Citrus Sinensis ID: 001512
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 1063 | ||||||
| 296083100 | 977 | unnamed protein product [Vitis vinifera] | 0.654 | 0.712 | 0.527 | 1e-174 | |
| 225429315 | 968 | PREDICTED: homeobox protein HAT3.1-like | 0.654 | 0.719 | 0.527 | 1e-174 | |
| 224060647 | 930 | predicted protein [Populus trichocarpa] | 0.824 | 0.941 | 0.454 | 1e-163 | |
| 255573075 | 896 | Homeobox protein HAT3.1, putative [Ricin | 0.671 | 0.796 | 0.546 | 1e-162 | |
| 356574291 | 820 | PREDICTED: homeobox protein HAT3.1-like | 0.728 | 0.943 | 0.449 | 1e-159 | |
| 356534303 | 963 | PREDICTED: uncharacterized protein LOC10 | 0.731 | 0.807 | 0.451 | 1e-157 | |
| 449501740 | 749 | PREDICTED: homeobox protein HAT3.1-like | 0.634 | 0.901 | 0.492 | 1e-148 | |
| 449446105 | 1061 | PREDICTED: uncharacterized protein LOC10 | 0.630 | 0.631 | 0.489 | 1e-148 | |
| 147822101 | 611 | hypothetical protein VITISV_006312 [Viti | 0.476 | 0.829 | 0.542 | 1e-128 | |
| 16326 | 660 | HAT 3.1 [Arabidopsis thaliana] | 0.516 | 0.831 | 0.467 | 1e-114 |
| >gi|296083100|emb|CBI22504.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
Score = 618 bits (1594), Expect = e-174, Method: Compositional matrix adjust.
Identities = 394/747 (52%), Positives = 496/747 (66%), Gaps = 51/747 (6%)
Query: 275 HEPSVVNYKLGSQL--EQTELGETSAGE--LGASLELVVKSSI-EQLKQPEVPITIPSTK 329
HEP+ ++ L + + EQ+EL G+ LG V K+S+ E L P + K
Sbjct: 49 HEPAEISPVLSNCIVTEQSELPPEDVGDTILGLPPADVTKNSLTEHLGLPPED----AIK 104
Query: 330 TSATKHLQSSSDLMEKKSCLE---QSETPPNYVANNSACLGRKG--------KRATKSLK 378
T+ L +++ K S +E QSE PP VA S L + G KR K +K
Sbjct: 105 NDGTEQLGFFPEVVTKSSIIEKLGQSEPPPENVARYSG-LDQSGSAPKDLANKRTAKLVK 163
Query: 379 NNYTVRSLIGSDRVLRSRSGERPIPPESSINLADVNSIGERKQKKRNKIRRKKIVADEYS 438
Y +RS + RVLRSRS E+P + S N VN+ R++K R K R K ADE++
Sbjct: 164 RKYKLRSSVSGSRVLRSRSQEKPKASQPSDNF--VNASASRERKGRKKKRMNKTTADEFA 221
Query: 439 RIRTHLRYLLNRINYEQNLIDAYSSEGWKGLSVEKLKPEKELQRATSEILRRKLKIRDLF 498
RIR HLRYLLNR++YEQNLIDAYS+EGWKG SVEKLKPEKELQRA+SEI RRKL+IRDLF
Sbjct: 222 RIRKHLRYLLNRMSYEQNLIDAYSAEGWKGQSVEKLKPEKELQRASSEISRRKLQIRDLF 281
Query: 499 QRLDSLCA-GGFPKSLFDSEGQIDSEDIYCAKCGSKDLSADNDIILCDGACDRGFHQYCL 557
Q LDSLCA G FP+SLFDSEGQIDSEDI+CAKC SKD+SADNDIILCDGACDRGFHQ+CL
Sbjct: 282 QHLDSLCAEGRFPESLFDSEGQIDSEDIFCAKCESKDMSADNDIILCDGACDRGFHQFCL 341
Query: 558 EPPLLKEDIPPDDEGWLCPGCDCKVDCIDLVNELQGTRLFITDNWEKVFPE-AAAGHNQD 616
EPPLLKE+IPPDDEGWLCP CDCKVDC+DL+N+ QGT+L + D+WEKVFPE AAAG+NQD
Sbjct: 342 EPPLLKEEIPPDDEGWLCPACDCKVDCMDLLNDSQGTKLSVIDSWEKVFPEAAAAGNNQD 401
Query: 617 PNFGLASDDSDDNEYDPDGSATDEQDEGDESSSDG-------SSSDDSDFTSTSDEVEAP 669
N G +SDDS+DN+YDPD DE+ +GD+SSSD SD+SDFTS SD++
Sbjct: 402 NNSGFSSDDSEDNDYDPDCPEVDEKGQGDKSSSDKFDESDEFDESDESDFTSASDDMVVS 461
Query: 670 ADDKTYLGLSSEDSEDDEYNPDAPELDDKVTQESSSSGSDFTSDSEDLAAVLEDNRSSGN 729
+++ LGL S+DSEDD+++PDAPE+D++V Q SS SDFTSDSED A L+ S N
Sbjct: 462 PNNEQCLGLPSDDSEDDDFDPDAPEIDEQVNQ--GSSSSDFTSDSEDFTATLDRRNFSDN 519
Query: 730 DEGAASPLGHSNGQRYKDGGNNESLNNELLSIIK--PGQDGAAPVYGKRSSERLDYKKLY 787
++G + QR ++L +ELLS+++ GQD AP+ KR ERLDYKKL+
Sbjct: 520 EDGL-------DEQRRFGRKKKDTLKDELLSVLESNSGQDN-APLSAKRHVERLDYKKLH 571
Query: 788 DETYGNVPYDSSDDESWSDDGGPRKRTKSTKEGSSASPDGKTPVIRRRKSTKAAKEKLNE 847
DE YGNV DSSDDE W+++ PRKR + +S SP+G T + +TK K L
Sbjct: 572 DEAYGNVSSDSSDDEDWTENVIPRKRKNLSGNVASVSPNGNTSITENGTNTKDIKHDLEA 631
Query: 848 TENTPKRRGRPKLNTEDSNISPAKSHEGCSTPGSRGRRH-RTSYRKLGEEVTQKLYNSFK 906
TPKRR R KLN E +N S A+SH+ +PGS G + ++SY+KLGE VT++LY SF+
Sbjct: 632 AGCTPKRRTRQKLNFESTNNSLAESHKDSRSPGSTGEKSGQSSYKKLGEAVTERLYKSFQ 691
Query: 907 ENQYPNRTTKESLAKELGLTFSQVRKWFENTRWSFNHPSSKNAKLANS--EKGTCTPQSN 964
ENQYP+R KE LA+ELG+T QV KWFEN RWSF H K A S +K T Q++
Sbjct: 692 ENQYPDRAMKEKLAEELGITSRQVSKWFENARWSFRHRPPKEASAGKSAVKKDASTSQTD 751
Query: 965 KN----TVGRVSNCNGAENVQSSKTGV 987
+ V R S+ NG +S K G
Sbjct: 752 QKPEQEVVLRESSHNGVGKKESPKAGA 778
|
Source: Vitis vinifera Species: Vitis vinifera Genus: Vitis Family: Vitaceae Order: Vitales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|225429315|ref|XP_002269077.1| PREDICTED: homeobox protein HAT3.1-like [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|224060647|ref|XP_002300247.1| predicted protein [Populus trichocarpa] gi|222847505|gb|EEE85052.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|255573075|ref|XP_002527467.1| Homeobox protein HAT3.1, putative [Ricinus communis] gi|223533107|gb|EEF34865.1| Homeobox protein HAT3.1, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|356574291|ref|XP_003555282.1| PREDICTED: homeobox protein HAT3.1-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|356534303|ref|XP_003535696.1| PREDICTED: uncharacterized protein LOC100306715 [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|449501740|ref|XP_004161446.1| PREDICTED: homeobox protein HAT3.1-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|449446105|ref|XP_004140812.1| PREDICTED: uncharacterized protein LOC101204775 [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|147822101|emb|CAN68079.1| hypothetical protein VITISV_006312 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|16326|emb|CAA49263.1| HAT 3.1 [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 1063 | ||||||
| TAIR|locus:2090694 | 723 | HAT3.1 [Arabidopsis thaliana ( | 0.263 | 0.387 | 0.548 | 3.1e-108 | |
| TAIR|locus:2005538 | 796 | PRHA "pathogenesis related hom | 0.169 | 0.226 | 0.480 | 1.6e-53 | |
| RGD|1311245 | 1444 | Rsf1 "remodeling and spacing f | 0.064 | 0.047 | 0.421 | 1e-11 | |
| ZFIN|ZDB-GENE-091204-206 | 1369 | si:dkey-21n12.3 "si:dkey-21n12 | 0.067 | 0.052 | 0.4 | 2.1e-07 | |
| MGI|MGI:2444959 | 4903 | Mll3 "myeloid/lymphoid or mixe | 0.306 | 0.066 | 0.263 | 1e-06 | |
| UNIPROTKB|F1P8R2 | 1434 | RSF1 "Uncharacterized protein" | 0.108 | 0.080 | 0.333 | 1.6e-06 | |
| UNIPROTKB|H0YDG9 | 276 | RSF1 "Remodeling and spacing f | 0.055 | 0.213 | 0.454 | 1.8e-06 | |
| UNIPROTKB|J9P712 | 1626 | PHRF1 "Uncharacterized protein | 0.050 | 0.033 | 0.419 | 1.9e-06 | |
| UNIPROTKB|F1PXY6 | 1637 | PHRF1 "Uncharacterized protein | 0.050 | 0.032 | 0.419 | 1.9e-06 | |
| UNIPROTKB|I3LU11 | 1643 | PHRF1 "Uncharacterized protein | 0.050 | 0.032 | 0.435 | 2e-06 |
| TAIR|locus:2090694 HAT3.1 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 776 (278.2 bits), Expect = 3.1e-108, Sum P(3) = 3.1e-108
Identities = 163/297 (54%), Positives = 197/297 (66%)
Query: 317 KQPEVPITIPSTKTSATKHLQSSSDLMEKKSCLEQSETPPNYVANNSAC-LGRKGKRATK 375
+Q P T+ + TK S +L+ C Q E A+ S+ LG G+R
Sbjct: 71 EQKPTPQTVKKDSNTNTKFSGSHRELVIGLPCRGQFEIHNRSRASTSSKRLGGGGER--- 127
Query: 376 SLKNNYTVRSLIGSDRVLRSRSGERPIPPESSINLADVNSIGEXXXXXXXXXXXXXIVAD 435
N S R RS+ P SS+ +A+ +G D
Sbjct: 128 ----NVLFAS---HKRAQRSKEDAGP----SSV-VANSTPVGRPKKKNKTMNKGQVREDD 175
Query: 436 EYSRIRTHLRYLLNRINYEQNLIDAYSSEGWKGLSVEKLKPEKELQRATSEILRRKLKIR 495
EY+RI+ LRY LNRINYEQ+LIDAYS EGWKG S+EK++PEKEL+RAT EILRRKLKIR
Sbjct: 176 EYTRIKKKLRYFLNRINYEQSLIDAYSLEGWKGSSLEKIRPEKELERATKEILRRKLKIR 235
Query: 496 DLFQRLDSLCA-GGFPKSLFDSEGQIDSEDIYCAKCGSKDLSADNDIILCDGACDRGFHQ 554
DLFQ LD+LCA G P+SLFD++G+I SEDI+CAKCGSKDLS DNDIILCDG CDRGFHQ
Sbjct: 236 DLFQHLDTLCAEGSLPESLFDTDGEISSEDIFCAKCGSKDLSVDNDIILCDGFCDRGFHQ 295
Query: 555 YCLEPPLLKEDIPPDDEGWLCPGCDCKVDCIDLVNELQGTRLFITDNWEKVFPEAAA 611
YCLEPPL KEDIPPDDEGWLCPGCDCK D +DL+N+ GT+ ++D+WEK+FPEAAA
Sbjct: 296 YCLEPPLRKEDIPPDDEGWLCPGCDCKDDSLDLLNDSLGTKFSVSDSWEKIFPEAAA 352
|
|
| TAIR|locus:2005538 PRHA "pathogenesis related homeodomain protein A" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| RGD|1311245 Rsf1 "remodeling and spacing factor 1" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-091204-206 si:dkey-21n12.3 "si:dkey-21n12.3" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:2444959 Mll3 "myeloid/lymphoid or mixed-lineage leukemia 3" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1P8R2 RSF1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|H0YDG9 RSF1 "Remodeling and spacing factor 1" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|J9P712 PHRF1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1PXY6 PHRF1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|I3LU11 PHRF1 "Uncharacterized protein" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
Fail to connect to STRING server
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 1063 | |||
| cd00086 | 59 | cd00086, homeodomain, Homeodomain; DNA binding dom | 3e-14 | |
| pfam00628 | 51 | pfam00628, PHD, PHD-finger | 5e-14 | |
| smart00389 | 57 | smart00389, HOX, Homeodomain | 2e-13 | |
| pfam00046 | 57 | pfam00046, Homeobox, Homeobox domain | 7e-11 | |
| smart00249 | 47 | smart00249, PHD, PHD zinc finger | 7e-10 | |
| COG4547 | 620 | COG4547, CobT, Cobalamin biosynthesis protein CobT | 2e-04 | |
| pfam05920 | 40 | pfam05920, Homeobox_KN, Homeobox KN domain | 5e-04 | |
| COG5576 | 156 | COG5576, COG5576, Homeodomain-containing transcrip | 6e-04 | |
| pfam04147 | 809 | pfam04147, Nop14, Nop14-like family | 0.002 | |
| PTZ00482 | 844 | PTZ00482, PTZ00482, membrane-attack complex/perfor | 0.003 |
| >gnl|CDD|238039 cd00086, homeodomain, Homeodomain; DNA binding domains involved in the transcriptional regulation of key eukaryotic developmental processes; may bind to DNA as monomers or as homo- and/or heterodimers, in a sequence-specific manner | Back alignment and domain information |
|---|
Score = 67.7 bits (166), Expect = 3e-14
Identities = 26/55 (47%), Positives = 35/55 (63%), Gaps = 3/55 (5%)
Query: 884 RRHRTSYRKLGEEVTQKLYNSFKENQYPNRTTKESLAKELGLTFSQVRKWFENTR 938
RR RT + E ++L F++N YP+R +E LAKELGLT QV+ WF+N R
Sbjct: 1 RRKRTRFTP---EQLEELEKEFEKNPYPSREEREELAKELGLTERQVKIWFQNRR 52
|
Length = 59 |
| >gnl|CDD|201356 pfam00628, PHD, PHD-finger | Back alignment and domain information |
|---|
| >gnl|CDD|197696 smart00389, HOX, Homeodomain | Back alignment and domain information |
|---|
| >gnl|CDD|200956 pfam00046, Homeobox, Homeobox domain | Back alignment and domain information |
|---|
| >gnl|CDD|214584 smart00249, PHD, PHD zinc finger | Back alignment and domain information |
|---|
| >gnl|CDD|226920 COG4547, CobT, Cobalamin biosynthesis protein CobT (nicotinate-mononucleotide:5, 6-dimethylbenzimidazole phosphoribosyltransferase) [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|203350 pfam05920, Homeobox_KN, Homeobox KN domain | Back alignment and domain information |
|---|
| >gnl|CDD|227863 COG5576, COG5576, Homeodomain-containing transcription factor [Transcription] | Back alignment and domain information |
|---|
| >gnl|CDD|217927 pfam04147, Nop14, Nop14-like family | Back alignment and domain information |
|---|
| >gnl|CDD|240433 PTZ00482, PTZ00482, membrane-attack complex/perforin (MACPF) Superfamily; Provisional | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 1063 | |||
| KOG4299 | 613 | consensus PHD Zn-finger protein [General function | 99.87 | |
| KOG0489 | 261 | consensus Transcription factor zerknullt and relat | 99.51 | |
| KOG0842 | 307 | consensus Transcription factor tinman/NKX2-3, cont | 99.49 | |
| KOG0484 | 125 | consensus Transcription factor PHOX2/ARIX, contain | 99.49 | |
| KOG0488 | 309 | consensus Transcription factor BarH and related HO | 99.46 | |
| KOG2251 | 228 | consensus Homeobox transcription factor [Transcrip | 99.43 | |
| KOG0487 | 308 | consensus Transcription factor Abd-B, contains HOX | 99.39 | |
| KOG0843 | 197 | consensus Transcription factor EMX1 and related HO | 99.39 | |
| KOG0850 | 245 | consensus Transcription factor DLX and related pro | 99.38 | |
| KOG0485 | 268 | consensus Transcription factor NKX-5.1/HMX1, conta | 99.32 | |
| KOG0494 | 332 | consensus Transcription factor CHX10 and related H | 99.28 | |
| KOG0492 | 246 | consensus Transcription factor MSH, contains HOX d | 99.23 | |
| PF00046 | 57 | Homeobox: Homeobox domain not present here.; Inter | 99.22 | |
| KOG0848 | 317 | consensus Transcription factor Caudal, contains HO | 99.19 | |
| KOG0486 | 351 | consensus Transcription factor PTX1, contains HOX | 99.16 | |
| KOG0493 | 342 | consensus Transcription factor Engrailed, contains | 99.12 | |
| smart00389 | 56 | HOX Homeodomain. DNA-binding factors that are invo | 99.08 | |
| KOG0844 | 408 | consensus Transcription factor EVX1, contains HOX | 99.06 | |
| TIGR01565 | 58 | homeo_ZF_HD homeobox domain, ZF-HD class. This mod | 99.05 | |
| cd00086 | 59 | homeodomain Homeodomain; DNA binding domains invol | 99.04 | |
| KOG0491 | 194 | consensus Transcription factor BSH, contains HOX d | 99.0 | |
| KOG0483 | 198 | consensus Transcription factor HEX, contains HOX a | 99.0 | |
| KOG4577 | 383 | consensus Transcription factor LIM3, contains LIM | 98.92 | |
| COG5576 | 156 | Homeodomain-containing transcription factor [Trans | 98.9 | |
| KOG0847 | 288 | consensus Transcription factor, contains HOX domai | 98.86 | |
| KOG0490 | 235 | consensus Transcription factor, contains HOX domai | 98.8 | |
| KOG3802 | 398 | consensus Transcription factor OCT-1, contains POU | 98.8 | |
| KOG1244 | 336 | consensus Predicted transcription factor Requiem/N | 98.76 | |
| KOG0825 | 1134 | consensus PHD Zn-finger protein [General function | 98.56 | |
| PF00628 | 51 | PHD: PHD-finger; InterPro: IPR019787 Zinc finger ( | 98.56 | |
| KOG0849 | 354 | consensus Transcription factor PRD and related pro | 98.49 | |
| KOG1245 | 1404 | consensus Chromatin remodeling complex WSTF-ISWI, | 98.48 | |
| KOG0775 | 304 | consensus Transcription factor SIX and related HOX | 98.26 | |
| KOG0955 | 1051 | consensus PHD finger protein BR140/LIN-49 [General | 98.12 | |
| KOG1168 | 385 | consensus Transcription factor ACJ6/BRN-3, contain | 98.1 | |
| smart00249 | 47 | PHD PHD zinc finger. The plant homeodomain (PHD) f | 98.03 | |
| cd04718 | 148 | BAH_plant_2 BAH, or Bromo Adjacent Homology domain | 98.02 | |
| KOG0774 | 334 | consensus Transcription factor PBX and related HOX | 97.99 | |
| KOG4323 | 464 | consensus Polycomb-like PHD Zn-finger protein [Gen | 97.96 | |
| COG5141 | 669 | PHD zinc finger-containing protein [General functi | 97.76 | |
| KOG0954 | 893 | consensus PHD finger protein [General function pre | 97.76 | |
| KOG1512 | 381 | consensus PHD Zn-finger protein [General function | 97.74 | |
| KOG1973 | 274 | consensus Chromatin remodeling protein, contains P | 97.6 | |
| KOG4443 | 694 | consensus Putative transcription factor HALR/MLL3, | 97.53 | |
| KOG0383 | 696 | consensus Predicted helicase [General function pre | 97.52 | |
| KOG0956 | 900 | consensus PHD finger protein AF10 [General functio | 97.51 | |
| KOG0957 | 707 | consensus PHD finger protein [General function pre | 97.46 | |
| PF05920 | 40 | Homeobox_KN: Homeobox KN domain; InterPro: IPR0084 | 97.43 | |
| COG5034 | 271 | TNG2 Chromatin remodeling protein, contains PhD zi | 97.41 | |
| KOG2252 | 558 | consensus CCAAT displacement protein and related h | 97.2 | |
| KOG0490 | 235 | consensus Transcription factor, contains HOX domai | 97.16 | |
| KOG1832 | 1516 | consensus HIV-1 Vpr-binding protein [Cell cycle co | 96.82 | |
| KOG1146 | 1406 | consensus Homeobox protein [General function predi | 96.18 | |
| PF13831 | 36 | PHD_2: PHD-finger; PDB: 2L43_A 2KU3_A. | 95.5 | |
| KOG1473 | 1414 | consensus Nucleosome remodeling factor, subunit NU | 94.96 | |
| KOG1832 | 1516 | consensus HIV-1 Vpr-binding protein [Cell cycle co | 94.01 | |
| PF15446 | 175 | zf-PHD-like: PHD/FYVE-zinc-finger like domain | 93.42 | |
| PF10446 | 458 | DUF2457: Protein of unknown function (DUF2457); In | 92.52 | |
| PF10446 | 458 | DUF2457: Protein of unknown function (DUF2457); In | 92.27 | |
| KOG3623 | 1007 | consensus Homeobox transcription factor SIP1 [Tran | 91.74 | |
| PF04931 | 784 | DNA_pol_phi: DNA polymerase phi; InterPro: IPR0070 | 91.09 | |
| KOG0957 | 707 | consensus PHD finger protein [General function pre | 91.08 | |
| KOG0773 | 342 | consensus Transcription factor MEIS1 and related H | 90.64 | |
| PF11569 | 56 | Homez: Homeodomain leucine-zipper encoding, Homez; | 88.07 | |
| KOG1246 | 904 | consensus DNA-binding protein jumonji/RBP2/SMCY, c | 86.19 | |
| KOG4443 | 694 | consensus Putative transcription factor HALR/MLL3, | 84.25 | |
| KOG4628 | 348 | consensus Predicted E3 ubiquitin ligase [Posttrans | 82.15 | |
| KOG4299 | 613 | consensus PHD Zn-finger protein [General function | 81.13 | |
| KOG1473 | 1414 | consensus Nucleosome remodeling factor, subunit NU | 80.31 |
| >KOG4299 consensus PHD Zn-finger protein [General function prediction only] | Back alignment and domain information |
|---|
Probab=99.87 E-value=6.6e-22 Score=229.16 Aligned_cols=197 Identities=39% Similarity=0.638 Sum_probs=167.6
Q ss_pred CchhhHHHHHHhHHHHHhhhhhhhhhHHHHhhcCcccccccc---------cCCHHHHHHHHHHHHHHHHHHHHHHHHHh
Q 001512 432 IVADEYSRIRTHLRYLLNRINYEQNLIDAYSSEGWKGLSVEK---------LKPEKELQRATSEILRRKLKIRDLFQRLD 502 (1063)
Q Consensus 432 ~~~de~~~~r~~vr~lL~k~k~EQ~~lday~~eGWk~~srEk---------~kPekEL~rak~eI~k~K~~ire~~~~L~ 502 (1063)
...++..+...+++|++..+...+.+++.|..+||++.+.++ +.+.+++.+...+|..++..++.+.+||+
T Consensus 149 ~~~p~~~r~~n~lk~~t~~~~~~~~li~~~s~e~~~a~~~~k~~~r~~~~~~~~~~~sn~tt~~i~~r~~~~~s~~~hl~ 228 (613)
T KOG4299|consen 149 AEVPDSFRDKNSLKYLTSLQNDVQELIDISSTEGWKASSDEKPPGRPFELLIRPAKESNVTTKEILNRKLTYRSLPRHLE 228 (613)
T ss_pred ccCCCcchhhhhhhhhhccccccccccchhcccccccCCcccCcccchhhhcCcchhhccchhhhhhhhhhhhhhhhhhh
Confidence 344556677789999999999999999999999999999999 99999999999999999999999999999
Q ss_pred hhhc-CCCCCCccCCCCCccccc--ccccccccccCCCCCceEEecCccCccccccccCCCCCCCCCCCCCCCccCCCCC
Q 001512 503 SLCA-GGFPKSLFDSEGQIDSED--IYCAKCGSKDLSADNDIILCDGACDRGFHQYCLEPPLLKEDIPPDDEGWLCPGCD 579 (1063)
Q Consensus 503 ~L~~-~~~~~S~~dsdG~~~~ed--~~C~vC~~~g~~~~~~lLlCDG~C~rafH~~CL~PPL~~e~iP~Gd~~WfC~~C~ 579 (1063)
.+.. +..+......++....++ +||..|++.+.. ++|||||| |+++|||+||+|||..+.||.|. |||+.|.
T Consensus 229 t~s~~~t~~e~r~~~D~~~~~~~~~~fCsaCn~~~~F--~~~i~CD~-Cp~sFH~~CLePPl~~eniP~g~--W~C~ec~ 303 (613)
T KOG4299|consen 229 TESKEGTVEEKRRERDKNISVEDIEDFCSACNGSGLF--NDIICCDG-CPRSFHQTCLEPPLEPENIPPGS--WFCPECK 303 (613)
T ss_pred hhhhhccchhhhhhhccccccCCHHHHHHHhCCcccc--ccceeecC-CchHHHHhhcCCCCCcccCCCCc--cccCCCe
Confidence 9888 666666666666655554 499999999966 88899995 99999999999999999999998 9999999
Q ss_pred cccchhHHHH--------hhcCcccc--cc--ccccccCccccc---CCCCCCCCCCCCCCCCCCCCCC
Q 001512 580 CKVDCIDLVN--------ELQGTRLF--IT--DNWEKVFPEAAA---GHNQDPNFGLASDDSDDNEYDP 633 (1063)
Q Consensus 580 ~K~~~~~~ln--------~~~~t~~~--l~--~~~edvF~E~a~---G~~~d~e~d~~sDDseDED~dp 633 (1063)
++..+....+ -...+.|. +. ..|+.+||+... |.-.....++.+|+.++.+|++
T Consensus 304 ~k~~in~~~~t~~~~~~~~~i~t~~~~~IDs~np~q~~lPe~i~~~~~~v~~g~~~~~sd~~~~~pl~~ 372 (613)
T KOG4299|consen 304 IKSVINPKMETLSNRGTVVDIFTQFVSKIDSHNPIQKILPENISESFGGVSRGDDGQYSDTQDEKPLDP 372 (613)
T ss_pred eeeecccchhhhhhccchHHHHHHHHHhhhccchhhhhCCHHHHhhccccccCCCCccccccCCcCCCh
Confidence 9999887776 44444444 44 448999998876 4444777789999999999999
|
|
| >KOG0489 consensus Transcription factor zerknullt and related HOX domain proteins [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0842 consensus Transcription factor tinman/NKX2-3, contains HOX domain [Transcription] | Back alignment and domain information |
|---|
| >KOG0484 consensus Transcription factor PHOX2/ARIX, contains HOX domain [Transcription] | Back alignment and domain information |
|---|
| >KOG0488 consensus Transcription factor BarH and related HOX domain proteins [General function prediction only] | Back alignment and domain information |
|---|
| >KOG2251 consensus Homeobox transcription factor [Transcription] | Back alignment and domain information |
|---|
| >KOG0487 consensus Transcription factor Abd-B, contains HOX domain [Transcription] | Back alignment and domain information |
|---|
| >KOG0843 consensus Transcription factor EMX1 and related HOX domain proteins [Transcription] | Back alignment and domain information |
|---|
| >KOG0850 consensus Transcription factor DLX and related proteins with LIM Zn-binding and HOX domains [Transcription] | Back alignment and domain information |
|---|
| >KOG0485 consensus Transcription factor NKX-5 | Back alignment and domain information |
|---|
| >KOG0494 consensus Transcription factor CHX10 and related HOX domain proteins [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0492 consensus Transcription factor MSH, contains HOX domain [General function prediction only] | Back alignment and domain information |
|---|
| >PF00046 Homeobox: Homeobox domain not present here | Back alignment and domain information |
|---|
| >KOG0848 consensus Transcription factor Caudal, contains HOX domain [Transcription] | Back alignment and domain information |
|---|
| >KOG0486 consensus Transcription factor PTX1, contains HOX domain [Transcription] | Back alignment and domain information |
|---|
| >KOG0493 consensus Transcription factor Engrailed, contains HOX domain [General function prediction only] | Back alignment and domain information |
|---|
| >smart00389 HOX Homeodomain | Back alignment and domain information |
|---|
| >KOG0844 consensus Transcription factor EVX1, contains HOX domain [Transcription] | Back alignment and domain information |
|---|
| >TIGR01565 homeo_ZF_HD homeobox domain, ZF-HD class | Back alignment and domain information |
|---|
| >cd00086 homeodomain Homeodomain; DNA binding domains involved in the transcriptional regulation of key eukaryotic developmental processes; may bind to DNA as monomers or as homo- and/or heterodimers, in a sequence-specific manner | Back alignment and domain information |
|---|
| >KOG0491 consensus Transcription factor BSH, contains HOX domain [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0483 consensus Transcription factor HEX, contains HOX and HALZ domains [Transcription] | Back alignment and domain information |
|---|
| >KOG4577 consensus Transcription factor LIM3, contains LIM and HOX domains [Transcription] | Back alignment and domain information |
|---|
| >COG5576 Homeodomain-containing transcription factor [Transcription] | Back alignment and domain information |
|---|
| >KOG0847 consensus Transcription factor, contains HOX domain [Transcription] | Back alignment and domain information |
|---|
| >KOG0490 consensus Transcription factor, contains HOX domain [General function prediction only] | Back alignment and domain information |
|---|
| >KOG3802 consensus Transcription factor OCT-1, contains POU and HOX domains [Transcription] | Back alignment and domain information |
|---|
| >KOG1244 consensus Predicted transcription factor Requiem/NEURO-D4 [Transcription] | Back alignment and domain information |
|---|
| >KOG0825 consensus PHD Zn-finger protein [General function prediction only] | Back alignment and domain information |
|---|
| >PF00628 PHD: PHD-finger; InterPro: IPR019787 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule | Back alignment and domain information |
|---|
| >KOG0849 consensus Transcription factor PRD and related proteins, contain PAX and HOX domains [Transcription] | Back alignment and domain information |
|---|
| >KOG1245 consensus Chromatin remodeling complex WSTF-ISWI, large subunit (contains heterochromatin localization, PHD and BROMO domains) [Chromatin structure and dynamics] | Back alignment and domain information |
|---|
| >KOG0775 consensus Transcription factor SIX and related HOX domain proteins [Transcription] | Back alignment and domain information |
|---|
| >KOG0955 consensus PHD finger protein BR140/LIN-49 [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1168 consensus Transcription factor ACJ6/BRN-3, contains POU and HOX domains [Transcription] | Back alignment and domain information |
|---|
| >smart00249 PHD PHD zinc finger | Back alignment and domain information |
|---|
| >cd04718 BAH_plant_2 BAH, or Bromo Adjacent Homology domain, plant-specific sub-family with unknown function | Back alignment and domain information |
|---|
| >KOG0774 consensus Transcription factor PBX and related HOX domain proteins [Transcription] | Back alignment and domain information |
|---|
| >KOG4323 consensus Polycomb-like PHD Zn-finger protein [General function prediction only] | Back alignment and domain information |
|---|
| >COG5141 PHD zinc finger-containing protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0954 consensus PHD finger protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1512 consensus PHD Zn-finger protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1973 consensus Chromatin remodeling protein, contains PHD Zn-finger [Chromatin structure and dynamics] | Back alignment and domain information |
|---|
| >KOG4443 consensus Putative transcription factor HALR/MLL3, involved in embryonic development [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0383 consensus Predicted helicase [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0956 consensus PHD finger protein AF10 [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0957 consensus PHD finger protein [General function prediction only] | Back alignment and domain information |
|---|
| >PF05920 Homeobox_KN: Homeobox KN domain; InterPro: IPR008422 This entry represents a homeobox transcription factor KN domain conserved from fungi to human and plants [] | Back alignment and domain information |
|---|
| >COG5034 TNG2 Chromatin remodeling protein, contains PhD zinc finger [Chromatin structure and dynamics] | Back alignment and domain information |
|---|
| >KOG2252 consensus CCAAT displacement protein and related homeoproteins [Transcription] | Back alignment and domain information |
|---|
| >KOG0490 consensus Transcription factor, contains HOX domain [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1832 consensus HIV-1 Vpr-binding protein [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >KOG1146 consensus Homeobox protein [General function prediction only] | Back alignment and domain information |
|---|
| >PF13831 PHD_2: PHD-finger; PDB: 2L43_A 2KU3_A | Back alignment and domain information |
|---|
| >KOG1473 consensus Nucleosome remodeling factor, subunit NURF301/BPTF [Chromatin structure and dynamics; Transcription] | Back alignment and domain information |
|---|
| >KOG1832 consensus HIV-1 Vpr-binding protein [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >PF15446 zf-PHD-like: PHD/FYVE-zinc-finger like domain | Back alignment and domain information |
|---|
| >PF10446 DUF2457: Protein of unknown function (DUF2457); InterPro: IPR018853 This entry represents a family of uncharacterised proteins | Back alignment and domain information |
|---|
| >PF10446 DUF2457: Protein of unknown function (DUF2457); InterPro: IPR018853 This entry represents a family of uncharacterised proteins | Back alignment and domain information |
|---|
| >KOG3623 consensus Homeobox transcription factor SIP1 [Transcription] | Back alignment and domain information |
|---|
| >PF04931 DNA_pol_phi: DNA polymerase phi; InterPro: IPR007015 Proteins of this family are predominantly nucleolar | Back alignment and domain information |
|---|
| >KOG0957 consensus PHD finger protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0773 consensus Transcription factor MEIS1 and related HOX domain proteins [Transcription] | Back alignment and domain information |
|---|
| >PF11569 Homez: Homeodomain leucine-zipper encoding, Homez; PDB: 2YS9_A | Back alignment and domain information |
|---|
| >KOG1246 consensus DNA-binding protein jumonji/RBP2/SMCY, contains JmjC domain [General function prediction only] | Back alignment and domain information |
|---|
| >KOG4443 consensus Putative transcription factor HALR/MLL3, involved in embryonic development [General function prediction only] | Back alignment and domain information |
|---|
| >KOG4628 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG4299 consensus PHD Zn-finger protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1473 consensus Nucleosome remodeling factor, subunit NURF301/BPTF [Chromatin structure and dynamics; Transcription] | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 1063 | ||||
| 2dmu_A | 70 | Solution Structure Of The Homeobox Domain Of Homeob | 2e-05 | ||
| 1puf_B | 73 | Crystal Structure Of Hoxa9 And Pbx1 Homeodomains Bo | 2e-05 | ||
| 1b72_B | 87 | Pbx1, Homeobox Protein Hox-B1DNA TERNARY COMPLEX Le | 2e-05 | ||
| 1lfu_P | 82 | Nmr Solution Stucture Of The Extended Pbx Homeodoma | 3e-05 | ||
| 3a01_B | 67 | Crystal Structure Of Aristaless And Clawless Homeod | 4e-04 | ||
| 1b8i_B | 63 | Structure Of The Homeotic UbxEXDDNA TERNARY COMPLEX | 4e-04 | ||
| 3ask_A | 226 | Structure Of Uhrf1 In Complex With Histone Tail Len | 9e-04 |
| >pdb|2DMU|A Chain A, Solution Structure Of The Homeobox Domain Of Homeobox Protein Goosecoid Length = 70 | Back alignment and structure |
|
| >pdb|1PUF|B Chain B, Crystal Structure Of Hoxa9 And Pbx1 Homeodomains Bound To Dna Length = 73 | Back alignment and structure |
| >pdb|1B72|B Chain B, Pbx1, Homeobox Protein Hox-B1DNA TERNARY COMPLEX Length = 87 | Back alignment and structure |
| >pdb|1LFU|P Chain P, Nmr Solution Stucture Of The Extended Pbx Homeodomain Bound To Dna Length = 82 | Back alignment and structure |
| >pdb|3A01|B Chain B, Crystal Structure Of Aristaless And Clawless Homeodomains Bo Length = 67 | Back alignment and structure |
| >pdb|1B8I|B Chain B, Structure Of The Homeotic UbxEXDDNA TERNARY COMPLEX Length = 63 | Back alignment and structure |
| >pdb|3ASK|A Chain A, Structure Of Uhrf1 In Complex With Histone Tail Length = 226 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 1063 | |||
| 1wev_A | 88 | Riken cDNA 1110020M19; structural genomics, PHD do | 3e-18 | |
| 2yt5_A | 66 | Metal-response element-binding transcription facto | 6e-18 | |
| 1fp0_A | 88 | KAP-1 corepressor; PHD domain, C3HC4 type zinc bin | 9e-15 | |
| 1mm2_A | 61 | MI2-beta; PHD, zinc finger, protein scaffold, DNA | 8e-14 | |
| 2puy_A | 60 | PHD finger protein 21A; PHD finger, histone CODE, | 8e-14 | |
| 2yql_A | 56 | PHD finger protein 21A; PHD domain, structural gen | 1e-13 | |
| 1f62_A | 51 | Transcription factor WSTF; Zn-finger; NMR {Homo sa | 2e-13 | |
| 2e6s_A | 77 | E3 ubiquitin-protein ligase UHRF2; PHD domain, str | 5e-13 | |
| 3asl_A | 70 | E3 ubiquitin-protein ligase UHRF1; histone reader | 7e-13 | |
| 2l5u_A | 61 | Chromodomain-helicase-DNA-binding protein 4; CHD4, | 1e-12 | |
| 2e6r_A | 92 | Jumonji/ARID domain-containing protein 1D; PHD dom | 1e-12 | |
| 2vpb_A | 65 | Hpygo1, pygopus homolog 1; gene regulation, WNT si | 2e-12 | |
| 2ku3_A | 71 | Bromodomain-containing protein 1; PHD finger, chro | 2e-12 | |
| 3shb_A | 77 | E3 ubiquitin-protein ligase UHRF1; unmodified hist | 2e-12 | |
| 2l43_A | 88 | N-teminal domain from histone H3.3, linker, PHD1 f | 9e-12 | |
| 1xwh_A | 66 | Autoimmune regulator; PHD domain, Zn binding domai | 2e-11 | |
| 2dn0_A | 76 | Zinc fingers and homeoboxes protein 3; triple home | 4e-11 | |
| 2kwj_A | 114 | Zinc finger protein DPF3; acetyl-lysine, transcrip | 5e-11 | |
| 3ask_A | 226 | E3 ubiquitin-protein ligase UHRF1; histone reader | 5e-11 | |
| 3nau_A | 66 | Zinc fingers and homeoboxes protein 2; ZHX2, corep | 7e-11 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 9e-11 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 1e-10 | |
| 3v43_A | 112 | Histone acetyltransferase KAT6A; MOZ, PHD finger, | 4e-10 | |
| 3v43_A | 112 | Histone acetyltransferase KAT6A; MOZ, PHD finger, | 5e-04 | |
| 2da3_A | 80 | Alpha-fetoprotein enhancer binding protein; homeob | 9e-10 | |
| 1akh_A | 61 | Protein (mating-type protein A-1); complex (TWO DN | 9e-10 | |
| 2ysm_A | 111 | Myeloid/lymphoid or mixed-lineage leukemia protein | 9e-10 | |
| 2ysm_A | 111 | Myeloid/lymphoid or mixed-lineage leukemia protein | 6e-09 | |
| 2da1_A | 70 | Alpha-fetoprotein enhancer binding protein; homeob | 1e-09 | |
| 2xb1_A | 105 | Pygopus homolog 2, B-cell CLL/lymphoma 9-like Pro; | 2e-09 | |
| 2d5v_A | 164 | Hepatocyte nuclear factor 6; transcription factor, | 2e-09 | |
| 1au7_A | 146 | Protein PIT-1, GHF-1; complex (DNA-binding protein | 3e-09 | |
| 2da2_A | 70 | Alpha-fetoprotein enhancer binding protein; homeob | 4e-09 | |
| 3ql9_A | 129 | Transcriptional regulator ATRX; zinc finger, trans | 1e-08 | |
| 1bw5_A | 66 | ISL-1HD, insulin gene enhancer protein ISL-1; DNA- | 3e-08 | |
| 2k16_A | 75 | Transcription initiation factor TFIID subunit 3; p | 3e-08 | |
| 1wi3_A | 71 | DNA-binding protein SATB2; homeodomain, helix-turn | 3e-08 | |
| 2ro1_A | 189 | Transcription intermediary factor 1-beta; KAP, TIF | 3e-08 | |
| 2xsd_C | 164 | POU domain, class 3, transcription factor 1; trans | 4e-08 | |
| 2dmq_A | 80 | LIM/homeobox protein LHX9; homeobox domain, three | 6e-08 | |
| 2da5_A | 75 | Zinc fingers and homeoboxes protein 3; homeobox do | 6e-08 | |
| 2k40_A | 67 | Homeobox expressed in ES cells 1; thermostable hom | 6e-08 | |
| 2lbm_A | 142 | Transcriptional regulator ATRX; metal binding prot | 9e-08 | |
| 1e3o_C | 160 | Octamer-binding transcription factor 1; transcript | 1e-07 | |
| 1x2n_A | 73 | Homeobox protein pknox1; homeobox domain, structur | 1e-07 | |
| 3d1n_I | 151 | POU domain, class 6, transcription factor 1; prote | 2e-07 | |
| 2dmt_A | 80 | Homeobox protein BARH-like 1; homeobox domain, thr | 2e-07 | |
| 2ecb_A | 89 | Zinc fingers and homeoboxes protein 1; homeobox do | 2e-07 | |
| 1du6_A | 64 | PBX1, homeobox protein PBX1; homeodomain, gene reg | 2e-07 | |
| 1b72_B | 87 | Protein (PBX1); homeodomain, DNA, complex, DNA-bin | 3e-07 | |
| 1puf_B | 73 | PRE-B-cell leukemia transcription factor-1; homeod | 6e-07 | |
| 1mnm_C | 87 | Protein (MAT alpha-2 transcriptional repressor); t | 7e-07 | |
| 1k61_A | 60 | Mating-type protein alpha-2; protein-DNA complex, | 8e-07 | |
| 2djn_A | 70 | Homeobox protein DLX-5; structural genomics, NPPSF | 8e-07 | |
| 2dmp_A | 89 | Zinc fingers and homeoboxes protein 2; homeobox do | 8e-07 | |
| 2e1o_A | 70 | Homeobox protein PRH; DNA binding protein, structu | 9e-07 | |
| 2dms_A | 80 | Homeobox protein OTX2; homeobox domain, three heli | 9e-07 | |
| 1yz8_P | 68 | Pituitary homeobox 2; DNA binding protein, transcr | 9e-07 | |
| 2lk2_A | 89 | Homeobox protein TGIF1; NESG, structural genomics, | 1e-06 | |
| 2dmu_A | 70 | Homeobox protein goosecoid; homeobox domain, three | 2e-06 | |
| 3a01_A | 93 | Homeodomain-containing protein; homeodomain, prote | 2e-06 | |
| 2cuf_A | 95 | FLJ21616 protein; homeobox domain, hepatocyte tran | 2e-06 | |
| 2dmn_A | 83 | Homeobox protein TGIF2LX; TGFB-induced factor 2-li | 3e-06 | |
| 1ic8_A | 194 | Hepatocyte nuclear factor 1-alpha; transcription r | 3e-06 | |
| 2ecc_A | 76 | Homeobox and leucine zipper protein homez; homeobo | 3e-06 | |
| 2hi3_A | 73 | Homeodomain-only protein; transcription; NMR {Mus | 3e-06 | |
| 3l1p_A | 155 | POU domain, class 5, transcription factor 1; POU, | 3e-06 | |
| 2hdd_A | 61 | Protein (engrailed homeodomain Q50K); DNA binding, | 3e-06 | |
| 3k2a_A | 67 | Homeobox protein MEIS2; homeobox domain, DNA-bindi | 4e-06 | |
| 3nar_A | 96 | ZHX1, zinc fingers and homeoboxes protein 1; corep | 5e-06 | |
| 2cue_A | 80 | Paired box protein PAX6; homeobox domain, transcri | 8e-06 | |
| 2kt0_A | 84 | Nanog, homeobox protein nanog; homeodomain, struct | 9e-06 | |
| 1le8_B | 83 | Mating-type protein alpha-2; matalpha2, isothermal | 1e-05 | |
| 3a1b_A | 159 | DNA (cytosine-5)-methyltransferase 3A, histone H3; | 1e-05 | |
| 1ig7_A | 58 | Homeotic protein MSX-1; helix-turn-helix, transcri | 2e-05 | |
| 3kqi_A | 75 | GRC5, PHD finger protein 2; metal-binding, zinc-fi | 2e-05 | |
| 3rkq_A | 58 | Homeobox protein NKX-2.5; helix-turn-helix, DNA bi | 2e-05 | |
| 2cra_A | 70 | Homeobox protein HOX-B13; DNA-binding, transcripti | 2e-05 | |
| 2vi6_A | 62 | Homeobox protein nanog; homeodomain, DNA-binding, | 2e-05 | |
| 1jgg_A | 60 | Segmentation protein EVEN-skipped; homeodomain, pr | 2e-05 | |
| 1nk2_P | 77 | Homeobox protein VND; homeodomain, DNA-binding pro | 2e-05 | |
| 3o36_A | 184 | Transcription intermediary factor 1-alpha; TRIM24, | 3e-05 | |
| 1fjl_A | 81 | Paired protein; DNA-binding protein, paired BOX, t | 3e-05 | |
| 1lfb_A | 99 | Liver transcription factor (LFB1); transcription r | 3e-05 | |
| 2l7z_A | 73 | Homeobox protein HOX-A13; gene regulation; NMR {Ho | 3e-05 | |
| 1b72_A | 97 | Protein (homeobox protein HOX-B1); homeodomain, DN | 3e-05 | |
| 2l9r_A | 69 | Homeobox protein NKX-3.1; structural genomics, nor | 4e-05 | |
| 1wep_A | 79 | PHF8; structural genomics, PHD domain, riken struc | 5e-05 | |
| 1uhs_A | 72 | HOP, homeodomain only protein; structural genomics | 5e-05 | |
| 1wem_A | 76 | Death associated transcription factor 1; structura | 7e-05 | |
| 1ftt_A | 68 | TTF-1 HD, thyroid transcription factor 1 homeodoma | 7e-05 | |
| 1x4i_A | 70 | Inhibitor of growth protein 3; structural genomics | 1e-04 | |
| 3a02_A | 60 | Homeobox protein aristaless; homeodomain, developm | 1e-04 | |
| 1puf_A | 77 | HOX-1.7, homeobox protein HOX-A9; homeodomian, pro | 1e-04 | |
| 3a03_A | 56 | T-cell leukemia homeobox protein 2; homeodomain, d | 2e-04 | |
| 2cqx_A | 72 | LAG1 longevity assurance homolog 5; homeodomain, D | 2e-04 | |
| 2pv0_B | 386 | DNA (cytosine-5)-methyltransferase 3-like; DNMT3L, | 2e-04 | |
| 1we9_A | 64 | PHD finger family protein; structural genomics, PH | 2e-04 | |
| 3u5n_A | 207 | E3 ubiquitin-protein ligase TRIM33; TRIM33, PHD, b | 2e-04 | |
| 2ri7_A | 174 | Nucleosome-remodeling factor subunit BPTF; zinc fi | 2e-04 | |
| 2h1k_A | 63 | IPF-1, pancreatic and duodenal homeobox 1, homeodo | 3e-04 | |
| 2r5y_A | 88 | Homeotic protein sex combs reduced; homeodomain; H | 3e-04 | |
| 1zq3_P | 68 | PRD-4, homeotic bicoid protein; protein-DNA comple | 4e-04 | |
| 1b8i_A | 81 | Ultrabithorax, protein (ultrabithorax homeotic pro | 4e-04 | |
| 2kgg_A | 52 | Histone demethylase jarid1A; PHD finger, histone m | 6e-04 | |
| 3c6w_A | 59 | P28ING5, inhibitor of growth protein 5; chromatin, | 6e-04 |
| >1wev_A Riken cDNA 1110020M19; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, gene regulation; NMR {Mus musculus} SCOP: g.50.1.2 Length = 88 | Back alignment and structure |
|---|
Score = 79.7 bits (196), Expect = 3e-18
Identities = 12/67 (17%), Positives = 27/67 (40%), Gaps = 1/67 (1%)
Query: 515 DSEGQIDSEDIYCAKCGSKDLSADNDIILCDGACDRGFHQYCLEPPLLKEDIPPDDEGWL 574
++ + C C +++ N ++ C C +HQ C +P + +++ W
Sbjct: 7 GADDFAMEMGLACVVCRQMTVASGNQLVECQE-CHNLYHQDCHKPQVTDKEVNDPRLVWY 65
Query: 575 CPGCDCK 581
C C +
Sbjct: 66 CARCTRQ 72
|
| >2yt5_A Metal-response element-binding transcription factor 2; zinc-regulated factor 1, ZIRF1, metal-response element DNA-binding protein M96; NMR {Mus musculus} Length = 66 | Back alignment and structure |
|---|
| >1fp0_A KAP-1 corepressor; PHD domain, C3HC4 type zinc binding domain, -structure, transcription; NMR {Homo sapiens} SCOP: g.50.1.2 Length = 88 | Back alignment and structure |
|---|
| >1mm2_A MI2-beta; PHD, zinc finger, protein scaffold, DNA binding protein; NMR {Homo sapiens} SCOP: g.50.1.2 PDB: 2l75_A* 1mm3_A Length = 61 | Back alignment and structure |
|---|
| >2puy_A PHD finger protein 21A; PHD finger, histone CODE, BRAF-HDAC complex, transcription; 1.43A {Homo sapiens} Length = 60 | Back alignment and structure |
|---|
| >2yql_A PHD finger protein 21A; PHD domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 56 | Back alignment and structure |
|---|
| >1f62_A Transcription factor WSTF; Zn-finger; NMR {Homo sapiens} SCOP: g.50.1.2 Length = 51 | Back alignment and structure |
|---|
| >2e6s_A E3 ubiquitin-protein ligase UHRF2; PHD domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 77 | Back alignment and structure |
|---|
| >3asl_A E3 ubiquitin-protein ligase UHRF1; histone reader module, epigenetic regulation, LI binding protein complex; 1.41A {Homo sapiens} PDB: 3sou_A 3sow_A* 3sox_A 3zvy_A 2lgg_A 2lgk_A* 2lgl_A 3t6r_A 3zvz_B Length = 70 | Back alignment and structure |
|---|
| >2l5u_A Chromodomain-helicase-DNA-binding protein 4; CHD4, MI2B, MI2-beta, PHD, protein binding, peptide binding metal binding protein; NMR {Homo sapiens} Length = 61 | Back alignment and structure |
|---|
| >2e6r_A Jumonji/ARID domain-containing protein 1D; PHD domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 92 | Back alignment and structure |
|---|
| >2vpb_A Hpygo1, pygopus homolog 1; gene regulation, WNT signaling pathway, WNT signaling complex, chromosomal rearrangement, signaling protein; 1.59A {Homo sapiens} PDB: 2vpd_A 2yyr_A* 2dx8_A* 2vp7_A 2vpg_A* 2vpe_A* Length = 65 | Back alignment and structure |
|---|
| >2ku3_A Bromodomain-containing protein 1; PHD finger, chromatin regulator, metal-binding, finger, signaling protein; NMR {Homo sapiens} Length = 71 | Back alignment and structure |
|---|
| >3shb_A E3 ubiquitin-protein ligase UHRF1; unmodified histone, methylation, UHRF1, PHD, ligase-NUCL protein complex; 1.80A {Homo sapiens} Length = 77 | Back alignment and structure |
|---|
| >2l43_A N-teminal domain from histone H3.3, linker, PHD1 from bromodomain-containing protein...; PHD finger, histone CODE, transcription; NMR {Homo sapiens} Length = 88 | Back alignment and structure |
|---|
| >1xwh_A Autoimmune regulator; PHD domain, Zn binding domain, apeced, nucleosome, E3 ligase, transcription; NMR {Homo sapiens} PDB: 2ke1_A 2kft_A Length = 66 | Back alignment and structure |
|---|
| >2dn0_A Zinc fingers and homeoboxes protein 3; triple homeobox 1 protein, KIAA0395, TIX1, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 76 | Back alignment and structure |
|---|
| >2kwj_A Zinc finger protein DPF3; acetyl-lysine, transcription regulation, nucleus, metal BIND protein; HET: ALY; NMR {Homo sapiens} PDB: 2kwk_A 2kwn_A* 2kwo_A* Length = 114 | Back alignment and structure |
|---|
| >3ask_A E3 ubiquitin-protein ligase UHRF1; histone reader modules, epigenetic regulation, trimethylaion of lysine residue, ligase-DNA binding protein; HET: M3L; 2.90A {Homo sapiens} Length = 226 | Back alignment and structure |
|---|
| >3nau_A Zinc fingers and homeoboxes protein 2; ZHX2, corepressor, homeodomain, domain swapping, structural oxford protein production facility, OPPF; 2.70A {Homo sapiens} Length = 66 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >3v43_A Histone acetyltransferase KAT6A; MOZ, PHD finger, transferase-structural protein; 1.47A {Homo sapiens} PDB: 2ln0_A Length = 112 | Back alignment and structure |
|---|
| >3v43_A Histone acetyltransferase KAT6A; MOZ, PHD finger, transferase-structural protein; 1.47A {Homo sapiens} PDB: 2ln0_A Length = 112 | Back alignment and structure |
|---|
| >2da3_A Alpha-fetoprotein enhancer binding protein; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics; NMR {Homo sapiens} Length = 80 | Back alignment and structure |
|---|
| >1akh_A Protein (mating-type protein A-1); complex (TWO DNA-binding proteins/DNA), complex, DNA- binding protein, DNA; HET: DNA; 2.50A {Saccharomyces cerevisiae} SCOP: a.4.1.1 PDB: 1f43_A 1yrn_A* Length = 61 | Back alignment and structure |
|---|
| >2ysm_A Myeloid/lymphoid or mixed-lineage leukemia protein 3 homolog; PHD domain, histone-lysine N-methyltransferase, H3 lysine-4 specific MLL3; NMR {Homo sapiens} Length = 111 | Back alignment and structure |
|---|
| >2ysm_A Myeloid/lymphoid or mixed-lineage leukemia protein 3 homolog; PHD domain, histone-lysine N-methyltransferase, H3 lysine-4 specific MLL3; NMR {Homo sapiens} Length = 111 | Back alignment and structure |
|---|
| >2da1_A Alpha-fetoprotein enhancer binding protein; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics; NMR {Homo sapiens} Length = 70 | Back alignment and structure |
|---|
| >2xb1_A Pygopus homolog 2, B-cell CLL/lymphoma 9-like Pro; fusion protein, signal transduction, transcription, metal BI WNT proteins; 1.90A {Homo sapiens} Length = 105 | Back alignment and structure |
|---|
| >2d5v_A Hepatocyte nuclear factor 6; transcription factor, transcription-DNA complex; 2.00A {Rattus norvegicus} PDB: 1s7e_A Length = 164 | Back alignment and structure |
|---|
| >1au7_A Protein PIT-1, GHF-1; complex (DNA-binding protein/DNA), pituitary, CPHD, POU domain, transcription factor, transcription/DNA complex; HET: DNA; 2.30A {Rattus norvegicus} SCOP: a.4.1.1 a.35.1.1 Length = 146 | Back alignment and structure |
|---|
| >2da2_A Alpha-fetoprotein enhancer binding protein; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics; NMR {Homo sapiens} Length = 70 | Back alignment and structure |
|---|
| >3ql9_A Transcriptional regulator ATRX; zinc finger, transcription, lysine trimethylation, protein, histone-binding protein, transcription-structural complex; HET: M3L; 0.93A {Homo sapiens} PDB: 3qla_A* 3qlc_A 3qln_A 2jm1_A Length = 129 | Back alignment and structure |
|---|
| >1bw5_A ISL-1HD, insulin gene enhancer protein ISL-1; DNA-binding protein, homeodomain, LIM domain; NMR {Rattus norvegicus} SCOP: a.4.1.1 Length = 66 | Back alignment and structure |
|---|
| >2k16_A Transcription initiation factor TFIID subunit 3; protein, alternative splicing, metal-binding, nucleus, phosphoprotein, transcription regulation; NMR {Mus musculus} PDB: 2k17_A* Length = 75 | Back alignment and structure |
|---|
| >1wi3_A DNA-binding protein SATB2; homeodomain, helix-turn-helix, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 71 | Back alignment and structure |
|---|
| >2ro1_A Transcription intermediary factor 1-beta; KAP, TIF, PHD finger, bromodomain, SUMO, acetylation, alternative splicing, metal-binding, nucleus; NMR {Homo sapiens} Length = 189 | Back alignment and structure |
|---|
| >2xsd_C POU domain, class 3, transcription factor 1; transcription-DNA complex, SOX; 2.05A {Mus musculus} Length = 164 | Back alignment and structure |
|---|
| >2dmq_A LIM/homeobox protein LHX9; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 80 | Back alignment and structure |
|---|
| >2da5_A Zinc fingers and homeoboxes protein 3; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 75 | Back alignment and structure |
|---|
| >2k40_A Homeobox expressed in ES cells 1; thermostable homeodomain variant, DNA binding protein, developmental protein, disease mutation, DNA-binding; NMR {Homo sapiens} Length = 67 | Back alignment and structure |
|---|
| >2lbm_A Transcriptional regulator ATRX; metal binding protein-structural protein compl; HET: M3L; NMR {Homo sapiens} PDB: 2ld1_A Length = 142 | Back alignment and structure |
|---|
| >1e3o_C Octamer-binding transcription factor 1; transcription factor, POU domain, dimer, DNA binding; 1.9A {Homo sapiens} SCOP: a.4.1.1 a.35.1.1 PDB: 1gt0_C 1hf0_A* 1cqt_A* 1o4x_A 1oct_C* 1pou_A 1pog_A 1hdp_A Length = 160 | Back alignment and structure |
|---|
| >1x2n_A Homeobox protein pknox1; homeobox domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 73 | Back alignment and structure |
|---|
| >3d1n_I POU domain, class 6, transcription factor 1; protein-DNA complex, helix-turn-helix (HTH), DNA-binding, homeobox, nucleus, transcription regulation; 2.51A {Homo sapiens} Length = 151 | Back alignment and structure |
|---|
| >2dmt_A Homeobox protein BARH-like 1; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 80 | Back alignment and structure |
|---|
| >2ecb_A Zinc fingers and homeoboxes protein 1; homeobox domain, transcription factor, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 89 | Back alignment and structure |
|---|
| >1du6_A PBX1, homeobox protein PBX1; homeodomain, gene regulation; NMR {Mus musculus} SCOP: a.4.1.1 Length = 64 | Back alignment and structure |
|---|
| >1b72_B Protein (PBX1); homeodomain, DNA, complex, DNA-binding protein, protein/DNA complex; HET: DNA; 2.35A {Homo sapiens} SCOP: a.4.1.1 PDB: 1lfu_P Length = 87 | Back alignment and structure |
|---|
| >1puf_B PRE-B-cell leukemia transcription factor-1; homeodomian, protein-DNA complex, HOX hexapeptide, TALE homeodomain, homeodomain interaction; 1.90A {Homo sapiens} SCOP: a.4.1.1 PDB: 1b8i_B* 2r5y_B* 2r5z_B* Length = 73 | Back alignment and structure |
|---|
| >1mnm_C Protein (MAT alpha-2 transcriptional repressor); transcription regulation, transcriptional repression, DNA- binding protein; HET: DNA; 2.25A {Saccharomyces cerevisiae} SCOP: a.4.1.1 Length = 87 | Back alignment and structure |
|---|
| >1k61_A Mating-type protein alpha-2; protein-DNA complex, homeodomain, hoogsteen base PAIR, transcription/DNA complex; HET: 5IU; 2.10A {Synthetic} SCOP: a.4.1.1 Length = 60 | Back alignment and structure |
|---|
| >2djn_A Homeobox protein DLX-5; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 70 | Back alignment and structure |
|---|
| >2dmp_A Zinc fingers and homeoboxes protein 2; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 89 | Back alignment and structure |
|---|
| >2e1o_A Homeobox protein PRH; DNA binding protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 70 | Back alignment and structure |
|---|
| >2dms_A Homeobox protein OTX2; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Mus musculus} Length = 80 | Back alignment and structure |
|---|
| >1yz8_P Pituitary homeobox 2; DNA binding protein, transcription/DNA complex; NMR {Homo sapiens} SCOP: a.4.1.1 PDB: 2l7f_P 2lkx_A* 2l7m_P Length = 68 | Back alignment and structure |
|---|
| >2lk2_A Homeobox protein TGIF1; NESG, structural genomics, northeast structural genomics CON PSI-biology, transcription; NMR {Homo sapiens} Length = 89 | Back alignment and structure |
|---|
| >2dmu_A Homeobox protein goosecoid; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 70 | Back alignment and structure |
|---|
| >3a01_A Homeodomain-containing protein; homeodomain, protein-DNA complex, DNA-binding, homeobox, NUC developmental protein; 2.70A {Drosophila melanogaster} Length = 93 | Back alignment and structure |
|---|
| >2cuf_A FLJ21616 protein; homeobox domain, hepatocyte transcription factor, structural genomics, loop insertion, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 95 | Back alignment and structure |
|---|
| >2dmn_A Homeobox protein TGIF2LX; TGFB-induced factor 2-like protein, X-linked TGF(beta) induced transcription factor 2-like protein, TGIF-like on the X; NMR {Homo sapiens} Length = 83 | Back alignment and structure |
|---|
| >1ic8_A Hepatocyte nuclear factor 1-alpha; transcription regulation, DNA-binding, POU domain, diabetes, disease mutation, MODY3, transcription/DNA comple; 2.60A {Homo sapiens} SCOP: a.4.1.1 a.35.1.1 Length = 194 | Back alignment and structure |
|---|
| >2ecc_A Homeobox and leucine zipper protein homez; homeobox domain, transcription factor, leucine zipper- containing factor, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 76 | Back alignment and structure |
|---|
| >2hi3_A Homeodomain-only protein; transcription; NMR {Mus musculus} SCOP: a.4.1.1 Length = 73 | Back alignment and structure |
|---|
| >3l1p_A POU domain, class 5, transcription factor 1; POU, transcription factor DNA complex, pore, stem cells; HET: DNA; 2.80A {Mus musculus} PDB: 1ocp_A Length = 155 | Back alignment and structure |
|---|
| >2hdd_A Protein (engrailed homeodomain Q50K); DNA binding, complex (DNA binding protein/DNA), transcription/DNA complex; HET: DNA; 1.90A {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 1hdd_C* 2jwt_A 3hdd_A 1p7j_A* 1p7i_A* 2hos_A 2hot_A 1du0_A* 1ztr_A 1enh_A 2p81_A Length = 61 | Back alignment and structure |
|---|
| >3k2a_A Homeobox protein MEIS2; homeobox domain, DNA-binding, transcription, nucleus, phosphoprotein, DNA bindi protein; 1.95A {Homo sapiens} Length = 67 | Back alignment and structure |
|---|
| >3nar_A ZHX1, zinc fingers and homeoboxes protein 1; corepressor, homeodomain, structural genomics, oxford production facility, OPPF, transcription; 2.60A {Homo sapiens} Length = 96 | Back alignment and structure |
|---|
| >2cue_A Paired box protein PAX6; homeobox domain, transcription factor, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 80 | Back alignment and structure |
|---|
| >2kt0_A Nanog, homeobox protein nanog; homeodomain, structural genomics, protein structure initiative, PSI, center for eukaryotic structural genomics; NMR {Homo sapiens} Length = 84 | Back alignment and structure |
|---|
| >1le8_B Mating-type protein alpha-2; matalpha2, isothermal titration calorimetry, protein-DNA complex, transcription/DNA complex; 2.30A {Saccharomyces cerevisiae} SCOP: a.4.1.1 PDB: 1akh_B* 1apl_C* 1yrn_B* Length = 83 | Back alignment and structure |
|---|
| >3a1b_A DNA (cytosine-5)-methyltransferase 3A, histone H3; zinc-finger, histone binding, chromosomal protein, DNA damag repair, DNA-binding, methylation; HET: DNA; 2.29A {Homo sapiens} PDB: 3a1a_A* Length = 159 | Back alignment and structure |
|---|
| >1ig7_A Homeotic protein MSX-1; helix-turn-helix, transcription/DNA complex; 2.20A {Mus musculus} SCOP: a.4.1.1 Length = 58 | Back alignment and structure |
|---|
| >3kqi_A GRC5, PHD finger protein 2; metal-binding, zinc-finger, histone-binding, NUC protein; HET: M3L; 1.78A {Homo sapiens} Length = 75 | Back alignment and structure |
|---|
| >3rkq_A Homeobox protein NKX-2.5; helix-turn-helix, DNA binding, nucleus, transcription-DNA CO; 1.70A {Homo sapiens} Length = 58 | Back alignment and structure |
|---|
| >2cra_A Homeobox protein HOX-B13; DNA-binding, transcription regulation, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 70 | Back alignment and structure |
|---|
| >2vi6_A Homeobox protein nanog; homeodomain, DNA-binding, transcription, transcription facto developmental protein, transcription regulation, NUC homeobox; 2.6A {Mus musculus} Length = 62 | Back alignment and structure |
|---|
| >1jgg_A Segmentation protein EVEN-skipped; homeodomain, protein-DNA complex, transcription/DNA complex; 2.00A {Drosophila melanogaster} SCOP: a.4.1.1 Length = 60 | Back alignment and structure |
|---|
| >1nk2_P Homeobox protein VND; homeodomain, DNA-binding protein, embryonic development, complex (homeodomain/DNA); HET: DNA; NMR {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 1nk3_P* 1vnd_A 1qry_A Length = 77 | Back alignment and structure |
|---|
| >3o36_A Transcription intermediary factor 1-alpha; TRIM24, PHD finger, bromodomain, H4K16 acetylation, breast C transcription-protein binding complex; HET: ALY; 1.70A {Homo sapiens} PDB: 3o33_A* 3o34_A* 3o35_A* 3o37_A Length = 184 | Back alignment and structure |
|---|
| >1fjl_A Paired protein; DNA-binding protein, paired BOX, transcription regulation; HET: DNA; 2.00A {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 3a01_B Length = 81 | Back alignment and structure |
|---|
| >1lfb_A Liver transcription factor (LFB1); transcription regulation; 2.80A {Rattus norvegicus} SCOP: a.4.1.1 PDB: 2lfb_A Length = 99 | Back alignment and structure |
|---|
| >2l7z_A Homeobox protein HOX-A13; gene regulation; NMR {Homo sapiens} PDB: 2ld5_A* Length = 73 | Back alignment and structure |
|---|
| >1b72_A Protein (homeobox protein HOX-B1); homeodomain, DNA, complex, DNA-binding protein, protein/DNA complex; HET: DNA; 2.35A {Homo sapiens} SCOP: a.4.1.1 Length = 97 | Back alignment and structure |
|---|
| >2l9r_A Homeobox protein NKX-3.1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Length = 69 | Back alignment and structure |
|---|
| >1wep_A PHF8; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, DNA binding protein; NMR {Mus musculus} SCOP: g.50.1.2 Length = 79 | Back alignment and structure |
|---|
| >1uhs_A HOP, homeodomain only protein; structural genomics, cardiac development, riken structural genomics/proteomics initiative, RSGI, transcription; NMR {Mus musculus} SCOP: a.4.1.1 Length = 72 | Back alignment and structure |
|---|
| >1wem_A Death associated transcription factor 1; structural genomics, PHD domain, death inducer- obliterator 1(DIO-1); NMR {Mus musculus} SCOP: g.50.1.2 Length = 76 | Back alignment and structure |
|---|
| >1ftt_A TTF-1 HD, thyroid transcription factor 1 homeodomain; DNA binding protein; NMR {Rattus norvegicus} SCOP: a.4.1.1 Length = 68 | Back alignment and structure |
|---|
| >1x4i_A Inhibitor of growth protein 3; structural genomics, PHD domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 70 | Back alignment and structure |
|---|
| >3a02_A Homeobox protein aristaless; homeodomain, developmental protein, DNA-binding, N gene regulation; 1.00A {Drosophila melanogaster} PDB: 3lnq_A 3cmy_A Length = 60 | Back alignment and structure |
|---|
| >1puf_A HOX-1.7, homeobox protein HOX-A9; homeodomian, protein-DNA complex, HOX hexapeptide, TALE homeodomain, homeodomain interaction; 1.90A {Mus musculus} SCOP: a.4.1.1 PDB: 1san_A Length = 77 | Back alignment and structure |
|---|
| >3a03_A T-cell leukemia homeobox protein 2; homeodomain, developmental protein, DNA-binding, N gene regulation; 1.54A {Homo sapiens} Length = 56 | Back alignment and structure |
|---|
| >2cqx_A LAG1 longevity assurance homolog 5; homeodomain, DNA binding domain, transcription, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: a.4.1.1 Length = 72 | Back alignment and structure |
|---|
| >2pv0_B DNA (cytosine-5)-methyltransferase 3-like; DNMT3L, unmethylated H3K4, de novo DNA methylation, transferase regulator; HET: DNA; 3.30A {Homo sapiens} PDB: 2pvc_B* Length = 386 | Back alignment and structure |
|---|
| >1we9_A PHD finger family protein; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: g.50.1.2 Length = 64 | Back alignment and structure |
|---|
| >3u5n_A E3 ubiquitin-protein ligase TRIM33; TRIM33, PHD, bromodomain, TGF-beta, epigenetics, methylation, K9ME3, K14AC, transcription; HET: M3L ALY; 1.95A {Homo sapiens} PDB: 3u5m_A* 3u5o_A* 3u5p_A* Length = 207 | Back alignment and structure |
|---|
| >2ri7_A Nucleosome-remodeling factor subunit BPTF; zinc finger, alpha-helical bundle, dimethyl-lysine, bromodom chromatin regulator, metal-binding, nucleus; HET: MLY; 1.45A {Homo sapiens} PDB: 2fsa_A* 2f6n_A 2f6j_A* 3qzv_A* 3uv2_A* 3qzt_A* 3qzs_A* 2fui_A 2fuu_A* Length = 174 | Back alignment and structure |
|---|
| >2h1k_A IPF-1, pancreatic and duodenal homeobox 1, homeodomain; protein-DNA complex, transcription/DNA complex; 2.42A {Mesocricetus auratus} Length = 63 | Back alignment and structure |
|---|
| >2r5y_A Homeotic protein sex combs reduced; homeodomain; HET: DNA; 2.60A {Drosophila melanogaster} PDB: 2r5z_A* Length = 88 | Back alignment and structure |
|---|
| >1zq3_P PRD-4, homeotic bicoid protein; protein-DNA complex, double helix, helix-turn-helix; NMR {Drosophila melanogaster} SCOP: a.4.1.1 Length = 68 | Back alignment and structure |
|---|
| >1b8i_A Ultrabithorax, protein (ultrabithorax homeotic protein IV); DNA binding, homeodomain, homeotic proteins, development, specificity; HET: DNA; 2.40A {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 9ant_A* Length = 81 | Back alignment and structure |
|---|
| >2kgg_A Histone demethylase jarid1A; PHD finger, histone modification, leukemia, alternative splicing, chromatin regulator, developmental protein; NMR {Homo sapiens} PDB: 2kgi_A* 3gl6_A* Length = 52 | Back alignment and structure |
|---|
| >3c6w_A P28ING5, inhibitor of growth protein 5; chromatin, PHD, ING, epigenetics, alternative splicing, metal-binding, phosphoprotein, zinc; HET: M3L; 1.75A {Homo sapiens} PDB: 2pnx_A* Length = 59 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
No hit with probability above 80.00
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 1063 | ||||
| d1fp0a1 | 70 | g.50.1.2 (A:19-88) Nuclear corepressor KAP-1 (TIF- | 5e-14 | |
| d1weva_ | 88 | g.50.1.2 (A:) PHD finger protein 22 {Mouse (Mus mu | 2e-13 | |
| d2cuea1 | 68 | a.4.1.1 (A:7-74) Paired box protein pax6 {Human (H | 1e-11 | |
| d1x2na1 | 62 | a.4.1.1 (A:6-67) Homeobox protein pknox1 {Human (H | 3e-11 | |
| d1mm2a_ | 61 | g.50.1.2 (A:) Mi2-beta (CHD4) {Human (Homo sapiens | 1e-10 | |
| d1f62a_ | 51 | g.50.1.2 (A:) Williams-Beuren syndrome transcripti | 3e-10 | |
| d1pufb_ | 73 | a.4.1.1 (B:) pbx1 {Human (Homo sapiens) [TaxId: 96 | 3e-10 | |
| d1bw5a_ | 66 | a.4.1.1 (A:) Insulin gene enhancer protein isl-1 { | 3e-10 | |
| d1fjla_ | 65 | a.4.1.1 (A:) Paired protein {Fruit fly (Drosophila | 9e-10 | |
| d2craa1 | 58 | a.4.1.1 (A:7-64) Homeobox protein hox-b13 {Human ( | 2e-09 | |
| d1we9a_ | 64 | g.50.1.2 (A:) PHD finger protein At5g26210 {Thale | 2e-09 | |
| d1yz8p1 | 60 | a.4.1.1 (P:1-60) Pituitary homeobox 2 {Human (Homo | 2e-09 | |
| d1b72a_ | 88 | a.4.1.1 (A:) Homeobox protein hox-b1 {Human (Homo | 2e-09 | |
| d1pufa_ | 77 | a.4.1.1 (A:) Homeobox protein hox-a9 {Mouse (Mus m | 3e-09 | |
| d1k61a_ | 60 | a.4.1.1 (A:) mat alpha2 Homeodomain {Baker's yeast | 3e-09 | |
| d1wi3a_ | 71 | a.4.1.1 (A:) DNA-binding protein SATB2 {Human (Hom | 5e-09 | |
| d1p7ia_ | 53 | a.4.1.1 (A:) Engrailed Homeodomain {Drosophila mel | 5e-09 | |
| d1wh7a_ | 80 | a.4.1.1 (A:) ZF-HD homeobox protein At4g24660 {Tha | 6e-09 | |
| d9anta_ | 56 | a.4.1.1 (A:) Antennapedia Homeodomain {Drosophila | 2e-08 | |
| d1weea_ | 72 | g.50.1.2 (A:) PHD finger protein At1g33420 {Thale | 2e-08 | |
| d1au7a1 | 58 | a.4.1.1 (A:103-160) Pit-1 POU homeodomain {Rat (Ra | 3e-08 | |
| d2e1oa1 | 57 | a.4.1.1 (A:8-64) Homeobox protein prh {Human (Homo | 3e-08 | |
| d2cqxa1 | 59 | a.4.1.1 (A:8-66) LAG1 longevity assurance homolog | 3e-08 | |
| d1s7ea1 | 50 | a.4.1.1 (A:103-152) Hepatocyte nuclear factor 6 {M | 5e-08 | |
| d1ig7a_ | 58 | a.4.1.1 (A:) Msx-1 homeodomain {Mouse (Mus musculu | 6e-08 | |
| d1jgga_ | 57 | a.4.1.1 (A:) Even-skipped homeodomain {Fruit fly ( | 8e-08 | |
| d1le8a_ | 53 | a.4.1.1 (A:) Mating type protein A1 Homeodomain {B | 1e-07 | |
| d1ftta_ | 68 | a.4.1.1 (A:) Thyroid transcription factor 1 homeod | 1e-07 | |
| d2cufa1 | 82 | a.4.1.1 (A:8-89) Homeobox-containing protein 1, HM | 3e-07 | |
| d1x2ma1 | 52 | a.4.1.1 (A:8-59) Lag1 longevity assurance homolog | 3e-07 | |
| d1wema_ | 76 | g.50.1.2 (A:) Death associated transcription facto | 6e-07 | |
| d1zq3p1 | 67 | a.4.1.1 (P:2-68) Homeotic bicoid protein {Fruit fl | 9e-07 | |
| d1vnda_ | 77 | a.4.1.1 (A:) VND/NK-2 protein {Fruit fly (Drosophi | 3e-06 | |
| d1ocpa_ | 67 | a.4.1.1 (A:) Oct-3 POU Homeodomain {Mouse (Mus mus | 5e-06 | |
| d1uhsa_ | 72 | a.4.1.1 (A:) Homeodomain-only protein, Hop {Mouse | 1e-05 | |
| d1e3oc1 | 57 | a.4.1.1 (C:104-160) Oct-1 POU Homeodomain {Human ( | 6e-05 | |
| d1wepa_ | 79 | g.50.1.2 (A:) PHD finger protein 8 {Mouse (Mus mus | 1e-04 | |
| d2ecba1 | 76 | a.4.1.1 (A:8-83) Zinc fingers and homeoboxes prote | 1e-04 | |
| d2pnxa1 | 51 | g.50.1.2 (A:195-245) Inhibitor of growth protein 4 | 0.001 | |
| d1wewa_ | 78 | g.50.1.2 (A:) Sumoylation ligase E3, SIZ1 {Thale c | 0.001 | |
| d1lfba_ | 78 | a.4.1.1 (A:) Hepatocyte nuclear factor 1a (LFB1/HN | 0.002 |
| >d1fp0a1 g.50.1.2 (A:19-88) Nuclear corepressor KAP-1 (TIF-1beta) {Human (Homo sapiens) [TaxId: 9606]} Length = 70 | Back information, alignment and structure |
|---|
class: Small proteins fold: FYVE/PHD zinc finger superfamily: FYVE/PHD zinc finger family: PHD domain domain: Nuclear corepressor KAP-1 (TIF-1beta) species: Human (Homo sapiens) [TaxId: 9606]
Score = 65.8 bits (160), Expect = 5e-14
Identities = 21/79 (26%), Positives = 34/79 (43%), Gaps = 10/79 (12%)
Query: 518 GQIDSEDIYCAKCGSKDLSADNDIILCDGACDRGFHQYCLEPPLLKEDIPPDDEGWLCPG 577
G +D C C D+++C+ C+ FH C P L +D+P ++ W C
Sbjct: 1 GTLDDSATICRVCQKPG-----DLVMCNQ-CEFCFHLDCHLPAL--QDVPGEE--WSCSL 50
Query: 578 CDCKVDCIDLVNELQGTRL 596
C D + +LQ +L
Sbjct: 51 CHVLPDLKEEDVDLQACKL 69
|
| >d1weva_ g.50.1.2 (A:) PHD finger protein 22 {Mouse (Mus musculus) [TaxId: 10090]} Length = 88 | Back information, alignment and structure |
|---|
| >d2cuea1 a.4.1.1 (A:7-74) Paired box protein pax6 {Human (Homo sapiens) [TaxId: 9606]} Length = 68 | Back information, alignment and structure |
|---|
| >d1x2na1 a.4.1.1 (A:6-67) Homeobox protein pknox1 {Human (Homo sapiens) [TaxId: 9606]} Length = 62 | Back information, alignment and structure |
|---|
| >d1mm2a_ g.50.1.2 (A:) Mi2-beta (CHD4) {Human (Homo sapiens) [TaxId: 9606]} Length = 61 | Back information, alignment and structure |
|---|
| >d1f62a_ g.50.1.2 (A:) Williams-Beuren syndrome transcription factor, WSTF {Human (Homo sapiens) [TaxId: 9606]} Length = 51 | Back information, alignment and structure |
|---|
| >d1pufb_ a.4.1.1 (B:) pbx1 {Human (Homo sapiens) [TaxId: 9606]} Length = 73 | Back information, alignment and structure |
|---|
| >d1bw5a_ a.4.1.1 (A:) Insulin gene enhancer protein isl-1 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 66 | Back information, alignment and structure |
|---|
| >d1fjla_ a.4.1.1 (A:) Paired protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 65 | Back information, alignment and structure |
|---|
| >d2craa1 a.4.1.1 (A:7-64) Homeobox protein hox-b13 {Human (Homo sapiens) [TaxId: 9606]} Length = 58 | Back information, alignment and structure |
|---|
| >d1we9a_ g.50.1.2 (A:) PHD finger protein At5g26210 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 64 | Back information, alignment and structure |
|---|
| >d1yz8p1 a.4.1.1 (P:1-60) Pituitary homeobox 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 60 | Back information, alignment and structure |
|---|
| >d1b72a_ a.4.1.1 (A:) Homeobox protein hox-b1 {Human (Homo sapiens) [TaxId: 9606]} Length = 88 | Back information, alignment and structure |
|---|
| >d1pufa_ a.4.1.1 (A:) Homeobox protein hox-a9 {Mouse (Mus musculus) [TaxId: 10090]} Length = 77 | Back information, alignment and structure |
|---|
| >d1k61a_ a.4.1.1 (A:) mat alpha2 Homeodomain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 60 | Back information, alignment and structure |
|---|
| >d1wi3a_ a.4.1.1 (A:) DNA-binding protein SATB2 {Human (Homo sapiens) [TaxId: 9606]} Length = 71 | Back information, alignment and structure |
|---|
| >d1p7ia_ a.4.1.1 (A:) Engrailed Homeodomain {Drosophila melanogaster [TaxId: 7227]} Length = 53 | Back information, alignment and structure |
|---|
| >d1wh7a_ a.4.1.1 (A:) ZF-HD homeobox protein At4g24660 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 80 | Back information, alignment and structure |
|---|
| >d9anta_ a.4.1.1 (A:) Antennapedia Homeodomain {Drosophila melanogaster [TaxId: 7227]} Length = 56 | Back information, alignment and structure |
|---|
| >d1weea_ g.50.1.2 (A:) PHD finger protein At1g33420 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 72 | Back information, alignment and structure |
|---|
| >d1au7a1 a.4.1.1 (A:103-160) Pit-1 POU homeodomain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 58 | Back information, alignment and structure |
|---|
| >d2e1oa1 a.4.1.1 (A:8-64) Homeobox protein prh {Human (Homo sapiens) [TaxId: 9606]} Length = 57 | Back information, alignment and structure |
|---|
| >d2cqxa1 a.4.1.1 (A:8-66) LAG1 longevity assurance homolog 5, LASS5 {Mouse (Mus musculus) [TaxId: 10090]} Length = 59 | Back information, alignment and structure |
|---|
| >d1s7ea1 a.4.1.1 (A:103-152) Hepatocyte nuclear factor 6 {Mouse (Mus musculus) [TaxId: 10090]} Length = 50 | Back information, alignment and structure |
|---|
| >d1ig7a_ a.4.1.1 (A:) Msx-1 homeodomain {Mouse (Mus musculus) [TaxId: 10090]} Length = 58 | Back information, alignment and structure |
|---|
| >d1jgga_ a.4.1.1 (A:) Even-skipped homeodomain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 57 | Back information, alignment and structure |
|---|
| >d1le8a_ a.4.1.1 (A:) Mating type protein A1 Homeodomain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 53 | Back information, alignment and structure |
|---|
| >d1ftta_ a.4.1.1 (A:) Thyroid transcription factor 1 homeodomain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 68 | Back information, alignment and structure |
|---|
| >d2cufa1 a.4.1.1 (A:8-89) Homeobox-containing protein 1, HMBOX1 (Flj21616) {Human (Homo sapiens) [TaxId: 9606]} Length = 82 | Back information, alignment and structure |
|---|
| >d1x2ma1 a.4.1.1 (A:8-59) Lag1 longevity assurance homolog 6, LASS6 {Mouse (Mus musculus) [TaxId: 10090]} Length = 52 | Back information, alignment and structure |
|---|
| >d1wema_ g.50.1.2 (A:) Death associated transcription factor 1, Datf1 (DIO-1) {Mouse (Mus musculus) [TaxId: 10090]} Length = 76 | Back information, alignment and structure |
|---|
| >d1zq3p1 a.4.1.1 (P:2-68) Homeotic bicoid protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 67 | Back information, alignment and structure |
|---|
| >d1vnda_ a.4.1.1 (A:) VND/NK-2 protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 77 | Back information, alignment and structure |
|---|
| >d1ocpa_ a.4.1.1 (A:) Oct-3 POU Homeodomain {Mouse (Mus musculus) [TaxId: 10090]} Length = 67 | Back information, alignment and structure |
|---|
| >d1uhsa_ a.4.1.1 (A:) Homeodomain-only protein, Hop {Mouse (Mus musculus) [TaxId: 10090]} Length = 72 | Back information, alignment and structure |
|---|
| >d1e3oc1 a.4.1.1 (C:104-160) Oct-1 POU Homeodomain {Human (Homo sapiens) [TaxId: 9606]} Length = 57 | Back information, alignment and structure |
|---|
| >d1wepa_ g.50.1.2 (A:) PHD finger protein 8 {Mouse (Mus musculus) [TaxId: 10090]} Length = 79 | Back information, alignment and structure |
|---|
| >d2ecba1 a.4.1.1 (A:8-83) Zinc fingers and homeoboxes protein 1, ZHX1 {Human (Homo sapiens) [TaxId: 9606]} Length = 76 | Back information, alignment and structure |
|---|
| >d2pnxa1 g.50.1.2 (A:195-245) Inhibitor of growth protein 4, Ing4 {Homo sapiens [TaxId: 9606]} Length = 51 | Back information, alignment and structure |
|---|
| >d1wewa_ g.50.1.2 (A:) Sumoylation ligase E3, SIZ1 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 78 | Back information, alignment and structure |
|---|
| >d1lfba_ a.4.1.1 (A:) Hepatocyte nuclear factor 1a (LFB1/HNF1) {Rat (Rattus rattus) [TaxId: 10117]} Length = 78 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 1063 | |||
| d1vnda_ | 77 | VND/NK-2 protein {Fruit fly (Drosophila melanogast | 99.55 | |
| d2craa1 | 58 | Homeobox protein hox-b13 {Human (Homo sapiens) [Ta | 99.51 | |
| d1pufa_ | 77 | Homeobox protein hox-a9 {Mouse (Mus musculus) [Tax | 99.5 | |
| d1b72a_ | 88 | Homeobox protein hox-b1 {Human (Homo sapiens) [Tax | 99.49 | |
| d1zq3p1 | 67 | Homeotic bicoid protein {Fruit fly (Drosophila mel | 99.48 | |
| d1uhsa_ | 72 | Homeodomain-only protein, Hop {Mouse (Mus musculus | 99.46 | |
| d1ig7a_ | 58 | Msx-1 homeodomain {Mouse (Mus musculus) [TaxId: 10 | 99.44 | |
| d1ftta_ | 68 | Thyroid transcription factor 1 homeodomain {Rat (R | 99.43 | |
| d1jgga_ | 57 | Even-skipped homeodomain {Fruit fly (Drosophila me | 99.43 | |
| d9anta_ | 56 | Antennapedia Homeodomain {Drosophila melanogaster | 99.43 | |
| d2cuea1 | 68 | Paired box protein pax6 {Human (Homo sapiens) [Tax | 99.42 | |
| d1wi3a_ | 71 | DNA-binding protein SATB2 {Human (Homo sapiens) [T | 99.41 | |
| d2e1oa1 | 57 | Homeobox protein prh {Human (Homo sapiens) [TaxId: | 99.41 | |
| d1wh7a_ | 80 | ZF-HD homeobox protein At4g24660 {Thale cress (Ara | 99.41 | |
| d1ocpa_ | 67 | Oct-3 POU Homeodomain {Mouse (Mus musculus) [TaxId | 99.41 | |
| d1fjla_ | 65 | Paired protein {Fruit fly (Drosophila melanogaster | 99.41 | |
| d1bw5a_ | 66 | Insulin gene enhancer protein isl-1 {Rat (Rattus n | 99.4 | |
| d1p7ia_ | 53 | Engrailed Homeodomain {Drosophila melanogaster [Ta | 99.39 | |
| d2cufa1 | 82 | Homeobox-containing protein 1, HMBOX1 (Flj21616) { | 99.39 | |
| d1yz8p1 | 60 | Pituitary homeobox 2 {Human (Homo sapiens) [TaxId: | 99.32 | |
| d1au7a1 | 58 | Pit-1 POU homeodomain {Rat (Rattus norvegicus) [Ta | 99.32 | |
| d1le8a_ | 53 | Mating type protein A1 Homeodomain {Baker's yeast | 99.27 | |
| d2ecba1 | 76 | Zinc fingers and homeoboxes protein 1, ZHX1 {Human | 99.25 | |
| d1e3oc1 | 57 | Oct-1 POU Homeodomain {Human (Homo sapiens) [TaxId | 99.24 | |
| d2ecca1 | 76 | Homeobox-leucine zipper protein Homez {Human (Homo | 99.22 | |
| d1pufb_ | 73 | pbx1 {Human (Homo sapiens) [TaxId: 9606]} | 99.22 | |
| d1lfba_ | 78 | Hepatocyte nuclear factor 1a (LFB1/HNF1) {Rat (Rat | 99.2 | |
| d1s7ea1 | 50 | Hepatocyte nuclear factor 6 {Mouse (Mus musculus) | 99.12 | |
| d1x2ma1 | 52 | Lag1 longevity assurance homolog 6, LASS6 {Mouse ( | 99.08 | |
| d1fp0a1 | 70 | Nuclear corepressor KAP-1 (TIF-1beta) {Human (Homo | 99.06 | |
| d2cqxa1 | 59 | LAG1 longevity assurance homolog 5, LASS5 {Mouse ( | 98.96 | |
| d1k61a_ | 60 | mat alpha2 Homeodomain {Baker's yeast (Saccharomyc | 98.94 | |
| d1x2na1 | 62 | Homeobox protein pknox1 {Human (Homo sapiens) [Tax | 98.93 | |
| d1mm2a_ | 61 | Mi2-beta (CHD4) {Human (Homo sapiens) [TaxId: 9606 | 98.9 | |
| d1weva_ | 88 | PHD finger protein 22 {Mouse (Mus musculus) [TaxId | 98.82 | |
| d1f62a_ | 51 | Williams-Beuren syndrome transcription factor, WST | 98.81 | |
| d1weea_ | 72 | PHD finger protein At1g33420 {Thale cress (Arabido | 98.14 | |
| d1wesa_ | 71 | PHD Inhibitor of growth protein 2, Ing2 {Mouse (Mu | 98.1 | |
| d1we9a_ | 64 | PHD finger protein At5g26210 {Thale cress (Arabido | 98.02 | |
| d1wepa_ | 79 | PHD finger protein 8 {Mouse (Mus musculus) [TaxId: | 97.9 | |
| d2pnxa1 | 51 | Inhibitor of growth protein 4, Ing4 {Homo sapiens | 97.77 | |
| d1wema_ | 76 | Death associated transcription factor 1, Datf1 (DI | 97.49 | |
| d1wewa_ | 78 | Sumoylation ligase E3, SIZ1 {Thale cress (Arabidop | 97.36 | |
| d1wila_ | 89 | Hypothetical protein KIAA1045 {Human (Homo sapiens | 95.02 | |
| d1zbdb_ | 124 | Effector domain of rabphilin-3a {Rat (Rattus norve | 85.58 | |
| d1vyxa_ | 60 | IE1B protein (ORF K3), N-terminal domain {Kaposi's | 83.86 |
| >d1vnda_ a.4.1.1 (A:) VND/NK-2 protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
class: All alpha proteins fold: DNA/RNA-binding 3-helical bundle superfamily: Homeodomain-like family: Homeodomain domain: VND/NK-2 protein species: Fruit fly (Drosophila melanogaster) [TaxId: 7227]
Probab=99.55 E-value=1.9e-15 Score=115.85 Aligned_cols=66 Identities=26% Similarity=0.502 Sum_probs=59.1
Q ss_pred CCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCCHHHHHHHHHHHCCCCCCEEECCCCCCCCCCCCCCCC
Q ss_conf 999998974457985789999999764179999899999999939996541000333411127888711
Q 001512 880 GSRGRRHRTSYRKLGEEVTQKLYNSFKENQYPNRTTKESLAKELGLTFSQVRKWFENTRWSFNHPSSKN 948 (1063)
Q Consensus 880 gsk~RR~RT~ft~~~~~QL~~LEk~F~~n~YPs~~~ReeLA~kLGLterQVKVWFQNRRaK~KRq~~~~ 948 (1063)
..+.++.|+.|+ +.|+..|+..|..++||+...++.||..|||++.||+|||||||+|+|+.....
T Consensus 6 p~k~rr~Rt~ft---~~Q~~~Le~~F~~~~yP~~~~r~~LA~~l~l~~~qV~~WFqNrR~k~kr~~~~~ 71 (77)
T d1vnda_ 6 PNKKRKRRVLFT---KAQTYELERRFRQQRYLSAPEREHLASLIRLTPTQVKIWFQNHRYKTKRAQNEK 71 (77)
T ss_dssp SSSSCSSCCCCC---TTHHHHHHHHHHHCSCCCHHHHHHHHHHHTCCHHHHHHHHHHSSSSCSSSCCCS
T ss_pred CCCCCCCCCCCC---HHHHHHHHHHHHHCCCCCHHHHHHHHHHHCCCHHHHHHCCHHHHHHHHHHHHCC
T ss_conf 999998998889---999999999999878899999999999709975661320262889999872016
|
| >d2craa1 a.4.1.1 (A:7-64) Homeobox protein hox-b13 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1pufa_ a.4.1.1 (A:) Homeobox protein hox-a9 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1b72a_ a.4.1.1 (A:) Homeobox protein hox-b1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1zq3p1 a.4.1.1 (P:2-68) Homeotic bicoid protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1uhsa_ a.4.1.1 (A:) Homeodomain-only protein, Hop {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1ig7a_ a.4.1.1 (A:) Msx-1 homeodomain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1ftta_ a.4.1.1 (A:) Thyroid transcription factor 1 homeodomain {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1jgga_ a.4.1.1 (A:) Even-skipped homeodomain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d9anta_ a.4.1.1 (A:) Antennapedia Homeodomain {Drosophila melanogaster [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d2cuea1 a.4.1.1 (A:7-74) Paired box protein pax6 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wi3a_ a.4.1.1 (A:) DNA-binding protein SATB2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2e1oa1 a.4.1.1 (A:8-64) Homeobox protein prh {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wh7a_ a.4.1.1 (A:) ZF-HD homeobox protein At4g24660 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1ocpa_ a.4.1.1 (A:) Oct-3 POU Homeodomain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1fjla_ a.4.1.1 (A:) Paired protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1bw5a_ a.4.1.1 (A:) Insulin gene enhancer protein isl-1 {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1p7ia_ a.4.1.1 (A:) Engrailed Homeodomain {Drosophila melanogaster [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d2cufa1 a.4.1.1 (A:8-89) Homeobox-containing protein 1, HMBOX1 (Flj21616) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1yz8p1 a.4.1.1 (P:1-60) Pituitary homeobox 2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1au7a1 a.4.1.1 (A:103-160) Pit-1 POU homeodomain {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1le8a_ a.4.1.1 (A:) Mating type protein A1 Homeodomain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2ecba1 a.4.1.1 (A:8-83) Zinc fingers and homeoboxes protein 1, ZHX1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1e3oc1 a.4.1.1 (C:104-160) Oct-1 POU Homeodomain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ecca1 a.4.1.1 (A:1-76) Homeobox-leucine zipper protein Homez {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1pufb_ a.4.1.1 (B:) pbx1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1lfba_ a.4.1.1 (A:) Hepatocyte nuclear factor 1a (LFB1/HNF1) {Rat (Rattus rattus) [TaxId: 10117]} | Back information, alignment and structure |
|---|
| >d1s7ea1 a.4.1.1 (A:103-152) Hepatocyte nuclear factor 6 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1x2ma1 a.4.1.1 (A:8-59) Lag1 longevity assurance homolog 6, LASS6 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1fp0a1 g.50.1.2 (A:19-88) Nuclear corepressor KAP-1 (TIF-1beta) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cqxa1 a.4.1.1 (A:8-66) LAG1 longevity assurance homolog 5, LASS5 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1k61a_ a.4.1.1 (A:) mat alpha2 Homeodomain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1x2na1 a.4.1.1 (A:6-67) Homeobox protein pknox1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1mm2a_ g.50.1.2 (A:) Mi2-beta (CHD4) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1weva_ g.50.1.2 (A:) PHD finger protein 22 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1f62a_ g.50.1.2 (A:) Williams-Beuren syndrome transcription factor, WSTF {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1weea_ g.50.1.2 (A:) PHD finger protein At1g33420 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1wesa_ g.50.1.2 (A:) PHD Inhibitor of growth protein 2, Ing2 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1we9a_ g.50.1.2 (A:) PHD finger protein At5g26210 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1wepa_ g.50.1.2 (A:) PHD finger protein 8 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2pnxa1 g.50.1.2 (A:195-245) Inhibitor of growth protein 4, Ing4 {Homo sapiens [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wema_ g.50.1.2 (A:) Death associated transcription factor 1, Datf1 (DIO-1) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1wewa_ g.50.1.2 (A:) Sumoylation ligase E3, SIZ1 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1wila_ g.50.1.3 (A:) Hypothetical protein KIAA1045 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1zbdb_ g.50.1.1 (B:) Effector domain of rabphilin-3a {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1vyxa_ g.44.1.3 (A:) IE1B protein (ORF K3), N-terminal domain {Kaposi's sarcoma-associated herpesvirus, KSHV, HHV8 [TaxId: 37296]} | Back information, alignment and structure |
|---|