Citrus Sinensis ID: 001538

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820-------830-------840-------850-------860-------870-------880-------890-------900-------910-------920-------930-------940-------950-------960-------970-------980-------990------1000------1010------1020------1030------1040------1050------106
MCLCRDGRIKVIGGDGIEGLLISPSQLPYKNLEFLQNQGFLISITNDNEIQVWSLESRSLACCLKWESNITAFSVISGSHFMYIGDENGLMSVIKYDADEGKLFQLPYNISADALSEKAGFPLLSHQPVVGVLPHPNSSGNRVLIAYENALVILWDVSEAQIIFVGGGKDLQLKDGVVDSPSEGDSTFLEGISEHQPEEKEISALCWASSSGSILAVGYIDGDILLWNTSTTASTKGQQTGSRNNVVKLELSSAERRLPVIVLHWSTNKESRSNIDGRLFVYGGDEIGSEEVLTVLSLEWSSGMENLRCVSRVDITLTGSFADMILLSSAGATVGNHKADLFVLTSPGQLHFYDNASLTTLLSQQEKKPSVCPVEFPGVIPISDPIMTVAEFMLLPFGGHSSKGLSEIATFTKLHSSHTQAGHIKWPLSGGVPSPVPITKCHSVDRVYLAGYHDGSVRIWDATYPVFKLICALDAEVQGIEVAGSRAPVSTLSFCFINSSLAVGNEFGLVYIYNLNGSLDAKNFLFVLETKSEVHALPEGKISLCRAVFSLVNSPVRALQFTSSGAKLAVGFECGRVAVLDMNLLSVLFFTDDISGSSSPIISMTWTEFKNTHSLAKNPNHSEREVPVNPAEEVIIVLFKDAKISIVGGSSENMISSSPWHLKKKVIAISMEVIEPVCGFPIEKQAEQSAEENAAKNKPTPDTSSIETKSHETEHLFSSENACSGESSNDALVLLCCEDSVRLYSRKSVIQGNNKTVQKVKHKNRCCWASTIEKDEKVCGLLLLFQTGAVQIRSLPDLELVMESSLMSILRWNFKANMDKTISADNGQITLANGSEVAFVNLLAGENEFSILESSPCLHDKVLEAAAAAAFNVSSNQKKKQTTAAGILGGIVKGFRGEKMIHTLDDSIDPKSSFSQLGGIFSRPPFPDLSPAATNNEEIELNIDDIEIDEPPSMMATSSHEVTNTKKEKLSERERLLGVPDDAKPRLRTREEIIAKYRKAEDASSVAAHARDKLFERQDKLERISRCTEELQSGAEDFASLANELVKTMENRKWWKI
ccccccccEEEEccccEEEEEEccccccEEEEEEEccccEEEEEEccccEEEEEcccccEEEEccccccEEEEEEcccccEEEEEcccccEEEEEEEcccccEEEcccccccccccccccccccccccEEEEEEcccccccEEEEEEcccEEEEEEccccEEEEEEccccEEEccccccccccccccccccccccccccccEEEEEEccccccEEEEEEccccEEEEEcccccccccccccccccccccccccccccccEEEEEEEEcccccccccccEEEEccccccccccEEEEEEEEccccEEEEEEEEEEEEcccccccEEEEEccccccccccEEEEEEccccEEEEEccccEEEEEccccccccccccccccccccccccccEEEEEEcccccccccccHHHHHHcccccccccccccccccccccccccccccccccccEEEEEEccccEEEEEcccccEEEEEEccccccccccccccccEEEEEEEccccEEEEEEcccEEEEEEEccccccccEEEEEccccEEEccccccccEEEEEEccccccEEEEEEcccccEEEEEEcccEEEEEEcccccEEEEEEccccccccEEEEEEEEccccccccccccccccccccccccEEEEEEccccEEEEEEcccccEEEcccccccccEEEEEEEEEcccccccccccccHHHHHHccccccccccccccccccccccccccccccccccccccEEEEEEccEEEEEEcccccccccEEEEEcccccccccEEEEEccccEEEEEEEEEcccEEEEEcccccccccccccccccccccccccEEEEEcccEEEEEcccEEEEEEEEcccccEEEccccccccccccHHHHcccEEcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHcccccccccccccccccccccccccccccHHHHHHHccccccccccccccHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccc
cccccccEEEEEcccccEEEEEcccccHEEEEEEEccccEEEEEEccccEEEEEEcccccccEEEEEEEEEEEEEEcccEEEEEEcccccEEEEEEEcEEEccEEEEccEEEEEccccccccccccccEEEEcccccccccEEEEEEcccEEEEEEccccEEEEEEcccccccccccHHHHHccHHHccHHHHHcccccccEEEEEEEEcccEEEEEEEccccEEEEEcccccccccccccccccEEEEEcccccccccEEEEEEccccccccccccEEEEEEccccccccEEEEEEccccEEEEEEEEEcEEEEEEcccEEEEEEEEcccccccccccEEEEEEccccEEEEEHHHHHHHHHHHccccccccccccccccccccccEEHHEEEcccccccHHHHHHHHHHHcccccccccccccccccccccccccccccccccEEEEEEcccccEEEEcccHHHHHHHHEccccccccccccccccEEEEEEcccccEEEEEccccEEEEEEEccccccEEEEEEEcccccccccccccccccEEEcccccccccEEEEccccccccccccccEEEEEEcccccEEEEEEEccccccccEEccccEEEcccccccccccccccccccccccEEEEEccccEEEEEEcccccEcccccccccccccEEEEEEEcccccccccccccccccccccccccccccEEEcccccccccccccccccccccccccEEEEEEcccEEEEccHHHHcccccEEEEEccccccEEEEEEccccccEEEEEEEEccEEEEEcccccHHHHHHcHHHHHcccccccccEEEEccccEEEEEcccEEEEEEEEcccccccccccccccccHHHHHHHHHcccccccHHHcccccccccccEEcccccccccccccccccccccHHHHHHHHccccccccccccccccccEcccccccccccccccccccccccccccccccHHHHccccccccccccccHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHccccccc
mclcrdgrikviggdgiegllispsqlpyknleFLQNQGFLISITNDNEIQVWSLESRSLACCLKWESNITAFSvisgshfmyigdenGLMSVIKYdadegklfqlpynisadalsekagfpllshqpvvgvlphpnssgnrVLIAYENALVILWDVSEAQIIFvgggkdlqlkdgvvdspsegdstflegisehqpeeKEISALCWasssgsilavgyidgdillwntsttastkgqqtgsrnnVVKLELSSAERRLPVIVLHWstnkesrsnidgrlfvyggdeigsEEVLTVLSLEwssgmenlrcvsrvditltgSFADMILLSsagatvgnhkadlfvltspgqlhfydnaslTTLLsqqekkpsvcpvefpgvipisdpimTVAEFmllpfgghsskglsEIATFTKLhsshtqaghikwplsggvpspvpitkchsvdrvylagyhdgsvriwdaTYPVFKLICALDAEVqgievagsrapvstlsfcfinsslavgneFGLVYIYNLNGSLDAKNFLFVLETksevhalpegkISLCRAVFSLvnspvralqftssgaklavgfECGRVAVLDMNLLSVLFFtddisgssspiismtwtefknthslaknpnhserevpvnpaEEVIIVLFKDakisivggssenmissspwhLKKKVIAISMEViepvcgfpiekQAEQSAEEnaaknkptpdtssietkshetehlfssenacsgessnDALVLLCCEdsvrlysrksviqgnNKTVQKVKhknrccwastieKDEKVCGLLLLFQTgavqirslpdLELVMESSLMSILRWNFKAnmdktisadngqitlanGSEVAFVNLLAGenefsilesspclhDKVLEAAAAAAFnvssnqkkkqttaagilggivkgfrgekmihtlddsidpkssfsqlggifsrppfpdlspaatnneeielniddieideppsmmatsshevtntkkekLSERErllgvpddakprlRTREEIIAKYRkaedassvaAHARDKLFERQDKLERISRCTEELQSGAEDFASLANELVKTMENRKWWKI
mclcrdgrikviggdgiegLLISPSQLPYKNLEFLQNQGFLISITNDNEIQVWSLESRSLACCLKWESNITAFSVISGSHFMYIGDENGLMSVIKYDADEGKLFQLPYNISADALSEKAGFPLLSHQPVVGVLPHPNSSGNRVLIAYENALVILWDVSEAQIIFVGGGKDLQLKDGVVDSPSEGDSTFLEGISEHQPEEKEISALCWASSSGSILAVGYIDGDILLWNTSTtastkgqqtgsrnnVVKLelssaerrlpVIVLhwstnkesrsnidGRLFVYGGDEIGSEEVLTVLSLEWSSGMENLRCVSRVDITLTGSFADMILLSSAGATVGNHKADLFVLTSPGQLHFYDNASLTTLLSQQEKKPSVCPVEFPGVIPISDPIMTVAEFMLLPFGGHSSKGLSEIATFTKLHSSHTQAGHIKWPLSGGVPSPVPITKCHSVDRVYLAGYHDGSVRIWDATYPVFKLICALDAEVQGIEVAGSRAPVSTLSFCFINSSLAVGNEFGLVYIYNLNGSLDAKNFLFVLETKSEVHALPEGKISLCRAVFSLVNSPVRALQFTSSGAKLAVGFECGRVAVLDMNLLSVLFFTDDISGSSSPIISMTWTEFKNTHSLAKnpnhserevpvNPAEEVIIVLFKDAKISIVGgssenmissspwHLKKKVIAISMEVIEPVCGFPIEKQAEQSAeenaaknkptpdtssieTKSHETEHLFSSENACSGESSNDALVLLCCEDSVRLysrksviqgnnktvqkvkhknrcCWASTIEKDEKVCGLLLLFQTGAVQIRSLPDLELVMESSLMSILRWNFKANMDKTISADNGQITLANGSEVAFVNLLAGENEFSILESSPCLHDKVLEAAAAAAfnvssnqkkkqttaagilGGIVKGFRGEKMIHTLDDSIDPKSSFSQLGGIFSRPPFPDLSPAATNNEEIELNIDDIEIDEPPSMMatsshevtntkkeklsererllgvpddakprlrtREEIIAkyrkaedassvaahardklferqdkLERISRCTEELQSGAEDFASLANELVktmenrkwwki
MCLCRDGRIKVIGGDGIEGLLISPSQLPYKNLEFLQNQGFLISITNDNEIQVWSLESRSLACCLKWESNITAFSVISGSHFMYIGDENGLMSVIKYDADEGKLFQLPYNISADALSEKAGFPLLSHQPVVGVLPHPNSSGNRVLIAYENALVILWDVSEAQIIFVGGGKDLQLKDGVVDSPSEGDSTFLEGISEHQPEEKEISALCWASSSGSILAVGYIDGDILLWNTSTTASTKGQQTGSRNNVVKLELSSAERRLPVIVLHWSTNKESRSNIDGRLFVYGGDEIGSEEVLTVLSLEWSSGMENLRCVSRVDITLTGSFADMILLSSAGATVGNHKADLFVLTSPGQLHFYDNASLTTLLSQQEKKPSVCPVEFPGVIPISDPIMTVAEFMLLPFGGHSSKGLSEIATFTKLHSSHTQAGHIKWPLSGGVPSPVPITKCHSVDRVYLAGYHDGSVRIWDATYPVFKLICALDAEVQGIEVAGSRAPVSTLSFCFINSSLAVGNEFGLVYIYNLNGSLDAKNFLFVLETKSEVHALPEGKISLCRAVFSLVNSPVRALQFTSSGAKLAVGFECGRVAVLDMNLLSVLFFTDDisgssspiisMTWTEFKNTHSLAKNPNHSEREVPVNPAEEVIIVLFKDAKISIVGGSSENMISSSPWHLKKKVIAISMEVIEPVCGFPIEKQAEQSAEENAAKNKPTPDTSSIETKSHETEHLFSSENACSGESSNDALVLLCCEDSVRLYSRKSVIQGNNKTVQKVKHKNRCCWASTIEKDEKVCGLLLLFQTGAVQIRSLPDLELVMESSLMSILRWNFKANMDKTISADNGQITLANGSEVAFVNLLAGENEFSILESSPCLHDKVLEaaaaaaFNVSSNQKKKQTTAAGILGGIVKGFRGEKMIHTLDDSIDPKSSFSQLGGIFSRPPFPDLSPAATnneeielniddieidePPSMMATSSHEVTNTKKEKLSERERLLGVPDDAKPRLRTREEIIAKYRKAEDASSVAAHARDKLFERQDKLERISRCTEELQSGAEDFASLANELVKTMENRKWWKI
*CLCRDGRIKVIGGDGIEGLLISPSQLPYKNLEFLQNQGFLISITNDNEIQVWSLESRSLACCLKWESNITAFSVISGSHFMYIGDENGLMSVIKYDADEGKLFQLPYNISADALSEKAGFPLLSHQPVVGVLPHPNSSGNRVLIAYENALVILWDVSEAQIIFVGGGKDLQLKD**************************ISALCWASSSGSILAVGYIDGDILLWNTS***********************AERRLPVIVLHWSTNKESRSNIDGRLFVYGGDEIGSEEVLTVLSLEWSSGMENLRCVSRVDITLTGSFADMILLSSAGATVGNHKADLFVLTSPGQLHFYDNASLTTLLSQQEKKPSVCPVEFPGVIPISDPIMTVAEFMLLPFGGHSSKGLSEIATFTKLHSSHTQAGHIKWPLSGGVPSPVPITKCHSVDRVYLAGYHDGSVRIWDATYPVFKLICALDAEVQGIEVAGSRAPVSTLSFCFINSSLAVGNEFGLVYIYNLNGSLDAKNFLFVLETKSEVHALPEGKISLCRAVFSLVNSPVRALQFTSSGAKLAVGFECGRVAVLDMNLLSVLFFTDDISGSSSPIISMTWTEFK********************AEEVIIVLFKDAKISIVGGSSENMISSSPWHLKKKVIAISMEVIEPVCGFPI************************************************ALVLLCCEDSVRLYSRKSVIQGNNKTVQKVKHKNRCCWASTIEKDEKVCGLLLLFQTGAVQIRSLPDLELVMESSLMSILRWNFKANMDKTISADNGQITLANGSEVAFVNLLAGENEFSILESSPCLHDKVLEAAAAAAFNV*********TAAGILGGIVKGFRGEKMIHTL*********************************************************************************************************************************************************
*CLCRDGRIKVIGGDGIEGLLISPSQLPYKNLEFLQNQGFLISITNDNEIQVWSLESRSLACCLKWESNITAFSVISGSHFMYIGDENGLMSVIKYDADEGKLFQLPYNISADALSE**********PVVGVLPHPNSSGNRVLIAYENALVILWDVSEAQIIFVGGGKDLQLKDGVVDSPSEGDSTFLEGISEHQPEEKEISALCWASSSGSILAVGYIDGDILLWNTS**********************SAERRLPVIVLHWSTNKESRSNIDGRLFVYGGDEIGSEEVLTVLSLEWSSGMENLRCVSRVDITLTGSFADMILLSSAGATVGNHKADLFVLTSPGQLHFYDNASLTTLLSQQEKKPSVCPVEFPGVIPISDPIMTVAEFMLLPFGGHSSKGLSEIATFTKLHSSH*********L*GGVPSPVPITKCHSVDRVYLAGYHDGSVRIWDATYPVFKLICALDAEVQGIEVAGSRAPVSTLSFCFINSSLAVGNEFGLVYIYNLNGSLDA*************HALPEGKISLCRAVFSLVNSPVRALQFTSSGAKLAVGFECGRVAVLDMNLLSVLFFTDDISGSSSPIISMTW**********************NPAEEVIIVLFKDAKISIVGGSSENMISSSPWHLKKKVIAISMEVIEPVC***************************IET**********************ALVLLCCEDSVRLYSRKSVIQGNNKTVQKVKHKNRCCWASTIEKDEKVCGLLLLFQTGAVQIRSLPDLELVME*********************DNGQITLANGSEVAFVNLLAGENEFSILESSPCLHDKVLEA**************************************************************************************************************************************************************************************TMENRKWWKI
MCLCRDGRIKVIGGDGIEGLLISPSQLPYKNLEFLQNQGFLISITNDNEIQVWSLESRSLACCLKWESNITAFSVISGSHFMYIGDENGLMSVIKYDADEGKLFQLPYNISADALSEKAGFPLLSHQPVVGVLPHPNSSGNRVLIAYENALVILWDVSEAQIIFVGGGKDLQLKDGVVDSPSEGDSTFLEGISEHQPEEKEISALCWASSSGSILAVGYIDGDILLWNTSTT**********RNNVVKLELSSAERRLPVIVLHWSTNKESRSNIDGRLFVYGGDEIGSEEVLTVLSLEWSSGMENLRCVSRVDITLTGSFADMILLSSAGATVGNHKADLFVLTSPGQLHFYDNASLTTL*********VCPVEFPGVIPISDPIMTVAEFMLLPFGGHSSKGLSEIATFTKLHSSHTQAGHIKWPLSGGVPSPVPITKCHSVDRVYLAGYHDGSVRIWDATYPVFKLICALDAEVQGIEVAGSRAPVSTLSFCFINSSLAVGNEFGLVYIYNLNGSLDAKNFLFVLETKSEVHALPEGKISLCRAVFSLVNSPVRALQFTSSGAKLAVGFECGRVAVLDMNLLSVLFFTDDISGSSSPIISMTWTEFKNTHSLAKNPNHSEREVPVNPAEEVIIVLFKDAKISIVGGSSENMISSSPWHLKKKVIAISMEVIEPVCGFPIEKQ*****************************************SSNDALVLLCCEDSVRLYSRKSVIQGNNKTVQKVKHKNRCCWASTIEKDEKVCGLLLLFQTGAVQIRSLPDLELVMESSLMSILRWNFKANMDKTISADNGQITLANGSEVAFVNLLAGENEFSILESSPCLHDKVLEAAAAAAFN**********TAAGILGGIVKGFRGEKMIHTLDDSIDPKSSFSQLGGIFSRPPFPDLSPAATNNEEIELNIDDIEIDEPPSMM****************ERERLLGVPDDAKPRLRTREEIIAKY***********HARDKLFERQDKLERISRCTEELQSGAEDFASLANELVKTMENRKWWKI
MCLCRDGRIKVIGGDGIEGLLISPSQLPYKNLEFLQNQGFLISITNDNEIQVWSLESRSLACCLKWESNITAFSVISGSHFMYIGDENGLMSVIKYDADEGKLFQLPYNISADALSEKAGFPLLSHQPVVGVLPHPNSSGNRVLIAYENALVILWDVSEAQIIFVGGGKDLQLKDGVVDSPSEGDSTFLEGISEHQPEEKEISALCWASSSGSILAVGYIDGDILLWNTSTTASTKGQQTGSRNNVVKLELSSAERRLPVIVLHWSTNKESRSNIDGRLFVYGGDEIGSEEVLTVLSLEWSSGMENLRCVSRVDITLTGSFADMILLSSAGATVGNHKADLFVLTSPGQLHFYDNASLTTLLSQQEKKPSVCPVEFPGVIPISDPIMTVAEFMLLPFGGHSSKGLSEIATFTKLH******GHI*W*LSGGVPSPVPITKCHSVDRVYLAGYHDGSVRIWDATYPVFKLICALDAEV*G**VAGSRAPVSTLSFCFINSSLAVGNEFGLVYIYNLNGSLDAKNFLFVLETKSEVHALPEGKISLCRAVFSLVNSPVRALQFTSSGAKLAVGFECGRVAVLDMNLLSVLFFTDDISGSSSPIISMTWTEFKNTH*************PVNPAEEVIIVLFKDAKISIVGGSSENMISSSPWHLKKKVIAISMEVIEPV**************************************************SNDALVLLCCEDSVRLYSRKSVIQGNNKTVQKVKHKNRCCWASTIEKDEKVCGLLLLFQTGAVQIRSLPDLELVMESSLMSILRWNFKANMDKTISADNGQITLANGSEVAFVNLLAGENEFSILESSPCLHDKVLEAAAAAAFNVSSNQ**K*TTAAGI*****KGFR************************FSRPPFPDLSPA*T*NEEIELNIDDIEIDEPP**********************************LRTREEIIAKYRKAEDASSVAAHARDKLFERQDKLERISRCTEELQSGAEDFASLANELVKTMENRKWWKI
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MCLCRDGRIKVIGGDGIEGLLISPSQLPYKNLEFLQNQGFLISITNDNEIQVWSLESRSLACCLKWESNITAFSVISGSHFMYIGDENGLMSVIKYDADEGKLFQLPYNISADALSEKAGFPLLSHQPVVGVLPHPNSSGNRVLIAYENALVILWDVSEAQIIFVGGGKDLQLKDGVVDSPSEGDSTFLEGISEHQPEEKEISALCWASSSGSILAVGYIDGDILLWNTSTTASTKGQQTGSRNNVVKLELSSAERRLPVIVLHWSTNKESRSNIDGRLFVYGGDEIGSEEVLTVLSLEWSSGMENLRCVSRVDITLTGSFADMILLSSAGATVGNHKADLFVLTSPGQLHFYDNASLTTLLSQQEKKPSVCPVEFPGVIPISDPIMTVAEFMLLPFGGHSSKGLSEIATFTKLHSSHTQAGHIKWPLSGGVPSPVPITKCHSVDRVYLAGYHDGSVRIWDATYPVFKLICALDAEVQGIEVAGSRAPVSTLSFCFINSSLAVGNEFGLVYIYNLNGSLDAKNFLFVLETKSEVHALPEGKISLCRAVFSLVNSPVRALQFTSSGAKLAVGFECGRVAVLDMNLLSVLFFTDDISGSSSPIISMTWTEFKNTHSLAKNPNHSEREVPVNPAEEVIIVLFKDAKISIVGGSSENMISSSPWHLKKKVIAISMEVIEPVCGFPIEKQAEQSAEENAAKNKPTPDTSSIETKSHETEHLFSSENACSGESSNDALVLLCCEDSVRLYSRKSVIQGNNKTVQKVKHKNRCCWASTIEKDEKVCGLLLLFQTGAVQIRSLPDLELVMESSLMSILRWNFKANMDKTISADNGQITLANGSEVAFVNLLAGENEFSILESSPCLHDKVLEAAAAAAFNVSSNQKKKQTTAAGILGGIVKGFRGEKMIHTLDDSIDPKSSFSQLGGIFSRPPFPDLSPAATNNEEIELNIDDIEIDEPPSMMATSSHEVTNTKKEKLSERERLLGVPDDAKPRLRTREEIIAKYRKAEDASSVAAHARDKLFERQDKLERISRCTEELQSGAEDFASLANELVKTMENRKWWKI
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query1057 2.2.26 [Sep-21-2011]
Q9Y2K9 1186 Syntaxin-binding protein yes no 0.363 0.323 0.193 7e-09
Q5DQR4 1185 Syntaxin-binding protein no no 0.359 0.320 0.188 3e-08
Q5SQE21159 Syntaxin-binding protein no no 0.339 0.309 0.192 8e-07
Q5T5C01151 Syntaxin-binding protein no no 0.369 0.339 0.207 3e-06
Q8K4001152 Syntaxin-binding protein no no 0.370 0.340 0.205 3e-06
Q9WU701152 Syntaxin-binding protein no no 0.369 0.339 0.205 3e-06
Q6P1M31020 Lethal(2) giant larvae pr no no 0.143 0.149 0.247 1e-05
Q5RCX21019 Lethal(2) giant larvae pr yes no 0.143 0.149 0.247 1e-05
>sp|Q9Y2K9|STB5L_HUMAN Syntaxin-binding protein 5-like OS=Homo sapiens GN=STXBP5L PE=2 SV=2 Back     alignment and function desciption
 Score = 63.9 bits (154), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 94/485 (19%), Positives = 184/485 (37%), Gaps = 101/485 (20%)

Query: 5   RDGRIKVIGGDGIEGLLISPSQLPYKNLEFLQNQGFLISITNDNEIQVWSLESRSLACCL 64
           R G I+++G  G++      S      L+FL N+G L+S ++D+ + +W+L  +  A   
Sbjct: 90  RTGAIRILGRPGVDCYCQHESGAAVLQLQFLINEGALVSASSDDTLHLWNLRQKRPAILH 149

Query: 65  KWESN---ITAFSVISGSHFMYIGDENGLMSVIKYDADEGKLFQLPYNISADALSEKAGF 121
             + N   IT   +   S ++Y+G E G   ++  ++     + + +N  A  LS K   
Sbjct: 150 SLKFNRERITYCHLPFQSKWLYVGTERGNTHIVNIESFILSGYVIMWN-KAIELSTK--- 205

Query: 122 PLLSHQ-PVVGVLPHPNSSGNRVLIAYENALVILWDVSEAQIIFVGGGKDLQLKDGVVDS 180
              +H  PVV +   P   G ++LI YEN  V+ WD+           K  +L+      
Sbjct: 206 ---THPGPVVHLSDSPRDEG-KLLIGYENGTVVFWDLK---------SKRAELRVYY--- 249

Query: 181 PSEGDSTFLEGISEHQPEEKEISALCWASSSGSILAVGYIDGDILLWN--------TSTT 232
                             ++ I ++ W    G      + DG + LWN         +T 
Sbjct: 250 ------------------DEAIHSIDW-HHEGKQFMCSHSDGSLTLWNLKSPSRPFQTTI 290

Query: 233 ASTKGQQTGSRNN----VVKLELSSAERRLPVIVLHWSTNKESRSNIDGRLFVYGGDEIG 288
              K Q+ G ++     ++K+E  + +   P I+     + +          ++G     
Sbjct: 291 PHGKSQREGRKSESCKPILKVEYKTCKNSEPFIIFSGGLSYDKACRRPSLTIMHG----- 345

Query: 289 SEEVLTVLSLEWSSGMENLRCVSRVDITLTGSFADMILLSSAGATVGNHKADLFVLTSPG 348
             + +TVL ++         C +         +A ++LL      V   +++  +  +P 
Sbjct: 346 --KAITVLEMDHPIVEFLTLCETPYPNEFQEPYAVVVLLEKDLIVVDLTQSNFPIFENPY 403

Query: 349 QLHFYDNASLTTLLSQQEKKPSVCPVEFPGVIPISDPIMTVAEFMLLPFGGHSSKGLSEI 408
            +  +++             P  C   F    P  D I+ +    +     H  +G S  
Sbjct: 404 PMDIHES-------------PVTCTAYFADCPP--DLILVLYSIGV----KHKKQGYS-- 442

Query: 409 ATFTKLHSSHTQAGHIKWPLSGGVPSPVPITKCHSVDRVYLAGYHDGSVRIWDATYPVFK 468
                         + +WP+SGG  +        +   + + G+ DGS++ WDA+    +
Sbjct: 443 --------------NKEWPISGGAWN----LGAQTYPEIIITGHADGSIKFWDASAITLQ 484

Query: 469 LICAL 473
           ++  L
Sbjct: 485 MLYKL 489
May play a role in vesicle trafficking and exocytosis.
Homo sapiens (taxid: 9606)
>sp|Q5DQR4|STB5L_MOUSE Syntaxin-binding protein 5-like OS=Mus musculus GN=Stxbp5l PE=1 SV=1 Back     alignment and function description
>sp|Q5SQE2|STB5L_DANRE Syntaxin-binding protein 5-like OS=Danio rerio GN=stxbp5l PE=3 SV=1 Back     alignment and function description
>sp|Q5T5C0|STXB5_HUMAN Syntaxin-binding protein 5 OS=Homo sapiens GN=STXBP5 PE=1 SV=1 Back     alignment and function description
>sp|Q8K400|STXB5_MOUSE Syntaxin-binding protein 5 OS=Mus musculus GN=Stxbp5 PE=1 SV=3 Back     alignment and function description
>sp|Q9WU70|STXB5_RAT Syntaxin-binding protein 5 OS=Rattus norvegicus GN=Stxbp5 PE=1 SV=1 Back     alignment and function description
>sp|Q6P1M3|L2GL2_HUMAN Lethal(2) giant larvae protein homolog 2 OS=Homo sapiens GN=LLGL2 PE=1 SV=2 Back     alignment and function description
>sp|Q5RCX2|L2GL2_PONAB Lethal(2) giant larvae protein homolog 2 OS=Pongo abelii GN=LLGL2 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query1057
225439408 1176 PREDICTED: uncharacterized protein LOC10 0.990 0.890 0.65 0.0
2960831691127 unnamed protein product [Vitis vinifera] 0.990 0.929 0.65 0.0
2555826701096 nucleotide binding protein, putative [Ri 0.975 0.940 0.610 0.0
2241404331099 predicted protein [Populus trichocarpa] 0.980 0.942 0.606 0.0
3565681101115 PREDICTED: uncharacterized protein LOC10 0.988 0.937 0.577 0.0
3565233181118 PREDICTED: uncharacterized protein LOC10 0.987 0.933 0.569 0.0
4494402591085 PREDICTED: LOW QUALITY PROTEIN: uncharac 0.925 0.901 0.543 0.0
2254484591108 PREDICTED: uncharacterized protein LOC10 0.982 0.937 0.534 0.0
2977365951137 unnamed protein product [Vitis vinifera] 0.982 0.913 0.520 0.0
3071359251044 nucleotide binding protein [Cucumis melo 0.893 0.904 0.533 0.0
>gi|225439408|ref|XP_002263824.1| PREDICTED: uncharacterized protein LOC100257563 [Vitis vinifera] Back     alignment and taxonomy information
 Score = 1340 bits (3469), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 689/1060 (65%), Positives = 813/1060 (76%), Gaps = 13/1060 (1%)

Query: 6    DGRIKVIGGDGIEGLLISPSQLPYKNLEFLQNQGFLISITNDNEIQVWSLESRSLACCLK 65
            DGRIKVIGGD IEGL ISP QLPYK LEFLQNQGFL+SI+ND+EIQVW+LE + ++CCL 
Sbjct: 122  DGRIKVIGGDNIEGLFISPKQLPYKYLEFLQNQGFLVSISNDDEIQVWNLERQCISCCLH 181

Query: 66   WESNITAFSVISGSHFMYIGDENGLMSVIKYDADEGKLFQLPYNISADALSEKAGFPLLS 125
            WESNITAFSVISGS+FMYIGDE G +SV+K +AD+GKL QLPYNI A ++SE  GF   +
Sbjct: 182  WESNITAFSVISGSNFMYIGDEYGSISVLKCEADDGKLLQLPYNIFAKSISEAGGFSFFN 241

Query: 126  HQPVVGVLPHPNSSGNRVLIAYENALVILWDVSEAQIIFVGGGKDLQLKDGVVDSPSEGD 185
            HQPV+GVLP P SSGNRVLIAYEN L+ILWDVSEAQII   G K+LQL D  VDSPSE D
Sbjct: 242  HQPVIGVLPQPCSSGNRVLIAYENGLIILWDVSEAQIIVAKGDKNLQLNDRAVDSPSEAD 301

Query: 186  STFLEGISEHQPEEKEISALCWASSSGSILAVGYIDGDILLWNTSTTASTKGQQTGSR-N 244
            S   +  SE   EEKEISALCWASS GSILAVGYIDGDIL WN S+ ASTKGQQTGS  N
Sbjct: 302  SNLPDDASEQHLEEKEISALCWASSDGSILAVGYIDGDILFWNLSSAASTKGQQTGSLGN 361

Query: 245  NVVKLELSSAERRLPVIVLHWSTNKESRSNIDGRLFVYGGDEIGSEEVLTVLSLEWSSGM 304
            NVVKL+LSSAERRLP+IVLHWST+ +  ++ DG LF+YGGD IGSEEVLT+LSLEWSSG+
Sbjct: 362  NVVKLQLSSAERRLPIIVLHWSTSNKPHNDRDGLLFIYGGDAIGSEEVLTILSLEWSSGV 421

Query: 305  ENLRCVSRVDITLTGSFADMILLSSAGATVGNHKADLFVLTSPGQLHFYDNASLTTLLSQ 364
            E LRC  RV++TL GSFADMILL +AGAT  N  A LFVLT+PGQLHFYD+ASL+ L+SQ
Sbjct: 422  ETLRCAGRVELTLVGSFADMILLPTAGATGINQNASLFVLTNPGQLHFYDDASLSALISQ 481

Query: 365  QEKKPSVCPVEFPGVIPISDPIMTVAEFMLLPFGGHSSKGLSEIATFTKLHSSHTQAGHI 424
            QE+K S+  VEFP  +P SDP MTVA+   L  GG+SSK LSEIA+  K  S+ T  G  
Sbjct: 482  QERKSSLSAVEFPAAVPTSDPYMTVAKLSFLHTGGNSSKALSEIASVMKHVSTPTLTGRA 541

Query: 425  KWPLSGGVPSPVPITKCHSVDRVYLAGYHDGSVRIWDATYPVFKLICALDAEVQGIEVAG 484
            KWPL+GGVPS +   +   V+RVY+AGY DGSVRIWDATYPV  LIC L+ EVQGI+VAG
Sbjct: 542  KWPLTGGVPSQLSFAEGKRVERVYVAGYQDGSVRIWDATYPVLSLICVLEGEVQGIKVAG 601

Query: 485  SRAPVSTLSFCFINSSLAVGNEFGLVYIYNLNGSLDAKNFLFVLETKSEVHALPEGKISL 544
            S A VS L FC +  SLAVGN  GLV +Y+LN + D  +F FV E+  EVH LP+ K   
Sbjct: 602  SSASVSKLDFCHLTLSLAVGNACGLVRVYDLNDNSDKTSFHFVTESNQEVHVLPQQKGPQ 661

Query: 545  CRAVFSLVNSPVRALQFTSSGAKLAVGFECGRVAVLDMNLLSVLFFTDDISGSSSPIISM 604
            CRA F L+NSP++AL++T+ G KLAVGFECGRVAVLDMN LSVL   D ISGSSSP+IS+
Sbjct: 662  CRAAFCLLNSPIQALKYTNKGGKLAVGFECGRVAVLDMNSLSVLLSMDCISGSSSPVISI 721

Query: 605  TWTEFKNTHSLAKNPNHSEREVPVNPAEEVIIVLFKDAKISIVGGSSENMISSSPWHLKK 664
             W    N H+L K+P HSE E+  +P +E++ +L KD+K+ ++ GS+ NMI+S P HLKK
Sbjct: 722  IWKAITNNHTLVKSPKHSESEISNDPPKELMFILTKDSKVVVIDGSTGNMINSGPMHLKK 781

Query: 665  KVIAISMEVIE---PVCGFPIEKQAEQSAEENAAKNKPTPDTSSIETKSHETEHLFSSEN 721
            +  AISM VIE   PV G   EK   QS+ E   KN+P  DT  +   S  +    SSE 
Sbjct: 782  ESTAISMYVIEDNVPVSGSSNEKLL-QSSSEAPTKNEPVQDTVPVGINSPGS----SSET 836

Query: 722  ACSGESSNDALVLLCCEDSVRLYSRKSVIQGNNKTVQKVKHKNRCCWASTIEKDEKVCGL 781
              SG    D+ VLLCCE+++RLY  KSVIQG+NK + KV+    CCW +  +KDEKV GL
Sbjct: 837  MYSGARLLDSHVLLCCENALRLYPTKSVIQGDNKPICKVELAKPCCWTTIFKKDEKVYGL 896

Query: 782  LLLFQTGAVQIRSLPDLELVMESSLMSILRWNFKANMDKTISAD-NGQITLANGSEVAFV 840
            +LL+QTGA++IRSLPDLE+V ESSLMSILRW FKANMDKTIS+  +GQI LANG E+AF+
Sbjct: 897  MLLYQTGAIEIRSLPDLEVVSESSLMSILRWAFKANMDKTISSSHDGQIALANGCELAFI 956

Query: 841  NLLAGENEFSILESSPCLHDKVLEAAAAAAFNVSSNQKKKQTTAAGILGGIVKGFRGEKM 900
            +LL GEN F I ES PCLHDKVL AAA AA  +SSNQKKKQ TA G+L GIVKGF+G K+
Sbjct: 957  SLLGGENGFRIPESFPCLHDKVLAAAADAAIGLSSNQKKKQGTAPGVLSGIVKGFKGGKV 1016

Query: 901  IHTLDDSIDPKSSFSQLGGIFSRPPFPDLSPAATNNEE-IELNIDDIEI-DEPPSMMATS 958
            IH +D S   KS+F+ L  IF R PFPD SP AT+N+E +ELNID+IEI DEP  + +TS
Sbjct: 1017 IHNVDLSASAKSNFAHLEDIFLRSPFPDPSPTATDNQEVVELNIDEIEIDDEPLPVASTS 1076

Query: 959  SHEVTNTKKEKLSERERLL-GVPDDAKPRLRTREEIIAKYRKAEDASSVAAHARDKLFER 1017
            S +V N KKEK +ERERL  G   D +PR+RTREEIIAKYRK  DASSVAAHARDKL ER
Sbjct: 1077 SRQVKNHKKEKGTERERLFQGTTADIEPRMRTREEIIAKYRKTGDASSVAAHARDKLVER 1136

Query: 1018 QDKLERISRCTEELQSGAEDFASLANELVKTMENRKWWKI 1057
            Q+KLERIS+ TEELQSGAEDFASLANELVK ME RKW++I
Sbjct: 1137 QEKLERISKRTEELQSGAEDFASLANELVKAMEGRKWYQI 1176

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|296083169|emb|CBI22805.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|255582670|ref|XP_002532114.1| nucleotide binding protein, putative [Ricinus communis] gi|223528217|gb|EEF30276.1| nucleotide binding protein, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|224140433|ref|XP_002323587.1| predicted protein [Populus trichocarpa] gi|222868217|gb|EEF05348.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|356568110|ref|XP_003552256.1| PREDICTED: uncharacterized protein LOC100776508 [Glycine max] Back     alignment and taxonomy information
>gi|356523318|ref|XP_003530287.1| PREDICTED: uncharacterized protein LOC100779801 [Glycine max] Back     alignment and taxonomy information
>gi|449440259|ref|XP_004137902.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC101217343 [Cucumis sativus] Back     alignment and taxonomy information
>gi|225448459|ref|XP_002272182.1| PREDICTED: uncharacterized protein LOC100250143 [Vitis vinifera] Back     alignment and taxonomy information
>gi|297736595|emb|CBI25466.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|307135925|gb|ADN33787.1| nucleotide binding protein [Cucumis melo subsp. melo] gi|307136468|gb|ADN34272.1| nucleotide binding protein [Cucumis melo subsp. melo] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query1057
TAIR|locus:21696721124 AT5G05570 "AT5G05570" [Arabido 0.971 0.913 0.436 7.1e-219
FB|FBgn0030412 1470 tomosyn "tomosyn" [Drosophila 0.138 0.099 0.246 1e-15
ZFIN|ZDB-GENE-041001-1611129 stxbp5a "syntaxin binding prot 0.138 0.129 0.288 3.6e-14
UNIPROTKB|Q5T5C01151 STXBP5 "Syntaxin-binding prote 0.135 0.124 0.277 2.6e-12
MGI|MGI:19260581152 Stxbp5 "syntaxin binding prote 0.136 0.125 0.279 4.1e-12
UNIPROTKB|E1BNK41152 STXBP5 "Uncharacterized protei 0.135 0.124 0.277 1.2e-11
UNIPROTKB|F1S7R81115 STXBP5 "Uncharacterized protei 0.135 0.128 0.283 1.9e-11
UNIPROTKB|C9JQS31129 STXBP5L "Syntaxin-binding prot 0.138 0.129 0.288 2.7e-11
UNIPROTKB|E9PFI21162 STXBP5L "Syntaxin-binding prot 0.138 0.125 0.288 3.2e-11
UNIPROTKB|E2R4F71152 STXBP5 "Uncharacterized protei 0.135 0.124 0.277 3.5e-11
TAIR|locus:2169672 AT5G05570 "AT5G05570" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 2114 (749.2 bits), Expect = 7.1e-219, P = 7.1e-219
 Identities = 474/1085 (43%), Positives = 660/1085 (60%)

Query:     6 DGRIKVIGGDGIEGLLISPSQLPYKNLEFLQNQGFLISITNDNEIQVWSLESRSLACCLK 65
             DGRIKVIGGD IE +L SP QLP+KNLEF+QNQGFL+SI+N+NEIQVW L+ R  A  LK
Sbjct:    65 DGRIKVIGGDNIEAILASPKQLPFKNLEFMQNQGFLVSISNENEIQVWDLDLRQPASSLK 124

Query:    66 WESNITAFSVISGSHFMYIGDENGLMSVIKYDADEGKLFQLPYNISADALSEKAGFPLLS 125
             WESNITAF+++ G+ +MY+GDE G++SV+ Y ADEGKL QLPY +  DALSE AG     
Sbjct:   125 WESNITAFAILHGTGYMYVGDEYGMVSVLNYSADEGKLLQLPYYVPTDALSEAAGLSSPI 184

Query:   126 HQPVVGVLPHPNSSGNRVLIAYENALVILWDVSEAQIIFVGGGKDLQLKDGVVDSPSEGD 185
               PVVG+L  P S G R+LIA+ N L+ LWD SE  ++ V G KDL ++   V    E  
Sbjct:   185 DYPVVGLLSQPCSKGTRLLIAFSNGLLFLWDASEDHVVLVRGNKDLPVEGKTVADSLEAS 244

Query:   186 STFLEGISEHQPEEKEISALCWASSSGSILAVGYIDGDILLWNTSTTASTKGQQTGSRNN 245
                 + +S  + + KEIS+LCWAS+ GS+LAVGY+DGDIL W+ S      GQ+    N+
Sbjct:   245 H---DELSNLELDGKEISSLCWASTDGSVLAVGYVDGDILFWDFSD-----GQKGKPSNH 296

Query:   246 VVKLELSSAERRLPVIVLHWSTNKESRSNIDGRLFVYGGDEIGSEEVLTVLSLEWSSGME 305
             VVKL+LSSAE+RLPVIV+HW  +  SR +  G+LF+YGGD IGS+EVLT+L L+WSSGM 
Sbjct:   297 VVKLQLSSAEKRLPVIVMHWCLDV-SRKSSGGKLFIYGGDIIGSDEVLTMLGLDWSSGMG 355

Query:   306 NLRCVSRVDITLTGSFADMILLSSAGATVGNHKADLFVLTSPGQLHFYDNASLTTLLSQQ 365
              L+CV R D+TL+GSFADM+L   A +        LF+LT+PGQL  YD+ SL +L+SQ+
Sbjct:   356 GLKCVGRADLTLSGSFADMVLSPIASSRQSG--VFLFLLTNPGQLQAYDDTSLASLMSQK 413

Query:   366 EKKPSVCPVEFPGVIPISDPIMTVAEFMLLPFGGHSSKGLSEIATFTKLHSSHTQAGH-I 424
             E K SV P+ +P V+P  DP MTVA F  L     +S  LSEI    K  +  T +G   
Sbjct:   414 ENKISVSPLPYPMVVPTMDPHMTVATFSALNVNDKTSLALSEIVLAAKARTPRTPSGESA 473

Query:   425 KWPLSGGVPSPVPITKCHSVDRVYLAGYHDGSVRIWDATYPVFKLICALDAEVQGIEVAG 484
             +WPL+GGVPS V   K   ++R+Y+AGY DGS+RIWDATYP   LI  L+ +   I++ G
Sbjct:   474 QWPLTGGVPSHVDDYK---LERLYMAGYQDGSMRIWDATYPCLSLIYILEPKASVIDITG 530

Query:   485 SRAPVSTLSFCFINSSLAVGNEFGLVYIYNL-----NGSLDA-----KNFLFVLETKSE- 533
               A V+   FC   S LAVGNE G+V +Y L      G+L+      K  L ++ T +  
Sbjct:   531 VDASVTAFCFCSKTSCLAVGNECGMVRLYKLVGHTSGGTLEVVTNTEKKGLAIVTTLTLW 590

Query:   534 -VHALPE--GKISLCR-----------AVFSLVNSPVRALQFTSSGAKLAVGFECGRVAV 579
               +AL    G + +             A FS ++SPV  LQF  S  +LAVGF+CG+VAV
Sbjct:   591 ICYALSHAVGSLLVAHHLHQEDGPQWLAAFSFLSSPVCTLQFVQSTRRLAVGFKCGKVAV 650

Query:   580 LDMNLLSVLFFTDDXXXXXXXXXXM-TWTEFKNTHSLAKNPNHSEREVPVNPAEEVII-V 637
             LD+ + SVLF T+           +   +    T S +   +H+     +N  +++++  
Sbjct:   651 LDIGVPSVLFVTNSLSDSGSPIKSLYVKSSSAPTGSKSDPTDHNS----INSEDDLLLCA 706

Query:   638 LFKDAKISIVGGSSENMISSSPWHLKKKVIAISMEVIEPVCGFPIEKQAEQSAEENAAKN 697
             + KD +  ++ G++  +++S    LK    AI M +IE  C    E  +E+ AE  + K+
Sbjct:   707 MTKDGQTILLDGNTGKILASCLRPLKNPT-AICMHIIEN-CYENYETPSEKPAENPSGKD 764

Query:   698 KPTPDTSSIE-TKSH--ETEHLFSSENACSGESSNDALVLLCCEDSVRLYSRKSVIQGNN 754
             K    +  I+ ++SH  + E    +E     +   ++L L+C ED++RLY+ KS+ QG+ 
Sbjct:   765 KHENKSHIIKASESHSPDGEQNAVTETKLIDQIFANSLFLMCSEDALRLYTVKSLSQGSL 824

Query:   755 KTVQKVKHKNRCCWASTIEKDEKVCGLLLLFQTGAVQIRSLPDLELVMESSLMSILRWNF 814
             +++ +V     CCW   ++KD + C +LL ++TG ++IRS P+LE+V ESSL+S+LRWNF
Sbjct:   825 ESIMEVNLPRPCCWMGILKKDGRECAVLLFYRTGHIEIRSFPNLEVVGESSLLSLLRWNF 884

Query:   815 KANMDKTISADN-GQITLANGSEVAFVNLLAGENEFSILESSPCLHDKVLEXXXXXXFNV 873
             K NM+KT+ +D+ G + L NG EVA ++ LA  N F + ES P LHDKVL       F+ 
Sbjct:   885 KPNMEKTVCSDDFGHVVLVNGCEVAILSFLAHANGFRLPESLPLLHDKVLAAAADATFSH 944

Query:   874 SSNQKKKQTTAAGILGGIVKGFRGEKMIHTLDDSIDPKSSFSQLGGIFSRPPFPDLSPAA 933
              S  KK    A   L  I+KGFR      + +  +D    FS LG IFS PP+   S   
Sbjct:   945 ISVHKKNHDGAPKFLSNIIKGFRS-----STEQKMDQVQDFSHLGNIFSNPPYLKPSDTG 999

Query:   934 TXXXXXXXXXXXXXXXXPPSMMATSSHEVTNTKKEKLSERERLL-GVPDDAKPRLRTREE 992
                               P ++   + +    KK+K +++E+L  G   DA+P+ RT +E
Sbjct:  1000 GDDEKIVELNIDDIEIDEPVIILPLTEKDKKEKKDKRTDKEKLFDGASSDAQPKTRTVDE 1059

Query:   993 IIAKYRKAEDASSVAAHARDKLFERQDKLERISRCTEELQSGAEDFASLANELVKTMENR 1052
             I +KYRKA + S++A+ A+DKL ER +KLERIS+ T ELQ  AE+FAS+A+EL K ME R
Sbjct:  1060 IKSKYRKAGETSAIASQAKDKLHERGEKLERISQRTAELQDNAENFASMAHELAKQMEKR 1119

Query:  1053 KWWKI 1057
             KWW I
Sbjct:  1120 KWWNI 1124
GO:0000166 "nucleotide binding" evidence=ISS
GO:0003676 "nucleic acid binding" evidence=IEA
GO:0005634 "nucleus" evidence=ISM
GO:0008168 "methyltransferase activity" evidence=IEA
GO:0016021 "integral to membrane" evidence=IEA
GO:0016192 "vesicle-mediated transport" evidence=IEA
GO:0032259 "methylation" evidence=IEA
GO:0005886 "plasma membrane" evidence=IDA
FB|FBgn0030412 tomosyn "tomosyn" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-041001-161 stxbp5a "syntaxin binding protein 5a (tomosyn)" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|Q5T5C0 STXBP5 "Syntaxin-binding protein 5" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
MGI|MGI:1926058 Stxbp5 "syntaxin binding protein 5 (tomosyn)" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|E1BNK4 STXBP5 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|F1S7R8 STXBP5 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|C9JQS3 STXBP5L "Syntaxin-binding protein 5-like" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|E9PFI2 STXBP5L "Syntaxin-binding protein 5-like" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|E2R4F7 STXBP5 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query1057
pfam0095789 pfam00957, Synaptobrevin, Synaptobrevin 2e-04
cd00200289 cd00200, WD40, WD40 domain, found in a number of e 7e-04
>gnl|CDD|201526 pfam00957, Synaptobrevin, Synaptobrevin Back     alignment and domain information 
 Score = 41.0 bits (97), Expect = 2e-04
 Identities = 19/45 (42%), Positives = 26/45 (57%), Gaps = 4/45 (8%)

Query: 1012 DKLFERQDKLERISRCTEELQSGAEDFASLANELVKTMENRKWWK 1056
            DK+ ER +KL+ +   TE LQS A+ F   A +L + M    WWK
Sbjct: 24   DKVLERGEKLDLLVDKTENLQSSAQQFRKQARKLKRKM----WWK 64

Length = 89
>gnl|CDD|238121 cd00200, WD40, WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and bottom surface of the propeller are proposed to coordinate interactions with other proteins and/or small ligands; 7 copies of the repeat are present in this alignment Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 1057
KOG0319775 consensus WD40-repeat-containing subunit of the 18 100.0
KOG0271480 consensus Notchless-like WD40 repeat-containing pr 100.0
KOG0291893 consensus WD40-repeat-containing subunit of the 18 100.0
KOG0319775 consensus WD40-repeat-containing subunit of the 18 100.0
KOG1983993 consensus Tomosyn and related SNARE-interacting pr 100.0
KOG0271480 consensus Notchless-like WD40 repeat-containing pr 100.0
KOG0318603 consensus WD40 repeat stress protein/actin interac 100.0
KOG0318603 consensus WD40 repeat stress protein/actin interac 100.0
KOG0291893 consensus WD40-repeat-containing subunit of the 18 100.0
KOG0306888 consensus WD40-repeat-containing subunit of the 18 99.97
PF08596395 Lgl_C: Lethal giant larvae(Lgl) like, C-terminal; 99.97
KOG0272459 consensus U4/U6 small nuclear ribonucleoprotein Pr 99.97
KOG0272459 consensus U4/U6 small nuclear ribonucleoprotein Pr 99.97
KOG0306888 consensus WD40-repeat-containing subunit of the 18 99.96
KOG1539910 consensus WD repeat protein [General function pred 99.95
KOG0273524 consensus Beta-transducin family (WD-40 repeat) pr 99.95
KOG0286343 consensus G-protein beta subunit [General function 99.95
KOG0279315 consensus G protein beta subunit-like protein [Sig 99.95
KOG1539910 consensus WD repeat protein [General function pred 99.94
PLN00181793 protein SPA1-RELATED; Provisional 99.94
KOG0296399 consensus Angio-associated migratory cell protein 99.94
KOG0315311 consensus G-protein beta subunit-like protein (con 99.93
KOG0263707 consensus Transcription initiation factor TFIID, s 99.93
KOG0276794 consensus Vesicle coat complex COPI, beta' subunit 99.93
KOG0315311 consensus G-protein beta subunit-like protein (con 99.93
PLN00181793 protein SPA1-RELATED; Provisional 99.93
KOG0263707 consensus Transcription initiation factor TFIID, s 99.93
KOG0273524 consensus Beta-transducin family (WD-40 repeat) pr 99.92
KOG0286343 consensus G-protein beta subunit [General function 99.92
KOG0279315 consensus G protein beta subunit-like protein [Sig 99.92
KOG0292 1202 consensus Vesicle coat complex COPI, alpha subunit 99.92
KOG0284464 consensus Polyadenylation factor I complex, subuni 99.92
cd00200289 WD40 WD40 domain, found in a number of eukaryotic 99.92
KOG0295406 consensus WD40 repeat-containing protein [Function 99.91
KOG2106626 consensus Uncharacterized conserved protein, conta 99.91
cd00200289 WD40 WD40 domain, found in a number of eukaryotic 99.91
KOG14081080 consensus WD40 repeat protein [Function unknown] 99.9
KOG0266456 consensus WD40 repeat-containing protein [General 99.9
KOG2048691 consensus WD40 repeat protein [General function pr 99.89
KOG0284464 consensus Polyadenylation factor I complex, subuni 99.89
KOG0285460 consensus Pleiotropic regulator 1 [RNA processing 99.89
KOG0296399 consensus Angio-associated migratory cell protein 99.89
KOG2048691 consensus WD40 repeat protein [General function pr 99.89
KOG0285460 consensus Pleiotropic regulator 1 [RNA processing 99.89
KOG0266456 consensus WD40 repeat-containing protein [General 99.89
KOG0265338 consensus U5 snRNP-specific protein-like factor an 99.88
KOG0295406 consensus WD40 repeat-containing protein [Function 99.88
KOG0282503 consensus mRNA splicing factor [Function unknown] 99.88
KOG0645312 consensus WD40 repeat protein [General function pr 99.88
KOG0276794 consensus Vesicle coat complex COPI, beta' subunit 99.87
KOG0645312 consensus WD40 repeat protein [General function pr 99.86
KOG0288459 consensus WD40 repeat protein TipD [General functi 99.86
KOG2106626 consensus Uncharacterized conserved protein, conta 99.86
KOG0316307 consensus Conserved WD40 repeat-containing protein 99.85
KOG0292 1202 consensus Vesicle coat complex COPI, alpha subunit 99.85
KOG0281499 consensus Beta-TrCP (transducin repeats containing 99.85
KOG0310487 consensus Conserved WD40 repeat-containing protein 99.84
KOG0293519 consensus WD40 repeat-containing protein [Function 99.84
KOG0281499 consensus Beta-TrCP (transducin repeats containing 99.84
KOG0293519 consensus WD40 repeat-containing protein [Function 99.84
KOG0646476 consensus WD40 repeat protein [General function pr 99.84
KOG0313423 consensus Microtubule binding protein YTM1 (contai 99.84
PTZ00421493 coronin; Provisional 99.83
KOG0772641 consensus Uncharacterized conserved protein, conta 99.83
KOG0265338 consensus U5 snRNP-specific protein-like factor an 99.83
KOG14081080 consensus WD40 repeat protein [Function unknown] 99.83
KOG1407313 consensus WD40 repeat protein [Function unknown] 99.83
KOG0305484 consensus Anaphase promoting complex, Cdc20, Cdh1, 99.83
KOG0310487 consensus Conserved WD40 repeat-containing protein 99.83
KOG0313423 consensus Microtubule binding protein YTM1 (contai 99.82
KOG1063764 consensus RNA polymerase II elongator complex, sub 99.82
KOG0772641 consensus Uncharacterized conserved protein, conta 99.82
KOG0282503 consensus mRNA splicing factor [Function unknown] 99.82
KOG0316307 consensus Conserved WD40 repeat-containing protein 99.82
KOG0277311 consensus Peroxisomal targeting signal type 2 rece 99.81
KOG0275508 consensus Conserved WD40 repeat-containing protein 99.81
KOG0643327 consensus Translation initiation factor 3, subunit 99.81
KOG0973942 consensus Histone transcription regulator HIRA, WD 99.8
KOG0283712 consensus WD40 repeat-containing protein [Function 99.8
KOG2096420 consensus WD40 repeat protein [General function pr 99.8
KOG0299479 consensus U3 snoRNP-associated protein (contains W 99.79
KOG0283712 consensus WD40 repeat-containing protein [Function 99.79
KOG0278334 consensus Serine/threonine kinase receptor-associa 99.79
KOG0289506 consensus mRNA splicing factor [General function p 99.79
PTZ00421493 coronin; Provisional 99.79
KOG1063764 consensus RNA polymerase II elongator complex, sub 99.78
KOG0641350 consensus WD40 repeat protein [General function pr 99.78
KOG0275508 consensus Conserved WD40 repeat-containing protein 99.78
PTZ00420568 coronin; Provisional 99.78
KOG0274537 consensus Cdc4 and related F-box and WD-40 protein 99.78
KOG0278334 consensus Serine/threonine kinase receptor-associa 99.78
KOG1036323 consensus Mitotic spindle checkpoint protein BUB3, 99.77
KOG1407313 consensus WD40 repeat protein [Function unknown] 99.77
KOG0647347 consensus mRNA export protein (contains WD40 repea 99.77
KOG1273405 consensus WD40 repeat protein [General function pr 99.76
KOG0643327 consensus Translation initiation factor 3, subunit 99.76
KOG0289506 consensus mRNA splicing factor [General function p 99.76
KOG0277311 consensus Peroxisomal targeting signal type 2 rece 99.76
KOG0305484 consensus Anaphase promoting complex, Cdc20, Cdh1, 99.76
KOG0973 942 consensus Histone transcription regulator HIRA, WD 99.76
KOG0288459 consensus WD40 repeat protein TipD [General functi 99.76
KOG2055514 consensus WD40 repeat protein [General function pr 99.76
KOG0641350 consensus WD40 repeat protein [General function pr 99.75
KOG0268433 consensus Sof1-like rRNA processing protein (conta 99.75
KOG0299479 consensus U3 snoRNP-associated protein (contains W 99.74
KOG1446311 consensus Histone H3 (Lys4) methyltransferase comp 99.74
KOG0300481 consensus WD40 repeat-containing protein [Function 99.74
KOG1963792 consensus WD40 repeat protein [General function pr 99.74
KOG0274537 consensus Cdc4 and related F-box and WD-40 protein 99.74
KOG1036323 consensus Mitotic spindle checkpoint protein BUB3, 99.73
PTZ00420568 coronin; Provisional 99.73
TIGR03866300 PQQ_ABC_repeats PQQ-dependent catabolism-associate 99.73
KOG0640430 consensus mRNA cleavage stimulating factor complex 99.72
KOG0639705 consensus Transducin-like enhancer of split protei 99.71
KOG0640430 consensus mRNA cleavage stimulating factor complex 99.71
KOG0268433 consensus Sof1-like rRNA processing protein (conta 99.7
KOG0308735 consensus Conserved WD40 repeat-containing protein 99.7
KOG0294362 consensus WD40 repeat-containing protein [Function 99.7
KOG0300481 consensus WD40 repeat-containing protein [Function 99.69
KOG2096420 consensus WD40 repeat protein [General function pr 99.69
KOG0647347 consensus mRNA export protein (contains WD40 repea 99.69
KOG2055514 consensus WD40 repeat protein [General function pr 99.68
KOG0294362 consensus WD40 repeat-containing protein [Function 99.68
KOG0308735 consensus Conserved WD40 repeat-containing protein 99.68
KOG1446311 consensus Histone H3 (Lys4) methyltransferase comp 99.68
TIGR03866300 PQQ_ABC_repeats PQQ-dependent catabolism-associate 99.68
KOG0301745 consensus Phospholipase A2-activating protein (con 99.68
KOG14451012 consensus Tumor-specific antigen (contains WD repe 99.67
KOG0269839 consensus WD40 repeat-containing protein [Function 99.65
KOG0301745 consensus Phospholipase A2-activating protein (con 99.64
KOG2445361 consensus Nuclear pore complex component (sc Seh1) 99.64
KOG0321720 consensus WD40 repeat-containing protein L2DTL [Fu 99.63
KOG1274 933 consensus WD40 repeat protein [General function pr 99.62
KOG0267 825 consensus Microtubule severing protein katanin p80 99.62
KOG1273405 consensus WD40 repeat protein [General function pr 99.62
KOG4283397 consensus Transcription-coupled repair protein CSA 99.62
KOG1332299 consensus Vesicle coat complex COPII, subunit SEC1 99.62
KOG0264422 consensus Nucleosome remodeling factor, subunit CA 99.62
KOG0264422 consensus Nucleosome remodeling factor, subunit CA 99.61
KOG2445361 consensus Nuclear pore complex component (sc Seh1) 99.61
KOG1332299 consensus Vesicle coat complex COPII, subunit SEC1 99.6
KOG0650733 consensus WD40 repeat nucleolar protein Bop1, invo 99.6
KOG1274 933 consensus WD40 repeat protein [General function pr 99.6
KOG15171387 consensus Guanine nucleotide binding protein MIP1 99.57
KOG0650733 consensus WD40 repeat nucleolar protein Bop1, invo 99.56
KOG0639705 consensus Transducin-like enhancer of split protei 99.56
KOG0302440 consensus Ribosome Assembly protein [General funct 99.56
KOG0322323 consensus G-protein beta subunit-like protein GNB1 99.54
KOG1538 1081 consensus Uncharacterized conserved protein WDR10, 99.54
KOG1034385 consensus Transcriptional repressor EED/ESC/FIE, r 99.53
KOG0270463 consensus WD40 repeat-containing protein [Function 99.52
KOG4328498 consensus WD40 protein [Function unknown] 99.52
KOG0322323 consensus G-protein beta subunit-like protein GNB1 99.5
KOG0269 839 consensus WD40 repeat-containing protein [Function 99.49
KOG0646476 consensus WD40 repeat protein [General function pr 99.49
KOG4283397 consensus Transcription-coupled repair protein CSA 99.48
COG2319466 FOG: WD40 repeat [General function prediction only 99.48
KOG0267825 consensus Microtubule severing protein katanin p80 99.47
KOG15171387 consensus Guanine nucleotide binding protein MIP1 99.45
KOG0302440 consensus Ribosome Assembly protein [General funct 99.45
KOG4378673 consensus Nuclear protein COP1 [Signal transductio 99.43
KOG1034385 consensus Transcriptional repressor EED/ESC/FIE, r 99.42
KOG1587555 consensus Cytoplasmic dynein intermediate chain [C 99.41
KOG12401431 consensus Protein kinase containing WD40 repeats [ 99.41
PRK11028330 6-phosphogluconolactonase; Provisional 99.4
KOG1963792 consensus WD40 repeat protein [General function pr 99.4
KOG0321720 consensus WD40 repeat-containing protein L2DTL [Fu 99.39
KOG1538 1081 consensus Uncharacterized conserved protein WDR10, 99.38
KOG0307 1049 consensus Vesicle coat complex COPII, subunit SEC3 99.38
KOG0270463 consensus WD40 repeat-containing protein [Function 99.36
KOG14451012 consensus Tumor-specific antigen (contains WD repe 99.35
KOG2919406 consensus Guanine nucleotide-binding protein [Gene 99.35
KOG0307 1049 consensus Vesicle coat complex COPII, subunit SEC3 99.33
COG2319466 FOG: WD40 repeat [General function prediction only 99.33
KOG0290364 consensus Conserved WD40 repeat-containing protein 99.29
KOG12401431 consensus Protein kinase containing WD40 repeats [ 99.26
KOG4328498 consensus WD40 protein [Function unknown] 99.25
KOG0649325 consensus WD40 repeat protein [General function pr 99.25
KOG0303472 consensus Actin-binding protein Coronin, contains 99.25
KOG1188376 consensus WD40 repeat protein [General function pr 99.24
KOG4378673 consensus Nuclear protein COP1 [Signal transductio 99.23
KOG0771398 consensus Prolactin regulatory element-binding pro 99.22
KOG0642577 consensus Cell-cycle nuclear protein, contains WD- 99.21
KOG1009434 consensus Chromatin assembly complex 1 subunit B/C 99.19
KOG1007370 consensus WD repeat protein TSSC1, WD repeat super 99.19
KOG2110391 consensus Uncharacterized conserved protein, conta 99.19
KOG2111346 consensus Uncharacterized conserved protein, conta 99.18
KOG1188376 consensus WD40 repeat protein [General function pr 99.14
PRK11028330 6-phosphogluconolactonase; Provisional 99.13
KOG1009434 consensus Chromatin assembly complex 1 subunit B/C 99.12
KOG0642577 consensus Cell-cycle nuclear protein, contains WD- 99.11
KOG1587555 consensus Cytoplasmic dynein intermediate chain [C 99.11
KOG1007370 consensus WD repeat protein TSSC1, WD repeat super 99.1
PF02239369 Cytochrom_D1: Cytochrome D1 heme domain; PDB: 1NNO 99.1
KOG0290364 consensus Conserved WD40 repeat-containing protein 99.07
KOG2394636 consensus WD40 protein DMR-N9 [General function pr 99.06
KOG1524737 consensus WD40 repeat-containing protein CHE-2 [Ge 99.06
KOG4497447 consensus Uncharacterized conserved protein WDR8, 99.05
KOG4227609 consensus WD40 repeat protein [General function pr 99.05
KOG4227609 consensus WD40 repeat protein [General function pr 99.05
PRK01742429 tolB translocation protein TolB; Provisional 99.04
KOG1524737 consensus WD40 repeat-containing protein CHE-2 [Ge 99.03
KOG0303472 consensus Actin-binding protein Coronin, contains 99.02
KOG0771398 consensus Prolactin regulatory element-binding pro 99.0
KOG2111346 consensus Uncharacterized conserved protein, conta 98.99
KOG19121062 consensus WD40 repeat protein [General function pr 98.98
KOG0649325 consensus WD40 repeat protein [General function pr 98.97
KOG2919406 consensus Guanine nucleotide-binding protein [Gene 98.96
PRK05137435 tolB translocation protein TolB; Provisional 98.95
KOG2110391 consensus Uncharacterized conserved protein, conta 98.95
KOG19121062 consensus WD40 repeat protein [General function pr 98.93
KOG2041 1189 consensus WD40 repeat protein [General function pr 98.92
PRK03629429 tolB translocation protein TolB; Provisional 98.9
KOG2321703 consensus WD40 repeat protein [General function pr 98.89
PF08662194 eIF2A: Eukaryotic translation initiation factor eI 98.88
PRK02889427 tolB translocation protein TolB; Provisional 98.88
PF02239369 Cytochrom_D1: Cytochrome D1 heme domain; PDB: 1NNO 98.87
KOG3881412 consensus Uncharacterized conserved protein [Funct 98.86
KOG1334559 consensus WD40 repeat protein [General function pr 98.86
KOG06441113 consensus Uncharacterized conserved protein, conta 98.85
PF04762928 IKI3: IKI3 family; InterPro: IPR006849 Members of 98.84
KOG3881412 consensus Uncharacterized conserved protein [Funct 98.84
PF08662194 eIF2A: Eukaryotic translation initiation factor eI 98.84
KOG4497447 consensus Uncharacterized conserved protein WDR8, 98.83
KOG2139445 consensus WD40 repeat protein [General function pr 98.8
PRK01742429 tolB translocation protein TolB; Provisional 98.78
PRK04922433 tolB translocation protein TolB; Provisional 98.78
KOG0644 1113 consensus Uncharacterized conserved protein, conta 98.77
KOG10642439 consensus RAVE (regulator of V-ATPase assembly) co 98.76
TIGR02800417 propeller_TolB tol-pal system beta propeller repea 98.74
KOG2394636 consensus WD40 protein DMR-N9 [General function pr 98.74
KOG1523361 consensus Actin-related protein Arp2/3 complex, su 98.69
KOG1272545 consensus WD40-repeat-containing subunit of the 18 98.69
PF04762928 IKI3: IKI3 family; InterPro: IPR006849 Members of 98.68
KOG4547541 consensus WD40 repeat-containing protein [General 98.67
KOG1523361 consensus Actin-related protein Arp2/3 complex, su 98.65
PRK00178430 tolB translocation protein TolB; Provisional 98.65
KOG0974967 consensus WD-repeat protein WDR6, WD repeat superf 98.63
PF10282345 Lactonase: Lactonase, 7-bladed beta-propeller; Int 98.63
PRK04792448 tolB translocation protein TolB; Provisional 98.62
PRK03629429 tolB translocation protein TolB; Provisional 98.61
KOG2321703 consensus WD40 repeat protein [General function pr 98.6
KOG1272545 consensus WD40-repeat-containing subunit of the 18 98.6
KOG1334559 consensus WD40 repeat protein [General function pr 98.56
TIGR03300377 assembly_YfgL outer membrane assembly lipoprotein 98.55
KOG2315566 consensus Predicted translation initiation factor 98.55
PRK04922433 tolB translocation protein TolB; Provisional 98.5
TIGR02658352 TTQ_MADH_Hv methylamine dehydrogenase heavy chain. 98.49
KOG2041 1189 consensus WD40 repeat protein [General function pr 98.48
KOG1310 758 consensus WD40 repeat protein [General function pr 98.44
KOG2139445 consensus WD40 repeat protein [General function pr 98.43
PRK05137435 tolB translocation protein TolB; Provisional 98.41
KOG1310 758 consensus WD40 repeat protein [General function pr 98.4
KOG3914390 consensus WD repeat protein WDR4 [Function unknown 98.32
PRK02889427 tolB translocation protein TolB; Provisional 98.31
PRK01029428 tolB translocation protein TolB; Provisional 98.3
KOG0974 967 consensus WD-repeat protein WDR6, WD repeat superf 98.3
TIGR03300377 assembly_YfgL outer membrane assembly lipoprotein 98.29
KOG4547541 consensus WD40 repeat-containing protein [General 98.29
KOG2314698 consensus Translation initiation factor 3, subunit 98.21
COG2706346 3-carboxymuconate cyclase [Carbohydrate transport 98.2
COG4946668 Uncharacterized protein related to the periplasmic 98.19
TIGR02800417 propeller_TolB tol-pal system beta propeller repea 98.18
PF10282345 Lactonase: Lactonase, 7-bladed beta-propeller; Int 98.16
TIGR02658352 TTQ_MADH_Hv methylamine dehydrogenase heavy chain. 98.15
KOG1354433 consensus Serine/threonine protein phosphatase 2A, 98.15
PF0040039 WD40: WD domain, G-beta repeat; InterPro: IPR01978 98.14
KOG2314698 consensus Translation initiation factor 3, subunit 98.13
PRK04792448 tolB translocation protein TolB; Provisional 98.12
KOG1409404 consensus Uncharacterized conserved protein, conta 98.11
KOG41901034 consensus Uncharacterized conserved protein [Funct 98.08
PRK00178430 tolB translocation protein TolB; Provisional 98.08
PRK01029428 tolB translocation protein TolB; Provisional 98.05
KOG3914390 consensus WD repeat protein WDR4 [Function unknown 98.03
PF0095789 Synaptobrevin: Synaptobrevin; InterPro: IPR001388 98.01
COG4946668 Uncharacterized protein related to the periplasmic 97.97
KOG10642439 consensus RAVE (regulator of V-ATPase assembly) co 97.96
PRK04043419 tolB translocation protein TolB; Provisional 97.94
COG5354561 Uncharacterized protein, contains Trp-Asp (WD) rep 97.91
KOG0860116 consensus Synaptobrevin/VAMP-like protein [Intrace 97.91
PLN029191057 haloacid dehalogenase-like hydrolase family protei 97.9
KOG0280339 consensus Uncharacterized conserved protein [Amino 97.87
PLN029191057 haloacid dehalogenase-like hydrolase family protei 97.86
PF11768545 DUF3312: Protein of unknown function (DUF3312); In 97.86
COG5354561 Uncharacterized protein, contains Trp-Asp (WD) rep 97.83
PF11768545 DUF3312: Protein of unknown function (DUF3312); In 97.8
PF15492282 Nbas_N: Neuroblastoma-amplified sequence, N termin 97.79
KOG2695425 consensus WD40 repeat protein [General function pr 97.77
KOG0309 1081 consensus Conserved WD40 repeat-containing protein 97.71
PF0040039 WD40: WD domain, G-beta repeat; InterPro: IPR01978 97.71
PRK11138394 outer membrane biogenesis protein BamB; Provisiona 97.68
COG5170460 CDC55 Serine/threonine protein phosphatase 2A, reg 97.66
KOG4532344 consensus WD40-like repeat containing protein [Gen 97.65
KOG2315566 consensus Predicted translation initiation factor 97.61
COG2706346 3-carboxymuconate cyclase [Carbohydrate transport 97.6
KOG2114933 consensus Vacuolar assembly/sorting protein PEP5/V 97.55
KOG4714319 consensus Nucleoporin [Nuclear structure] 97.55
KOG4714319 consensus Nucleoporin [Nuclear structure] 97.54
KOG4532344 consensus WD40-like repeat containing protein [Gen 97.52
PF13360238 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 97.49
PRK04043419 tolB translocation protein TolB; Provisional 97.49
KOG2066846 consensus Vacuolar assembly/sorting protein VPS41 97.47
KOG1409404 consensus Uncharacterized conserved protein, conta 97.43
KOG1645463 consensus RING-finger-containing E3 ubiquitin liga 97.43
KOG1354433 consensus Serine/threonine protein phosphatase 2A, 97.43
PF15492282 Nbas_N: Neuroblastoma-amplified sequence, N termin 97.43
KOG0280339 consensus Uncharacterized conserved protein [Amino 97.42
KOG1645463 consensus RING-finger-containing E3 ubiquitin liga 97.37
KOG3617 1416 consensus WD40 and TPR repeat-containing protein [ 97.33
PF13360238 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 97.33
KOG3621726 consensus WD40 repeat-containing protein [General 97.27
KOG2066 846 consensus Vacuolar assembly/sorting protein VPS41 97.27
PRK11138394 outer membrane biogenesis protein BamB; Provisiona 97.27
KOG41901034 consensus Uncharacterized conserved protein [Funct 97.25
KOG4640 665 consensus Anaphase-promoting complex (APC), subuni 97.23
KOG2695425 consensus WD40 repeat protein [General function pr 97.22
KOG1920 1265 consensus IkappaB kinase complex, IKAP component [ 97.07
PF08450246 SGL: SMP-30/Gluconolaconase/LRE-like region; Inter 97.03
PF08450246 SGL: SMP-30/Gluconolaconase/LRE-like region; Inter 97.0
KOG0882558 consensus Cyclophilin-related peptidyl-prolyl cis- 97.0
PF03178321 CPSF_A: CPSF A subunit region; InterPro: IPR004871 96.96
KOG2079 1206 consensus Vacuolar assembly/sorting protein VPS8 [ 96.84
KOG2114 933 consensus Vacuolar assembly/sorting protein PEP5/V 96.84
COG5170460 CDC55 Serine/threonine protein phosphatase 2A, reg 96.83
KOG0859217 consensus Synaptobrevin/VAMP-like protein [Intrace 96.75
PF00780275 CNH: CNH domain; InterPro: IPR001180 Based on sequ 96.73
smart0032040 WD40 WD40 repeats. Note that these repeats are per 96.7
PF14655415 RAB3GAP2_N: Rab3 GTPase-activating protein regulat 96.56
KOG0309 1081 consensus Conserved WD40 repeat-containing protein 96.55
PF08596395 Lgl_C: Lethal giant larvae(Lgl) like, C-terminal; 96.55
KOG4649354 consensus PQQ (pyrrolo-quinoline quinone) repeat p 96.5
KOG4640665 consensus Anaphase-promoting complex (APC), subuni 96.45
PRK02888635 nitrous-oxide reductase; Validated 96.4
KOG0882558 consensus Cyclophilin-related peptidyl-prolyl cis- 96.33
PF14783111 BBS2_Mid: Ciliary BBSome complex subunit 2, middle 96.33
PF06977248 SdiA-regulated: SdiA-regulated; InterPro: IPR00972 96.29
KOG12751118 consensus PAB-dependent poly(A) ribonuclease, subu 96.25
KOG3621 726 consensus WD40 repeat-containing protein [General 96.2
PF07433305 DUF1513: Protein of unknown function (DUF1513); In 96.15
KOG1920 1265 consensus IkappaB kinase complex, IKAP component [ 96.14
PF07433305 DUF1513: Protein of unknown function (DUF1513); In 96.02
PRK02888635 nitrous-oxide reductase; Validated 95.93
PF14783111 BBS2_Mid: Ciliary BBSome complex subunit 2, middle 95.88
KOG1275 1118 consensus PAB-dependent poly(A) ribonuclease, subu 95.68
COG3204316 Uncharacterized protein conserved in bacteria [Fun 95.64
PF08553794 VID27: VID27 cytoplasmic protein; InterPro: IPR013 95.61
KOG2395644 consensus Protein involved in vacuole import and d 95.5
PF08553794 VID27: VID27 cytoplasmic protein; InterPro: IPR013 95.48
PF03178321 CPSF_A: CPSF A subunit region; InterPro: IPR004871 95.46
PF06433342 Me-amine-dh_H: Methylamine dehydrogenase heavy cha 95.28
KOG2079 1206 consensus Vacuolar assembly/sorting protein VPS8 [ 95.27
smart0032040 WD40 WD40 repeats. Note that these repeats are per 95.22
KOG2444238 consensus WD40 repeat protein [General function pr 95.22
COG0823425 TolB Periplasmic component of the Tol biopolymer t 95.2
KOG3617 1416 consensus WD40 and TPR repeat-containing protein [ 95.17
PF00780275 CNH: CNH domain; InterPro: IPR001180 Based on sequ 94.95
PF10647253 Gmad1: Lipoprotein LpqB beta-propeller domain; Int 94.52
COG3391381 Uncharacterized conserved protein [Function unknow 94.5
PRK13616591 lipoprotein LpqB; Provisional 94.44
KOG4649354 consensus PQQ (pyrrolo-quinoline quinone) repeat p 94.42
COG0823425 TolB Periplasmic component of the Tol biopolymer t 94.38
PF1289447 Apc4_WD40: Anaphase-promoting complex subunit 4 WD 94.29
KOG18321516 consensus HIV-1 Vpr-binding protein [Cell cycle co 94.19
PF04841410 Vps16_N: Vps16, N-terminal region; InterPro: IPR00 94.16
KOG4499310 consensus Ca2+-binding protein Regucalcin/SMP30 [I 94.09
PF04053443 Coatomer_WDAD: Coatomer WD associated region ; Int 93.9
PF08366105 LLGL: LLGL2; InterPro: IPR013577 This domain is fo 93.87
PF1289447 Apc4_WD40: Anaphase-promoting complex subunit 4 WD 93.57
PF14727418 PHTB1_N: PTHB1 N-terminus 93.52
KOG3630 1405 consensus Nuclear pore complex, Nup214/CAN compone 93.03
COG3391381 Uncharacterized conserved protein [Function unknow 92.71
PF10168717 Nup88: Nuclear pore component; InterPro: IPR019321 92.69
KOG18321516 consensus HIV-1 Vpr-binding protein [Cell cycle co 92.67
PF14781136 BBS2_N: Ciliary BBSome complex subunit 2, N-termin 92.65
cd00216488 PQQ_DH Dehydrogenases with pyrrolo-quinoline quino 92.51
PF06977248 SdiA-regulated: SdiA-regulated; InterPro: IPR00972 92.41
KOG2395644 consensus Protein involved in vacuole import and d 92.4
KOG2444238 consensus WD40 repeat protein [General function pr 91.79
PF14761215 HPS3_N: Hermansky-Pudlak syndrome 3 91.43
cd00216488 PQQ_DH Dehydrogenases with pyrrolo-quinoline quino 91.33
PF06433342 Me-amine-dh_H: Methylamine dehydrogenase heavy cha 91.31
PF10168 717 Nup88: Nuclear pore component; InterPro: IPR019321 90.83
KOG18971096 consensus Damage-specific DNA binding complex, sub 90.56
PF04053443 Coatomer_WDAD: Coatomer WD associated region ; Int 90.56
PF10395 670 Utp8: Utp8 family; InterPro: IPR018843 Utp8 is an 90.39
PF14870302 PSII_BNR: Photosynthesis system II assembly factor 89.71
PF1097943 DUF2786: Protein of unknown function (DUF2786); In 89.43
PF08728717 CRT10: CRT10; InterPro: IPR014839 CRT10 is a trans 88.55
KOG18971096 consensus Damage-specific DNA binding complex, sub 88.53
COG3386307 Gluconolactonase [Carbohydrate transport and metab 87.76
KOG3630 1405 consensus Nuclear pore complex, Nup214/CAN compone 87.7
PRK13616591 lipoprotein LpqB; Provisional 87.1
PF07569219 Hira: TUP1-like enhancer of split; InterPro: IPR01 86.28
PF14655415 RAB3GAP2_N: Rab3 GTPase-activating protein regulat 86.13
PF14781136 BBS2_N: Ciliary BBSome complex subunit 2, N-termin 86.04
KOG1008 783 consensus Uncharacterized conserved protein, conta 85.8
KOG1008783 consensus Uncharacterized conserved protein, conta 85.7
PF13449326 Phytase-like: Esterase-like activity of phytase 85.3
PF1031343 DUF2415: Uncharacterised protein domain (DUF2415); 85.21
PF12234 631 Rav1p_C: RAVE protein 1 C terminal; InterPro: IPR0 84.91
PF10647253 Gmad1: Lipoprotein LpqB beta-propeller domain; Int 84.38
PF00930353 DPPIV_N: Dipeptidyl peptidase IV (DPP IV) N-termin 84.36
PF12234631 Rav1p_C: RAVE protein 1 C terminal; InterPro: IPR0 84.26
PF04841410 Vps16_N: Vps16, N-terminal region; InterPro: IPR00 83.7
PF15390671 DUF4613: Domain of unknown function (DUF4613) 83.02
PF11635753 Med16: Mediator complex subunit 16; InterPro: IPR0 82.63
PF05096264 Glu_cyclase_2: Glutamine cyclotransferase; InterPr 81.07
PF02897414 Peptidase_S9_N: Prolyl oligopeptidase, N-terminal 80.96
PLN00033398 photosystem II stability/assembly factor; Provisio 80.62
PF08728717 CRT10: CRT10; InterPro: IPR014839 CRT10 is a trans 80.16
PRK13684334 Ycf48-like protein; Provisional 80.1
PHA02713557 hypothetical protein; Provisional 80.04
>KOG0319 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification] Back     alignment and domain information 
Probab=100.00  E-value=3e-36  Score=340.81  Aligned_cols=502  Identities=13%  Similarity=0.132  Sum_probs=346.4

Q ss_pred             ccccCCcEEEEcCCCeEEEE--EcCCCCCeeEEEEEcCCcEEEEEeCCCcEEEEECCCCceeeeecC-CCCEEEEEEecC
Q 001538            2 CLCRDGRIKVIGGDGIEGLL--ISPSQLPYKNLEFLQNQGFLISITNDNEIQVWSLESRSLACCLKW-ESNITAFSVISG   78 (1057)
Q Consensus         2 vgt~dG~I~v~g~~~~e~~~--~~~~~~~v~~L~F~~~~~~Lvs~s~d~~I~VWdl~s~~~l~tl~~-~~~Ita~~~sp~   78 (1057)
                      .+.+.+-+++|.-+..+++-  ..-+..||--|+|.|.++.|++++.||.++|||+..+.+.++++. ++.|.++.|.|.
T Consensus        79 ~a~rs~llrv~~L~tgk~irswKa~He~Pvi~ma~~~~g~LlAtggaD~~v~VWdi~~~~~th~fkG~gGvVssl~F~~~  158 (775)
T KOG0319|consen   79 TASRSQLLRVWSLPTGKLIRSWKAIHEAPVITMAFDPTGTLLATGGADGRVKVWDIKNGYCTHSFKGHGGVVSSLLFHPH  158 (775)
T ss_pred             EeeccceEEEEEcccchHhHhHhhccCCCeEEEEEcCCCceEEeccccceEEEEEeeCCEEEEEecCCCceEEEEEeCCc
Confidence            45566777777655443322  223578999999999999999999999999999999999999985 789999999998


Q ss_pred             CcE--EEEEccCCcEEEEEEeCCCCceeccCcccchhhhhhhcCCCCCCCCCeEEEEeCcCCCCCeEEEEECCCEEEEEE
Q 001538           79 SHF--MYIGDENGLMSVIKYDADEGKLFQLPYNISADALSEKAGFPLLSHQPVVGVLPHPNSSGNRVLIAYENALVILWD  156 (1057)
Q Consensus        79 ~~~--l~vG~~~G~v~v~~~d~~~~~l~~~~~~i~~~~~~~~~g~~~~~~~~V~sI~~sP~d~g~~lli~~~dG~I~lWd  156 (1057)
                      ..+  |++|..|+.+++|++...+-++.       .         -..|.+.|++++|.+  ++.-++++++|..|.|||
T Consensus       159 ~~~~lL~sg~~D~~v~vwnl~~~~tcl~-------~---------~~~H~S~vtsL~~~~--d~~~~ls~~RDkvi~vwd  220 (775)
T KOG0319|consen  159 WNRWLLASGATDGTVRVWNLNDKRTCLH-------T---------MILHKSAVTSLAFSE--DSLELLSVGRDKVIIVWD  220 (775)
T ss_pred             cchhheeecCCCceEEEEEcccCchHHH-------H---------HHhhhhheeeeeecc--CCceEEEeccCcEEEEee
Confidence            664  78999999999999865432221       1         123678899999999  466799999999999999


Q ss_pred             ccCCeEEEEecCCcccccCCccCCCCCCCCCcccCCCCCCCCCCCeEEEEEecCC-----CCEEEEEEcCCcEEEEeCCC
Q 001538          157 VSEAQIIFVGGGKDLQLKDGVVDSPSEGDSTFLEGISEHQPEEKEISALCWASSS-----GSILAVGYIDGDILLWNTST  231 (1057)
Q Consensus       157 l~~~~~~~~~~~~~~~~~~~~~~~p~~~~~~~~~~~~~~~~~~~~Vtsl~ws~pd-----G~~latg~~DG~I~lWd~~~  231 (1057)
                      +.+-+...+..-                              ...+-++.+. ++     |.++.|++.+|.++.||.++
T Consensus       221 ~~~~~~l~~lp~------------------------------ye~~E~vv~l-~~~~~~~~~~~~TaG~~g~~~~~d~es  269 (775)
T KOG0319|consen  221 LVQYKKLKTLPL------------------------------YESLESVVRL-REELGGKGEYIITAGGSGVVQYWDSES  269 (775)
T ss_pred             hhhhhhhheech------------------------------hhheeeEEEe-chhcCCcceEEEEecCCceEEEEeccc
Confidence            976665554432                              3456677777 66     67999999999999999988


Q ss_pred             CCccCCCCCCCCCcceeeecccccCCccEEEEEeeccCcCCCCCCceEEEecCCCCCCcceEEEEEcCcccccccceeee
Q 001538          232 TASTKGQQTGSRNNVVKLELSSAERRLPVIVLHWSTNKESRSNIDGRLFVYGGDEIGSEEVLTVLSLEWSSGMENLRCVS  311 (1057)
Q Consensus       232 ~~~~~~~~~~~~~~i~kl~l~~~~~~~pI~~l~w~~~~~~~~~~~~~Llv~gg~~~~~~~~ltvl~l~~~~~~~~~~~~~  311 (1057)
                      +....-+.......              +..+.-       ....+++++...+     +.+-+++.+      .++-. 
T Consensus       270 ~~~~~~~~~~~~~e--------------~~~~~~-------~~~~~~~l~vtae-----Qnl~l~d~~------~l~i~-  316 (775)
T KOG0319|consen  270 GKCVYKQRQSDSEE--------------IDHLLA-------IESMSQLLLVTAE-----QNLFLYDED------ELTIV-  316 (775)
T ss_pred             chhhhhhccCCchh--------------hhccee-------ccccCceEEEEcc-----ceEEEEEcc------ccEEe-
Confidence            75321111110000              111111       1122333333221     345555422      22111 


Q ss_pred             eeeecCCCcccEEEEeecCCCCCCCCceEEEEEcCCCeeEEeeccchhhhhcccCCCCCCCCcccccccCCCCCcceEEE
Q 001538          312 RVDITLTGSFADMILLSSAGATVGNHKADLFVLTSPGQLHFYDNASLTTLLSQQEKKPSVCPVEFPGVIPISDPIMTVAE  391 (1057)
Q Consensus       312 ~~~l~~~~~~~d~~~~p~~~~~g~~~~~~lv~l~~~G~l~~~D~~~~~~~l~~~~~~~~~~~~~~~~~l~~~~~~it~~~  391 (1057)
                      +.-...++++.||.++.+.-       ..+++.+|.++|++|+..+..+                 .-+++|...|..+.
T Consensus       317 k~ivG~ndEI~Dm~~lG~e~-------~~laVATNs~~lr~y~~~~~~c-----------------~ii~GH~e~vlSL~  372 (775)
T KOG0319|consen  317 KQIVGYNDEILDMKFLGPEE-------SHLAVATNSPELRLYTLPTSYC-----------------QIIPGHTEAVLSLD  372 (775)
T ss_pred             hhhcCCchhheeeeecCCcc-------ceEEEEeCCCceEEEecCCCce-----------------EEEeCchhheeeee
Confidence            11233566799999876432       3788889999999998433222                 23455665555554


Q ss_pred             ------EEeccCCCCchhhhHHHHhhccccCCCCCCCCCcCCCCCCCCCCCCccccCCCCcEEEEEeCCCcEEEEecCCC
Q 001538          392 ------FMLLPFGGHSSKGLSEIATFTKLHSSHTQAGHIKWPLSGGVPSPVPITKCHSVDRVYLAGYHDGSVRIWDATYP  465 (1057)
Q Consensus       392 ------~~~~~~~~~~~~~w~~~~~~~~~~~~~~~~~~~~wpl~Gg~~~~~~~~~~~~~~~~liTG~~DGtVriWd~~~~  465 (1057)
                            +...+..+..+..|.-    .++.+.... -.   ..+|+...+..++-......++++++.|+++++|++...
T Consensus       373 ~~~~g~llat~sKD~svilWr~----~~~~~~~~~-~a---~~~gH~~svgava~~~~~asffvsvS~D~tlK~W~l~~s  444 (775)
T KOG0319|consen  373 VWSSGDLLATGSKDKSVILWRL----NNNCSKSLC-VA---QANGHTNSVGAVAGSKLGASFFVSVSQDCTLKLWDLPKS  444 (775)
T ss_pred             ecccCcEEEEecCCceEEEEEe----cCCcchhhh-hh---hhcccccccceeeecccCccEEEEecCCceEEEecCCCc
Confidence                  2222233344555621    111010000 00   024444444333223445678999999999999998762


Q ss_pred             cee-EEeecccceeeeeecCCCCCEEEEEEecCCCeEEEEecCccEEEEEecCCCCccceeeeecCCCceEEeccCCcce
Q 001538          466 VFK-LICALDAEVQGIEVAGSRAPVSTLSFCFINSSLAVGNEFGLVYIYNLNGSLDAKNFLFVLETKSEVHALPEGKISL  544 (1057)
Q Consensus       466 ~l~-~l~~l~~~v~~i~l~~~~~~V~~v~fspd~~~Lavg~~dG~V~l~~~~~~~~~~~~~~~~~~~~~~~~i~~~~g~~  544 (1057)
                      ... ....++..   -....|...|+||+++|+...+|+|++|.+.+||+++....                        
T Consensus       445 ~~~~~~~~~~~~---~t~~aHdKdIN~Vaia~ndkLiAT~SqDktaKiW~le~~~l------------------------  497 (775)
T KOG0319|consen  445 KETAFPIVLTCR---YTERAHDKDINCVAIAPNDKLIATGSQDKTAKIWDLEQLRL------------------------  497 (775)
T ss_pred             ccccccceehhh---HHHHhhcccccceEecCCCceEEecccccceeeecccCceE------------------------
Confidence            210 00011100   00125778999999999999999999999999999973322                        


Q ss_pred             eeEEEeeCCCCeEEEEEcCCCCEEEEEeCCceEEEEeCCCCeEEEEeecCCCCCCCeEEEEEeeccCcccccCCCCCCCC
Q 001538          545 CRAVFSLVNSPVRALQFTSSGAKLAVGFECGRVAVLDMNLLSVLFFTDDISGSSSPIISMTWTEFKNTHSLAKNPNHSER  624 (1057)
Q Consensus       545 ~~~~~~~h~~~ItsLa~S~~g~~lA~G~~dG~V~vwDi~~~~~l~~~~~~~g~~~~V~sl~f~~~~~~~~~~~~~~~~~~  624 (1057)
                       ..++++|+..|.|+.|++..+.||++|.|++|+||.+.+.+++.++   +||+..|..++|.                 
T Consensus       498 -~~vLsGH~RGvw~V~Fs~~dq~laT~SgD~TvKIW~is~fSClkT~---eGH~~aVlra~F~-----------------  556 (775)
T KOG0319|consen  498 -LGVLSGHTRGVWCVSFSKNDQLLATCSGDKTVKIWSISTFSCLKTF---EGHTSAVLRASFI-----------------  556 (775)
T ss_pred             -EEEeeCCccceEEEEeccccceeEeccCCceEEEEEeccceeeeee---cCccceeEeeeee-----------------
Confidence             2488999999999999999999999999999999999999999876   5699999999998                 


Q ss_pred             cCCCCCCCcEEEEEecCCeEEEEeCCCcceeecCccccCCcceeEEEEe
Q 001538          625 EVPVNPAEEVIIVLFKDAKISIVGGSSENMISSSPWHLKKKVIAISMEV  673 (1057)
Q Consensus       625 ~~~~~~d~~~L~sgt~dg~i~v~d~~tg~~i~~~~i~p~~~~~~~~~~~  673 (1057)
                           .++..|++++.||-|++|+..|++++.+.   ..+..+++.+..
T Consensus       557 -----~~~~qliS~~adGliKlWnikt~eC~~tl---D~H~DrvWaL~~  597 (775)
T KOG0319|consen  557 -----RNGKQLISAGADGLIKLWNIKTNECEMTL---DAHNDRVWALSV  597 (775)
T ss_pred             -----eCCcEEEeccCCCcEEEEeccchhhhhhh---hhccceeEEEee
Confidence                 55788999999999999999999999876   445567676653

>KOG0271 consensus Notchless-like WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0291 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification] Back     alignment and domain information
>KOG0319 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification] Back     alignment and domain information
>KOG1983 consensus Tomosyn and related SNARE-interacting proteins [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0271 consensus Notchless-like WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0318 consensus WD40 repeat stress protein/actin interacting protein [Cytoskeleton] Back     alignment and domain information
>KOG0318 consensus WD40 repeat stress protein/actin interacting protein [Cytoskeleton] Back     alignment and domain information
>KOG0291 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification] Back     alignment and domain information
>KOG0306 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification] Back     alignment and domain information
>PF08596 Lgl_C: Lethal giant larvae(Lgl) like, C-terminal; InterPro: IPR013905 The Lethal giant larvae (Lgl) tumour suppressor protein is conserved from yeast to mammals Back     alignment and domain information
>KOG0272 consensus U4/U6 small nuclear ribonucleoprotein Prp4 (contains WD40 repeats) [RNA processing and modification] Back     alignment and domain information
>KOG0272 consensus U4/U6 small nuclear ribonucleoprotein Prp4 (contains WD40 repeats) [RNA processing and modification] Back     alignment and domain information
>KOG0306 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification] Back     alignment and domain information
>KOG1539 consensus WD repeat protein [General function prediction only] Back     alignment and domain information
>KOG0273 consensus Beta-transducin family (WD-40 repeat) protein [Chromatin structure and dynamics] Back     alignment and domain information
>KOG0286 consensus G-protein beta subunit [General function prediction only] Back     alignment and domain information
>KOG0279 consensus G protein beta subunit-like protein [Signal transduction mechanisms] Back     alignment and domain information
>KOG1539 consensus WD repeat protein [General function prediction only] Back     alignment and domain information
>PLN00181 protein SPA1-RELATED; Provisional Back     alignment and domain information
>KOG0296 consensus Angio-associated migratory cell protein (contains WD40 repeats) [Function unknown] Back     alignment and domain information
>KOG0315 consensus G-protein beta subunit-like protein (contains WD40 repeats) [General function prediction only] Back     alignment and domain information
>KOG0263 consensus Transcription initiation factor TFIID, subunit TAF5 (also component of histone acetyltransferase SAGA) [Transcription] Back     alignment and domain information
>KOG0276 consensus Vesicle coat complex COPI, beta' subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0315 consensus G-protein beta subunit-like protein (contains WD40 repeats) [General function prediction only] Back     alignment and domain information
>PLN00181 protein SPA1-RELATED; Provisional Back     alignment and domain information
>KOG0263 consensus Transcription initiation factor TFIID, subunit TAF5 (also component of histone acetyltransferase SAGA) [Transcription] Back     alignment and domain information
>KOG0273 consensus Beta-transducin family (WD-40 repeat) protein [Chromatin structure and dynamics] Back     alignment and domain information
>KOG0286 consensus G-protein beta subunit [General function prediction only] Back     alignment and domain information
>KOG0279 consensus G protein beta subunit-like protein [Signal transduction mechanisms] Back     alignment and domain information
>KOG0292 consensus Vesicle coat complex COPI, alpha subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0284 consensus Polyadenylation factor I complex, subunit PFS2 [RNA processing and modification] Back     alignment and domain information
>cd00200 WD40 WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and botto Back     alignment and domain information
>KOG0295 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG2106 consensus Uncharacterized conserved protein, contains HELP and WD40 domains [Function unknown] Back     alignment and domain information
>cd00200 WD40 WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and botto Back     alignment and domain information
>KOG1408 consensus WD40 repeat protein [Function unknown] Back     alignment and domain information
>KOG0266 consensus WD40 repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG2048 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0284 consensus Polyadenylation factor I complex, subunit PFS2 [RNA processing and modification] Back     alignment and domain information
>KOG0285 consensus Pleiotropic regulator 1 [RNA processing and modification] Back     alignment and domain information
>KOG0296 consensus Angio-associated migratory cell protein (contains WD40 repeats) [Function unknown] Back     alignment and domain information
>KOG2048 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0285 consensus Pleiotropic regulator 1 [RNA processing and modification] Back     alignment and domain information
>KOG0266 consensus WD40 repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG0265 consensus U5 snRNP-specific protein-like factor and related proteins [RNA processing and modification] Back     alignment and domain information
>KOG0295 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0282 consensus mRNA splicing factor [Function unknown] Back     alignment and domain information
>KOG0645 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0276 consensus Vesicle coat complex COPI, beta' subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0645 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0288 consensus WD40 repeat protein TipD [General function prediction only] Back     alignment and domain information
>KOG2106 consensus Uncharacterized conserved protein, contains HELP and WD40 domains [Function unknown] Back     alignment and domain information
>KOG0316 consensus Conserved WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0292 consensus Vesicle coat complex COPI, alpha subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0281 consensus Beta-TrCP (transducin repeats containing)/Slimb proteins [Function unknown] Back     alignment and domain information
>KOG0310 consensus Conserved WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0293 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0281 consensus Beta-TrCP (transducin repeats containing)/Slimb proteins [Function unknown] Back     alignment and domain information
>KOG0293 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0646 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0313 consensus Microtubule binding protein YTM1 (contains WD40 repeats) [Cytoskeleton] Back     alignment and domain information
>PTZ00421 coronin; Provisional Back     alignment and domain information
>KOG0772 consensus Uncharacterized conserved protein, contains WD40 repeat [Function unknown] Back     alignment and domain information
>KOG0265 consensus U5 snRNP-specific protein-like factor and related proteins [RNA processing and modification] Back     alignment and domain information
>KOG1408 consensus WD40 repeat protein [Function unknown] Back     alignment and domain information
>KOG1407 consensus WD40 repeat protein [Function unknown] Back     alignment and domain information
>KOG0305 consensus Anaphase promoting complex, Cdc20, Cdh1, and Ama1 subunits [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0310 consensus Conserved WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0313 consensus Microtubule binding protein YTM1 (contains WD40 repeats) [Cytoskeleton] Back     alignment and domain information
>KOG1063 consensus RNA polymerase II elongator complex, subunit ELP2, WD repeat superfamily [Chromatin structure and dynamics; Transcription] Back     alignment and domain information
>KOG0772 consensus Uncharacterized conserved protein, contains WD40 repeat [Function unknown] Back     alignment and domain information
>KOG0282 consensus mRNA splicing factor [Function unknown] Back     alignment and domain information
>KOG0316 consensus Conserved WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0277 consensus Peroxisomal targeting signal type 2 receptor [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0275 consensus Conserved WD40 repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG0643 consensus Translation initiation factor 3, subunit i (eIF-3i)/TGF-beta receptor-interacting protein (TRIP-1) [Translation, ribosomal structure and biogenesis; Signal transduction mechanisms] Back     alignment and domain information
>KOG0973 consensus Histone transcription regulator HIRA, WD repeat superfamily [Cell cycle control, cell division, chromosome partitioning; Transcription] Back     alignment and domain information
>KOG0283 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG2096 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0299 consensus U3 snoRNP-associated protein (contains WD40 repeats) [RNA processing and modification] Back     alignment and domain information
>KOG0283 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0278 consensus Serine/threonine kinase receptor-associated protein [Lipid transport and metabolism] Back     alignment and domain information
>KOG0289 consensus mRNA splicing factor [General function prediction only] Back     alignment and domain information
>PTZ00421 coronin; Provisional Back     alignment and domain information
>KOG1063 consensus RNA polymerase II elongator complex, subunit ELP2, WD repeat superfamily [Chromatin structure and dynamics; Transcription] Back     alignment and domain information
>KOG0641 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0275 consensus Conserved WD40 repeat-containing protein [General function prediction only] Back     alignment and domain information
>PTZ00420 coronin; Provisional Back     alignment and domain information
>KOG0274 consensus Cdc4 and related F-box and WD-40 proteins [General function prediction only] Back     alignment and domain information
>KOG0278 consensus Serine/threonine kinase receptor-associated protein [Lipid transport and metabolism] Back     alignment and domain information
>KOG1036 consensus Mitotic spindle checkpoint protein BUB3, WD repeat superfamily [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG1407 consensus WD40 repeat protein [Function unknown] Back     alignment and domain information
>KOG0647 consensus mRNA export protein (contains WD40 repeats) [RNA processing and modification] Back     alignment and domain information
>KOG1273 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0643 consensus Translation initiation factor 3, subunit i (eIF-3i)/TGF-beta receptor-interacting protein (TRIP-1) [Translation, ribosomal structure and biogenesis; Signal transduction mechanisms] Back     alignment and domain information
>KOG0289 consensus mRNA splicing factor [General function prediction only] Back     alignment and domain information
>KOG0277 consensus Peroxisomal targeting signal type 2 receptor [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0305 consensus Anaphase promoting complex, Cdc20, Cdh1, and Ama1 subunits [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0973 consensus Histone transcription regulator HIRA, WD repeat superfamily [Cell cycle control, cell division, chromosome partitioning; Transcription] Back     alignment and domain information
>KOG0288 consensus WD40 repeat protein TipD [General function prediction only] Back     alignment and domain information
>KOG2055 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0641 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0268 consensus Sof1-like rRNA processing protein (contains WD40 repeats) [RNA processing and modification] Back     alignment and domain information
>KOG0299 consensus U3 snoRNP-associated protein (contains WD40 repeats) [RNA processing and modification] Back     alignment and domain information
>KOG1446 consensus Histone H3 (Lys4) methyltransferase complex and RNA cleavage factor II complex, subunit SWD2 [RNA processing and modification; Chromatin structure and dynamics; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0300 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG1963 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0274 consensus Cdc4 and related F-box and WD-40 proteins [General function prediction only] Back     alignment and domain information
>KOG1036 consensus Mitotic spindle checkpoint protein BUB3, WD repeat superfamily [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PTZ00420 coronin; Provisional Back     alignment and domain information
>TIGR03866 PQQ_ABC_repeats PQQ-dependent catabolism-associated beta-propeller protein Back     alignment and domain information
>KOG0640 consensus mRNA cleavage stimulating factor complex; subunit 1 [RNA processing and modification] Back     alignment and domain information
>KOG0639 consensus Transducin-like enhancer of split protein (contains WD40 repeats) [Chromatin structure and dynamics] Back     alignment and domain information
>KOG0640 consensus mRNA cleavage stimulating factor complex; subunit 1 [RNA processing and modification] Back     alignment and domain information
>KOG0268 consensus Sof1-like rRNA processing protein (contains WD40 repeats) [RNA processing and modification] Back     alignment and domain information
>KOG0308 consensus Conserved WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0294 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0300 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG2096 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0647 consensus mRNA export protein (contains WD40 repeats) [RNA processing and modification] Back     alignment and domain information
>KOG2055 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0294 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0308 consensus Conserved WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG1446 consensus Histone H3 (Lys4) methyltransferase complex and RNA cleavage factor II complex, subunit SWD2 [RNA processing and modification; Chromatin structure and dynamics; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR03866 PQQ_ABC_repeats PQQ-dependent catabolism-associated beta-propeller protein Back     alignment and domain information
>KOG0301 consensus Phospholipase A2-activating protein (contains WD40 repeats) [Lipid transport and metabolism] Back     alignment and domain information
>KOG1445 consensus Tumor-specific antigen (contains WD repeats) [Cytoskeleton] Back     alignment and domain information
>KOG0269 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0301 consensus Phospholipase A2-activating protein (contains WD40 repeats) [Lipid transport and metabolism] Back     alignment and domain information
>KOG2445 consensus Nuclear pore complex component (sc Seh1) [Nuclear structure; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0321 consensus WD40 repeat-containing protein L2DTL [Function unknown] Back     alignment and domain information
>KOG1274 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0267 consensus Microtubule severing protein katanin p80 subunit B (contains WD40 repeats) [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG1273 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG4283 consensus Transcription-coupled repair protein CSA, contains WD40 domain [Transcription; Replication, recombination and repair] Back     alignment and domain information
>KOG1332 consensus Vesicle coat complex COPII, subunit SEC13 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0264 consensus Nucleosome remodeling factor, subunit CAF1/NURF55/MSI1 [Chromatin structure and dynamics] Back     alignment and domain information
>KOG0264 consensus Nucleosome remodeling factor, subunit CAF1/NURF55/MSI1 [Chromatin structure and dynamics] Back     alignment and domain information
>KOG2445 consensus Nuclear pore complex component (sc Seh1) [Nuclear structure; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1332 consensus Vesicle coat complex COPII, subunit SEC13 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0650 consensus WD40 repeat nucleolar protein Bop1, involved in ribosome biogenesis [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG1274 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG1517 consensus Guanine nucleotide binding protein MIP1 [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0650 consensus WD40 repeat nucleolar protein Bop1, involved in ribosome biogenesis [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG0639 consensus Transducin-like enhancer of split protein (contains WD40 repeats) [Chromatin structure and dynamics] Back     alignment and domain information
>KOG0302 consensus Ribosome Assembly protein [General function prediction only] Back     alignment and domain information
>KOG0322 consensus G-protein beta subunit-like protein GNB1L, contains WD repeats [General function prediction only] Back     alignment and domain information
>KOG1538 consensus Uncharacterized conserved protein WDR10, contains WD40 repeats [General function prediction only] Back     alignment and domain information
>KOG1034 consensus Transcriptional repressor EED/ESC/FIE, required for transcriptional silencing, WD repeat superfamily [Transcription] Back     alignment and domain information
>KOG0270 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG4328 consensus WD40 protein [Function unknown] Back     alignment and domain information
>KOG0322 consensus G-protein beta subunit-like protein GNB1L, contains WD repeats [General function prediction only] Back     alignment and domain information
>KOG0269 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0646 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG4283 consensus Transcription-coupled repair protein CSA, contains WD40 domain [Transcription; Replication, recombination and repair] Back     alignment and domain information
>COG2319 FOG: WD40 repeat [General function prediction only] Back     alignment and domain information
>KOG0267 consensus Microtubule severing protein katanin p80 subunit B (contains WD40 repeats) [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG1517 consensus Guanine nucleotide binding protein MIP1 [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0302 consensus Ribosome Assembly protein [General function prediction only] Back     alignment and domain information
>KOG4378 consensus Nuclear protein COP1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG1034 consensus Transcriptional repressor EED/ESC/FIE, required for transcriptional silencing, WD repeat superfamily [Transcription] Back     alignment and domain information
>KOG1587 consensus Cytoplasmic dynein intermediate chain [Cytoskeleton] Back     alignment and domain information
>KOG1240 consensus Protein kinase containing WD40 repeats [Signal transduction mechanisms] Back     alignment and domain information
>PRK11028 6-phosphogluconolactonase; Provisional Back     alignment and domain information
>KOG1963 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0321 consensus WD40 repeat-containing protein L2DTL [Function unknown] Back     alignment and domain information
>KOG1538 consensus Uncharacterized conserved protein WDR10, contains WD40 repeats [General function prediction only] Back     alignment and domain information
>KOG0307 consensus Vesicle coat complex COPII, subunit SEC31 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0270 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG1445 consensus Tumor-specific antigen (contains WD repeats) [Cytoskeleton] Back     alignment and domain information
>KOG2919 consensus Guanine nucleotide-binding protein [General function prediction only] Back     alignment and domain information
>KOG0307 consensus Vesicle coat complex COPII, subunit SEC31 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>COG2319 FOG: WD40 repeat [General function prediction only] Back     alignment and domain information
>KOG0290 consensus Conserved WD40 repeat-containing protein AN11 [Function unknown] Back     alignment and domain information
>KOG1240 consensus Protein kinase containing WD40 repeats [Signal transduction mechanisms] Back     alignment and domain information
>KOG4328 consensus WD40 protein [Function unknown] Back     alignment and domain information
>KOG0649 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0303 consensus Actin-binding protein Coronin, contains WD40 repeats [Cytoskeleton] Back     alignment and domain information
>KOG1188 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG4378 consensus Nuclear protein COP1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0771 consensus Prolactin regulatory element-binding protein/Protein transport protein SEC12p [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0642 consensus Cell-cycle nuclear protein, contains WD-40 repeats [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG1009 consensus Chromatin assembly complex 1 subunit B/CAC2 (contains WD40 repeats) [Chromatin structure and dynamics; Replication, recombination and repair] Back     alignment and domain information
>KOG1007 consensus WD repeat protein TSSC1, WD repeat superfamily [Function unknown] Back     alignment and domain information
>KOG2110 consensus Uncharacterized conserved protein, contains WD40 repeats [Function unknown] Back     alignment and domain information
>KOG2111 consensus Uncharacterized conserved protein, contains WD40 repeats [Function unknown] Back     alignment and domain information
>KOG1188 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PRK11028 6-phosphogluconolactonase; Provisional Back     alignment and domain information
>KOG1009 consensus Chromatin assembly complex 1 subunit B/CAC2 (contains WD40 repeats) [Chromatin structure and dynamics; Replication, recombination and repair] Back     alignment and domain information
>KOG0642 consensus Cell-cycle nuclear protein, contains WD-40 repeats [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG1587 consensus Cytoplasmic dynein intermediate chain [Cytoskeleton] Back     alignment and domain information
>KOG1007 consensus WD repeat protein TSSC1, WD repeat superfamily [Function unknown] Back     alignment and domain information
>PF02239 Cytochrom_D1: Cytochrome D1 heme domain; PDB: 1NNO_B 1HZU_A 1N15_B 1N50_A 1GJQ_A 1BL9_B 1NIR_B 1N90_B 1HZV_A 1AOQ_A Back     alignment and domain information
>KOG0290 consensus Conserved WD40 repeat-containing protein AN11 [Function unknown] Back     alignment and domain information
>KOG2394 consensus WD40 protein DMR-N9 [General function prediction only] Back     alignment and domain information
>KOG1524 consensus WD40 repeat-containing protein CHE-2 [General function prediction only] Back     alignment and domain information
>KOG4497 consensus Uncharacterized conserved protein WDR8, contains WD repeats [General function prediction only] Back     alignment and domain information
>KOG4227 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG4227 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PRK01742 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG1524 consensus WD40 repeat-containing protein CHE-2 [General function prediction only] Back     alignment and domain information
>KOG0303 consensus Actin-binding protein Coronin, contains WD40 repeats [Cytoskeleton] Back     alignment and domain information
>KOG0771 consensus Prolactin regulatory element-binding protein/Protein transport protein SEC12p [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG2111 consensus Uncharacterized conserved protein, contains WD40 repeats [Function unknown] Back     alignment and domain information
>KOG1912 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0649 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG2919 consensus Guanine nucleotide-binding protein [General function prediction only] Back     alignment and domain information
>PRK05137 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG2110 consensus Uncharacterized conserved protein, contains WD40 repeats [Function unknown] Back     alignment and domain information
>KOG1912 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG2041 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PRK03629 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG2321 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PF08662 eIF2A: Eukaryotic translation initiation factor eIF2A; InterPro: IPR013979 This entry contains beta propellor domains found in eukaryotic translation initiation factors and TolB domain-containing proteins Back     alignment and domain information
>PRK02889 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PF02239 Cytochrom_D1: Cytochrome D1 heme domain; PDB: 1NNO_B 1HZU_A 1N15_B 1N50_A 1GJQ_A 1BL9_B 1NIR_B 1N90_B 1HZV_A 1AOQ_A Back     alignment and domain information
>KOG3881 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1334 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0644 consensus Uncharacterized conserved protein, contains WD40 repeat and BROMO domains [General function prediction only] Back     alignment and domain information
>PF04762 IKI3: IKI3 family; InterPro: IPR006849 Members of this family are components of the elongator multi-subunit component of a novel RNA polymerase II holoenzyme for transcriptional elongation [] Back     alignment and domain information
>KOG3881 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF08662 eIF2A: Eukaryotic translation initiation factor eIF2A; InterPro: IPR013979 This entry contains beta propellor domains found in eukaryotic translation initiation factors and TolB domain-containing proteins Back     alignment and domain information
>KOG4497 consensus Uncharacterized conserved protein WDR8, contains WD repeats [General function prediction only] Back     alignment and domain information
>KOG2139 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PRK01742 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK04922 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG0644 consensus Uncharacterized conserved protein, contains WD40 repeat and BROMO domains [General function prediction only] Back     alignment and domain information
>KOG1064 consensus RAVE (regulator of V-ATPase assembly) complex subunit RAV1/DMX protein, WD repeat superfamily [General function prediction only] Back     alignment and domain information
>TIGR02800 propeller_TolB tol-pal system beta propeller repeat protein TolB Back     alignment and domain information
>KOG2394 consensus WD40 protein DMR-N9 [General function prediction only] Back     alignment and domain information
>KOG1523 consensus Actin-related protein Arp2/3 complex, subunit ARPC1/p41-ARC [Cytoskeleton] Back     alignment and domain information
>KOG1272 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification] Back     alignment and domain information
>PF04762 IKI3: IKI3 family; InterPro: IPR006849 Members of this family are components of the elongator multi-subunit component of a novel RNA polymerase II holoenzyme for transcriptional elongation [] Back     alignment and domain information
>KOG4547 consensus WD40 repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG1523 consensus Actin-related protein Arp2/3 complex, subunit ARPC1/p41-ARC [Cytoskeleton] Back     alignment and domain information
>PRK00178 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG0974 consensus WD-repeat protein WDR6, WD repeat superfamily [General function prediction only] Back     alignment and domain information
>PF10282 Lactonase: Lactonase, 7-bladed beta-propeller; InterPro: IPR019405 6-phosphogluconolactonases (6PGL) 3 Back     alignment and domain information
>PRK04792 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK03629 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG2321 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG1272 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification] Back     alignment and domain information
>KOG1334 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>TIGR03300 assembly_YfgL outer membrane assembly lipoprotein YfgL Back     alignment and domain information
>KOG2315 consensus Predicted translation initiation factor related to eIF-3a [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK04922 tolB translocation protein TolB; Provisional Back     alignment and domain information
>TIGR02658 TTQ_MADH_Hv methylamine dehydrogenase heavy chain Back     alignment and domain information
>KOG2041 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG1310 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG2139 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PRK05137 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG1310 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG3914 consensus WD repeat protein WDR4 [Function unknown] Back     alignment and domain information
>PRK02889 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK01029 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG0974 consensus WD-repeat protein WDR6, WD repeat superfamily [General function prediction only] Back     alignment and domain information
>TIGR03300 assembly_YfgL outer membrane assembly lipoprotein YfgL Back     alignment and domain information
>KOG4547 consensus WD40 repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG2314 consensus Translation initiation factor 3, subunit b (eIF-3b) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>COG2706 3-carboxymuconate cyclase [Carbohydrate transport and metabolism] Back     alignment and domain information
>COG4946 Uncharacterized protein related to the periplasmic component of the Tol biopolymer transport system [Function unknown] Back     alignment and domain information
>TIGR02800 propeller_TolB tol-pal system beta propeller repeat protein TolB Back     alignment and domain information
>PF10282 Lactonase: Lactonase, 7-bladed beta-propeller; InterPro: IPR019405 6-phosphogluconolactonases (6PGL) 3 Back     alignment and domain information
>TIGR02658 TTQ_MADH_Hv methylamine dehydrogenase heavy chain Back     alignment and domain information
>KOG1354 consensus Serine/threonine protein phosphatase 2A, regulatory subunit [Signal transduction mechanisms] Back     alignment and domain information
>PF00400 WD40: WD domain, G-beta repeat; InterPro: IPR019781 WD-40 repeats (also known as WD or beta-transducin repeats) are short ~40 amino acid motifs, often terminating in a Trp-Asp (W-D) dipeptide Back     alignment and domain information
>KOG2314 consensus Translation initiation factor 3, subunit b (eIF-3b) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK04792 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG1409 consensus Uncharacterized conserved protein, contains WD40 repeats and FYVE domains [Function unknown] Back     alignment and domain information
>KOG4190 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK00178 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK01029 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG3914 consensus WD repeat protein WDR4 [Function unknown] Back     alignment and domain information
>PF00957 Synaptobrevin: Synaptobrevin; InterPro: IPR001388 Synaptobrevin is an intrinsic membrane protein of small synaptic vesicles [], specialised secretory organelles of neurons that actively accumulate neurotransmitters and participate in their calcium-dependent release by exocytosis Back     alignment and domain information
>COG4946 Uncharacterized protein related to the periplasmic component of the Tol biopolymer transport system [Function unknown] Back     alignment and domain information
>KOG1064 consensus RAVE (regulator of V-ATPase assembly) complex subunit RAV1/DMX protein, WD repeat superfamily [General function prediction only] Back     alignment and domain information
>PRK04043 tolB translocation protein TolB; Provisional Back     alignment and domain information
>COG5354 Uncharacterized protein, contains Trp-Asp (WD) repeat [General function prediction only] Back     alignment and domain information
>KOG0860 consensus Synaptobrevin/VAMP-like protein [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PLN02919 haloacid dehalogenase-like hydrolase family protein Back     alignment and domain information
>KOG0280 consensus Uncharacterized conserved protein [Amino acid transport and metabolism] Back     alignment and domain information
>PLN02919 haloacid dehalogenase-like hydrolase family protein Back     alignment and domain information
>PF11768 DUF3312: Protein of unknown function (DUF3312); InterPro: IPR024511 This is a eukaryotic family of uncharacterised proteins that contain WD40 repeats Back     alignment and domain information
>COG5354 Uncharacterized protein, contains Trp-Asp (WD) repeat [General function prediction only] Back     alignment and domain information
>PF11768 DUF3312: Protein of unknown function (DUF3312); InterPro: IPR024511 This is a eukaryotic family of uncharacterised proteins that contain WD40 repeats Back     alignment and domain information
>PF15492 Nbas_N: Neuroblastoma-amplified sequence, N terminal Back     alignment and domain information
>KOG2695 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0309 consensus Conserved WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>PF00400 WD40: WD domain, G-beta repeat; InterPro: IPR019781 WD-40 repeats (also known as WD or beta-transducin repeats) are short ~40 amino acid motifs, often terminating in a Trp-Asp (W-D) dipeptide Back     alignment and domain information
>PRK11138 outer membrane biogenesis protein BamB; Provisional Back     alignment and domain information
>COG5170 CDC55 Serine/threonine protein phosphatase 2A, regulatory subunit [Signal transduction mechanisms] Back     alignment and domain information
>KOG4532 consensus WD40-like repeat containing protein [General function prediction only] Back     alignment and domain information
>KOG2315 consensus Predicted translation initiation factor related to eIF-3a [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>COG2706 3-carboxymuconate cyclase [Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG2114 consensus Vacuolar assembly/sorting protein PEP5/VPS11 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG4714 consensus Nucleoporin [Nuclear structure] Back     alignment and domain information
>KOG4714 consensus Nucleoporin [Nuclear structure] Back     alignment and domain information
>KOG4532 consensus WD40-like repeat containing protein [General function prediction only] Back     alignment and domain information
>PF13360 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 3Q54_A 2YH3_A 3PRW_A 3P1L_A 3Q7M_A 3Q7O_A 3Q7N_A Back     alignment and domain information
>PRK04043 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG2066 consensus Vacuolar assembly/sorting protein VPS41 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1409 consensus Uncharacterized conserved protein, contains WD40 repeats and FYVE domains [Function unknown] Back     alignment and domain information
>KOG1645 consensus RING-finger-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1354 consensus Serine/threonine protein phosphatase 2A, regulatory subunit [Signal transduction mechanisms] Back     alignment and domain information
>PF15492 Nbas_N: Neuroblastoma-amplified sequence, N terminal Back     alignment and domain information
>KOG0280 consensus Uncharacterized conserved protein [Amino acid transport and metabolism] Back     alignment and domain information
>KOG1645 consensus RING-finger-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3617 consensus WD40 and TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF13360 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 3Q54_A 2YH3_A 3PRW_A 3P1L_A 3Q7M_A 3Q7O_A 3Q7N_A Back     alignment and domain information
>KOG3621 consensus WD40 repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG2066 consensus Vacuolar assembly/sorting protein VPS41 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PRK11138 outer membrane biogenesis protein BamB; Provisional Back     alignment and domain information
>KOG4190 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG4640 consensus Anaphase-promoting complex (APC), subunit 4 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2695 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG1920 consensus IkappaB kinase complex, IKAP component [Transcription] Back     alignment and domain information
>PF08450 SGL: SMP-30/Gluconolaconase/LRE-like region; InterPro: IPR013658 This family describes a region that is found in proteins expressed by a variety of eukaryotic and prokaryotic species Back     alignment and domain information
>PF08450 SGL: SMP-30/Gluconolaconase/LRE-like region; InterPro: IPR013658 This family describes a region that is found in proteins expressed by a variety of eukaryotic and prokaryotic species Back     alignment and domain information
>KOG0882 consensus Cyclophilin-related peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF03178 CPSF_A: CPSF A subunit region; InterPro: IPR004871 This family includes a region that lies towards the C terminus of the cleavage and polyadenylation specificity factor (CPSF) A (160 kDa) subunit Back     alignment and domain information
>KOG2079 consensus Vacuolar assembly/sorting protein VPS8 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG2114 consensus Vacuolar assembly/sorting protein PEP5/VPS11 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>COG5170 CDC55 Serine/threonine protein phosphatase 2A, regulatory subunit [Signal transduction mechanisms] Back     alignment and domain information
>KOG0859 consensus Synaptobrevin/VAMP-like protein [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF00780 CNH: CNH domain; InterPro: IPR001180 Based on sequence similarities a domain of homology has been identified in the following proteins []: Citron and Citron kinase Back     alignment and domain information
>smart00320 WD40 WD40 repeats Back     alignment and domain information
>PF14655 RAB3GAP2_N: Rab3 GTPase-activating protein regulatory subunit N-terminus Back     alignment and domain information
>KOG0309 consensus Conserved WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>PF08596 Lgl_C: Lethal giant larvae(Lgl) like, C-terminal; InterPro: IPR013905 The Lethal giant larvae (Lgl) tumour suppressor protein is conserved from yeast to mammals Back     alignment and domain information
>KOG4649 consensus PQQ (pyrrolo-quinoline quinone) repeat protein [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>KOG4640 consensus Anaphase-promoting complex (APC), subunit 4 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK02888 nitrous-oxide reductase; Validated Back     alignment and domain information
>KOG0882 consensus Cyclophilin-related peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF14783 BBS2_Mid: Ciliary BBSome complex subunit 2, middle region Back     alignment and domain information
>PF06977 SdiA-regulated: SdiA-regulated; InterPro: IPR009722 This entry represents a conserved region approximately 100 residues long within a number of hypothetical bacterial proteins that may be regulated by SdiA, a member of the LuxR family of transcriptional regulators [] Back     alignment and domain information
>KOG1275 consensus PAB-dependent poly(A) ribonuclease, subunit PAN2 [Replication, recombination and repair] Back     alignment and domain information
>KOG3621 consensus WD40 repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF07433 DUF1513: Protein of unknown function (DUF1513); InterPro: IPR008311 There are currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function Back     alignment and domain information
>KOG1920 consensus IkappaB kinase complex, IKAP component [Transcription] Back     alignment and domain information
>PF07433 DUF1513: Protein of unknown function (DUF1513); InterPro: IPR008311 There are currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function Back     alignment and domain information
>PRK02888 nitrous-oxide reductase; Validated Back     alignment and domain information
>PF14783 BBS2_Mid: Ciliary BBSome complex subunit 2, middle region Back     alignment and domain information
>KOG1275 consensus PAB-dependent poly(A) ribonuclease, subunit PAN2 [Replication, recombination and repair] Back     alignment and domain information
>COG3204 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF08553 VID27: VID27 cytoplasmic protein; InterPro: IPR013863 This entry represents fungal and plant proteins and contains many hypothetical proteins Back     alignment and domain information
>KOG2395 consensus Protein involved in vacuole import and degradation [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF08553 VID27: VID27 cytoplasmic protein; InterPro: IPR013863 This entry represents fungal and plant proteins and contains many hypothetical proteins Back     alignment and domain information
>PF03178 CPSF_A: CPSF A subunit region; InterPro: IPR004871 This family includes a region that lies towards the C terminus of the cleavage and polyadenylation specificity factor (CPSF) A (160 kDa) subunit Back     alignment and domain information
>PF06433 Me-amine-dh_H: Methylamine dehydrogenase heavy chain (MADH); InterPro: IPR009451 Methylamine dehydrogenase (1 Back     alignment and domain information
>KOG2079 consensus Vacuolar assembly/sorting protein VPS8 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>smart00320 WD40 WD40 repeats Back     alignment and domain information
>KOG2444 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>COG0823 TolB Periplasmic component of the Tol biopolymer transport system [Intracellular trafficking and secretion] Back     alignment and domain information
>KOG3617 consensus WD40 and TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF00780 CNH: CNH domain; InterPro: IPR001180 Based on sequence similarities a domain of homology has been identified in the following proteins []: Citron and Citron kinase Back     alignment and domain information
>PF10647 Gmad1: Lipoprotein LpqB beta-propeller domain; InterPro: IPR018910 The Gmad1 domain is found associated with IPR019606 from INTERPRO, in bacterial spore formation Back     alignment and domain information
>COG3391 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK13616 lipoprotein LpqB; Provisional Back     alignment and domain information
>KOG4649 consensus PQQ (pyrrolo-quinoline quinone) repeat protein [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>COG0823 TolB Periplasmic component of the Tol biopolymer transport system [Intracellular trafficking and secretion] Back     alignment and domain information
>PF12894 Apc4_WD40: Anaphase-promoting complex subunit 4 WD40 domain Back     alignment and domain information
>KOG1832 consensus HIV-1 Vpr-binding protein [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PF04841 Vps16_N: Vps16, N-terminal region; InterPro: IPR006926 This protein forms part of the Class C vacuolar protein sorting (Vps) complex Back     alignment and domain information
>KOG4499 consensus Ca2+-binding protein Regucalcin/SMP30 [Inorganic ion transport and metabolism; Signal transduction mechanisms] Back     alignment and domain information
>PF04053 Coatomer_WDAD: Coatomer WD associated region ; InterPro: IPR006692 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>PF08366 LLGL: LLGL2; InterPro: IPR013577 This domain is found in lethal giant larvae homologue 2 (LLGL2) proteins and syntaxin-binding proteins like tomosyn [] Back     alignment and domain information
>PF12894 Apc4_WD40: Anaphase-promoting complex subunit 4 WD40 domain Back     alignment and domain information
>PF14727 PHTB1_N: PTHB1 N-terminus Back     alignment and domain information
>KOG3630 consensus Nuclear pore complex, Nup214/CAN component [Nuclear structure; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>COG3391 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF10168 Nup88: Nuclear pore component; InterPro: IPR019321 Nup88 can be divided into two structural domains; the N-terminal two-thirds of the protein have no obvious structural motifs Back     alignment and domain information
>KOG1832 consensus HIV-1 Vpr-binding protein [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PF14781 BBS2_N: Ciliary BBSome complex subunit 2, N-terminal Back     alignment and domain information
>cd00216 PQQ_DH Dehydrogenases with pyrrolo-quinoline quinone (PQQ) as cofactor, like ethanol, methanol, and membrane bound glucose dehydrogenases Back     alignment and domain information
>PF06977 SdiA-regulated: SdiA-regulated; InterPro: IPR009722 This entry represents a conserved region approximately 100 residues long within a number of hypothetical bacterial proteins that may be regulated by SdiA, a member of the LuxR family of transcriptional regulators [] Back     alignment and domain information
>KOG2395 consensus Protein involved in vacuole import and degradation [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG2444 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PF14761 HPS3_N: Hermansky-Pudlak syndrome 3 Back     alignment and domain information
>cd00216 PQQ_DH Dehydrogenases with pyrrolo-quinoline quinone (PQQ) as cofactor, like ethanol, methanol, and membrane bound glucose dehydrogenases Back     alignment and domain information
>PF06433 Me-amine-dh_H: Methylamine dehydrogenase heavy chain (MADH); InterPro: IPR009451 Methylamine dehydrogenase (1 Back     alignment and domain information
>PF10168 Nup88: Nuclear pore component; InterPro: IPR019321 Nup88 can be divided into two structural domains; the N-terminal two-thirds of the protein have no obvious structural motifs Back     alignment and domain information
>KOG1897 consensus Damage-specific DNA binding complex, subunit DDB1 [Replication, recombination and repair] Back     alignment and domain information
>PF04053 Coatomer_WDAD: Coatomer WD associated region ; InterPro: IPR006692 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>PF10395 Utp8: Utp8 family; InterPro: IPR018843 Utp8 is an essential component of the nuclear tRNA export machinery in Saccharomyces cerevisiae (Baker's yeast) Back     alignment and domain information
>PF14870 PSII_BNR: Photosynthesis system II assembly factor YCF48; PDB: 2XBG_A Back     alignment and domain information
>PF10979 DUF2786: Protein of unknown function (DUF2786); InterPro: IPR024498 This domain is found in proteins that have no known function Back     alignment and domain information
>PF08728 CRT10: CRT10; InterPro: IPR014839 CRT10 is a transcriptional regulator of ribonucleotide reductase (RNR) genes [] Back     alignment and domain information
>KOG1897 consensus Damage-specific DNA binding complex, subunit DDB1 [Replication, recombination and repair] Back     alignment and domain information
>COG3386 Gluconolactonase [Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG3630 consensus Nuclear pore complex, Nup214/CAN component [Nuclear structure; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PRK13616 lipoprotein LpqB; Provisional Back     alignment and domain information
>PF07569 Hira: TUP1-like enhancer of split; InterPro: IPR011494 The Hira proteins are found in a range of eukaryotes and are implicated in the assembly of repressive chromatin Back     alignment and domain information
>PF14655 RAB3GAP2_N: Rab3 GTPase-activating protein regulatory subunit N-terminus Back     alignment and domain information
>PF14781 BBS2_N: Ciliary BBSome complex subunit 2, N-terminal Back     alignment and domain information
>KOG1008 consensus Uncharacterized conserved protein, contains WD40 repeats [Function unknown] Back     alignment and domain information
>KOG1008 consensus Uncharacterized conserved protein, contains WD40 repeats [Function unknown] Back     alignment and domain information
>PF13449 Phytase-like: Esterase-like activity of phytase Back     alignment and domain information
>PF10313 DUF2415: Uncharacterised protein domain (DUF2415); InterPro: IPR019417 This entry represents a short (30 residues) domain of unknown function found in a family of fungal proteins Back     alignment and domain information
>PF12234 Rav1p_C: RAVE protein 1 C terminal; InterPro: IPR022033 This domain family is found in eukaryotes, and is typically between 621 and 644 amino acids in length Back     alignment and domain information
>PF10647 Gmad1: Lipoprotein LpqB beta-propeller domain; InterPro: IPR018910 The Gmad1 domain is found associated with IPR019606 from INTERPRO, in bacterial spore formation Back     alignment and domain information
>PF00930 DPPIV_N: Dipeptidyl peptidase IV (DPP IV) N-terminal region; InterPro: IPR002469 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>PF12234 Rav1p_C: RAVE protein 1 C terminal; InterPro: IPR022033 This domain family is found in eukaryotes, and is typically between 621 and 644 amino acids in length Back     alignment and domain information
>PF04841 Vps16_N: Vps16, N-terminal region; InterPro: IPR006926 This protein forms part of the Class C vacuolar protein sorting (Vps) complex Back     alignment and domain information
>PF15390 DUF4613: Domain of unknown function (DUF4613) Back     alignment and domain information
>PF11635 Med16: Mediator complex subunit 16; InterPro: IPR021665 Mediator is a large complex of up to 33 proteins that is conserved from plants through fungi to humans - the number and representation of individual subunits varying with species [],[] Back     alignment and domain information
>PF05096 Glu_cyclase_2: Glutamine cyclotransferase; InterPro: IPR007788 This family of enzymes 2 Back     alignment and domain information
>PF02897 Peptidase_S9_N: Prolyl oligopeptidase, N-terminal beta-propeller domain; InterPro: IPR004106 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>PLN00033 photosystem II stability/assembly factor; Provisional Back     alignment and domain information
>PF08728 CRT10: CRT10; InterPro: IPR014839 CRT10 is a transcriptional regulator of ribonucleotide reductase (RNR) genes [] Back     alignment and domain information
>PRK13684 Ycf48-like protein; Provisional Back     alignment and domain information
>PHA02713 hypothetical protein; Provisional Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query1057
2oaj_A902 Crystal Structure Of Sro7 From S. Cerevisiae Length 2e-04
>pdb|2OAJ|A Chain A, Crystal Structure Of Sro7 From S. Cerevisiae Length = 902 Back     alignment and structure 
Iteration: 1

 Score = 45.4 bits (106), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 37/142 (26%), Positives = 65/142 (45%), Gaps = 8/142 (5%)
Query: 7   GRIKVIGGDGIEGLLISPSQLPYKNLEFLQNQGFLISITNDNEIQVWSLESRSLACCLKW 66
           G + + G   +E ++    +   K + F++   +L+ I   + + V SL S+ +   +  
Sbjct: 39  GEVHIYGQQQVEVVIKLEDRSAIKEMRFVKGI-YLVVINAKDTVYVLSLYSQKVLTTVFV 97
Query: 67  ESNITAFSVISGSHFMYIGDENGLMSVIKYDADEGKLFQLPYNISADALSEKAGFPLLSH 126
              IT+    +   +M IG +NG M V   D D+   F+L      D L + + FP    
Sbjct: 98  PGKITSIDTDASLDWMLIGLQNGSMIVYDIDRDQLSSFKL------DNLQKSSFFPAARL 151
Query: 127 QPVVGVLPHPNSSGNRVLIAYE 148
            P+V +  +P   G  VLI+YE
Sbjct: 152 SPIVSIQWNPRDIGT-VLISYE 172

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

No hit with probability above 80.00

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 1057
d1vyhc1317 b.69.4.1 (C:92-408) Platelet-activating factor ace 4e-04
d1nr0a2299 b.69.4.1 (A:313-611) Actin interacting protein 1 { 0.001
d1gxra_337 b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Hum 0.004
d1k8kc_371 b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 0.004
>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Length = 317 Back     information, alignment and structure

class: All beta proteins
fold: 7-bladed beta-propeller
superfamily: WD40 repeat-like
family: WD40-repeat
domain: Platelet-activating factor acetylhydrolase IB subunit alpha
species: Mouse (Mus musculus) [TaxId: 10090]

 Score = 41.3 bits (95), Expect = 4e-04
 Identities = 39/319 (12%), Positives = 91/319 (28%), Gaps = 23/319 (7%)

Query: 199 EKEISALCWASSSGSILAVGYIDGDILLWNTSTTASTKGQQTGSRNNVVKLELSSAERRL 258
              ++ + +     S++     D  I +W+  T    +    G  ++V  +    + + L
Sbjct: 17  RSPVTRVIF-HPVFSVMVSASEDATIKVWDYET-GDFERTLKGHTDSVQDISFDHSGKLL 74

Query: 259 PVIVLHWSTNKESRSNIDGRLFVYGGDEIGSEEVL----TVLSLEWSSGMENLRCVSRVD 314
                  +         +    ++G D   S   +      +          +  V    
Sbjct: 75  ASCSADMTIKLWDFQGFECIRTMHGHDHNVSSVSIMPNGDHIVSASRDKTIKMWEVQTGY 134

Query: 315 ITLTGSFADMILLSSAGATVGNHKADLFVLTSPGQLHFYDNASLTTLLSQQEKKPSVCPV 374
              T +     +        G     +   ++   +  +  A+       +E +  V  +
Sbjct: 135 CVKTFTGHREWVRMVRPNQDGTL---IASCSNDQTVRVWVVATKECKAELREHRHVVECI 191

Query: 375 EFPGVIPISDPIMTVAEFMLLPFGGHSSKGLSEIATFTKLHSSHTQAGHIKWPLSGGVPS 434
            +      S   ++ A        G     L   +    +       G     L G   +
Sbjct: 192 SWA--PESSYSSISEATGSETKKSGKPGPFLLSGSRDKTIKMWDVSTGMCLMTLVGH-DN 248

Query: 435 PVPITKCHSVDRVYLAGYHDGSVRIWDATYPVFKLICALDAEVQGIEVAGSRAPVSTLSF 494
            V     HS  +  L+   D ++R+WD  Y   + +  L+              V++L F
Sbjct: 249 WVRGVLFHSGGKFILSCADDKTLRVWD--YKNKRCMKTLN---------AHEHFVTSLDF 297

Query: 495 CFINSSLAVGNEFGLVYIY 513
                 +  G+    V ++
Sbjct: 298 HKTAPYVVTGSVDQTVKVW 316
>d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 299 Back     information, alignment and structure
>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 337 Back     information, alignment and structure
>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} Length = 371 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query1057
d1erja_388 Tup1, C-terminal domain {Baker's yeast (Saccharomy 100.0
d1gxra_337 Groucho/tle1, C-terminal domain {Human (Homo sapie 100.0
d1gxra_337 Groucho/tle1, C-terminal domain {Human (Homo sapie 100.0
d1erja_388 Tup1, C-terminal domain {Baker's yeast (Saccharomy 100.0
d1vyhc1317 Platelet-activating factor acetylhydrolase IB subu 100.0
d1nr0a1311 Actin interacting protein 1 {Nematode (Caenorhabdi 100.0
d1tbga_340 beta1-subunit of the signal-transducing G protein 100.0
d1k8kc_371 Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taur 100.0
d1vyhc1317 Platelet-activating factor acetylhydrolase IB subu 100.0
d1k8kc_371 Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taur 100.0
d1nr0a2299 Actin interacting protein 1 {Nematode (Caenorhabdi 100.0
d1tbga_340 beta1-subunit of the signal-transducing G protein 100.0
d1nr0a1311 Actin interacting protein 1 {Nematode (Caenorhabdi 100.0
d1nexb2355 Cdc4 propeller domain {Baker's yeast (Saccharomyce 100.0
d1nr0a2299 Actin interacting protein 1 {Nematode (Caenorhabdi 99.98
d1nexb2355 Cdc4 propeller domain {Baker's yeast (Saccharomyce 99.98
d2ovrb2342 F-box/WD repeat-containing protein 7, FBXW7 {Human 99.97
d1pgua1325 Actin interacting protein 1 {Baker's yeast (Saccha 99.97
d2ovrb2342 F-box/WD repeat-containing protein 7, FBXW7 {Human 99.97
d1sq9a_393 Antiviral protein Ski8 (Ski8p) {Baker's yeast (Sac 99.97
d1sq9a_393 Antiviral protein Ski8 (Ski8p) {Baker's yeast (Sac 99.96
d1yfqa_342 Cell cycle arrest protein BUB3 {Baker's yeast (Sac 99.95
d1pgua1325 Actin interacting protein 1 {Baker's yeast (Saccha 99.95
d1qksa2432 C-terminal (heme d1) domain of cytochrome cd1-nitr 99.95
d1p22a2293 F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Hom 99.95
d1pgua2287 Actin interacting protein 1 {Baker's yeast (Saccha 99.94
d1yfqa_342 Cell cycle arrest protein BUB3 {Baker's yeast (Sac 99.94
d1hzua2426 C-terminal (heme d1) domain of cytochrome cd1-nitr 99.94
d1k32a3360 Tricorn protease domain 2 {Archaeon Thermoplasma a 99.94
d1p22a2293 F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Hom 99.94
d1pgua2287 Actin interacting protein 1 {Baker's yeast (Saccha 99.92
d1k32a3360 Tricorn protease domain 2 {Archaeon Thermoplasma a 99.91
d1qksa2432 C-terminal (heme d1) domain of cytochrome cd1-nitr 99.9
d1hzua2426 C-terminal (heme d1) domain of cytochrome cd1-nitr 99.88
d1jmxb_346 Quinohemoprotein amine dehydrogenase B chain {Pseu 99.86
d1pbyb_337 Quinohemoprotein amine dehydrogenase B chain {Para 99.85
d1l0qa2301 Surface layer protein {Archaeon Methanosarcina maz 99.84
d1l0qa2301 Surface layer protein {Archaeon Methanosarcina maz 99.84
d1jmxb_346 Quinohemoprotein amine dehydrogenase B chain {Pseu 99.78
d2madh_373 Methylamine dehydrogenase, H-chain {Gram negative 99.78
d1pbyb_337 Quinohemoprotein amine dehydrogenase B chain {Para 99.77
d1ri6a_333 Putative isomerase YbhE {Escherichia coli [TaxId: 99.71
d2madh_373 Methylamine dehydrogenase, H-chain {Gram negative 99.71
d2bbkh_355 Methylamine dehydrogenase, H-chain {Paracoccus den 99.65
d2bgra1470 Dipeptidyl peptidase IV/CD26, N-terminal domain {P 99.56
d1ri6a_333 Putative isomerase YbhE {Escherichia coli [TaxId: 99.51
d2bbkh_355 Methylamine dehydrogenase, H-chain {Paracoccus den 99.43
d2bgra1470 Dipeptidyl peptidase IV/CD26, N-terminal domain {P 99.3
d1mdah_368 Methylamine dehydrogenase, H-chain {Paracoccus den 99.28
d1mdah_368 Methylamine dehydrogenase, H-chain {Paracoccus den 99.02
d1qnia2441 Nitrous oxide reductase, N-terminal domain {Pseudo 98.98
d1qnia2441 Nitrous oxide reductase, N-terminal domain {Pseudo 98.64
d1jofa_365 3-carboxy-cis,cis-mucoante lactonizing enzyme {Neu 98.24
d2hqsa1269 TolB, C-terminal domain {Escherichia coli [TaxId: 98.04
d1jofa_365 3-carboxy-cis,cis-mucoante lactonizing enzyme {Neu 97.94
d2p4oa1302 Hypothetical protein All0351 homologue {Nostoc pun 97.52
d1pjxa_314 Diisopropylfluorophosphatase (phosphotriesterase, 97.22
d1xfda1465 Dipeptidyl aminopeptidase-like protein 6, DPP6, N- 97.08
d2p4oa1302 Hypothetical protein All0351 homologue {Nostoc pun 96.89
d1q7fa_279 Brain tumor cg10719-pa {Fruit fly (Drosophila mela 96.86
d1rwia_260 Serine/threonine-protein kinase PknD {Mycobacteriu 96.75
d1rwia_260 Serine/threonine-protein kinase PknD {Mycobacteriu 96.57
d2ghsa1295 Regucalcin {Agrobacterium tumefaciens [TaxId: 358] 96.21
d1pjxa_314 Diisopropylfluorophosphatase (phosphotriesterase, 96.02
d1xfda1465 Dipeptidyl aminopeptidase-like protein 6, DPP6, N- 94.93
d1q7fa_279 Brain tumor cg10719-pa {Fruit fly (Drosophila mela 91.97
d2ghsa1295 Regucalcin {Agrobacterium tumefaciens [TaxId: 358] 91.93
d1flga_582 Ethanol dehydrogenase {Pseudomonas aeruginosa [Tax 84.05
d1fwxa2459 Nitrous oxide reductase, N-terminal domain {Paraco 83.16
d2dg1a1319 Lactonase Drp35 {Staphylococcus aureus [TaxId: 128 82.57
d2ad6a1571 Methanol dehydrogenase, heavy chain {Methylophilus 81.47
d1kv9a2560 Quinoprotein alcohol dehydrogenase, N-terminal dom 80.55
>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
class: All beta proteins
fold: 7-bladed beta-propeller
superfamily: WD40 repeat-like
family: WD40-repeat
domain: Tup1, C-terminal domain
species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]

Probab=100.00  E-value=1.4e-34  Score=235.18  Aligned_cols=173  Identities=19%  Similarity=0.193  Sum_probs=132.8

Q ss_pred             CCCCCEEEEEECCCCEEEEECCCCCEEEEEECCCCEEEEEECCCCCCEEEEEEECCCCEEEEEECCCCEEEEEECCCCCC
Q ss_conf             89882999996798399996689961688611452001220499989799999608996999935860999993688776
Q 001538          442 HSVDRVYLAGYHDGSVRIWDATYPVFKLICALDAEVQGIEVAGSRAPVSTLSFCFINSSLAVGNEFGLVYIYNLNGSLDA  521 (1057)
Q Consensus       442 ~~~~~~liTG~~DGsVriWD~~~~~l~~l~~l~~~v~~i~l~~~~~~V~~i~fs~~~~~Lavg~~dG~V~i~~~~~~~~~  521 (1057)
                      ..+++++++|+.||.|++||...+...  ..+....  ....+|..+|++++|+|++..|++|+.||.|++|++......
T Consensus       214 ~~~~~~l~~~~~d~~i~i~~~~~~~~~--~~~~~~~--~~~~~h~~~v~~l~~s~~~~~l~s~~~d~~i~iwd~~~~~~~  289 (388)
T d1erja_         214 PGDGKYIAAGSLDRAVRVWDSETGFLV--ERLDSEN--ESGTGHKDSVYSVVFTRDGQSVVSGSLDRSVKLWNLQNANNK  289 (388)
T ss_dssp             STTCCEEEEEETTSCEEEEETTTCCEE--EEEC--------CCCSSCEEEEEECTTSSEEEEEETTSEEEEEEC------
T ss_pred             CCCCCEEEEECCCCEEEEEECCCCCCC--EEECCCC--CCCCCCCCCEEEEEECCCCCEEEEEECCCCEEEEECCCCCCC
T ss_conf             887875899738981999634557300--0102443--334577898789999799999999978992898751577643


Q ss_pred             CCEEEEECCCCCEEEECCCCCCEEEEEEEECCCCEEEEEECCCCCEEEEEECCCEEEEEECCCCEEEEEEECCCCCCCCE
Q ss_conf             41255313787168830698523659974079784999986799899998489609999579870799962488999884
Q 001538          522 KNFLFVLETKSEVHALPEGKISLCRAVFSLVNSPVRALQFTSSGAKLAVGFECGRVAVLDMNLLSVLFFTDDISGSSSPI  601 (1057)
Q Consensus       522 ~~~~~~~~~~~~i~~i~~~~g~~~~~~~~~h~~~ItsLa~S~~g~~LA~Gs~dG~i~vwDi~~~~~l~~~~~~~g~~~~V  601 (1057)
                      ..             ........+......|...|++++|+|++++|++|+.||.|++||+++++++..+.   +|..+|
T Consensus       290 ~~-------------~~~~~~~~~~~~~~~~~~~v~~~~~s~~~~~l~sg~~dg~i~vwd~~~~~~~~~l~---~H~~~V  353 (388)
T d1erja_         290 SD-------------SKTPNSGTCEVTYIGHKDFVLSVATTQNDEYILSGSKDRGVLFWDKKSGNPLLMLQ---GHRNSV  353 (388)
T ss_dssp             ----------------------CEEEEEECCSSCEEEEEECGGGCEEEEEETTSEEEEEETTTCCEEEEEE---CCSSCE
T ss_pred             CC-------------CCCCCCCCEEEECCCCCCEEEEEEECCCCCEEEEEECCCEEEEEECCCCCEEEEEE---CCCCCE
T ss_conf             21-------------01344420011012455327899988999999999698979999999996999996---889978


Q ss_pred             EEEEEEECCCCCCCCCCCCCCCCCCCCCCCCCEEEEEECCCEEEEEECC
Q ss_conf             8989832147644668999977767889997299997268719999289
Q 001538          602 ISMTWTEFKNTHSLAKNPNHSEREVPVNPAEEVIIVLFKDAKISIVGGS  650 (1057)
Q Consensus       602 ~sl~f~~~~~~~~~~~~~~~~~~~~~~~p~~~~L~~gt~dg~i~i~d~~  650 (1057)
                      +++++.....                -.|++.+|++|+.||+|++|+.+
T Consensus       354 ~~~~~~~~~~----------------~spd~~~l~s~s~Dg~I~iW~~~  386 (388)
T d1erja_         354 ISVAVANGSS----------------LGPEYNVFATGSGDCKARIWKYK  386 (388)
T ss_dssp             EEEEECSSCT----------------TCTTCEEEEEEETTSEEEEEEEE
T ss_pred             EEEEEECCCC----------------CCCCCCEEEEEECCCEEEEEEEE
T ss_conf             9999846742----------------58999999999189979997621
>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2ovrb2 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pgua1 b.69.4.1 (A:2-326) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2ovrb2 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sq9a_ b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1sq9a_ b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1yfqa_ b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1pgua1 b.69.4.1 (A:2-326) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1qksa2 b.70.2.1 (A:136-567) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1p22a2 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pgua2 b.69.4.1 (A:327-613) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1yfqa_ b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1hzua2 b.70.2.1 (A:118-543) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1k32a3 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1p22a2 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pgua2 b.69.4.1 (A:327-613) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1k32a3 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1qksa2 b.70.2.1 (A:136-567) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1hzua2 b.70.2.1 (A:118-543) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1jmxb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1pbyb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1l0qa2 b.69.2.3 (A:1-301) Surface layer protein {Archaeon Methanosarcina mazei [TaxId: 2209]} Back     information, alignment and structure
>d1l0qa2 b.69.2.3 (A:1-301) Surface layer protein {Archaeon Methanosarcina mazei [TaxId: 2209]} Back     information, alignment and structure
>d1jmxb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d2madh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Gram negative methylotrophic bacteria (Thiobacillus versutus) [TaxId: 34007]} Back     information, alignment and structure
>d1pbyb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1ri6a_ b.69.11.1 (A:) Putative isomerase YbhE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2madh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Gram negative methylotrophic bacteria (Thiobacillus versutus) [TaxId: 34007]} Back     information, alignment and structure
>d2bbkh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d2bgra1 b.70.3.1 (A:39-508) Dipeptidyl peptidase IV/CD26, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1ri6a_ b.69.11.1 (A:) Putative isomerase YbhE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2bbkh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d2bgra1 b.70.3.1 (A:39-508) Dipeptidyl peptidase IV/CD26, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1mdah_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1mdah_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1qnia2 b.69.3.1 (A:10-450) Nitrous oxide reductase, N-terminal domain {Pseudomonas nautica [TaxId: 2743]} Back     information, alignment and structure
>d1qnia2 b.69.3.1 (A:10-450) Nitrous oxide reductase, N-terminal domain {Pseudomonas nautica [TaxId: 2743]} Back     information, alignment and structure
>d1jofa_ b.69.10.1 (A:) 3-carboxy-cis,cis-mucoante lactonizing enzyme {Neurospora crassa [TaxId: 5141]} Back     information, alignment and structure
>d2hqsa1 b.68.4.1 (A:163-431) TolB, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1jofa_ b.69.10.1 (A:) 3-carboxy-cis,cis-mucoante lactonizing enzyme {Neurospora crassa [TaxId: 5141]} Back     information, alignment and structure
>d2p4oa1 b.68.6.3 (A:4-305) Hypothetical protein All0351 homologue {Nostoc punctiforme [TaxId: 272131]} Back     information, alignment and structure
>d1pjxa_ b.68.6.1 (A:) Diisopropylfluorophosphatase (phosphotriesterase, DFP) {Squid (Loligo vulgaris) [TaxId: 6622]} Back     information, alignment and structure
>d1xfda1 b.70.3.1 (A:127-591) Dipeptidyl aminopeptidase-like protein 6, DPP6, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2p4oa1 b.68.6.3 (A:4-305) Hypothetical protein All0351 homologue {Nostoc punctiforme [TaxId: 272131]} Back     information, alignment and structure
>d1q7fa_ b.68.9.1 (A:) Brain tumor cg10719-pa {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1rwia_ b.68.9.1 (A:) Serine/threonine-protein kinase PknD {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1rwia_ b.68.9.1 (A:) Serine/threonine-protein kinase PknD {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2ghsa1 b.68.6.1 (A:20-314) Regucalcin {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1pjxa_ b.68.6.1 (A:) Diisopropylfluorophosphatase (phosphotriesterase, DFP) {Squid (Loligo vulgaris) [TaxId: 6622]} Back     information, alignment and structure
>d1xfda1 b.70.3.1 (A:127-591) Dipeptidyl aminopeptidase-like protein 6, DPP6, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1q7fa_ b.68.9.1 (A:) Brain tumor cg10719-pa {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2ghsa1 b.68.6.1 (A:20-314) Regucalcin {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1flga_ b.70.1.1 (A:) Ethanol dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1fwxa2 b.69.3.1 (A:8-451) Nitrous oxide reductase, N-terminal domain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d2dg1a1 b.68.6.1 (A:6-324) Lactonase Drp35 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d2ad6a1 b.70.1.1 (A:1-571) Methanol dehydrogenase, heavy chain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} Back     information, alignment and structure
>d1kv9a2 b.70.1.1 (A:1-560) Quinoprotein alcohol dehydrogenase, N-terminal domain {Pseudomonas putida, hk5 [TaxId: 303]} Back     information, alignment and structure