogenase iron protein {Azotobacter vinelandii [TaxId: 354]} | Back information, alignment and structure |
|---|
| >d1zina1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1g8pa_ c.37.1.20 (A:) ATPase subunit of magnesium chelatase, BchI {Rhodobacter capsulatus [TaxId: 1061]} | Back information, alignment and structure |
|---|
| >d1ukza_ c.37.1.1 (A:) Uridylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1zp6a1 c.37.1.25 (A:6-181) Hypothetical protein Atu3015 {Agrobacterium tumefaciens [TaxId: 358]} | Back information, alignment and structure |
|---|
| >d1m8pa3 c.37.1.15 (A:391-573) ATP sulfurylase C-terminal domain {Fungus (Penicillium chrysogenum) [TaxId: 5076]} | Back information, alignment and structure |
|---|
| >d2cdna1 c.37.1.1 (A:1-181) Adenylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1viaa_ c.37.1.2 (A:) Shikimate kinase (AroK) {Campylobacter jejuni [TaxId: 197]} | Back information, alignment and structure |
|---|
| >d1zaka1 c.37.1.1 (A:3-127,A:159-222) Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} | Back information, alignment and structure |
|---|
| >d1teva_ c.37.1.1 (A:) UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1jbka_ c.37.1.20 (A:) ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1pzna2 c.37.1.11 (A:96-349) DNA repair protein Rad51, catalytic domain {Archaeon Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d3adka_ c.37.1.1 (A:) Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d1y63a_ c.37.1.1 (A:) Probable kinase LmjF30.1890 {Leishmania major [TaxId: 5664]} | Back information, alignment and structure |
|---|
| >d1nija1 c.37.1.10 (A:2-223) Hypothetical protein YjiA, N-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1ak2a1 c.37.1.1 (A:14-146,A:177-233) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-2 [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1s3ga1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus globisporus [TaxId: 1459]} | Back information, alignment and structure |
|---|
| >d1r6bx2 c.37.1.20 (X:169-436) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2fnaa2 c.37.1.20 (A:1-283) Archaeal ATPase SSO1545 {Sulfolobus solfataricus [TaxId: 2287]} | Back information, alignment and structure |
|---|
| >d1akya1 c.37.1.1 (A:3-130,A:169-220) Adenylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1a5ta2 c.37.1.20 (A:1-207) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1yrba1 c.37.1.10 (A:1-244) ATP(GTP)-binding protein PAB0955 {Pyrococcus abyssi [TaxId: 29292]} | Back information, alignment and structure |
|---|
| >d2ak3a1 c.37.1.1 (A:0-124,A:162-225) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-3 [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1n0wa_ c.37.1.11 (A:) DNA repair protein Rad51, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1q3ta_ c.37.1.1 (A:) CMP kinase {Streptococcus pneumoniae [TaxId: 1313]} | Back information, alignment and structure |
|---|
| >d1xpua3 c.37.1.11 (A:129-417) Transcription termination factor Rho, ATPase domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1cp2a_ c.37.1.10 (A:) Nitrogenase iron protein {Clostridium pasteurianum [TaxId: 1501]} | Back information, alignment and structure |
|---|
| >d1e4va1 c.37.1.1 (A:1-121,A:157-214) Adenylate kinase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1mo6a1 c.37.1.11 (A:1-269) RecA protein, ATPase-domain {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1szpa2 c.37.1.11 (A:145-395) DNA repair protein Rad51, catalytic domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1byia_ c.37.1.10 (A:) Dethiobiotin synthetase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2iyva1 c.37.1.2 (A:2-166) Shikimate kinase (AroK) {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1v5wa_ c.37.1.11 (A:) Meiotic recombination protein DMC1/LIM15 homolog {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2i1qa2 c.37.1.11 (A:65-322) DNA repair protein Rad51, catalytic domain {Archaeon Methanococcus voltae [TaxId: 2188]} | Back information, alignment and structure |
|---|
| >d1m7ga_ c.37.1.4 (A:) Adenosine-5'phosphosulfate kinase (APS kinase) {Fungus (Penicillium chrysogenum) [TaxId: 5076]} | Back information, alignment and structure |
|---|
| >d1x6va3 c.37.1.4 (A:34-228) Adenosine-5'phosphosulfate kinase (APS kinase) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xp8a1 c.37.1.11 (A:15-282) RecA protein, ATPase-domain {Deinococcus radiodurans [TaxId: 1299]} | Back information, alignment and structure |
|---|
| >d1yj5a2 c.37.1.1 (A:351-522) 5' polynucleotide kinase-3' phosphatase, C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1g41a_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1hyqa_ c.37.1.10 (A:) Cell division regulator MinD {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d4tmka_ c.37.1.1 (A:) Thymidylate kinase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1uj2a_ c.37.1.6 (A:) Uridine-cytidine kinase 2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1g3qa_ c.37.1.10 (A:) Cell division regulator MinD {Archaeon Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d1gsia_ c.37.1.1 (A:) Thymidylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1lvga_ c.37.1.1 (A:) Guanylate kinase {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1sq5a_ c.37.1.6 (A:) Pantothenate kinase PanK {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1qvra2 c.37.1.20 (A:149-535) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1r6bx3 c.37.1.20 (X:437-751) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1gkya_ c.37.1.1 (A:) Guanylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1nn5a_ c.37.1.1 (A:) Thymidylate kinase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1znwa1 c.37.1.1 (A:20-201) Guanylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1tuea_ c.37.1.20 (A:) Replication protein E1 helicase domain {Human papillomavirus type 18 [TaxId: 333761]} | Back information, alignment and structure |
|---|
| >d2jdia3 c.37.1.11 (A:95-379) Central domain of alpha subunit of F1 ATP synthase {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1qvra3 c.37.1.20 (A:536-850) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1um8a_ c.37.1.20 (A:) ClpX {Helicobacter pylori [TaxId: 210]} | Back information, alignment and structure |
|---|
| >d2jdid3 c.37.1.11 (D:82-357) Central domain of beta subunit of F1 ATP synthase {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1tf5a3 c.37.1.19 (A:1-226,A:349-395) Translocation ATPase SecA, nucleotide-binding domains {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1s96a_ c.37.1.1 (A:) Guanylate kinase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1a7ja_ c.37.1.6 (A:) Phosphoribulokinase {Rhodobacter sphaeroides [TaxId: 1063]} | Back information, alignment and structure |
|---|
| >d1kgda_ c.37.1.1 (A:) Guanylate kinase-like domain of Cask {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|