Citrus Sinensis ID: 001554


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820-------830-------840-------850-------860-------870-------880-------890-------900-------910-------920-------930-------940-------950-------960-------970-------980-------990------1000------1010------1020------1030------1040------1050-----
MGNPLPFWSWKIWFSSFFFGFSLLCILVSGRCLEDQKLLLLEFKRGLSFDPQTDSTNKLLSWSSTTDCCSWDGVTCDPRTGHVIGLDISSSFITGGINGSSSLFDLQRLQHLNLADNSLYSSPFPSGFDRLFSLTHLNLSYSGFSGHIPLEISSLKMLVSLDLSASGLVAPIQLRRANLEKLVKNLTNLEELYLGGIDISGADWGPILSILSNLRILSLPDCHVAGPIHSSLSKLQLLTHLNLDGNDLSSEVPDFLTNFSSLQYLHLSLCGLYGRVPEKIFLMPSLCFLDVSSNSNLTGSLPEFPPSSQLKVIELSETRFSGKLPDSINNLALLEDLELSDCNFFGSIPSSFGNLTELINIDFSRNNFSGSLPSFASSNKVISLKFAHNSFTGTIPLSYGDQLISLQVLDLRNNSLQGIIPKSLYTKQSIESLLLGQNKFHGQLEKFQNASSLSLREMDFSQNKLQGLVPESIFQIKGLNVLRLSSNKFSGFITLEMFKDLRQLGTLELSENNFSFNVSGSNSNMFPKIGTLKLSSCKITEFPNFLRNQTNLFHLDLSNNRIKGEIPNWTWNVGDGKLVHLNLSHNMLEAFEKPGPNLTSTVLAVLDLHSNMLQGSFPIPPASIIFLDYSENKFTTNIPYNIGNYINYAVFFSLASNNLSGGIPLSLCNAFDLQVLDLSDNHLTGSIPSCLVSSNILKVLKLRNNEFLGTVPQVIGNECSLRTLDLSQNHLAGSLPKSLSKCTSLEVLDVGKNQLNGSFPFWLETLPQLRVLVLQSNNYDGSIKDTQTANAFALLQIIDISSNNFSGNLPARWFQSWRGMKKRTKESQESQILKFVYLELSNLYYQDSVTLMNKGLSMELAKILTIFTSIDVSNNQFEGEIPEMLGDFDALLVLNMSNNNFKGQIPATLGNLKELGSLDLSHNQLSGKIPEKLATLNFLSVLKLSQNLLVGEIPRGPQFATFTAASFEGNAGLCGFPLPKACQNALPPVEQTTKDEEGSGSIFDWEFFWIGFGFGDGTGMVIGITLGVVVSNEIIKKKGKVHRSISSGHALRRNL
cccccHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHcccccccccccccccccccccccccccccEEEccccccEEEEEcccccccEEccccccccccccccEEEccccccccccccccccccccccEEEcccccccccccccccccccccEEEccccccccccccccccHHHHHcccccccEEEcccccccccccHHHHcccccccEEEcccccccccccccccccccccEEEcccccccccccHHccccccccEEEcccccccccccccccccccccEEEcccccccccccccccccccccEEEcccccccccccHHccccccccEEEcccccccccccccccccccccEEEccccccccccccccccccccEEEcccccccccccHHHHcccccccEEEcccccccccccHHHHccccccEEEccccccEEEcccccccccccccEEEcccccccccccccccccccccEEEccccccEEEEccHHHcccccccEEEccccEEEEEEccccccccccccEEEccccccccccHHHcccccccEEEcccccccccccHHHHHcccccccEEEccccccccccccccccccccccEEEccccccccccccccccccEEEcccccccccccccHHHccccccEEEccccccEEEccccccccccccEEEcccccccccccccccccccccEEEccccccEEEccccccccccccEEEcccccccccccccccccccccEEEcccccccccccHHccccccccEEEccccccEEEccccccccccccccEEEcccccccccccHHHHHHHHHcccccccccccEEEEEEEcccccEEEEEEEEEEEccccEEHHHHccccEEEEcccccccccccHHHHccccccccccccccccccccccHHccccccEEccccccccccccccccccccccEEcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEEEEEEEHHHHHHHHHHHHHHHHHHHHccccccccEEEEEEcccccccccc
ccccHHHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHccccccccccccccccccccccccEEEEEEcccccEEEEEEcccccccccccccHHHHHHHHHHHEEccccccccccccHHHcccccccEEEcccccccccccHHHHcccccEEEEccccccccccccccccHHHHHHHcccccEEEcccccccccccHHHHHcccccEEEEcccccccccccHHHHccccccEEEcccccccccccHHHHccccccEEEcccccccccccHHHHccccccEEEEccccccccccccHccccccEEEEEccccccccccHHHHccccccEEEcccccccccccHHHcccccccEEEcccccccccccccccccccEEEEEccccccccccHHHHHcccccEEEEcccccccccccHHHccccccEEEEccccccccccccccccccccccEEEcccccccccccHHHHccccccEEEEccccccccccHHHHHHcccccEEEEcccccEEEcccccccccHHHHHHHHcccccccccHHHccccccEEEEcccccccccccHHHHHccccccEEEEcccccccccccccccccccccEEEEcccccccccccccccccEEEEEccccccccccHHHHHcccccEEEEcccccccccccHHHccccccEEEEcccccccccccHHHHcccccEEEEcccccccccccHHHccccccEEEEcccccccccccHHHHcccccEEEEcccccccccccHHHHcccccEEEEEEcccccccccccHcccccccEEEEEEccccccccccHHHHHHHHHHHHccccccccccccHHHccccccEEEHEEEEEcccccHHHHHHccEEEEEEcccccccccccHHHHHHHHHcEEEccccccccccccHccccccccEEEccccccEEcccHHHHHcccccEEEccccEEEEEccccccHHHccHHHcccccEEEccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHccHHHHccc
mgnplpfwswkiWFSSFFFGFSLLCILVSGRCLEDQKLLLLEFkrglsfdpqtdstnkllswssttdccswdgvtcdprtghvigldisssfitggingssslfDLQRlqhlnladnslysspfpsgfdrLFSLThlnlsysgfsghipleISSLKMLVSLdlsasglvapIQLRRANLEKLVKNLTNLEELYlggidisgadwgpILSILSnlrilslpdchvagpihsslSKLQLLTHlnldgndlssevpdfltnFSSLQYLHLSLcglygrvpekiflmpslcfldvssnsnltgslpefppssqlkvielsetrfsgklpdsinnlalledlelsdcnffgsipssfgnltelinidfsrnnfsgslpsfassnkVISLKFahnsftgtiplsygdqliSLQVLDLRnnslqgiipkslytKQSIESLLLGQNKFHGQLEKFQNASSLSLREMDFSqnklqglvpesifqikglnvlrlssnkfsgfITLEMFKDLRQlgtlelsennfsfnvsgsnsnmfpkigtlklssckitefpnflrnqtnlfhldlsnnrikgeipnwtwnvgdgkLVHLNLSHNMLEafekpgpnltSTVLAVLDLHSnmlqgsfpippasiifldysenkfttnipynignYINYAVFFSLAsnnlsggiplslcnafdlqvldlsdnhltgsipsclvssNILKVLKLRnneflgtvpqvignecslrtldlsqnhlagslpkslskctslevldvgknqlngsfpfwletLPQLRVLVLQSnnydgsikDTQTANAFALLQIIDissnnfsgnlparwFQSWRgmkkrtkesqESQILKFVYLELSNLYYQDSVTLMNKGLSMELAKILTIFTSidvsnnqfegeipeMLGDFDALLVLNMsnnnfkgqipatlgnlkelgsldlshnqlsgkipekLATLNFLSVLKLSQNllvgeiprgpqfatftaasfegnaglcgfplpkacqnalppveqttkdeegsgsifdweffwigfgfgdgtGMVIGITLGVVVSNEIIKKKGKVHRSISSGHALRRNL
MGNPLPFWSWKIWFSSFFFGFSLLCILVSGRCLEDQKLLLLEFKRGLSFDPQTDSTNKLLSWSSTTDCCSWDGVTCDPRTGHVIGLDISSSFITGGINGSSSLFDLQRLQHLNLADNSLYSSPFPSGFDRLFSLTHLNLSYSGFSGHIPLEISSLKMLVSLDLSASGLVAPIQLRRANLEKLVKNLTNLEELYLGGIDISGADWGPILSILSNLRILSLPDCHVAGPIHSSLSKLQLLTHLNLDGNDLSSEVPDFLTNFSSLQYLHLSLCGLYGRVPEKIFLMPSLCFLDVSSNSNLTGSLPEFPPSSQLKVIELSETRFSGKLPDSINNLALLEDLELSDCNFFGSIPSSFGNLTELINIDFSRNNFSGSLPSFASSNKVISLKFAHNSFTGTIPLSYGDQLISLQVLDLRNNSLQGIIPKSLYTKQSIESLLLGQNKFHGQLEKFQNASSLSLREMDFSQNKLQGLVPESIFQIKGLNVLRLSSNKFSGFITLEMFKDLRQLGTLELSENNFSFNVSGSNSNMFPKIGTLKLSSCKITEFPNFLRNQTNLFHLDLSNNRIKGEIPNWTWNVGDGKLVHLNLSHNMLEAFEKPGPNLTSTVLAVLDLHSNMLQGSFPIPPASIIFLDYSENKFTTNIPYNIGNYINYAVFFSLASNNLSGGIPLSLCNAFDLQVLDLSDNHLTGSIPSCLVSSNILKVLKLRNNEFLGTVPQVIGNECSLRTLDLSQNHLAGSLPKSLSKCTSLEVLDVGKNQLNGSFPFWLETLPQLRVLVLQSNNYDGSIKDTQTANAFALLQIIDIssnnfsgnlpARWFQSWRGMKKRTKESQESQILKFVYLELSNLYYQDSVTLMNKGLSMELAKILTIFTSIDVSNNQFEGEIPEMLGDFDALLVLNMSNNNFKGQIPATLGNLKELGSLDLSHNQLSGKIPEKLATLNFLSVLKLSQNLLVGEIPRGPQFATFTAASFEGNAGLCGFPLPKACQNALPPVEQTTKDEEGSGSIFDWEFFWIGFGFGDGTGMVIGITLGVVVSNeiikkkgkvhrsissghalrrnl
MGNPLPfwswkiwfssfffgfsLLCILVSGRCLEDQKLLLLEFKRGLSFDPQTDSTNKLLSWSSTTDCCSWDGVTCDPRTGHVIGLDISSSFITGGINGSSSLFDLQRLQHLNLADNSLYSSPFPSGFDRLFSLTHLNLSYSGFSGHIPLEISSLKMLVSLDLSASGLVAPIQLRRANLEKLVKNLTNLEELYLGGIDISGADWGPilsilsnlrilslPDCHVAGPIHSSLSKLQLLTHLNLDGNDLSSEVPDFLTNFSSLQYLHLSLCGLYGRVPEKIFLMPSLCFLDVSSNSNLTGSLPEFPPSSQLKVIELSETRFSGKLPDSINNLALLEDLELSDCNFFGSIPSSFGNLTELINIDFSRNNFSGSLPSFASSNKVISLKFAHNSFTGTIPLSYGDQLISLQVLDLRNNSLQGIIPKSLYTKQSIESLLLGQNKFHGQLEKFQNASSLSLREMDFSQNKLQGLVPESIFQIKGLNVLRLSSNKFSGFITLEMFKDLRQLGTLELsennfsfnvsgsnsnmfPKIGTLKLSSCKITEFPNFLRNQTNLFHLDLSNNRIKGEIPNWTWNVGDGKLVHLNLSHNMLEAFEKPGPNLTSTVLAVLDLHSNMLQGSFPIPPASIIFLDYSENKFTTnipynignyinyAVFFSLASNNLSGGIPLSLCNAFDLQVLDLSDNHLTGSIPSCLVSSNILKVLKLRNNEFLGTVPQVIGNECSLRTLDLSQNHLAGSLPKSLSKCTSLEVLDVGKNQLNGSFPFWLETLPQLRVLVLQSNNYDGSIKDTQTANAFALLQIIDISSNNFSGNLPARWFQSWRGMKKRTKESQESQILKFVYLELSNLYYQDSVTLMNKGLSMELAKILTIFTSIDVSNNQFEGEIPEMLGDFDALLVLNMSNNNFKGQIPATLGNLKELGSLDLSHNQLSGKIPEKLATLNFLSVLKLSQNLLVGEIPRGPQFATFTAASFEGNAGLCGFPLPKACQNALPPVEQTTKDEEGSGSIFDWEFFWIGFGFGDGTGMVIGITLGVVVSNEIIKKKGKVHRSISSGHALRRNL
****LPFWSWKIWFSSFFFGFSLLCILVSGRCLEDQKLLLLEFKRGLSFDPQTDSTNKLLSWSSTTDCCSWDGVTCDPRTGHVIGLDISSSFITGGINGSSSLFDLQRLQHLNLADNSLYSSPFPSGFDRLFSLTHLNLSYSGFSGHIPLEISSLKMLVSLDLSASGLVAPIQLRRANLEKLVKNLTNLEELYLGGIDISGADWGPILSILSNLRILSLPDCHVAGPIHSSLSKLQLLTHLNLDGNDLSSEVPDFLTNFSSLQYLHLSLCGLYGRVPEKIFLMPSLCFLDVS***************************FSGKLPDSINNLALLEDLELSDCNFFGSIPSSFGNLTELINIDFSRNNFSGSLPSFASSNKVISLKFAHNSFTGTIPLSYGDQLISLQVLDLRNNSLQGIIPKSLYTKQSIESLLLGQNKFHGQLEKF***************NKLQGLVPESIFQIKGLNVLRLSSNKFSGFITLEMFKDLRQLGTLELSENNFSFNVSGSNSNMFPKIGTLKLSSCKITEFPNFLRNQTNLFHLDLSNNRIKGEIPNWTWNVGDGKLVHLNLSHNMLEAFEKPGPNLTSTVLAVLDLHSNMLQGSFPIPPASIIFLDYSENKFTTNIPYNIGNYINYAVFFSLASNNLSGGIPLSLCNAFDLQVLDLSDNHLTGSIPSCLVSSNILKVLKLRNNEFLGTVPQVIGNECSLRTLDLSQNHLAGSLPKSLSKCTSLEVLDVGKNQLNGSFPFWLETLPQLRVLVLQSNNYDGSIKDTQTANAFALLQIIDISSNNFSGNLPARWFQSWRGM**********QILKFVYLELSNLYYQDSVTLMNKGLSMELAKILTIFTSIDVSNNQFEGEIPEMLGDFDALLVLNMSNNNFKGQIPATLGNLKELGSLDLSHNQLSGKIPEKLATLNFLSVLKLSQNLLVGEIPRGPQFATFTAASFEGNAGLCGFPLPKACQNA**************GSIFDWEFFWIGFGFGDGTGMVIGITLGVVVSNEIIKK******************
*****PFWSWKIWFSSFFFGFSLLCILVSGRCLEDQKLLLLEFKRGLSFDPQTDSTNKLLSWSSTTDCCSWDGVTCDPRTGHVIGLDISSSFITGGINGSSSLFDLQRLQHLNLADNSLYSSPFPSGFDRLFSLTHLNLSYSGFSGHIPLEISSLKMLVSLDLSASGLVAPIQLRRANLEKLVKNLTNLEELYLGGIDISGADWGPILSILSNLRILSLPDCHVAGPIHSSLSKLQLLTHLNLDGNDLSSEVPDFLTNFSSLQYLHLSLCGLYGRVPEKIFLMPSLCFLDVSSNSNLTGSLPEFPPSSQLKVIELSETRFSGKLPDSINNLALLEDLELSDCNFFGSIPSSFGNLTELINIDFSRNNFSGSLPSFASSNKVISLKFAHNSFTGTIPLSYGDQLISLQVLDLRNNSLQGIIPKSLYTKQSIESLLLGQNKFHGQLEKFQNASSLSLREMDFSQNKLQGLVPESIFQIKGLNVLRLSSNKFSGFITLEMFKDLRQLGTLELSENNFSFNVSGSNSNMFPKIGTLKLSSCKITEFPNFLRNQTNLFHLDLSNNRIKGEIPNWTWNVGDGKLVHLNLSHNMLEAFEKPGPNLTSTVLAVLDLHSNMLQGSFPIPPASIIFLDYSENKFTTNIPYNIGNYINYAVFFSLASNNLSGGIPLSLCNAFDLQVLDLSDNHLTGSIPSCLVSSNILKVLKLRNNEFLGTVPQVIGNECSLRTLDLSQNHLAGSLPKSLSKCTSLEVLDVGKNQLNGSFPFWLETLPQLRVLVLQSNNYDGSIKDTQTANAFALLQIIDISSNNFSGNLPARWFQSWRGMK***********LKFVYLELSNLYYQDSVTLMNKGLSMELAKILTIFTSIDVSNNQFEGEIPEMLGDFDALLVLNMSNNNFKGQIPATLGNLKELGSLDLSHNQLSGKIPEKLATLNFLSVLKLSQNLLVGEIPRGPQFATFTAASFEGNAGLCGFPL**************************WEFFWIGFGFGDGTGMVIGITLGVVVSNEIIKKKGKVHRSIS*********
MGNPLPFWSWKIWFSSFFFGFSLLCILVSGRCLEDQKLLLLEFKRGLSFDPQTDSTNKLLSWSSTTDCCSWDGVTCDPRTGHVIGLDISSSFITGGINGSSSLFDLQRLQHLNLADNSLYSSPFPSGFDRLFSLTHLNLSYSGFSGHIPLEISSLKMLVSLDLSASGLVAPIQLRRANLEKLVKNLTNLEELYLGGIDISGADWGPILSILSNLRILSLPDCHVAGPIHSSLSKLQLLTHLNLDGNDLSSEVPDFLTNFSSLQYLHLSLCGLYGRVPEKIFLMPSLCFLDVSSNSNLTGSLPEFPPSSQLKVIELSETRFSGKLPDSINNLALLEDLELSDCNFFGSIPSSFGNLTELINIDFSRNNFSGSLPSFASSNKVISLKFAHNSFTGTIPLSYGDQLISLQVLDLRNNSLQGIIPKSLYTKQSIESLLLGQNKFHGQLEKFQNASSLSLREMDFSQNKLQGLVPESIFQIKGLNVLRLSSNKFSGFITLEMFKDLRQLGTLELSENNFSFNVSGSNSNMFPKIGTLKLSSCKITEFPNFLRNQTNLFHLDLSNNRIKGEIPNWTWNVGDGKLVHLNLSHNMLEAFEKPGPNLTSTVLAVLDLHSNMLQGSFPIPPASIIFLDYSENKFTTNIPYNIGNYINYAVFFSLASNNLSGGIPLSLCNAFDLQVLDLSDNHLTGSIPSCLVSSNILKVLKLRNNEFLGTVPQVIGNECSLRTLDLSQNHLAGSLPKSLSKCTSLEVLDVGKNQLNGSFPFWLETLPQLRVLVLQSNNYDGSIKDTQTANAFALLQIIDISSNNFSGNLPARWFQSWR***********SQILKFVYLELSNLYYQDSVTLMNKGLSMELAKILTIFTSIDVSNNQFEGEIPEMLGDFDALLVLNMSNNNFKGQIPATLGNLKELGSLDLSHNQLSGKIPEKLATLNFLSVLKLSQNLLVGEIPRGPQFATFTAASFEGNAGLCGFPLPKACQNALPP*********GSGSIFDWEFFWIGFGFGDGTGMVIGITLGVVVSNEIIKK******************
***PLPFWSWKIWFSSFFFGFSLLCILVSGRCLEDQKLLLLEFKRGLSFDPQ*DSTNKLLSWSSTTDCCSWDGVTCDPRTGHVIGLDISSSFITGGINGSSSLFDLQRLQHLNLADNSLYSSPFPSGFDRLFSLTHLNLSYSGFSGHIPLEISSLKMLVSLDLSASGLVAPIQLRRANLEKLVKNLTNLEELYLGGIDISGADWGPILSILSNLRILSLPDCHVAGPIHSSLSKLQLLTHLNLDGNDLSSEVPDFLTNFSSLQYLHLSLCGLYGRVPEKIFLMPSLCFLDVSSNSNLTGSLPEFPPSSQLKVIELSETRFSGKLPDSINNLALLEDLELSDCNFFGSIPSSFGNLTELINIDFSRNNFSGSLPSFASSNKVISLKFAHNSFTGTIPLSYGDQLISLQVLDLRNNSLQGIIPKSLYTKQSIESLLLGQNKFHGQLEKFQNASSLSLREMDFSQNKLQGLVPESIFQIKGLNVLRLSSNKFSGFITLEMFKDLRQLGTLELSENNFSFNVSGSNSNMFPKIGTLKLSSCKITEFPNFLRNQTNLFHLDLSNNRIKGEIPNWTWNVGDGKLVHLNLSHNMLEAFEKPGPNLTSTVLAVLDLHSNMLQGSFPIPPASIIFLDYSENKFTTNIPYNIGNYINYAVFFSLASNNLSGGIPLSLCNAFDLQVLDLSDNHLTGSIPSCLVSSNILKVLKLRNNEFLGTVPQVIGNECSLRTLDLSQNHLAGSLPKSLSKCTSLEVLDVGKNQLNGSFPFWLETLPQLRVLVLQSNNYDGSIKDTQTANAFALLQIIDISSNNFSGNLPARWFQSWRGMKKRTKESQESQILKFVYLELSNLYYQDSVTLMNKGLSMELAKILTIFTSIDVSNNQFEGEIPEMLGDFDALLVLNMSNNNFKGQIPATLGNLKELGSLDLSHNQLSGKIPEKLATLNFLSVLKLSQNLLVGEIPRGPQFATFTAASFEGNAGLCGFPLPKAC******************SIFDWEFFWIGFGFGDGTGMVIGITLGVVVSNEIIKKKGKVHRS***********
iiiiiiHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSiiHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGNPLPFWSWKIWFSSFFFGFSLLCILVSGRCLEDQKLLLLEFKRGLSFDPQTDSTNKLLSWSSTTDCCSWDGVTCDPRTGHVIGLDISSSFITGGINGSSSLFDLQRLQHLNLADNSLYSSPFPSGFDRLFSLTHLNLSYSGFSGHIPLEISSLKMLVSLDLSASGLVAPxxxxxxxxxxxxxxxxxxxxxYLGGIDISGADWGPILSILSNLRILSLPDCHVAGPIHSSLSKLQLLTHLNLDGNDLSSEVPDFLTNFSSLQYLHLSLCGLYGRVPEKIFLMPSLCFLDVSSNSNLTGSLPEFPPSSQLKVIELSETRFSGKLPDSINNLALLEDLELSDCNFFGSIPSSFGNLTELINIDFSRNNFSGSLPSFASSNKVISLKFAHNSFTGTIPLSYGDQLISLQVLDLRNNSLQGIIPKSLYTKQSIESLLLGQNKFHGQLEKFQNASSLSLREMDFSQNKLQGLVPESIFQIKGLNVLRLSSNKFSGFITLEMFKDLRQLGTLELSENNFSFNVSGSNSNMFPKIGTLKLSSCKITEFPNFLRNQTNLFHLDLSNNRIKGEIPNWTWNVGDGKLVHLNLSHNMLEAFEKPGPNLTSTVLAVLDLHSNMLQGSFPIPPASIIFLDYSENKFTTNIPYNIGNYINYAVFFSLASNNLSGGIPLSLCNAFDLQVLDLSDNHLTGSIPSCLVSSNILKVLKLRNNEFLGTVPQVIGNECSLRTLDLSQNHLAGSLPKSLSKCTSLEVLDVGKNQLNGSFPFWLETLPQLRVLVLQSNNYDGSIKDTQTANAFALLQIIDISSNNFSGNLPARWFQSWRGMKKRTKESQESQILKFVYLELSNLYYQDSVTLMNKGLSMELAKILTIFTSIDVSNNQFEGEIPEMLGDFDALLVLNMSNNNFKGQIPATLGNLKELGSLDLSHNQLSGKIPEKLATLNFLSVLKLSQNLLVGEIPRGPQFATFTAASFEGNAGLCGFPLPKACQNALPPVEQTTKDEEGSGSIFDWEFFWIGFGFGDGTGMVIGITLGVVVSNEIIKKKGKVHRSISSGHALRRNL
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query1055 2.2.26 [Sep-21-2011]
Q9C9H7847 Receptor-like protein 12 no no 0.661 0.824 0.355 2e-94
C0LGQ5 1249 LRR receptor-like serine/ no no 0.758 0.640 0.304 6e-83
Q9FIZ3 1252 LRR receptor-like serine/ no no 0.751 0.633 0.284 2e-69
Q9FL28 1173 LRR receptor-like serine/ no no 0.631 0.567 0.321 2e-68
Q9LYN8 1192 Leucine-rich repeat recep no no 0.589 0.521 0.316 4e-61
O49318 1124 Probable leucine-rich rep no no 0.593 0.556 0.3 6e-59
C0LGS2 1136 Probable LRR receptor-lik no no 0.618 0.574 0.307 1e-58
Q9SHI2 1101 Leucine-rich repeat recep no no 0.599 0.574 0.292 4e-58
Q9SSL9 1123 Leucine-rich repeat recep no no 0.589 0.553 0.301 1e-57
Q9LP24 1120 Probable leucine-rich rep no no 0.631 0.594 0.300 5e-57
>sp|Q9C9H7|RLP12_ARATH Receptor-like protein 12 OS=Arabidopsis thaliana GN=RLP12 PE=2 SV=2 Back     alignment and function desciption
 Score =  347 bits (891), Expect = 2e-94,   Method: Compositional matrix adjust.
 Identities = 257/722 (35%), Positives = 377/722 (52%), Gaps = 24/722 (3%)

Query: 310  LKVIELSETRFSGKLPDSINNLALLEDLELSDCNFFGSIPSSFGNLTELINIDFSRNNFS 369
            L+ ++L+     G++P S+ NL+ L  + L    F G IP+S GNL +L ++  + N  +
Sbjct: 112  LRHLDLTNCNLYGEIPSSLGNLSHLTLVNLYFNKFVGEIPASIGNLNQLRHLILANNVLT 171

Query: 370  GSLPS-FASSNKVISLKFAHNSFTGTIPLSYGDQLISLQVLDLRNNSLQGIIPKSLYTKQ 428
            G +PS   + +++++L+   N   G IP S GD L  L+ L L +N+L G IP SL    
Sbjct: 172  GEIPSSLGNLSRLVNLELFSNRLVGKIPDSIGD-LKQLRNLSLASNNLIGEIPSSLGNLS 230

Query: 429  SIESLLLGQNKFHGQLEKFQNASSLSLREMDFSQNKLQGLVPESIFQIKGLNVLRLSSNK 488
            ++  L+L  N+  G++      + + LR M F  N L G +P S   +  L++  LSSN 
Sbjct: 231  NLVHLVLTHNQLVGEVPA-SIGNLIELRVMSFENNSLSGNIPISFANLTKLSIFVLSSNN 289

Query: 489  FSGFITLEMFKDLRQLGTLELSENNFSFNVSGSNSNMFPKIGTLKLSSCKIT---EFPNF 545
            F+     +M      L   ++S N+FS     S   + P + ++ L   + T   EF N 
Sbjct: 290  FTSTFPFDM-SIFHNLEYFDVSYNSFSGPFPKSLL-LIPSLESIYLQENQFTGPIEFAN- 346

Query: 546  LRNQTNLFHLDLSNNRIKGEIPNWTWNVGDGKLVHLNLSHNMLEAFEKPGPNLTSTVLAV 605
              + T L  L L  NR+ G IP     + +  L  L++SHN       P  +    +L  
Sbjct: 347  TSSSTKLQDLILGRNRLHGPIPESISRLLN--LEELDISHNNFTGAIPPTISKLVNLLH- 403

Query: 606  LDLHSNMLQGSFPIPPASIIFLDYSENKFTTNIPYNIGNYINYAVFFSLASNNLSGGIPL 665
            LDL  N L+G  P     +  +  S N F++    N            L SN+  G IP 
Sbjct: 404  LDLSKNNLEGEVPACLWRLNTMVLSHNSFSSF--ENTSQEEALIEELDLNSNSFQGPIPY 461

Query: 666  SLCNAFDLQVLDLSDNHLTGSIPSCLVS-SNILKVLKLRNNEFLGTVPQVIGNECSLRTL 724
             +C    L  LDLS+N  +GSIPSC+ + S  +K L L +N F GT+P +      L +L
Sbjct: 462  MICKLSSLGFLDLSNNLFSGSIPSCIRNFSGSIKELNLGDNNFSGTLPDIFSKATELVSL 521

Query: 725  DLSQNHLAGSLPKSLSKCTSLEVLDVGKNQLNGSFPFWLETLPQLRVLVLQSNNYDGSIK 784
            D+S N L G  PKSL  C +LE+++V  N++   FP WLE+LP L VL L+SN + G + 
Sbjct: 522  DVSHNQLEGKFPKSLINCKALELVNVESNKIKDIFPSWLESLPSLHVLNLRSNKFYGPLY 581

Query: 785  DTQTANAFALLQIIDISSNNFSGNLPARWFQSWRGMKKRTKESQESQILKFVYLELSNLY 844
                +  F  L+IIDIS NNFSG LP  +F +W+ M   T+E  +     + Y   ++ Y
Sbjct: 582  HRHASIGFQSLRIIDISHNNFSGTLPPYYFSNWKDMTTLTEEMDQYMTEFWRY---ADSY 638

Query: 845  YQDSVTLMNKGLSMELAKILTIFTSIDVSNNQFEGEIPEMLGDFDALLVLNMSNNNFKGQ 904
            Y + + ++NKG+ M   +I   F +ID S N+  G IPE LG    L VLN+S N F   
Sbjct: 639  YHE-MEMVNKGVDMSFERIRRDFRAIDFSGNKINGNIPESLGYLKELRVLNLSGNAFTSV 697

Query: 905  IPATLGNLKELGSLDLSHNQLSGKIPEKLATLNFLSVLKLSQNLLVGEIPRGPQFATFTA 964
            IP  L NL +L +LD+S N+LSG+IP+ LA L+FLS +  S NLL G +PRG QF     
Sbjct: 698  IPRFLANLTKLETLDISRNKLSGQIPQDLAALSFLSYMNFSHNLLQGPVPRGTQFQRQKC 757

Query: 965  ASFEGNAGLCGFPLPKACQN--ALPPVEQTTKD-EEGSGSIFDWEFFWIGFGFGDGTGMV 1021
            +SF  N GL G  L   C++  AL P  Q  +D  E   ++F+W    I +G G   G+V
Sbjct: 758  SSFLDNPGLYG--LEDICRDTGALNPTSQLPEDLSEAEENMFNWVAAAIAYGPGVLCGLV 815

Query: 1022 IG 1023
            IG
Sbjct: 816  IG 817




Involved in the perception of CLV3 and CLV3-like peptides, that act as extracellular signals regulating meristems maintenance.
Arabidopsis thaliana (taxid: 3702)
>sp|C0LGQ5|GSO1_ARATH LRR receptor-like serine/threonine-protein kinase GSO1 OS=Arabidopsis thaliana GN=GSO1 PE=2 SV=1 Back     alignment and function description
>sp|Q9FIZ3|GSO2_ARATH LRR receptor-like serine/threonine-protein kinase GSO2 OS=Arabidopsis thaliana GN=GSO2 PE=2 SV=2 Back     alignment and function description
>sp|Q9FL28|FLS2_ARATH LRR receptor-like serine/threonine-protein kinase FLS2 OS=Arabidopsis thaliana GN=FLS2 PE=1 SV=1 Back     alignment and function description
>sp|Q9LYN8|EXS_ARATH Leucine-rich repeat receptor protein kinase EXS OS=Arabidopsis thaliana GN=EXS PE=1 SV=1 Back     alignment and function description
>sp|O49318|Y2317_ARATH Probable leucine-rich repeat receptor-like protein kinase At2g33170 OS=Arabidopsis thaliana GN=At2g33170 PE=2 SV=1 Back     alignment and function description
>sp|C0LGS2|Y4361_ARATH Probable LRR receptor-like serine/threonine-protein kinase At4g36180 OS=Arabidopsis thaliana GN=At4g36180 PE=1 SV=1 Back     alignment and function description
>sp|Q9SHI2|Y1723_ARATH Leucine-rich repeat receptor-like serine/threonine-protein kinase At1g17230 OS=Arabidopsis thaliana GN=At1g17230 PE=2 SV=2 Back     alignment and function description
>sp|Q9SSL9|PEPR1_ARATH Leucine-rich repeat receptor-like protein kinase PEPR1 OS=Arabidopsis thaliana GN=PEPR1 PE=1 SV=1 Back     alignment and function description
>sp|Q9LP24|Y1571_ARATH Probable leucine-rich repeat receptor-like protein kinase At1g35710 OS=Arabidopsis thaliana GN=At1g35710 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query1055
2241384241057 predicted protein [Populus trichocarpa] 0.963 0.962 0.591 0.0
3594812981070 PREDICTED: LRR receptor-like serine/thre 0.949 0.936 0.498 0.0
3594813041057 PREDICTED: LRR receptor-like serine/thre 0.936 0.934 0.492 0.0
3594813001054 PREDICTED: leucine-rich repeat receptor 0.937 0.938 0.494 0.0
359481293 1197 PREDICTED: leucine-rich repeat receptor 0.963 0.848 0.489 0.0
3594812961075 PREDICTED: receptor-like protein 12-like 0.981 0.963 0.477 0.0
1478060631032 hypothetical protein VITISV_032508 [Viti 0.925 0.945 0.486 0.0
2140114381128 GbVe [Gossypium barbadense] 0.952 0.890 0.468 0.0
2241391841032 predicted protein [Populus trichocarpa] 0.947 0.968 0.478 0.0
3565065791123 PREDICTED: probable LRR receptor-like se 0.928 0.872 0.463 0.0
>gi|224138424|ref|XP_002326599.1| predicted protein [Populus trichocarpa] gi|222833921|gb|EEE72398.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
 Score = 1132 bits (2929), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 606/1025 (59%), Positives = 752/1025 (73%), Gaps = 8/1025 (0%)

Query: 18   FFGFSLLCILVSGRCLEDQKLLLLEFKRGLSFDPQTDSTNKLLSWSSTTDCCSWDGVTCD 77
            F G   L  +VS +CLE Q+ +LL+ K+ LS DP   + +KLLSW+ T +CC WDGVTCD
Sbjct: 17   FVGICFLSSIVSSQCLEHQRSVLLQIKQELSIDPHFVTDSKLLSWTPTKNCCLWDGVTCD 76

Query: 78   PRTGHVIGLDISSSFITGGINGSSSLFDLQRLQHLNLADNSLYSSPFPSGFDRLFSLTHL 137
             +TG+V+GLD+S+S IT GINGS+S+F L  LQ+L++A N LYSSPFPSGF RL SLTHL
Sbjct: 77   LQTGYVVGLDLSNSSITSGINGSTSIFSLHHLQYLSIAGNELYSSPFPSGFSRLSSLTHL 136

Query: 138  NLSYSGFSGHIPLEISSLKMLVSLDLS--ASGLVAPIQLRRANLEKLVKNLTNLEELYLG 195
            N S+SGF G +P EIS L+ LVSLDLS    G   P+ L+  ++E LV+NLT L  L+L 
Sbjct: 137  NFSWSGFFGQVPAEISFLRKLVSLDLSFYPFGSEEPVTLQNPDIETLVENLTRLRVLHLD 196

Query: 196  GIDISGAD---WGPILSILSNLRILSLPDCHVAGPIHSSLSKLQLLTHLNLDGNDLSSEV 252
            GID+S A+   W  + + L NLR+L L +C++AG +H SL +L+ LT L L GN+ SS V
Sbjct: 197  GIDLSMAESKLWAVLSTKLPNLRVLGLSNCNLAGVLHPSLLQLEKLTDLQLSGNNFSSRV 256

Query: 253  PDFLTNFSSLQYLHLSLCGLYGRVPEKIFLMPSLCFLDVSSNSNLTGSLP-EFPPSSQLK 311
            PDFL  FSSL+ LHLS CGLYG  P  +FLM +L  LDVS NSNLTG+LP EFP  S+L+
Sbjct: 257  PDFLAKFSSLKTLHLSCCGLYGIFPNSLFLMRTLRSLDVSYNSNLTGTLPAEFPSGSRLE 316

Query: 312  VIELSETRFSGKLPDSINNLALLEDLELSDCNFFGSIPSSFGNLTELINIDFSRNNFSGS 371
            VI LS T F G LP SI NL  L+DLE+S C+F GSIPSSF NLTEL  +DF RNNFSG 
Sbjct: 317  VINLSGTMFMGNLPHSIVNLVFLQDLEISQCSFSGSIPSSFENLTELRYLDFGRNNFSGP 376

Query: 372  LPSFASSNKVISLKFAHNSFTGTIPLSYGDQLISLQVLDLRNNSLQGIIPKSLYTKQSIE 431
            +PS A S K+  L F  N F+G IPLSY + L  L+VLDLRNNSL+G+IP +L+TK  + 
Sbjct: 377  VPSLALSEKITGLIFFDNHFSGFIPLSYANGLTYLEVLDLRNNSLKGMIPPALFTKPLLW 436

Query: 432  SLLLGQNKFHGQLEKFQNASSLSLREMDFSQNKLQGLVPESIFQIKGLNVLRLSSNKFSG 491
             L L QN+ +GQL++FQNASS  LR M  S+N+LQG +P SIF+I+GLNVL LSSN+F+G
Sbjct: 437  RLDLSQNQLNGQLKEFQNASSSLLRVMHLSENELQGPIPVSIFKIRGLNVLGLSSNQFNG 496

Query: 492  FITLEMFKDLRQLGTLELSENNFSFNVSGSNSNMFPKIGTLKLSSCKITEFPNFLRNQTN 551
             I  EM KD  +L TL+LS NNFSF VSG NS +F  IG L L SC + E P FL N  N
Sbjct: 497  TINFEMIKDTNELTTLDLSGNNFSFEVSGVNSTLFSHIGKLGLGSCNLKEIPGFLTNLMN 556

Query: 552  LFHLDLSNNRIKGEIPNWTWNVGDGKLVHLNLSHNMLEAFEKPGPNLTSTVLAVLDLHSN 611
            LF+LDLSNN+IKGEIP W W +G+  LV+LNLS+NML  F+KP PNL+   L VLDLHSN
Sbjct: 557  LFYLDLSNNKIKGEIPKWIWKLGNENLVYLNLSNNMLSGFDKPIPNLSPGNLVVLDLHSN 616

Query: 612  MLQGSFPIPPASIIFLDYSENKFTTNIPYNIGNYINYAVFFSLASNNLSGGIPLSLCNAF 671
            +LQG F +P  SII LDYS N+F++++P  I   + YA F SL+SN+ +G IP S+C ++
Sbjct: 617  LLQGPFLMPSPSIIHLDYSHNQFSSSLPSRIFENLTYASFVSLSSNHFNGEIPFSMCESW 676

Query: 672  DLQVLDLSDNHLTGSIPSCLVSSN-ILKVLKLRNNEFLGTVPQVIGNECSLRTLDLSQNH 730
            +L VLDLS NH  GSIP CL +SN  LKVL LRNNE  G +P+     C+LRTLD++QNH
Sbjct: 677  NLFVLDLSKNHFNGSIPECLGNSNSFLKVLNLRNNELHGILPKRFAENCTLRTLDVNQNH 736

Query: 731  LAGSLPKSLSKCTSLEVLDVGKNQLNGSFPFWLETLPQLRVLVLQSNNYDGSIKDTQTAN 790
            L G LP+SL+ C  LEVLDVG N LNGSFPFWLETLP LRVL+L+SN + GSI  + +  
Sbjct: 737  LEGPLPRSLANCGDLEVLDVGNNFLNGSFPFWLETLPLLRVLILRSNFFGGSIIYSPSKT 796

Query: 791  AFALLQIIDISSNNFSGNLPARWFQSWRGMKKRTKESQESQILKFVYLELSNLYYQDSVT 850
            +F LLQIID++SN F GNL + WF+SW+GM K+ K+SQ SQ+L++ YL L+  YY+DSVT
Sbjct: 797  SFPLLQIIDLASNKFRGNLSSEWFKSWKGMMKQEKKSQSSQVLRYSYLVLTPFYYKDSVT 856

Query: 851  LMNKGLSMELAKILTIFTSIDVSNNQFEGEIPEMLGDFDALLVLNMSNNNFKGQIPATLG 910
            L+NKG +MEL KILTIFTSID+SNN FEGEIPE +GD D L VLN+SNN+  GQIP++ G
Sbjct: 857  LVNKGFNMELEKILTIFTSIDLSNNLFEGEIPEKIGDLDLLYVLNLSNNHLTGQIPSSFG 916

Query: 911  NLKELGSLDLSHNQLSGKIPEKLATLNFLSVLKLSQNLLVGEIPRGPQFATFTAASFEGN 970
             LKELGSLDLS N+LSG IP++L TL FLSVLKLSQNLLVGEIP+G QF TFT+A+FEGN
Sbjct: 917  KLKELGSLDLSENRLSGTIPQQLTTLTFLSVLKLSQNLLVGEIPQGNQFGTFTSAAFEGN 976

Query: 971  AGLCGFPLPKACQNALPPVEQTTKDEEGSGSIFDWEFFWIGFGFGDGTGMVIGITLGVVV 1030
             GLCG PL K C +ALPP+E       G+  I DW ++WIGFG G G G+ IG   G V 
Sbjct: 977  IGLCGPPLTKTCSHALPPMEPNADRGNGTWGI-DWNYYWIGFGCGGGMGLNIGFVAGTVA 1035

Query: 1031 SNEII 1035
             N  +
Sbjct: 1036 INIFV 1040




Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|359481298|ref|XP_003632604.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase GSO2-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|359481304|ref|XP_002270356.2| PREDICTED: LRR receptor-like serine/threonine-protein kinase FLS2-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|359481300|ref|XP_002269481.2| PREDICTED: leucine-rich repeat receptor protein kinase EXS-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|359481293|ref|XP_003632602.1| PREDICTED: leucine-rich repeat receptor protein kinase EXS-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|359481296|ref|XP_003632603.1| PREDICTED: receptor-like protein 12-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|147806063|emb|CAN76702.1| hypothetical protein VITISV_032508 [Vitis vinifera] Back     alignment and taxonomy information
>gi|214011438|gb|ACJ61469.1| GbVe [Gossypium barbadense] Back     alignment and taxonomy information
>gi|224139184|ref|XP_002323001.1| predicted protein [Populus trichocarpa] gi|222867631|gb|EEF04762.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|356506579|ref|XP_003522057.1| PREDICTED: probable LRR receptor-like serine/threonine-protein kinase At4g36180-like [Glycine max] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query1055
TAIR|locus:2074633943 RLP35 "AT3G11080" [Arabidopsis 0.741 0.829 0.363 4.6e-112
TAIR|locus:2144392957 RLP53 "receptor like protein 5 0.744 0.820 0.354 3.4e-109
TAIR|locus:2078102875 RLP33 "receptor like protein 3 0.681 0.821 0.369 8.3e-106
TAIR|locus:2085537894 RLP34 "AT3G11010" [Arabidopsis 0.737 0.870 0.354 5.8e-105
TAIR|locus:2087253884 RLP39 "AT3G24900" [Arabidopsis 0.356 0.425 0.416 7.5e-101
TAIR|locus:2055772983 RLP19 "receptor like protein 1 0.801 0.860 0.335 1e-100
TAIR|locus:22050051019 RLP7 "AT1G47890" [Arabidopsis 0.848 0.878 0.320 3.4e-100
TAIR|locus:2086974881 RLP41 "AT3G25010" [Arabidopsis 0.354 0.424 0.424 9.7e-99
TAIR|locus:2825762994 RLP6 "AT1G45616" [Arabidopsis 0.741 0.786 0.340 1e-98
TAIR|locus:2078112868 RLP32 "receptor like protein 3 0.666 0.809 0.352 1.5e-97
TAIR|locus:2074633 RLP35 "AT3G11080" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1106 (394.4 bits), Expect = 4.6e-112, P = 4.6e-112
 Identities = 301/829 (36%), Positives = 432/829 (52%)

Query:   226 GPIHS--SLSKLQLLTHLNLDGNDLSSEVPDFLTNFSSLQYLHLSLCGLYGRVPEKIFLM 283
             G  HS  SL +LQ L  L+L  NDL  E+P  + N S L  LHLS     G +P  I  +
Sbjct:   113 GSFHSNSSLFRLQNLRVLDLTQNDLDGEIPSSIGNLSHLTSLHLSYNQFLGLIPSSIENL 172

Query:   284 PSLCFLDVSSNSNLTGSLPEFPPS-SQLKVIELSETRFSGKLPDSINNLALLEDLELSDC 342
               L  L +SSN   +G +P    + S L  +ELS  +FSG++P SI NL+ L  L L   
Sbjct:   173 SRLTSLHLSSNQ-FSGQIPSSIGNLSHLTSLELSSNQFSGQIPSSIGNLSNLTFLSLPSN 231

Query:   343 NFFGSIPSSFGNLTELINIDFSRNNFSGSLPS-FASSNKVISLKFAHNSFTGTIPLSYGD 401
             +FFG IPSS GNL  L  +  S NNF G +PS F + N++I L+   N  +G +P+S  +
Sbjct:   232 DFFGQIPSSIGNLARLTYLYLSYNNFVGEIPSSFGNLNQLIVLQVDSNKLSGNVPISLLN 291

Query:   402 QLISLQVLDLRNNSLQGIIPKSLYTKQSIESLLLGQNKFHGQL-EKFQNASSLSLREMDF 460
              L  L  L L +N   G IP ++    ++       N F G L     N   L +R +D 
Sbjct:   292 -LTRLSALLLSHNQFTGTIPNNISLLSNLMDFEASNNAFTGTLPSSLFNIPPL-IR-LDL 348

Query:   461 SQNKLQGLVP-ESIFQIKGLNVLRLSSNKFSGFITLEMFKDLRQLGTLELXXXXXXXXXX 519
             S N+L G +   +I     L  L + SN F G I   + + +  L   +L          
Sbjct:   349 SDNQLNGTLHFGNISSPSNLQYLIIGSNNFIGTIPRSLSRFVN-LTLFDLSHLNTQCRPV 407

Query:   520 XXXXXXXPK-IGTLKLSSCKIT--EFPNFLRNQTNLFHLDLSNNRIKGEIPNWTWNVGDG 576
                     K +  L+LS    T  +  + L     L  LD+S N +     +   +    
Sbjct:   408 DFSIFSHLKSLDDLRLSYLTTTTIDLNDILPYFKTLRSLDISGNLVSATNKSSVSSDPPS 467

Query:   577 KLVH-LNLSHNMLEAFEKPGPNLTSTVLAVLDLHSNMLQGSFP-----IPPASIIFLDYS 630
             + +  L LS   +  F  P    T   L  LD+ +N ++G  P     +P  ++ +L+ S
Sbjct:   468 QSIQSLYLSGCGITDF--PEILRTQHELGFLDVSNNKIKGQVPGWLWTLP--NLFYLNLS 523

Query:   631 ENKFTTXXXXXXXXXXXXA-----VFFSLASNNLSGGIPLSLCNAFDLQVLDLSDNHLTG 685
              N F +                  +    ++NN +G IP  +C    L  LDLS+N+  G
Sbjct:   524 NNTFISFESSSKKHGLSSVRKPSMIHLFASNNNFTGKIPSFICGLRSLNTLDLSENNYNG 583

Query:   686 SIPSCLVS-SNILKVLKLRNNEFLGTVPQVIGNECSLRTLDLSQNHLAGSLPKSLSKCTS 744
             SIP C+    + L VL LR N   G +P+ I    SLR+LD+  N L G LP+SL + ++
Sbjct:   584 SIPRCMEKLKSTLFVLNLRQNNLSGGLPKHIFE--SLRSLDVGHNLLVGKLPRSLIRFSN 641

Query:   745 LEVLDVGKNQLNGSFPFWLETLPQLRVLVLQSNNYDGSIKDTQTANAFALLQIIDISSNN 804
             LEVL+V  N++N +FPFWL +L +L+VLVL+SN + G I +      F  L+IIDIS N+
Sbjct:   642 LEVLNVESNRINDTFPFWLSSLSKLQVLVLRSNAFHGPIHEA----TFPELRIIDISHNH 697

Query:   805 FSGNLPARWFQSWRGMKKRTKESQESQILKFVYLELSNLYYQDSVTLMNKGLSMELAKIL 864
             F+G LP  +F  W  M    K   +S   K++    S LYYQDS+ LMNKGL+MEL +IL
Sbjct:   698 FNGTLPTEYFVKWSAMSSLGKNEDQSNE-KYMG---SGLYYQDSMVLMNKGLAMELVRIL 753

Query:   865 TIFTSIDVSNNQFEGEIPEMLGDFDALLVLNMSNNNFKGQIPATLGNLKELGSLDLSHNQ 924
             TI+T++D S N+FEGEIP+ +G    LLVLN+SNN F G IP+++GNL  L SLD+S N+
Sbjct:   754 TIYTALDFSGNKFEGEIPKSIGLLKELLVLNLSNNAFGGHIPSSMGNLTALESLDVSQNK 813

Query:   925 LSGKIPEKLATLNFLSVLKLSQNLLVGEIPRGPQFATFTAASFEGNAGLCGFPLPKACQN 984
             L+G+IP++L  L+FL+ +  S N L G +P G QF     ++FE N GL G  L + C++
Sbjct:   814 LTGEIPQELGDLSFLAYMNFSHNQLAGLVPGGTQFRRQNCSAFENNLGLFGPSLDEVCRD 873

Query:   985 ALPPVEQ---TTKDEEGSGSIFDWEFFWIGFGFGDGTGMVIGITLGVVV 1030
                P  Q   TT+ EE      + E  WI    G   G+V G+T+G ++
Sbjct:   874 KHTPASQQNETTETEEED----EEEISWIAAAIGFIPGIVFGLTIGYIL 918


GO:0006952 "defense response" evidence=ISS
GO:0016301 "kinase activity" evidence=ISS
GO:0007165 "signal transduction" evidence=IC
TAIR|locus:2144392 RLP53 "receptor like protein 53" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2078102 RLP33 "receptor like protein 33" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2085537 RLP34 "AT3G11010" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2087253 RLP39 "AT3G24900" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2055772 RLP19 "receptor like protein 19" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2205005 RLP7 "AT1G47890" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2086974 RLP41 "AT3G25010" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2825762 RLP6 "AT1G45616" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2078112 RLP32 "receptor like protein 32" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Fail to connect to STRING server


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query1055
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 1e-65
PLN00113968 PLN00113, PLN00113, leucine-rich repeat receptor-l 2e-59
PLN00113968 PLN00113, PLN00113, leucine-rich repeat receptor-l 7e-50
PLN00113968 PLN00113, PLN00113, leucine-rich repeat receptor-l 8e-40
PLN00113968 PLN00113, PLN00113, leucine-rich repeat receptor-l 2e-20
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 4e-18
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 8e-10
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 3e-09
pfam0826342 pfam08263, LRRNT_2, Leucine rich repeat N-terminal 3e-09
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 5e-09
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 5e-08
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 6e-08
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 3e-07
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 2e-06
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 4e-06
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 1e-05
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 2e-05
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 2e-05
PLN032101153 PLN03210, PLN03210, Resistant to P 9e-05
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 0.001
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 0.002
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 0.002
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 0.002
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 0.002
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 0.004
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
 Score =  239 bits (612), Expect = 1e-65
 Identities = 192/654 (29%), Positives = 282/654 (43%), Gaps = 117/654 (17%)

Query: 329 NNLALLEDLELSDCNFFGSIPSSFGNLTELINIDFSRNNFSGSLPS--FASSNKVISLKF 386
           NN + +  ++LS  N  G I S+   L  +  I+ S N  SG +P   F +S+ +  L  
Sbjct: 66  NNSSRVVSIDLSGKNISGKISSAIFRLPYIQTINLSNNQLSGPIPDDIFTTSSSLRYLNL 125

Query: 387 AHNSFTGTIPLSYGDQLISLQVLDLRNNSLQGIIPKSLYTKQSIESLLLGQNKFHGQLEK 446
           ++N+FTG+IP      + +L+ LDL NN L G IP  +                      
Sbjct: 126 SNNNFTGSIP---RGSIPNLETLDLSNNMLSGEIPNDI---------------------- 160

Query: 447 FQNASSLSLREMDFSQNKLQGLVPESIFQIKGLNVLRLSSNKFSGFITLEMFKDLRQLGT 506
               S  SL+ +D   N L G +P S+  +  L  L L+SN+  G I  E+ + ++ L  
Sbjct: 161 ---GSFSSLKVLDLGGNVLVGKIPNSLTNLTSLEFLTLASNQLVGQIPRELGQ-MKSLKW 216

Query: 507 LELSENNFSFNVSGSNSNMFPKIGTLKLSSCKITEFPNFLRNQTNLFHLDLSNNRIKGEI 566
           + L  NN S                         E P  +   T+L HLDL  N + G I
Sbjct: 217 IYLGYNNLS------------------------GEIPYEIGGLTSLNHLDLVYNNLTGPI 252

Query: 567 PNWTWNVGDGKLVHLNLSHNMLEAFEKPGPNLTSTVLAVLDLHSNMLQGSFPIPPA---- 622
           P+   N+ +                           L  L L+ N L G  PIPP+    
Sbjct: 253 PSSLGNLKN---------------------------LQYLFLYQNKLSG--PIPPSIFSL 283

Query: 623 -SIIFLDYSENKFTTNIPYNIGNYINYAVFFSLASNNLSGGIPLSLCNAFDLQVLDLSDN 681
             +I LD S+N  +  IP  +    N  +   L SNN +G IP++L +   LQVL L  N
Sbjct: 284 QKLISLDLSDNSLSGEIPELVIQLQNLEIL-HLFSNNFTGKIPVALTSLPRLQVLQLWSN 342

Query: 682 HLTGSIPSCLVSSNILKVLKLRNNEFLGTVPQVIGNECSLRTLDLSQNHLAGSLPKSLSK 741
             +G IP  L   N L VL L  N   G +P+ + +  +L  L L  N L G +PKSL  
Sbjct: 343 KFSGEIPKNLGKHNNLTVLDLSTNNLTGEIPEGLCSSGNLFKLILFSNSLEGEIPKSLGA 402

Query: 742 CTSLEVLDVGKNQLNGSFPFWLETLPQLRVLVLQSNNYDGSIKDTQTANAFALLQIIDIS 801
           C SL  + +  N  +G  P     LP +  L + +NN  G I   +       LQ++ ++
Sbjct: 403 CRSLRRVRLQDNSFSGELPSEFTKLPLVYFLDISNNNLQGRINSRKWD--MPSLQMLSLA 460

Query: 802 SNNFSGNLPARWFQSWRGMKKRTKESQESQILKFVYLELSNLYYQDSVTLMNKGLSMELA 861
            N F G LP     S+   +    +   +Q    V  +L +L       LM         
Sbjct: 461 RNKFFGGLP----DSFGSKRLENLDLSRNQFSGAVPRKLGSL-----SELMQ-------- 503

Query: 862 KILTIFTSIDVSNNQFEGEIPEMLGDFDALLVLNMSNNNFKGQIPATLGNLKELGSLDLS 921
                   + +S N+  GEIP+ L     L+ L++S+N   GQIPA+   +  L  LDLS
Sbjct: 504 --------LKLSENKLSGEIPDELSSCKKLVSLDLSHNQLSGQIPASFSEMPVLSQLDLS 555

Query: 922 HNQLSGKIPEKLATLNFLSVLKLSQNLLVGEIPRGPQFATFTAASFEGNAGLCG 975
            NQLSG+IP+ L  +  L  + +S N L G +P    F    A++  GN  LCG
Sbjct: 556 QNQLSGEIPKNLGNVESLVQVNISHNHLHGSLPSTGAFLAINASAVAGNIDLCG 609


Length = 968

>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|219766 pfam08263, LRRNT_2, Leucine rich repeat N-terminal domain Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|215633 PLN03210, PLN03210, Resistant to P Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 1055
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 100.0
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 100.0
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 100.0
KOG0472565 consensus Leucine-rich repeat protein [Function un 100.0
KOG4194873 consensus Membrane glycoprotein LIG-1 [Signal tran 100.0
KOG0472565 consensus Leucine-rich repeat protein [Function un 100.0
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.97
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.97
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.96
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.96
KOG4237498 consensus Extracellular matrix protein slit, conta 99.88
KOG4237498 consensus Extracellular matrix protein slit, conta 99.88
PLN032101153 Resistant to P. syringae 6; Provisional 99.87
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 99.86
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 99.86
PLN032101153 Resistant to P. syringae 6; Provisional 99.86
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 99.79
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 99.77
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.7
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.69
PLN03150623 hypothetical protein; Provisional 99.66
KOG0617264 consensus Ras suppressor protein (contains leucine 99.6
KOG0617264 consensus Ras suppressor protein (contains leucine 99.55
PLN03150623 hypothetical protein; Provisional 99.51
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 99.19
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 99.14
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 99.1
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 99.08
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 99.07
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 99.01
KOG3207505 consensus Beta-tubulin folding cofactor E [Posttra 99.0
KOG3207505 consensus Beta-tubulin folding cofactor E [Posttra 98.98
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 98.93
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 98.91
KOG1259490 consensus Nischarin, modulator of integrin alpha5 98.88
PF0826343 LRRNT_2: Leucine rich repeat N-terminal domain; In 98.88
KOG1259490 consensus Nischarin, modulator of integrin alpha5 98.81
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 98.71
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 98.68
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.68
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.67
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 98.64
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 98.63
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 98.62
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 98.5
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 98.27
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 98.23
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 98.1
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 98.0
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 97.97
KOG2982418 consensus Uncharacterized conserved protein [Funct 97.94
KOG2982418 consensus Uncharacterized conserved protein [Funct 97.88
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 97.85
KOG4341483 consensus F-box protein containing LRR [General fu 97.78
KOG4341483 consensus F-box protein containing LRR [General fu 97.77
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 97.76
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 97.75
KOG3665699 consensus ZYG-1-like serine/threonine protein kina 97.62
PRK15386426 type III secretion protein GogB; Provisional 97.54
KOG3665699 consensus ZYG-1-like serine/threonine protein kina 97.53
PRK15386426 type III secretion protein GogB; Provisional 97.46
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 97.37
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 97.1
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 96.7
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 96.53
KOG2123388 consensus Uncharacterized conserved protein [Funct 96.43
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 96.16
KOG1947482 consensus Leucine rich repeat proteins, some prote 96.14
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 96.08
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 96.03
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 95.96
KOG1947482 consensus Leucine rich repeat proteins, some prote 95.83
KOG2123388 consensus Uncharacterized conserved protein [Funct 95.8
KOG4308478 consensus LRR-containing protein [Function unknown 91.55
KOG4308478 consensus LRR-containing protein [Function unknown 90.97
PF1350417 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO 90.07
PF1350417 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO 88.9
KOG0473326 consensus Leucine-rich repeat protein [Function un 88.51
KOG0473326 consensus Leucine-rich repeat protein [Function un 87.97
PF1351624 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RI 86.77
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 84.71
smart0037026 LRR Leucine-rich repeats, outliers. 84.71
PF1351624 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RI 80.55
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
Probab=100.00  E-value=3.6e-72  Score=719.59  Aligned_cols=584  Identities=35%  Similarity=0.571  Sum_probs=372.2

Q ss_pred             CHHHHHHHHHHHhcCCCCCCCCCccccCCCCCCCCCcccceeEecCCCCcEEEEEcCCCccccccCCCCCccCCCCCCee
Q 001554           33 LEDQKLLLLEFKRGLSFDPQTDSTNKLLSWSSTTDCCSWDGVTCDPRTGHVIGLDISSSFITGGINGSSSLFDLQRLQHL  112 (1055)
Q Consensus        33 ~~~~~~aLl~~k~~~~~~~~~~~~~~l~~W~~~~~~c~w~gv~C~~~~~~v~~L~L~~~~l~g~~~~~~~l~~l~~L~~L  112 (1055)
                      .++|++||++||+++.++.     +.+.+|..+.+||.|+||+|+. .++|+.|||+++.++|.+++  .+..+++|++|
T Consensus        27 ~~~~~~~l~~~~~~~~~~~-----~~~~~w~~~~~~c~w~gv~c~~-~~~v~~L~L~~~~i~~~~~~--~~~~l~~L~~L   98 (968)
T PLN00113         27 HAEELELLLSFKSSINDPL-----KYLSNWNSSADVCLWQGITCNN-SSRVVSIDLSGKNISGKISS--AIFRLPYIQTI   98 (968)
T ss_pred             CHHHHHHHHHHHHhCCCCc-----ccCCCCCCCCCCCcCcceecCC-CCcEEEEEecCCCccccCCh--HHhCCCCCCEE
Confidence            5689999999999996433     3678998888999999999986 57999999999999988766  77788888888


Q ss_pred             eCCCCCCCCCCCCccCC-CCCCCCEEeCCCCCCCCCCChhcccCCCCcEEEecCCCCCCchhhccccHHHHhcCCCCCce
Q 001554          113 NLADNSLYSSPFPSGFD-RLFSLTHLNLSYSGFSGHIPLEISSLKMLVSLDLSASGLVAPIQLRRANLEKLVKNLTNLEE  191 (1055)
Q Consensus       113 ~Ls~n~~~~~~lp~~l~-~l~~L~~L~Ls~n~~~~~~p~~l~~L~~L~~L~Ls~n~~~~~~~~~~~~~~~~l~~l~~L~~  191 (1055)
                      +|++|.+.+. +|..+. .+++|++|+|++|.+++.+|.  +.+++|++|++++                          
T Consensus        99 ~Ls~n~~~~~-ip~~~~~~l~~L~~L~Ls~n~l~~~~p~--~~l~~L~~L~Ls~--------------------------  149 (968)
T PLN00113         99 NLSNNQLSGP-IPDDIFTTSSSLRYLNLSNNNFTGSIPR--GSIPNLETLDLSN--------------------------  149 (968)
T ss_pred             ECCCCccCCc-CChHHhccCCCCCEEECcCCccccccCc--cccCCCCEEECcC--------------------------
Confidence            8888887765 665544 777777777777777766663  3344444444444                          


Q ss_pred             eeCCCcccCCCCCchhhcCCCCCcEEeCCCCcCCCCCcccccCCCCCCEEECCCCCCCCCcchhccCCCCCcEEEccCCc
Q 001554          192 LYLGGIDISGADWGPILSILSNLRILSLPDCHVAGPIHSSLSKLQLLTHLNLDGNDLSSEVPDFLTNFSSLQYLHLSLCG  271 (1055)
Q Consensus       192 L~L~~n~l~~~~~~~~l~~l~~L~~L~L~~~~l~~~~~~~l~~l~~L~~L~Ls~n~~~~~~p~~l~~l~~L~~L~L~~n~  271 (1055)
                                                    |.+.+.+|..++++++|++|++++|.+.+.+|..++++++|++|++++|.
T Consensus       150 ------------------------------n~~~~~~p~~~~~l~~L~~L~L~~n~l~~~~p~~~~~l~~L~~L~L~~n~  199 (968)
T PLN00113        150 ------------------------------NMLSGEIPNDIGSFSSLKVLDLGGNVLVGKIPNSLTNLTSLEFLTLASNQ  199 (968)
T ss_pred             ------------------------------CcccccCChHHhcCCCCCEEECccCcccccCChhhhhCcCCCeeeccCCC
Confidence                                          34444455555555666666666665555555555556666666666655


Q ss_pred             CCCccCcccCCCCCCcEEEccCCCCCCCCCCCCCCCCCCcEEEccCCcCCCCCcccccCCCCCCEEEccCCcCCCCCccc
Q 001554          272 LYGRVPEKIFLMPSLCFLDVSSNSNLTGSLPEFPPSSQLKVIELSETRFSGKLPDSINNLALLEDLELSDCNFFGSIPSS  351 (1055)
Q Consensus       272 l~~~~p~~l~~l~~L~~L~Ls~n~~~~~~~~~~~~l~~L~~L~L~~n~l~~~~~~~l~~l~~L~~L~Ls~n~l~~~~p~~  351 (1055)
                      +.+.+|..++++++|++|+++                        +|.+.+.+|..++++++|++|++++|.+.+.+|..
T Consensus       200 l~~~~p~~l~~l~~L~~L~L~------------------------~n~l~~~~p~~l~~l~~L~~L~L~~n~l~~~~p~~  255 (968)
T PLN00113        200 LVGQIPRELGQMKSLKWIYLG------------------------YNNLSGEIPYEIGGLTSLNHLDLVYNNLTGPIPSS  255 (968)
T ss_pred             CcCcCChHHcCcCCccEEECc------------------------CCccCCcCChhHhcCCCCCEEECcCceeccccChh
Confidence            555555555555555555554                        33444455555555555555555555555555555


Q ss_pred             ccCCCCCCEEEeecCCCCCCCCcccccCcccEEEcccccCccccCcccccCCCCccEEEccCcccccccccccccCCCcc
Q 001554          352 FGNLTELINIDFSRNNFSGSLPSFASSNKVISLKFAHNSFTGTIPLSYGDQLISLQVLDLRNNSLQGIIPKSLYTKQSIE  431 (1055)
Q Consensus       352 l~~l~~L~~L~Ls~n~l~~~~~~~~~~~~L~~L~l~~n~l~~~~p~~~~~~l~~L~~L~L~~n~l~~~~~~~l~~l~~L~  431 (1055)
                      ++++++|++|++++|.+.+.+|..+                        ..+++|++|++++|.+.+.+|..+..+++  
T Consensus       256 l~~l~~L~~L~L~~n~l~~~~p~~l------------------------~~l~~L~~L~Ls~n~l~~~~p~~~~~l~~--  309 (968)
T PLN00113        256 LGNLKNLQYLFLYQNKLSGPIPPSI------------------------FSLQKLISLDLSDNSLSGEIPELVIQLQN--  309 (968)
T ss_pred             HhCCCCCCEEECcCCeeeccCchhH------------------------hhccCcCEEECcCCeeccCCChhHcCCCC--
Confidence            5555555555555554443332221                        23334444444444433333333222222  


Q ss_pred             EEEccCccccCCcchhhcccccCcCeeeccCccccCCCCccccCCCCCCEEEccCCCCCCccchhhhhcCCCCCeEECCC
Q 001554          432 SLLLGQNKFHGQLEKFQNASSLSLREMDFSQNKLQGLVPESIFQIKGLNVLRLSSNKFSGFITLEMFKDLRQLGTLELSE  511 (1055)
Q Consensus       432 ~L~L~~n~l~~~~~~~~~~~~~~L~~L~Ls~n~l~~~~p~~l~~l~~L~~L~L~~n~l~~~i~~~~~~~l~~L~~L~Ls~  511 (1055)
                                             |+.|++++|.+.+.+|..+..+++|+.|++++|.+.+.                   
T Consensus       310 -----------------------L~~L~l~~n~~~~~~~~~~~~l~~L~~L~L~~n~l~~~-------------------  347 (968)
T PLN00113        310 -----------------------LEILHLFSNNFTGKIPVALTSLPRLQVLQLWSNKFSGE-------------------  347 (968)
T ss_pred             -----------------------CcEEECCCCccCCcCChhHhcCCCCCEEECcCCCCcCc-------------------
Confidence                                   22222222222222222233333333333333322211                   


Q ss_pred             CcceeecCCCCCCcCCccceeecccCcCcccchhhhCCCCCCEEECcCCCCCCcccccccccCCCCceEEeccCcccccc
Q 001554          512 NNFSFNVSGSNSNMFPKIGTLKLSSCKITEFPNFLRNQTNLFHLDLSNNRIKGEIPNWTWNVGDGKLVHLNLSHNMLEAF  591 (1055)
Q Consensus       512 n~l~~~~~~~~~~~~~~L~~L~L~~n~l~~ip~~l~~l~~L~~L~Ls~N~l~~~~p~~~~~~~~~~L~~L~Ls~N~l~~~  591 (1055)
                                                    +|..+..+++|+.|++++|+++                            
T Consensus       348 ------------------------------~p~~l~~~~~L~~L~Ls~n~l~----------------------------  369 (968)
T PLN00113        348 ------------------------------IPKNLGKHNNLTVLDLSTNNLT----------------------------  369 (968)
T ss_pred             ------------------------------CChHHhCCCCCcEEECCCCeeE----------------------------
Confidence                                          1122223333333333333322                            


Q ss_pred             CCCCCcccccceeEEEccCCCCCCCCCCCCCccceeecCCCccccCCCcchhccccceeEEEccCCcCcCCccccccCCC
Q 001554          592 EKPGPNLTSTVLAVLDLHSNMLQGSFPIPPASIIFLDYSENKFTTNIPYNIGNYINYAVFFSLASNNLSGGIPLSLCNAF  671 (1055)
Q Consensus       592 ~~~~~~~~~~~L~~L~l~~n~l~~~~p~~~~~l~~Ldls~n~l~~~~p~~~~~~~~~l~~l~L~~n~l~~~~p~~l~~l~  671 (1055)
                                                                                           +.+|..++.+.
T Consensus       370 ---------------------------------------------------------------------~~~p~~~~~~~  380 (968)
T PLN00113        370 ---------------------------------------------------------------------GEIPEGLCSSG  380 (968)
T ss_pred             ---------------------------------------------------------------------eeCChhHhCcC
Confidence                                                                                 22333344444


Q ss_pred             CCCEEeccCCCCCCCCCccccCCCcccEEeccCCcCcccCCcccCCCCCccEEeCCCCcccccCcccccCCCCCcEEECC
Q 001554          672 DLQVLDLSDNHLTGSIPSCLVSSNILKVLKLRNNEFLGTVPQVIGNECSLRTLDLSQNHLAGSLPKSLSKCTSLEVLDVG  751 (1055)
Q Consensus       672 ~L~~L~Ls~N~l~~~~p~~l~~l~~L~~L~Ls~N~l~~~~p~~~~~l~~L~~L~Ls~N~l~~~~p~~l~~l~~L~~L~Ls  751 (1055)
                      +|+.|++++|++.+.+|..+..+++|+.|++++|++++.+|..|.+++.|+.|++++|++++.+|..+..+++|+.|+++
T Consensus       381 ~L~~L~l~~n~l~~~~p~~~~~~~~L~~L~L~~n~l~~~~p~~~~~l~~L~~L~Ls~N~l~~~~~~~~~~l~~L~~L~L~  460 (968)
T PLN00113        381 NLFKLILFSNSLEGEIPKSLGACRSLRRVRLQDNSFSGELPSEFTKLPLVYFLDISNNNLQGRINSRKWDMPSLQMLSLA  460 (968)
T ss_pred             CCCEEECcCCEecccCCHHHhCCCCCCEEECcCCEeeeECChhHhcCCCCCEEECcCCcccCccChhhccCCCCcEEECc
Confidence            55666666666665555555555555555555555555555555555555555555555555555444444455555555


Q ss_pred             CCcCccccCccccCCCCCcEEEccCCcCccccCCCcccccCCCCcEEeccCCCCccCCChHHHhhhhhhccccccchhhh
Q 001554          752 KNQLNGSFPFWLETLPQLRVLVLQSNNYDGSIKDTQTANAFALLQIIDISSNNFSGNLPARWFQSWRGMKKRTKESQESQ  831 (1055)
Q Consensus       752 ~N~l~~~~p~~l~~l~~L~~L~L~~N~l~~~~~~~~~~~~l~~L~~Ldls~N~l~g~~p~~~~~~~~~~~~~~~~~~~~~  831 (1055)
                      +|+                        +.+.+|...   ..++|+.||+++|++++.+|..+                  
T Consensus       461 ~n~------------------------~~~~~p~~~---~~~~L~~L~ls~n~l~~~~~~~~------------------  495 (968)
T PLN00113        461 RNK------------------------FFGGLPDSF---GSKRLENLDLSRNQFSGAVPRKL------------------  495 (968)
T ss_pred             Cce------------------------eeeecCccc---ccccceEEECcCCccCCccChhh------------------
Confidence            554                        444444321   23567778888888877777422                  


Q ss_pred             hhhhhhhhccccccccceEEeecCchhHHHhhcccccEEEccCCcccccCcccccCCCCCCEEECCCCccccccCccccC
Q 001554          832 ILKFVYLELSNLYYQDSVTLMNKGLSMELAKILTIFTSIDVSNNQFEGEIPEMLGDFDALLVLNMSNNNFKGQIPATLGN  911 (1055)
Q Consensus       832 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~l~~LdLs~N~l~g~ip~~~~~l~~L~~L~Ls~N~l~g~iP~~~~~  911 (1055)
                                                    ..++.|+.|||++|+++|.+|+.++++++|+.|+|++|+++|.+|..|++
T Consensus       496 ------------------------------~~l~~L~~L~Ls~N~l~~~~p~~~~~l~~L~~L~Ls~N~l~~~~p~~~~~  545 (968)
T PLN00113        496 ------------------------------GSLSELMQLKLSENKLSGEIPDELSSCKKLVSLDLSHNQLSGQIPASFSE  545 (968)
T ss_pred             ------------------------------hhhhccCEEECcCCcceeeCChHHcCccCCCEEECCCCcccccCChhHhC
Confidence                                          13567889999999999999999999999999999999999999999999


Q ss_pred             cCCCCeEeCCCCcCcccCcccccCCCCCCeEecCCCcCcccCCCCCCcccccccccccCCCCCCCC
Q 001554          912 LKELGSLDLSHNQLSGKIPEKLATLNFLSVLKLSQNLLVGEIPRGPQFATFTAASFEGNAGLCGFP  977 (1055)
Q Consensus       912 L~~L~~LdLs~N~lsg~ip~~l~~l~~L~~l~ls~N~L~g~iP~~~~~~~~~~~s~~gn~~lcg~~  977 (1055)
                      +++|+.|||++|+++|.+|..++++++|+.||+++|+++|.||..++|.+|...+|.||+++||.+
T Consensus       546 l~~L~~L~Ls~N~l~~~~p~~l~~l~~L~~l~ls~N~l~~~~p~~~~~~~~~~~~~~~n~~lc~~~  611 (968)
T PLN00113        546 MPVLSQLDLSQNQLSGEIPKNLGNVESLVQVNISHNHLHGSLPSTGAFLAINASAVAGNIDLCGGD  611 (968)
T ss_pred             cccCCEEECCCCcccccCChhHhcCcccCEEeccCCcceeeCCCcchhcccChhhhcCCccccCCc
Confidence            999999999999999999999999999999999999999999999999999999999999999865



>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>PF08263 LRRNT_2: Leucine rich repeat N-terminal domain; InterPro: IPR013210 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG4308 consensus LRR-containing protein [Function unknown] Back     alignment and domain information
>KOG4308 consensus LRR-containing protein [Function unknown] Back     alignment and domain information
>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D Back     alignment and domain information
>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D Back     alignment and domain information
>KOG0473 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG0473 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>PF13516 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RIZ_A 3RGX_A 1DFJ_I 2BNH_A 3VQ1_A 3VQ2_A 2Z64_A 2OMX_A Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>PF13516 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RIZ_A 3RGX_A 1DFJ_I 2BNH_A 3VQ1_A 3VQ2_A 2Z64_A 2OMX_A Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query1055
3riz_A772 Crystal Structure Of The Plant Steroid Receptor Bri 2e-52
3rgx_A768 Structural Insight Into Brassinosteroid Perception 2e-52
1ogq_A313 The Crystal Structure Of Pgip (Polygalacturonase In 3e-18
3b2d_A603 Crystal Structure Of Human Rp105MD-1 Complex Length 6e-04
>pdb|3RIZ|A Chain A, Crystal Structure Of The Plant Steroid Receptor Bri1 Ectodomain Length = 772 Back     alignment and structure

Iteration: 1

Score = 204 bits (519), Expect = 2e-52, Method: Compositional matrix adjust. Identities = 214/705 (30%), Positives = 319/705 (45%), Gaps = 102/705 (14%) Query: 339 LSDCNFFGSIPSSFGNLTELINIDFSRNNFSGSLPSFASSNKVISLKFAHNS-----FTG 393 LS+ + GS+ S F L ++D SRN+ SG + + S LKF + S F G Sbjct: 81 LSNSHINGSV-SGFKCSASLTSLDLSRNSLSGPVTTLTSLGSCSGLKFLNVSSNTLDFPG 139 Query: 394 TIPLSYGDQLISLQVLDLRNNSLQG--IIPKSLYTK-QSIESLLLGQNKFHGQLE----- 445 + S G +L SL+VLDL NS+ G ++ L ++ L + NK G ++ Sbjct: 140 KV--SGGLKLNSLEVLDLSANSISGANVVGWVLSDGCGELKHLAISGNKISGDVDVSRCV 197 Query: 446 --KFQNASS-------------LSLREMDFSQNKLQGLVPESIFQIKGLNVLRLSSNKFS 490 +F + SS +L+ +D S NKL G +I L +L +SSN+F Sbjct: 198 NLEFLDVSSNNFSTGIPFLGDCSALQHLDISGNKLSGDFSRAISTCTELKLLNISSNQFV 257 Query: 491 GFITLEMFKDLRQLGTLELXXXXXXXXXXXXXXXXXPKIGTLKLSSCKIT-EFPNFLRNQ 549 G I K L+ L L+ K T E P+FL Sbjct: 258 GPIPPLPLKSLQYL----------------------------SLAENKFTGEIPDFLSGA 289 Query: 550 TN-LFHLDLSNNRIKGEIPNWTWNVGDGKLVHLNLSHNMLEAFEKPGPN---LTSTVLAV 605 + L LDLS N G +P + G L F P L L V Sbjct: 290 CDTLTGLDLSGNHFYGAVPPFF-----GSCSLLESLALSSNNFSGELPMDTLLKMRGLKV 344 Query: 606 LDLHSNMLQGSFPIP----PASIIFLDYSENKFTTXXXXXXXXXXXXAV-FFSLASNNLS 660 LDL N G P AS++ LD S N F+ + L +N + Sbjct: 345 LDLSFNEFSGELPESLTNLSASLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFT 404 Query: 661 GGIPLSLCNAFDLQVLDLSDNHLTGSIPSCLVSSNILKVLKLRNNEFLGTVPQVIGNECS 720 G IP +L N +L L LS N+L+G+IPS L S + L+ LKL N G +PQ + + Sbjct: 405 GKIPPTLSNCSELVSLHLSFNYLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKT 464 Query: 721 LRTLDLSQNHLAGSLPKSLSKCTSLEVLDVGKNQLNGSFPFWLETLPQLRVLVLQSNNYD 780 L TL L N L G +P LS CT+L + + N+L G P W+ L L +L L +N++ Sbjct: 465 LETLILDFNDLTGEIPSGLSNCTNLNWISLSNNRLTGEIPKWIGRLENLAILKLSNNSFS 524 Query: 781 GSIKDTQTANAFALLQIIDISSNNFSGNLPARWF-QSWR-----------------GMKK 822 G+I + + +L+ +D+++N F+G +PA F QS + GMKK Sbjct: 525 GNIP-AELGDCRSLIW-LDLNTNLFNGTIPAAMFKQSGKIAANFIAGKRYVYIKNDGMKK 582 Query: 823 RTKESQESQILKFVYL---ELSNLYYQDSVTLMNKGLSMELAKILTIFTS---IDVSNNQ 876 + +L+F + +L+ L ++ + ++ + S +D+S N Sbjct: 583 ECHGA--GNLLEFQGIRSEQLNRLSTRNPCNITSRVYGGHTSPTFDNNGSMMFLDMSYNM 640 Query: 877 FEGEIPEMLGDFDALLVLNMSNNNFKGQIPATLGNLKELGSLDLSHNQLSGKIPEKLATL 936 G IP+ +G L +LN+ +N+ G IP +G+L+ L LDLS N+L G+IP+ ++ L Sbjct: 641 LSGYIPKEIGSMPYLFILNLGHNDISGSIPDEVGDLRGLNILDLSSNKLDGRIPQAMSAL 700 Query: 937 NFLSVLKLSQNLLVGEIPRGPQFATFTAASFEGNAGLCGFPLPKA 981 L+ + LS N L G IP QF TF A F N GLCG+PLP+ Sbjct: 701 TMLTEIDLSNNNLSGPIPEMGQFETFPPAKFLNNPGLCGYPLPRC 745
>pdb|3RGX|A Chain A, Structural Insight Into Brassinosteroid Perception By Bri1 Length = 768 Back     alignment and structure
>pdb|1OGQ|A Chain A, The Crystal Structure Of Pgip (Polygalacturonase Inhibiting Protein), A Leucine Rich Repeat Protein Involved In Plant Defense Length = 313 Back     alignment and structure
>pdb|3B2D|A Chain A, Crystal Structure Of Human Rp105MD-1 Complex Length = 603 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query1055
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 1e-167
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 1e-154
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 2e-85
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 1e-78
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 4e-58
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 3e-56
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 2e-50
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 3e-36
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 3e-17
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 8e-75
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 9e-64
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 6e-60
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 5e-57
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 7e-54
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 7e-44
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 8e-33
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 7e-68
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 1e-67
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 4e-65
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 1e-58
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 5e-47
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 4e-34
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 1e-19
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 1e-63
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 2e-63
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 1e-50
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 2e-39
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 6e-37
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 4e-19
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 1e-60
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 5e-52
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 2e-50
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 5e-42
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 3e-39
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 4e-14
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 1e-60
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 1e-54
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 3e-52
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 8e-51
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 9e-42
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 2e-36
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 1e-20
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 2e-59
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 2e-58
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 7e-57
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 4e-56
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 2e-53
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 5e-52
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 3e-43
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 8e-32
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 3e-31
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 8e-30
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 2e-12
3j0a_A844 TOLL-like receptor 5; membrane protein, leucine-ri 1e-48
3j0a_A844 TOLL-like receptor 5; membrane protein, leucine-ri 1e-47
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 7e-39
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 1e-36
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 1e-35
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 4e-45
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 7e-42
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 7e-42
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 1e-37
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 1e-35
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 3e-28
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 1e-40
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 8e-38
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 9e-37
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 6e-32
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 5e-22
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 6e-21
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 9e-06
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 4e-39
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 2e-32
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 2e-28
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 5e-27
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 4e-22
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 1e-19
1o6v_A466 Internalin A; bacterial infection, extracellular r 9e-36
1o6v_A466 Internalin A; bacterial infection, extracellular r 9e-36
1o6v_A466 Internalin A; bacterial infection, extracellular r 3e-35
1o6v_A466 Internalin A; bacterial infection, extracellular r 3e-30
1o6v_A466 Internalin A; bacterial infection, extracellular r 4e-29
1o6v_A466 Internalin A; bacterial infection, extracellular r 2e-28
1o6v_A466 Internalin A; bacterial infection, extracellular r 2e-27
1o6v_A466 Internalin A; bacterial infection, extracellular r 1e-23
4fmz_A347 Internalin; leucine rich repeat, structural genomi 3e-34
4fmz_A347 Internalin; leucine rich repeat, structural genomi 1e-30
4fmz_A347 Internalin; leucine rich repeat, structural genomi 4e-30
4fmz_A347 Internalin; leucine rich repeat, structural genomi 8e-29
4fmz_A347 Internalin; leucine rich repeat, structural genomi 1e-25
4fmz_A347 Internalin; leucine rich repeat, structural genomi 2e-25
4fmz_A347 Internalin; leucine rich repeat, structural genomi 3e-24
4fmz_A347 Internalin; leucine rich repeat, structural genomi 5e-16
4fmz_A347 Internalin; leucine rich repeat, structural genomi 2e-08
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 2e-31
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 3e-29
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 8e-29
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 8e-28
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 7e-26
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 4e-23
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 5e-21
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 2e-19
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 1e-18
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 6e-12
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 1e-07
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 2e-28
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 2e-27
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 1e-25
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 2e-23
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 7e-20
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 5e-19
3o6n_A 390 APL1; leucine-rich repeat, protein binding; HET: N 4e-05
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 3e-04
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 6e-28
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 5e-20
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 7e-18
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 2e-13
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 8e-28
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 1e-27
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 2e-26
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 4e-25
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 2e-24
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 4e-24
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 6e-24
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 2e-20
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 2e-18
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 5e-17
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 8e-13
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 1e-07
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 1e-05
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 2e-27
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 7e-24
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 5e-23
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 3e-21
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 8e-21
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 4e-16
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 9e-16
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 2e-09
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 2e-27
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 1e-23
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 2e-23
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 3e-22
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 7e-20
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 5e-12
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 5e-05
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 3e-27
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 5e-22
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 2e-20
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 9e-18
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 2e-08
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 5e-05
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 1e-25
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 2e-24
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 2e-24
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 3e-22
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 3e-21
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 4e-20
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 5e-20
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 6e-19
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 3e-15
3o53_A 317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 8e-08
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 2e-06
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 5e-25
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 1e-24
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 1e-24
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 2e-21
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 5e-21
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 8e-12
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 3e-11
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 1e-04
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 1e-24
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 1e-19
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 9e-19
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 1e-17
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 6e-16
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 4e-15
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 3e-11
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 4e-10
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 2e-08
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 1e-24
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 7e-22
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 1e-21
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 7e-21
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 2e-18
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 4e-15
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 3e-14
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 3e-23
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 3e-18
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 1e-17
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 3e-14
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 6e-12
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 7e-10
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 4e-08
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 5e-08
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 1e-21
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 1e-20
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 4e-19
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 1e-17
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 4e-17
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 2e-16
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 1e-09
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 4e-20
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 3e-19
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 4e-18
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 7e-17
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 3e-16
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 4e-16
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 6e-16
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 2e-14
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 2e-13
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 7e-11
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 2e-04
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 7e-20
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 6e-19
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 2e-18
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 8e-17
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 3e-13
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 1e-19
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 4e-16
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 6e-14
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 2e-13
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 6e-13
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 5e-07
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 2e-18
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 3e-17
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 6e-17
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 3e-15
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 6e-15
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 1e-14
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 1e-12
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 4e-12
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 7e-12
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 6e-11
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 3e-10
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 4e-10
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 2e-09
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 1e-17
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 7e-15
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 2e-13
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 2e-11
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 4e-11
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 4e-08
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 1e-16
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 1e-15
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 1e-15
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 6e-14
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 2e-13
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 5e-13
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 3e-10
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 1e-16
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 8e-16
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 3e-15
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 6e-15
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 1e-13
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 4e-13
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 8e-13
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 6e-10
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 6e-16
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 1e-14
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 2e-14
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 4e-13
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 4e-09
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 5e-07
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 1e-15
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 1e-13
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 3e-12
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 2e-11
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 2e-11
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 6e-11
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 9e-10
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 1e-09
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 2e-15
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 8e-15
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 6e-13
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 1e-12
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 2e-12
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 1e-11
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 7e-11
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 8e-11
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 4e-10
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 7e-10
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 4e-07
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 2e-14
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 1e-05
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 1e-13
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 1e-12
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 5e-11
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 3e-09
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 5e-06
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 2e-05
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 2e-13
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 1e-12
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 2e-08
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 2e-08
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 7e-08
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 1e-12
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 2e-09
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 2e-09
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 3e-07
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 1e-06
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 2e-06
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 2e-04
4ezg_A197 Putative uncharacterized protein; internalin-A, le 3e-12
4ezg_A197 Putative uncharacterized protein; internalin-A, le 1e-11
4ezg_A197 Putative uncharacterized protein; internalin-A, le 2e-11
4ezg_A197 Putative uncharacterized protein; internalin-A, le 7e-11
4ezg_A197 Putative uncharacterized protein; internalin-A, le 2e-09
4ezg_A197 Putative uncharacterized protein; internalin-A, le 1e-08
4ezg_A197 Putative uncharacterized protein; internalin-A, le 6e-08
4ezg_A197 Putative uncharacterized protein; internalin-A, le 5e-07
4ezg_A197 Putative uncharacterized protein; internalin-A, le 1e-06
4ezg_A197 Putative uncharacterized protein; internalin-A, le 8e-05
4ezg_A197 Putative uncharacterized protein; internalin-A, le 1e-04
4ezg_A197 Putative uncharacterized protein; internalin-A, le 6e-04
4ezg_A197 Putative uncharacterized protein; internalin-A, le 9e-04
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 4e-12
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 9e-12
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 3e-10
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 5e-10
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 2e-09
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 1e-08
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 5e-12
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 1e-09
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 6e-09
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 7e-09
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 1e-07
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 3e-07
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 2e-05
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 1e-11
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 5e-11
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 5e-11
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 7e-08
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 2e-07
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 1e-06
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 7e-06
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 6e-11
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 3e-09
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 2e-04
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 2e-10
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 4e-10
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 7e-10
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 4e-08
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 6e-07
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 6e-07
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 6e-04
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 3e-10
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 3e-06
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 7e-04
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 3e-10
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 6e-10
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 7e-10
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 8e-10
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 1e-07
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 5e-06
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 2e-09
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 3e-05
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 6e-04
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 3e-09
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 3e-08
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 3e-07
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 5e-07
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 4e-05
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 6e-05
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 9e-05
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 8e-09
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 5e-08
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 1e-07
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 8e-07
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 2e-04
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 9e-09
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 1e-07
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 2e-07
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 1e-06
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 5e-06
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 9e-05
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 1e-04
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 2e-07
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 1e-06
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 9e-06
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 9e-06
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 1e-05
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 4e-05
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 3e-07
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 1e-05
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 3e-05
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 1e-04
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 1e-04
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 1e-04
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 1e-04
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 5e-04
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 6e-04
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 4e-07
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 7e-07
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 1e-06
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 3e-06
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 2e-06
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 1e-05
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 2e-05
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 2e-05
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 2e-05
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 5e-05
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 2e-06
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 2e-05
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 3e-04
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 6e-04
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 3e-06
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 6e-04
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 5e-06
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 6e-06
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 8e-06
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 8e-06
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 4e-05
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 4e-05
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 5e-05
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 3e-04
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 3e-04
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 5e-04
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 6e-04
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 9e-04
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 7e-06
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 1e-05
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 1e-05
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 4e-05
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 8e-05
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 1e-04
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 1e-04
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 2e-04
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 2e-04
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 3e-04
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 4e-04
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 8e-04
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 1e-05
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 3e-04
3e6j_A229 Variable lymphocyte receptor diversity region; var 3e-05
3m19_A251 Variable lymphocyte receptor A diversity region; a 8e-05
3m19_A251 Variable lymphocyte receptor A diversity region; a 1e-04
3m19_A251 Variable lymphocyte receptor A diversity region; a 1e-04
3m19_A251 Variable lymphocyte receptor A diversity region; a 5e-04
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 1e-04
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 4e-04
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 2e-04
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 3e-04
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
 Score =  509 bits (1314), Expect = e-167
 Identities = 212/798 (26%), Positives = 316/798 (39%), Gaps = 92/798 (11%)

Query: 211 LSNLRILSLPDCHVAGPIHSSLSKLQLLTHLNLDGNDLSSEVPDFLTNFSSLQYLHLSLC 270
           ++++ + S P       + SSL  L  L  L L  + ++  V  F    +SL  L LS  
Sbjct: 52  VTSIDLSSKPLNVGFSAVSSSLLSLTGLESLFLSNSHINGSVSGFK-CSASLTSLDLSRN 110

Query: 271 GLYGRVPEKIFL--MPSLCFLDVSSNS-NLTGSLPEFPPSSQLKVIELSETRFSGKLPDS 327
            L G V     L     L FL+VSSN+ +  G +      + L+V++LS    SG     
Sbjct: 111 SLSGPVTTLTSLGSCSGLKFLNVSSNTLDFPGKVSGGLKLNSLEVLDLSANSISGANVVG 170

Query: 328 I---NNLALLEDLELSDCNFFGSIPSSFGNLTELINIDFSRNNFSGSLPSFASSNKVISL 384
               +    L+ L +S     G +         L  +D S NNFS  +P     + +  L
Sbjct: 171 WVLSDGCGELKHLAISGNKISGDVD--VSRCVNLEFLDVSSNNFSTGIPFLGDCSALQHL 228

Query: 385 KFAHNSFTGTIPLSYGDQLISLQVLDLRNNSLQGIIPKSLYTKQSIESLLLGQNKFHGQL 444
             + N  +G    +       L++L++ +N   G IP       S++ L L +NKF G++
Sbjct: 229 DISGNKLSGDFSRAIS-TCTELKLLNISSNQFVGPIPPLPLK--SLQYLSLAENKFTGEI 285

Query: 445 EKFQNASSLSLREMDFSQNKLQGLVPESIFQIKGLNVLRLSSNKFSGFITLEMFKDLRQL 504
             F + +  +L  +D S N   G VP        L  L LSSN FSG + ++    +R L
Sbjct: 286 PDFLSGACDTLTGLDLSGNHFYGAVPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGL 345

Query: 505 GTLELSENNFSFNVSGSNSNMFPKIGTLKLSSCKIT-EFPNFLRN--QTNLFHLDLSNNR 561
             L+LS N FS  +  S +N+   + TL LSS   +      L    +  L  L L NN 
Sbjct: 346 KVLDLSFNEFSGELPESLTNLSASLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNG 405

Query: 562 IKGEIPNWTWNVGDGKLVHLNLSHNMLEAFEKPGPNLTSTVLAVLDLHSNMLQGSFPIPP 621
             G+IP    N                            + L  L L  N L G+     
Sbjct: 406 FTGKIPPTLSN---------------------------CSELVSLHLSFNYLSGT----- 433

Query: 622 ASIIFLDYSENKFTTNIPYNIGNYINYAVFFSLASNNLSGGIPLSLCNAFDLQVLDLSDN 681
                           IP ++G+         L  N L G IP  L     L+ L L  N
Sbjct: 434 ----------------IPSSLGSLSK-LRDLKLWLNMLEGEIPQELMYVKTLETLILDFN 476

Query: 682 HLTGSIPSCLVSSNILKVLKLRNNEFLGTVPQVIGNECSLRTLDLSQNHLAGSLPKSLSK 741
            LTG IPS L +   L  + L NN   G +P+ IG   +L  L LS N  +G++P  L  
Sbjct: 477 DLTGEIPSGLSNCTNLNWISLSNNRLTGEIPKWIGRLENLAILKLSNNSFSGNIPAELGD 536

Query: 742 CTSLEVLDVGKNQLNGSFPFWLETLPQLRVLVLQSNNYDGSIKDTQTANAFALLQIIDIS 801
           C SL  LD+  N  NG+ P  +          + +N   G        +          +
Sbjct: 537 CRSLIWLDLNTNLFNGTIPAAMFKQSGK----IAANFIAGKRYVYIKNDGMKKECHGAGN 592

Query: 802 SNNFSGNLPARWFQSWRGMKKRTKESQESQILKFVYLELSNLYYQDSVTLMNKGLSMELA 861
              F G    +  +                        LS     +  + +  G +    
Sbjct: 593 LLEFQGIRSEQLNR------------------------LSTRNPCNITSRVYGGHTSPTF 628

Query: 862 KILTIFTSIDVSNNQFEGEIPEMLGDFDALLVLNMSNNNFKGQIPATLGNLKELGSLDLS 921
                   +D+S N   G IP+ +G    L +LN+ +N+  G IP  +G+L+ L  LDLS
Sbjct: 629 DNNGSMMFLDMSYNMLSGYIPKEIGSMPYLFILNLGHNDISGSIPDEVGDLRGLNILDLS 688

Query: 922 HNQLSGKIPEKLATLNFLSVLKLSQNLLVGEIPRGPQFATFTAASFEGNAGLCGFPLPKA 981
            N+L G+IP+ ++ L  L+ + LS N L G IP   QF TF  A F  N GLCG+PLP+ 
Sbjct: 689 SNKLDGRIPQAMSALTMLTEIDLSNNNLSGPIPEMGQFETFPPAKFLNNPGLCGYPLPRC 748

Query: 982 CQNALPPVEQTTKDEEGS 999
             +         +     
Sbjct: 749 DPSNADGYAHHQRSHHHH 766


>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336 Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336 Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Length = 372 Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Length = 372 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208 Back     alignment and structure

Structure Templates Detected by HHsearch ?

No hit with probability above 80.00


Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 1055
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 3e-22
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 4e-18
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 5e-16
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 8e-12
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 1e-09
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 3e-09
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 9e-06
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 8e-17
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 1e-16
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 4e-16
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 6e-14
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 2e-13
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 1e-10
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 3e-05
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 2e-14
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 8e-13
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 2e-12
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 8e-12
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 2e-10
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 4e-08
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 1e-13
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 4e-11
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 1e-10
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 1e-10
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 2e-09
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 2e-04
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 5e-11
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 1e-07
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 2e-07
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 8e-07
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 8e-06
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 1e-04
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 2e-04
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 2e-04
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 1e-10
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 4e-08
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 2e-06
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 2e-06
d1z7xw1 460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 2e-05
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 7e-05
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 1e-04
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 6e-04
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 0.001
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 2e-10
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 4e-08
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 2e-07
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 4e-06
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 1e-05
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 2e-05
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 2e-04
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 4e-04
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 6e-04
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 0.003
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 4e-08
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 1e-05
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 4e-07
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 5e-07
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 7e-06
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 1e-05
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 2e-05
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 3e-04
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 5e-04
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 0.004
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 3e-06
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 8e-06
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 1e-05
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 3e-04
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 0.002
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 6e-06
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 1e-05
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 2e-05
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 0.003
d1koha1162 c.10.2.3 (A:201-362) mRNA export factor tap {Human 9e-05
d1koha1162 c.10.2.3 (A:201-362) mRNA export factor tap {Human 0.002
d1w8aa_192 c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanoga 1e-04
d1h6ta2210 c.10.2.1 (A:31-240) Internalin B {Listeria monocyt 1e-04
d1h6ta2210 c.10.2.1 (A:31-240) Internalin B {Listeria monocyt 0.001
d2ifga3156 c.10.2.7 (A:36-191) High affinity nerve growth fac 3e-04
d2ca6a1344 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom 5e-04
d2ca6a1344 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom 8e-04
d2omxa2199 c.10.2.1 (A:37-235) Internalin B {Listeria monocyt 7e-04
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Polygalacturonase inhibiting protein PGIP
domain: Polygalacturonase inhibiting protein PGIP
species: Kidney bean (Phaseolus vulgaris) [TaxId: 3885]
 Score = 96.7 bits (239), Expect = 3e-22
 Identities = 80/346 (23%), Positives = 119/346 (34%), Gaps = 44/346 (12%)

Query: 32  CLEDQKLLLLEFKRGLSFDPQTDSTNKLLSWSSTTDCC--SWDGVTCDP--RTGHVIGLD 87
           C    K  LL+ K+ L  +P       L SW  TTDCC  +W GV CD   +T  V  LD
Sbjct: 3   CNPQDKQALLQIKKDLG-NP-----TTLSSWLPTTDCCNRTWLGVLCDTDTQTYRVNNLD 56

Query: 88  ISSSFITGGINGSSSLFDLQRLQHLNLADNSLYSSPFPSGFDRLFSLTHLNLSYSGFSGH 147
           +S   +       SSL +L  L  L +   +    P P    +L  L +L ++++  SG 
Sbjct: 57  LSGLNLPKPYPIPSSLANLPYLNFLYIGGINNLVGPIPPAIAKLTQLHYLYITHTNVSGA 116

Query: 148 IPLEISSLKMLVSLDLSASGLVAPIQLRRANLEKLVKNLTNLEELYLGGIDISGADWGPI 207
           IP  +S +K LV+LD S +                                       P 
Sbjct: 117 IPDFLSQIKTLVTLDFSYNA--------------------------------LSGTLPPS 144

Query: 208 LSILSNLRILSLPDCHVAGPIHSSLSKLQLLTHLNLDGNDLSSEVPDFLTNFSSLQYLHL 267
           +S L NL  ++     ++G I  S      L        +         T  +       
Sbjct: 145 ISSLPNLVGITFDGNRISGAIPDSYGSFSKLFTSMTISRN-RLTGKIPPTFANLNLAFVD 203

Query: 268 SLCGLYGRVPEKIFLMPSLCFLDVSSNSNLTGSLPEFPPSSQLKVIELSETRFSGKLPDS 327
               +       +F           + ++L   L +   S  L  ++L   R  G LP  
Sbjct: 204 LSRNMLEGDASVLFGSDKNTQKIHLAKNSLAFDLGKVGLSKNLNGLDLRNNRIYGTLPQG 263

Query: 328 INNLALLEDLELSDCNFFGSIPSSFGNLTELINIDFSRNNFSGSLP 373
           +  L  L  L +S  N  G IP   GNL       ++ N      P
Sbjct: 264 LTQLKFLHSLNVSFNNLCGEIP-QGGNLQRFDVSAYANNKCLCGSP 308


>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 192 Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 210 Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 210 Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344 Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344 Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 199 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query1055
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 100.0
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 100.0
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 100.0
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 100.0
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 100.0
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 100.0
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 100.0
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 100.0
d1p9ag_266 von Willebrand factor binding domain of glycoprote 100.0
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.97
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.96
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 99.95
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 99.93
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.93
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.93
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.92
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.91
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.9
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.89
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.89
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.88
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.88
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.88
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.87
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.85
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 99.81
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.75
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.69
d2ifga3156 High affinity nerve growth factor receptor, N-term 99.68
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.66
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.6
d2ifga3156 High affinity nerve growth factor receptor, N-term 99.57
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.52
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 98.86
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 98.46
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 97.99
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Polygalacturonase inhibiting protein PGIP
domain: Polygalacturonase inhibiting protein PGIP
species: Kidney bean (Phaseolus vulgaris) [TaxId: 3885]
Probab=100.00  E-value=0  Score=302.65  Aligned_cols=128  Identities=37%  Similarity=0.543  Sum_probs=79.6

Q ss_pred             CCCHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCC--CCEEEECCC--CCCEEEEECCCCCCCCCCCCCCCCCCC
Q ss_conf             9988879999997704988999987653699989999865--210485199--992999985998654556898876478
Q 001554           31 RCLEDQKLLLLEFKRGLSFDPQTDSTNKLLSWSSTTDCCS--WDGVTCDPR--TGHVIGLDISSSFITGGINGSSSLFDL  106 (1055)
Q Consensus        31 ~~~~~~~~~ll~~k~~~~~~~~~~~~~~l~~W~~~~~~c~--w~gv~C~~~--~~~v~~L~L~~~~l~g~~~~~~~l~~l  106 (1055)
                      -|.++||+||++||+++.++ .     .+++|..++|||.  |+||+|+..  ++||++|+|+++++.|..+.+.+++++
T Consensus         2 ~c~~~e~~aLl~~k~~~~~~-~-----~l~sW~~~~d~C~~~w~gv~C~~~~~~~~v~~L~L~~~~l~g~~~lp~~l~~L   75 (313)
T d1ogqa_           2 LCNPQDKQALLQIKKDLGNP-T-----TLSSWLPTTDCCNRTWLGVLCDTDTQTYRVNNLDLSGLNLPKPYPIPSSLANL   75 (313)
T ss_dssp             CSCHHHHHHHHHHHHHTTCC-G-----GGTTCCTTSCTTTTCSTTEEECCSSSCCCEEEEEEECCCCSSCEECCGGGGGC
T ss_pred             CCCHHHHHHHHHHHHHCCCC-C-----CCCCCCCCCCCCCCCCCCEEEECCCCCEEEEEEECCCCCCCCCCCCCHHHHCC
T ss_conf             98989999999999977999-8-----67788999999889488969748999479889989899888888798478467


Q ss_pred             CCCCEEECCC-CCCCCCCCCCCCCCCCCCCEEECCCCCCCCCCCHHCCCCCCCCEEEECC
Q ss_conf             7788443899-9999999994577999999884899999888871000688986899047
Q 001554          107 QRLQHLNLAD-NSLYSSPFPSGFDRLFSLTHLNLSYSGFSGHIPLEISSLKMLVSLDLSA  165 (1055)
Q Consensus       107 ~~L~~L~Ls~-n~l~~~~lp~~~~~l~~L~~L~Ls~n~l~~~~p~~l~~l~~L~~L~Ls~  165 (1055)
                      ++|++|+|++ |.+.+. +|..++++++|++|++++|.+.+..+..+..+.+|++++++.
T Consensus        76 ~~L~~L~Ls~~N~l~g~-iP~~i~~L~~L~~L~Ls~N~l~~~~~~~~~~~~~L~~l~l~~  134 (313)
T d1ogqa_          76 PYLNFLYIGGINNLVGP-IPPAIAKLTQLHYLYITHTNVSGAIPDFLSQIKTLVTLDFSY  134 (313)
T ss_dssp             TTCSEEEEEEETTEESC-CCGGGGGCTTCSEEEEEEECCEEECCGGGGGCTTCCEEECCS
T ss_pred             CCCCCCCCCCCCCCCCC-CCCCCCCCCCCCHHHHCCCCCCCCCCCCCCCHHHHCCCCCCC
T ss_conf             53352020265433300-243114542001102035643443322222011100111122



>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure