Citrus Sinensis ID: 001560

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820-------830-------840-------850-------860-------870-------880-------890-------900-------910-------920-------930-------940-------950-------960-------970-------980-------990------1000------1010------1020------1030------1040------1050--
MELEVRVVGGVENCFVSLPLKLIETLESTRSAHLLPQVLSLELRSRSNQRWVVAWSGATSSSSFIEVARQFAECISLADHTIVQVRVVSNVLKATLVTIEPLTEDDWEVLELNSEHAEAAILNQVRIVHEAMRFPLWLHGRTIITFHVVSTFPKKPVVQLVPGTEVAVAPKRRKNNVKKHEDSYMQAFNESTSIAKALLRVQDSDEGLSHKCNVKGVELGVALTSVAFINPETAENVSLCSLELVAILPRLSSKENNPENNAPRIKSNLTSKEISGGASTDKKECRQAVVHLLFSDSVAKGHVKIARALRLYLNAGLHSWVYLKKCTVNLKKEIPMVSLSPCHFKMLEKDKAFGIGLELDNKNHKTKKMLEKTSSGIYMDDGDLSAEDDIIAALSSEPSSKEDEEAVYQFENKKGLECLLHTWLLAQLTAVASNIGSEFNTLVLSNETLLHFEVKGYKSGTYGKVPASCNGALENKTKARELRTEIFCVLTFSEESLHGGKNNAYELTLEARGQQNNNTEAVRQLFGKLNSGDSVSFYTVKERGSTQGFDSNVSSLSWMGTTASDVINRIKVLLSPDSGLWFSTYHLPLPGHILIHGPPGSGKTSLAKAVAKSLEHHKDLVAHIVFVCCSRLSLEKGPIIRQALSNFISEALDHAPSIVIFDNLDSIISSSSDPEGSQPSTSVIALTKFLVDIMDEYGEKRKSSCGIGPIAFVASAQSLEKIPQSLTSSGRFDFHVQLPAPAASERKAILEHEIQRRSLECSDEILLDVASKCDGYDAYDLEILVDRTVHAAVGRYLHSDSSFEKHIKPTLVRDDFSQAMHEFLPVAMRDITKTSAEGGRSGWDDVGGLTDIQNAIKEMIELPSKFPNIFAQAPLRLRSNVLLYGPPGCGKTHIVGAAAAACSLRFISVKGPELLNKYIGASEQAVRDIFSKATAAAPCLLFFDEFDSIAPKRGHDNTGVTDRVVNQVSSTSYLFIIYFWEVGKKEGVVPYDIYILVNFLISACPCFQQFLTELDGVEVLTGVFVFAATRLEFFHYNVLLFCSFIIFLILLF
cEEEEEEEcccccccccccHHHHHHHHccccccccccEEEEEEEcccccEEEEEEcccccccccEEEcHHHHHHcccccccEEEEEEEccccccEEEEEEcccccHHHHHHHcHHHHHHHHHccEEEEEcccEEEEEEccccEEEEEEEEEcccccEEEEccccEEEEcccccccccccccccHHHcccccHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccEEEEEcccccccccccccccccccccccccccccccccccccccccEEEEEEcccccccccccHHHHHHHHHcccccEEEEEEcccccccccccEEEcccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHcccccccccHHHHHHHHcccccHHHHHHHHHHHHHHHHHcccccccEEEEcccEEEEEEEccccccccccccccccccccccHHHHHHHHHHHHcccccccccccccccHHHHHHHHHccccccHHHHHHHHccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHcccccHHHHHHcccccccEEEEEccccccHHHHHHHHHHHHccccccccEEEEEEccccccccHHHHHHHHHHHHHHHHHcccEEEEEcccccccccccccccccccHHHHHHHHHHHHHHHHHccccccccccccEEEEEEEcccccccccccccccccEEEEcccccHHHHHHHHHHHHccccccccHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHccccccccccccccccHHHHHHHHHHccccccccccccccccccccccccccHHHHHHHHHHHHHHHcccHHHHHHcccccccEEEEEccccccHHHHHHHHHHHccccEEEccccccccccccHHHHHHHHHHHHHHHcccEEEEEEccccccccccccccccccEEEccccccccHHHHHHHccccccccccccHHHHHHccccccccccccccccccccccccEEEEEEcccccccccccccccccEEEEEcc
cEEEEEEEccccHHHHHccHHHHHHHHccccccccccEEEEEEEcccccEEEEEEcccccccHHHHHHHHHHHHcccccccEEEEEEEcccccccEEEEccccccHHHHHHHHHHHHHHHHHHHccEEEccccccEEEcccEEEEEEEEEccccccEEEEccccEEEEccccccccccccHHHHHHHcccHHHHHHHHHHcccccccEEEEEEEEEEEEEEEEEEEEEEcHHHHHHccccccEEEEEEcccccccccccccccccccccccHHHccccccccccHHEEEEEEEEcHHHcccccEccHHHHHHHcccccEEEEEEEEcccccccccEEEEcccEEEEcccHHHcccccEccccccEEEcccccccccccccEEEcccccHHHEEccccccccccccccHHHHcHHHHHHHHHHHHHHHHHHHHHHcccEEcEEEEcccEEEEEEEEcccccccccccccccccEEcccccccccHHHHHHccHHHHHHHHcHccHHHHHHHccccccccccccHHHHHHHccccHcHHHHHccccccccccccHHccccHHHHHHHHHHHHHHccccccHHHHHHcccccccEEEEEccccccHHHHHHHHHHHcccEEEEEcccHHccHHHHHHHHHcHcHHHHHHHHHHHHHcccEEEEEEcHHHHccccccccccccHHHHHHHHHHHHHHHHHHHHHcccccccccEEEEEEccccccccHHHcccccccEEEEEccccHHHHHHHHHHHHcccccccccccHHHHHHHHccccHHHHHHHHHHHHHHHHHHHccHccHHHHcccccccHHHHHHHHHHccccccHHHEEEEEccccccHHHcccHHHHHHHHHHHHccccccHHHHHHcccccccEEEEEccccccHHHHHHHHHHHcccEEEEEccHHHHHHHHcHcHHHHHHHHHHHHHcccEEEEEEcHHHHcccccccccccEHHHHHHHHHHcEEEEEEEEEcccccccEccccccccccccHHHHHHHHHHHHHccHHccccEEEEEEcccccccHHHcccccccEEEEEcc
MELEVRVVGGVENCFVSLPLKLIETLEstrsahllPQVLSLELRSRSNQRWVVAWSGATSSSSFIEVARQFAECISLADHTIVQVRVVSNVLKATLVtieplteddWEVLELNSEHAEAAILNQVRIVHEAMRfplwlhgrtiITFHVvstfpkkpvvqlvpgtevavapkrrknnvkkhEDSYMQAFNESTSIAKALLRVqdsdeglshkcnVKGVELGVALTSVafinpetaenvsLCSLELVAIlprlsskennpennapriksnltskeisggastdkkECRQAVVHLLFSDSVAKGHVKIARALRLYLNAGLHSWVYLKKCTVnlkkeipmvslspchfkMLEKDKAFGigleldnknhKTKKMLEktssgiymddgdlsaEDDIIAAlssepsskedEEAVYQFENKKGLECLLHTWLLAQLTAVASNIGSEFNTLVLSNETLLHFEvkgyksgtygkvpascngalenkTKARELRTEIFCVLTfseeslhggknnaYELTLEARGQQNNNTEAVRQLFGklnsgdsvsfYTVKergstqgfdsnvsslswmgtTASDVINRIKVLlspdsglwfstyhlplpghilihgppgsgktSLAKAVAKSLEHHKDLVAHIVFVCCsrlslekgpIIRQALSNFISEaldhapsivifdnldsiissssdpegsqpstsVIALTKFLVDIMDEYGekrksscgigpIAFVASAQslekipqsltssgrfdfhvqlpapaaSERKAILEHEIQRRSLECSDEILLDVaskcdgydaydlEILVDRTVHAAVGrylhsdssfekhikptlvrddFSQAMHEFLPVAMRDItktsaeggrsgwddvggLTDIQNAIKEMIelpskfpnifaqaplrlrsnvllygppgcgkthIVGAAAAACSLRFISVKGPELLNKYIGASEQAVRDIFSKATaaapcllffdefdsiapkrghdntgvtDRVVNQVSSTSYLFIIYFWEvgkkegvvpyDIYILVNFLISACPCFQQFLTELDGVEVLTGVFVFAATRLEFFHYNVLLFCSFIIFLILLF
melevrvvggvencfvsLPLKLIETLESTRSAHLLPQVLSLELRSRSNQRWVVAWSGATSSSSFIEVARQFAECISLADHTIVQVRVVSNVLKATLVTIEPLTEDDWEVLELNSEHAEAAILNQVRIVHEAMRFPLWLHGRTIITFHVVSTfpkkpvvqlvpgtevavapkrrknnvkkhedSYMQAFNESTSIAKALLRVQDSDEGLSHKCNVKGVELGVALTSVAFINPETAENVSLCSLELVAILPrlsskennpennapriksnltskEISGGASTDKKECRQAVVHLLFSDSVAKGHVKIARALRLYLNAGLHSWVYLKKCTVNLKKEIPMVSLSPCHFKMLEKDKAFGIgleldnknhkTKKMLEKTSSGIYMDDGDLSAEDDIIAALssepsskedEEAVYQFENKKGLECLLHTWLLAQLTAVASNIGSEFNTLVLSNETLLHFEVKGyksgtygkvpascNGALENKTKARELRTEIFCVLtfseeslhggkNNAYELTLEARGQQNNNTEAVRQLFGKLNSGDSVSFYTVKergstqgfdsnvssLSWMGTTASDVINRIKVLLSPDSGLWFSTYHLPLPGHILIHGPPGSGKTSLAKAVAKSLEHHKDLVAHIVFVCCSRLSLEKGPIIRQALSNFISEALDHAPSIVIFDNLDSIISSssdpegsqpstSVIALTKFLVDIMDEYGEKRKSSCGIGPIAFVASAQSLEKIPQSLTSSGRFDFHVQLPAPAASERKAILEHEIQRRSLECSDEILLDVASKCDGYDAYDLEILVDRTVHAAVGRylhsdssfekhikptLVRDDFSQAMHEFLPVAMRDITKTSaeggrsgwddvGGLTDIQNAIKEMIELPSKFPNIFAQAPLRLRSNVLLYGPPGCGKTHIVGAAAAACSLRFISVKGPELLNKYIGASEQAVRDIFSKATAAAPCLLFFDEFDSIApkrghdntgvtdrvvnqvSSTSYLFIIYFWEVGKKEGVVPYDIYILVNFLISACPCFQQFLTELDGVEVLTGVFVFAATRLEFFHYNVLLFCSFIIFLILLF
MELEVRVVGGVENCFVSLPLKLIETLESTRSAHLLPQVLSLELRSRSNQRWVVAWSGATSSSSFIEVARQFAECISLADHTIVQVRVVSNVLKATLVTIEPLTEDDWEVLELNSEHAEAAILNQVRIVHEAMRFPLWLHGRTIITFHVVSTFPKKPVVQLVPGTEVAVAPKRRKNNVKKHEDSYMQAFNESTSIAKALLRVQDSDEGLSHKCNVKGVELGVALTSVAFINPETAENVSLCSLELVAILPRLSSKENNPENNAPRIKSNLTSKEISGGASTDKKECRQAVVHLLFSDSVAKGHVKIARALRLYLNAGLHSWVYLKKCTVNLKKEIPMVSLSPCHFKMLEKDKAFGIGLELDNKNHKTKKMLEKTSSGIYMDDGDLSAEDDIIAALSSEPSSKEDEEAVYQFENKKGLECLLHTWLLAQLTAVASNIGSEFNTLVLSNETLLHFEVKGYKSGTYGKVPASCNGALENKTKARELRTEIFCVLTFSEESLHGGKNNAYELTLEARGQQNNNTEAVRQLFGKLNSGDSVSFYTVKERGSTQGFDSNVSSLSWMGTTASDVINRIKVLLSPDSGLWFSTYHLPLPGHILIHGPPGSGKTSLAKAVAKSLEHHKDLVAHIVFVCCSRLSLEKGPIIRQALSNFISEALDHAPSIVIFDNLdsiissssdpegsqpstsVIALTKFLVDIMDEYGEKRKSSCGIGPIAFVASAQSLEKIPQSLTSSGRFDFHVQLPAPAASERKAILEHEIQRRSLECSDEILLDVASKCDGYDAYDLEILVDRTVHAAVGRYLHSDSSFEKHIKPTLVRDDFSQAMHEFLPVAMRDITKTSAEGGRSGWDDVGGLTDIQNAIKEMIELPSKFPNIFAQAPLRLRSNVLLYGPPGCGKTHIVGAAAAACSLRFISVKGPELLNKYIGASEQAVRDIFSKATAAAPCLLFFDEFDSIAPKRGHDNTGVTDRVVNQVSSTSYLFIIYFWEVGKKEGVVPYDIYILVNFLISACPCFQQFLTELDGVEVLTGVFVFAATRLEFFHYNVllfcsfiiflillf
****VRVVGGVENCFVSLPLKLIETLESTRSAHLLPQVLSLELRSRSNQRWVVAWSGATSSSSFIEVARQFAECISLADHTIVQVRVVSNVLKATLVTIEPLTEDDWEVLELNSEHAEAAILNQVRIVHEAMRFPLWLHGRTIITFHVVSTFPKKPVVQLVPGTEVAV**************************AKALLRVQ***EGLSHKCNVKGVELGVALTSVAFINPETAENVSLCSLELVAILP***********************************CRQAVVHLLFSDSVAKGHVKIARALRLYLNAGLHSWVYLKKCTVNLKKEIPMVSLSPCHFKMLEKDKAFGIGLEL***********************************************VYQFENKKGLECLLHTWLLAQLTAVASNIGSEFNTLVLSNETLLHFEVKGYKSGTYGKVPASCNGALENKTKARELRTEIFCVLTFSEESLHGGKNNAYELT***************QLFGKLNSGDSVSFYTVK*******FDSNVSSLSWMGTTASDVINRIKVLLSPDSGLWFSTYHLPLPGHILIHGP*******LAKAVAKSLEHHKDLVAHIVFVCCSRLSLEKGPIIRQALSNFISEALDHAPSIVIF*********************VIALTKFLVDIMDEYGEKRKSSCGIGPIAFVASAQ**************FDFHVQ**********AILEHEIQRRSLECSDEILLDVASKCDGYDAYDLEILVDRTVHAAVGRYLHSDSSFEKHIKPTLVRDDFSQAMHEFLPVAMRDITKTSAEGGRSGWDDVGGLTDIQNAIKEMIELPSKFPNIFAQAPLRLRSNVLLYGPPGCGKTHIVGAAAAACSLRFISVKGPELLNKYIGASEQAVRDIFSKATAAAPCLLFFDEFDSIAPKRGHDNTGVTDRVVNQVSSTSYLFIIYFWEVGKKEGVVPYDIYILVNFLISACPCFQQFLTELDGVEVLTGVFVFAATRLEFFHYNVLLFCSFIIFLILL*
*ELEVRVVGGVENCFVSLPLKLIETLESTRSAHLLPQVLSLELRSRSNQRWVVAWSGATSSSSFIEVARQFAECISLADHTIVQVRVVSNVLKATLVTIEPLTEDDWEVLELNSEHAEAAILNQVRIVHEAMRFPLWLHGRTIITFHVVSTFPKKPVVQLVPGTEVAV********************************************************SVAF**********LCSLELVA*************************************ECRQAVVHLLFSDSVAKGHVKIARALRLYLNAGLHSWVYLKKCTVNLKKEIPMV*****************************************MDDGDLSAEDDIIAALSSE********************CLLHTWLLAQLTAV**********LVLSNETLLHFEV******************LE**TKARELRTEIFCVLTFSEESLHGGKNNAYE*******************F******************************SWMGTTASDVINRIKVLLSPDSGLWFSTYHLPLPGHILIHGPPGSGKTSLAKAVAKSLEHHKDLVAHIVFVCC*************ALSNFISEALDHAPSIVIFDNLDS********************TKFLVDIMDEYGE****SCGIGPIAFVASAQSLEKIPQSLTSSGRFDFHVQLPAPAASERKAILEHEIQRRSLECSDEILLDVASKCDGYDAYDLEILVDRTVHAAV****************TLVRDDFSQAMHEFLPVAMRDITKTSAEGGRSGWDDVGGLTDIQNAIKEMIELPSKFPNIFAQAPLRLRSNVLLYGPPGCGKTHIVGAAAAACSLRFISVKGPELLNKYIGASEQAVRDIFSKATAAAPCLLFFDEFDSIAP***********RVVNQVSSTSYLFIIYFWEVGKKEGVVPYDIYILVNFLISACPCFQQFLTELDGVEVLTGVFVFAATRLEFFHYNVLLFCSFIIFLILLF
MELEVRVVGGVENCFVSLPLKLIETLESTRSAHLLPQVLSLELRSRSNQRWVVAWSGATSSSSFIEVARQFAECISLADHTIVQVRVVSNVLKATLVTIEPLTEDDWEVLELNSEHAEAAILNQVRIVHEAMRFPLWLHGRTIITFHVVSTFPKKPVVQLVPGTEVAVAPKRRKNNVKKHEDSYMQAFNESTSIAKALLRVQDSDEGLSHKCNVKGVELGVALTSVAFINPETAENVSLCSLELVAILPRLSSKENNPENNAPRIKSNLTSKE**********ECRQAVVHLLFSDSVAKGHVKIARALRLYLNAGLHSWVYLKKCTVNLKKEIPMVSLSPCHFKMLEKDKAFGIGLELDNKNHKTKKMLEKTSSGIYMDDGDLSAEDDIIAALSS***********YQFENKKGLECLLHTWLLAQLTAVASNIGSEFNTLVLSNETLLHFEVKGYKSGTYGKVPASCNGALENKTKARELRTEIFCVLTFSEESLHGGKNNAYELTLEARGQQNNNTEAVRQLFGKLNSGDSVSFYTVKERGSTQGFDSNVSSLSWMGTTASDVINRIKVLLSPDSGLWFSTYHLPLPGHILIHGPP************KSLEHHKDLVAHIVFVCCSRLSLEKGPIIRQALSNFISEALDHAPSIVIFDNLDSIIS***********TSVIALTKFLVDIMDEYGEKRKSSCGIGPIAFVASAQSLEKIPQSLTSSGRFDFHVQLPAPAASERKAILEHEIQRRSLECSDEILLDVASKCDGYDAYDLEILVDRTVHAAVGRYLHSDSSFEKHIKPTLVRDDFSQAMHEFLPVAMRDITKTSAEGGRSGWDDVGGLTDIQNAIKEMIELPSKFPNIFAQAPLRLRSNVLLYGPPGCGKTHIVGAAAAACSLRFISVKGPELLNKYIGASEQAVRDIFSKATAAAPCLLFFDEFDSIAPKRGHDNTGVTDRVVNQVSSTSYLFIIYFWEVGKKEGVVPYDIYILVNFLISACPCFQQFLTELDGVEVLTGVFVFAATRLEFFHYNVLLFCSFIIFLILLF
MELEVRVVGGVENCFVSLPLKLIETLESTRSAHLLPQVLSLELRSRSNQRWVVAWSGATSSSSFIEVARQFAECISLADHTIVQVRVVSNVLKATLVTIEPLTEDDWEVLELNSEHAEAAILNQVRIVHEAMRFPLWLHGRTIITFHVVSTFPKKPVVQLVPGTEVAVAPKRRKNNVKKHE*SY**AFNESTSIAKALLRVQDSDEGLSHKCNVKGVELGVALTSVAFINPETAENVSLCSLELVAILPRL***************************STDKKECRQAVVHLLFSDSVAKGHVKIARALRLYLNAGLHSWVYLKKCTVNLKKEIPMVSLSPCHFKMLEKDKAFGIGLELDNKNHKTKKMLEKTSSGIYMDDGDLSAEDDIIAALSSE*S******AVYQFENKKGLECLLHTWLLAQLTAVASNIGSEFNTLVLSNETLLHFEVKGYKSGTYGKVPASCNGALENKTKARELRTEIFCVLTFSEESLHGGKNNAYELTLEARGQQNNNTEAVRQLFGKLNSGDSVSFYTVKERGSTQGFDSNVSSLSWMGTTASDVINRIKVLLSPDSGLWFSTYHLPLPGHILIHGPPGSGKTSLAKAVAKSLEHHKDLVAHIVFVCCSRLSLEKGPIIRQALSNFISEALDHAPSIVIFDNLDSIISS******SQPSTSVIALTKFLVDIMDEYGEKRKSSCGIGPIAFVASAQSLEKIPQSLTSSGRFDFHVQLPAPAASERKAILEHEIQRRSLECSDEILLDVASKCDGYDAYDLEILVDRTVHAAVGRYLHSDSSFEKHIKPTLVRDDFSQAMHEFLPVAMRDITKTSAEGGRSGWDDVGGLTDIQNAIKEMIELPSKFPNIFAQAPLRLRSNVLLYGPPGCGKTHIVGAAAAACSLRFISVKGPELLNKYIGASEQAVRDIFSKATAAAPCLLFFDEFDSIAPKR*H*NTGVTDRVVNQVSSTSYLFIIYFWEVGKKEGVVPYDIYILVNFLISACPCFQQFLTELDGVEVLTGVFVFAATRLEFFHYNVLLFCSFIIFLILLF
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHi
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHo
oooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHi
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MELEVRVVGGVENCFVSLPLKLIETLESTRSAHLLPQVLSLELRSRSNQRWVVAWSGATSSSSFIEVARQFAECISLADHTIVQVRVVSNVLKATLVTIEPLTEDDWEVLELNSEHAEAAILNQVRIVHEAMRFPLWLHGRTIITFHVVSTFPKKPVVQLVPGTEVAVAPKRRKNNVKKHEDSYMQAFNESTSIAKALLRVQDSDEGLSHKCNVKGVELGVALTSVAFINPETAENVSLCSLELVAILPRLSSKENNPENNAPRIKSNLTSKEISGGASTDKKECRQAVVHLLFSDSVAKGHVKIARALRLYLNAGLHSWVYLKKCTVNLKKEIPMVSLSPCHFKMLEKDKAFGIGLELDNKNHKTKKMLEKTSSGIYMDDGDLSAEDDIIAALSSEPSSKEDEEAVYQFENKKGLECLLHTWLLAQLTAVASNIGSEFNTLVLSNETLLHFEVKGYKSGTYGKVPASCNGALENKTKARELRTEIFCVLTFSEESLHGGKNNAYELTLEARGQQNNNTEAVRQLFGKLNSGDSVSFYTVKERGSTQGFDSNVSSLSWMGTTASDVINRIKVLLSPDSGLWFSTYHLPLPGHILIHGPPGSGKTSLAKAVAKSLEHHKDLVAHIVFVCCSRLSLEKGPIIRQALSNFISEALDHAPSIVIFDNLDSIISSSSDPEGSQPSTSVIALTKFLVDIMDEYGEKRKSSCGIGPIAFVASAQSLEKIPQSLTSSGRFDFHVQLPAPAASERKAILEHEIQRRSLECSDEILLDVASKCDGYDAYDLEILVDRTVHAAVGRYLHSDSSFEKHIKPTLVRDDFSQAMHEFLPVAMRDITKTSAEGGRSGWDDVGGLTDIQNAIKEMIELPSKFPNIFAQAPLRLRSNVLLYGPPGCGKTHIVGAAAAACSLRFISVKGPELLNKYIGASEQAVRDIFSKATAAAPCLLFFDEFDSIAPKRGHDNTGVTDRVVNQVSSTSYLFIIYFWEVGKKEGVVPYDIYILVNFLISACPCFQQFLTELDGVEVLTGVFVFAATRLEFFHYNVLLFCSFIIFLILLF
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query1052 2.2.26 [Sep-21-2011]
Q9FNP1 1130 Peroxisome biogenesis pro yes no 0.937 0.872 0.571 0.0
O43933 1283 Peroxisome biogenesis fac yes no 0.362 0.296 0.387 7e-72
Q5BL07 1284 Peroxisome biogenesis fac yes no 0.360 0.295 0.379 2e-67
Q54GX5 1227 Peroxisome biogenesis fac yes no 0.371 0.318 0.355 1e-66
P46463 1157 Peroxisome biosynthesis p yes no 0.362 0.329 0.330 3e-65
P24004 1043 Peroxisomal ATPase PEX1 O yes no 0.350 0.353 0.318 2e-55
O05209 745 VCP-like ATPase OS=Thermo yes no 0.359 0.507 0.319 2e-55
Q9HPF0 742 Protein CdcH OS=Halobacte yes no 0.358 0.508 0.330 5e-55
O28972 733 Cell division cycle prote yes no 0.357 0.512 0.318 2e-53
P32794780 ATPase family gene 2 prot no no 0.364 0.491 0.317 2e-53
>sp|Q9FNP1|PEX1_ARATH Peroxisome biogenesis protein 1 OS=Arabidopsis thaliana GN=PEX1 PE=2 SV=2 Back     alignment and function desciption
 Score = 1098 bits (2840), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 603/1056 (57%), Positives = 747/1056 (70%), Gaps = 70/1056 (6%)

Query: 1    MELE--VRVVGGVENCFVSLPLKLIETLESTRSAHLLPQVLSLELRSRSNQRWVVAWSGA 58
            ME E  V  V GV +CFVSLP +L+  L+ST S+ L   +L +ELRS  ++RW VAWSG+
Sbjct: 14   METEAVVNTVAGV-DCFVSLPRQLLHALQSTSSSPLP-PLLPVELRS-GDRRWSVAWSGS 70

Query: 59   TSSSSFIEVARQFAECISLADHTIVQVRVVSNVLKATLVTIEPLTEDDWEVLELNSEHAE 118
            +SSSS IE+AR FAE ISL D T+V+VRV+ NV KATLVT+EP TEDDWEVLELN+E AE
Sbjct: 71   SSSSSAIEIARVFAESISLPDGTVVKVRVLPNVPKATLVTVEPETEDDWEVLELNAELAE 130

Query: 119  AAILNQVRIVHEAMRFPLWLHGRTIITFHVVSTFPKKPVVQLVPGTEVAVAPKRRKNNVK 178
            AAIL+QVRI+HE M+FPLWLH RT+I F VVSTFP K VVQLVPGTEVAVAPKRR  N+K
Sbjct: 131  AAILSQVRILHETMKFPLWLHDRTVIRFSVVSTFPSKGVVQLVPGTEVAVAPKRRDRNLK 190

Query: 179  KHEDSYMQAFNESTSIAKALLRVQDSDEGLSHKCNVKGVELGVALTSVAFINPETAENVS 238
              +    +  N      KALLRVQ++D    H+ +VKG EL VALTS+A+I+PETA+  S
Sbjct: 191  AKKSQEKECNN-----VKALLRVQETDRSAFHEADVKGFELRVALTSIAYIHPETAKKHS 245

Query: 239  LCSLELVAILPRLSSKENNPENNAPRIKSNLTSKEISGGASTDKKECRQAVVHLLFSDSV 298
            L SL+L+++ PR+  K +  ++ A  +K++  SK    G S+ KKE RQA++ L+FSD  
Sbjct: 246  LESLQLISVSPRIPLKGSAKKDEALNMKNSEASKVAENGTSSAKKEPRQAILRLVFSDLA 305

Query: 299  AKGHVKIARALRLYLNAGLHSWVYLKKCTVNLKKEIPMVSLSPCHFKMLEKDKAFGIGLE 358
            AKGH+ +  +LRLYL AGLHSWVYL+ C VN  KEIP +SLSPC FK+ E +K    G +
Sbjct: 306  AKGHLMMVESLRLYLGAGLHSWVYLRGCNVNEDKEIPALSLSPCVFKISENEKVLDKGTD 365

Query: 359  -LDNKNHKTKKMLEKTSSGIYMDDGDLSAEDDIIAALSSEPSSKEDEEAVYQFENKKGLE 417
             L N N   K     +    Y+D  D S  D ++ ALSSE    E        +NKKGLE
Sbjct: 366  RLGNNNSVRKSSHPPSGLSTYVDVVDWSVHDKVVTALSSEGLHDEGNHD----KNKKGLE 421

Query: 418  CLLHTWLLAQLTAVASNIGSEFNTLVLSNETLLHFEVKGYKSGTYGKVPASCNGALENKT 477
             L   W LAQL A+AS  G + ++L++  ET  HFEV+G +S        S N   E+  
Sbjct: 422  YLTRLWSLAQLDAMASVTGVDVSSLIVGRETFFHFEVRGLESYKSIDGQPSVNDRWESGK 481

Query: 478  KARELRTEIFCVLTFSEESLHGGKNNAYELTLEARGQQNNNTEAVRQLFGKLNSGDSVSF 537
            K +    EI  V+T S+ESL G K   Y+L+L+ R ++++N   +  +  K+N G+ +  
Sbjct: 482  KDKHTPLEILYVMTVSDESLLGDKFAGYDLSLD-RSEKSDNVVHIEPVLEKMNLGEPIYL 540

Query: 538  YTVKERGSTQGFDSNVSSLSWMGTTASDVINRIKVLLSPDSGLWFSTYHLPLPGHILIHG 597
             + KE    +G   ++SSL+WMG   SDVI R+ VLLSP +G+WFS + +P PGHILI+G
Sbjct: 541  KSAKETHCNKGVSPDISSLTWMGPIVSDVIKRMTVLLSPAAGMWFSKFKIPSPGHILIYG 600

Query: 598  PPGSGKTSLAKAVAKSLEHHKDLVAHIVFVCCSRLSLEKGPIIRQALSNFISEALDHAPS 657
            PPGSGKT LA+A AK  E  KDL+AH++ V CS L+LEK   I   LS+ I+E L+HAPS
Sbjct: 601  PPGSGKTILARAAAKYFEEQKDLLAHVILVSCSTLALEKVQHIHHVLSSVIAEGLEHAPS 660

Query: 658  IVIFDNLDSIISSSSDPEGSQPSTSVIALTKFLVDIMDEYGEKRKSSCGIGPIAFVASAQ 717
            ++I D+LDSIISSSSD EG+Q S  V  LTKFL D++D+YGE R SSCGIGP+AFVAS Q
Sbjct: 661  VIILDDLDSIISSSSDTEGTQASVGVTMLTKFLTDVIDDYGEYRNSSCGIGPLAFVASVQ 720

Query: 718  SLEKIPQSLTSSGRFDFHVQLPAPAASERKAILEHEIQRRSLECSDEILLDVASKCDGYD 777
            SLE+IPQ+L+SSGRFDFHVQL APA SER AIL+HEIQ+R L+CS++ILL++A+KC+GYD
Sbjct: 721  SLEQIPQTLSSSGRFDFHVQLAAPATSERGAILKHEIQKRLLDCSEDILLNLAAKCEGYD 780

Query: 778  AYDLEILVDRTVHAAVGRYLHSDSSFEKHIKPTLVRDDFSQAMHEFLPVAMRDITKTSAE 837
            AYDLEILVDR VHAA+GR+L  +S+  K+    LV++DF++AMH+F+PVAMRDITK+++E
Sbjct: 781  AYDLEILVDRAVHAAIGRHLPLESNISKY---NLVKEDFTRAMHDFVPVAMRDITKSASE 837

Query: 838  GGRSGWDDVGGLTDIQNAIKEMIELPSKFPNIFAQAPLRLRSNVLLYGPPGCGKTHIVGA 897
            GGR GW+DVGG+TDI+NAIKEMIELPSKFP IFA++PLRLRSNVLLYGPPGCGKTHIVGA
Sbjct: 838  GGRLGWEDVGGVTDIKNAIKEMIELPSKFPKIFAKSPLRLRSNVLLYGPPGCGKTHIVGA 897

Query: 898  AAAACSLRFISVKGPELLNKYIGASEQAVRDIFSKATAAAPCLLFFDEFDSIAPKRGHDN 957
            AAAACSLRFISVKGPELLNKYIGASEQAVRDIFSKA AAAPC+LFFDEFDSIAPKRGHDN
Sbjct: 898  AAAACSLRFISVKGPELLNKYIGASEQAVRDIFSKAAAAAPCILFFDEFDSIAPKRGHDN 957

Query: 958  TGVTDRVVNQVSSTSYLFIIYFWEVGKKEGVVPYDIYILVNFLISACPCFQQFLTELDGV 1017
            TGVTDRVVN                                          QFLTELDGV
Sbjct: 958  TGVTDRVVN------------------------------------------QFLTELDGV 975

Query: 1018 EVLTGVFVFAATR---------LEFFHYNVLLFCSF 1044
            EVLTGVFVFAAT          L     + LL C F
Sbjct: 976  EVLTGVFVFAATSRPDLLDPALLRPGRLDRLLLCDF 1011
Involved in PTS1- and PTS2-dependent protein import into peroxisomes. May form heteromeric AAA ATPase complexes required for the import of proteins.
Arabidopsis thaliana (taxid: 3702)
>sp|O43933|PEX1_HUMAN Peroxisome biogenesis factor 1 OS=Homo sapiens GN=PEX1 PE=1 SV=1 Back     alignment and function description
>sp|Q5BL07|PEX1_MOUSE Peroxisome biogenesis factor 1 OS=Mus musculus GN=Pex1 PE=1 SV=2 Back     alignment and function description
>sp|Q54GX5|PEX1_DICDI Peroxisome biogenesis factor 1 OS=Dictyostelium discoideum GN=pex1 PE=3 SV=1 Back     alignment and function description
>sp|P46463|PEX1_PICPA Peroxisome biosynthesis protein PAS1 OS=Komagataella pastoris GN=PEX1 PE=3 SV=1 Back     alignment and function description
>sp|P24004|PEX1_YEAST Peroxisomal ATPase PEX1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PEX1 PE=1 SV=2 Back     alignment and function description
>sp|O05209|VAT_THEAC VCP-like ATPase OS=Thermoplasma acidophilum (strain ATCC 25905 / DSM 1728 / JCM 9062 / NBRC 15155 / AMRC-C165) GN=vat PE=1 SV=1 Back     alignment and function description
>sp|Q9HPF0|CDCH_HALSA Protein CdcH OS=Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) GN=cdcH PE=3 SV=1 Back     alignment and function description
>sp|O28972|Y1297_ARCFU Cell division cycle protein 48 homolog AF_1297 OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=AF_1297 PE=3 SV=1 Back     alignment and function description
>sp|P32794|AFG2_YEAST ATPase family gene 2 protein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=AFG2 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query1052
2254651331134 PREDICTED: peroxisome biogenesis protein 0.950 0.881 0.663 0.0
2555530551137 peroxisome biogenesis factor, putative [ 0.946 0.875 0.656 0.0
3021432451114 unnamed protein product [Vitis vinifera] 0.931 0.879 0.657 0.0
3565216041130 PREDICTED: peroxisome biogenesis protein 0.942 0.876 0.6 0.0
4494876821123 PREDICTED: peroxisome biogenesis protein 0.926 0.868 0.565 0.0
2978068911122 peroxisome biogenesis protein PEX1 [Arab 0.940 0.881 0.576 0.0
306824051130 peroxisome 1 [Arabidopsis thaliana] gi|3 0.937 0.872 0.571 0.0
120062721119 peroxisome biogenesis protein PEX1 [Arab 0.937 0.881 0.571 0.0
97593411125 unnamed protein product [Arabidopsis tha 0.937 0.876 0.571 0.0
2420818731094 hypothetical protein SORBIDRAFT_07g02447 0.906 0.872 0.471 0.0
>gi|225465133|ref|XP_002273767.1| PREDICTED: peroxisome biogenesis protein 1-like [Vitis vinifera] Back     alignment and taxonomy information
 Score = 1362 bits (3524), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 701/1056 (66%), Positives = 818/1056 (77%), Gaps = 56/1056 (5%)

Query: 1    MELEVRVVGGVENCFVSLPLKLIETLESTRSAHLLPQVLSLELRSRSNQRWVVAWSGATS 60
            MEL VR VGG+E+CFVSLPL LI+TL+ST S  LLP VL+LELRS +N  WVVAWSG+ S
Sbjct: 1    MELAVRTVGGIESCFVSLPLPLIQTLQSTSSG-LLPPVLALELRSSNNDVWVVAWSGSAS 59

Query: 61   SSSFIEVARQFAECISLADHTIVQVRVVSNVLKATLVTIEPLTEDDWEVLELNSEHAEAA 120
            +SS IEVARQFAECISL DHT VQVR V+N+ KATLVTIEP TEDDWEVLELN+EHAEAA
Sbjct: 60   TSSSIEVARQFAECISLPDHTAVQVRAVANLPKATLVTIEPHTEDDWEVLELNAEHAEAA 119

Query: 121  ILNQVRIVHEAMRFPLWLHGRTIITFHVVSTFPKKPVVQLVPGTEVAVAPKRRKNNVKKH 180
            IL Q+ IVHEAMRFPLWLHGRT ITF VVSTFPKK VVQLVPGTEVAVAPKRRK  +  H
Sbjct: 120  ILKQIGIVHEAMRFPLWLHGRTTITFLVVSTFPKKAVVQLVPGTEVAVAPKRRKKYLDSH 179

Query: 181  EDSYMQAFNESTSIAKALLRVQDSDEGLSHKCNVKGVELGVALTSVAFINPETAENVSLC 240
            +++ +Q+ N+   IAKALLRVQDS + L HK  VKGVELGV LT+V +I+PETA N S  
Sbjct: 180  KNALVQSSNKDHPIAKALLRVQDSGQKLIHKSEVKGVELGVVLTNVVYIHPETARNYSFD 239

Query: 241  SLELVAILPRLSSKENNPENNAPRIKSNLTSKEISGGASTDKKECRQAVVHLLFSDSVAK 300
            SL+LV ++PR  SK N  + +  R KS  T+KE S G + DKKE  Q VV LL S+SVAK
Sbjct: 240  SLQLVILVPRSPSKGNYNDTDMFRKKSISTAKEFSDGLA-DKKEPCQVVVRLLISESVAK 298

Query: 301  GHVKIARALRLYLNAGLHSWVYLKKCTVNLKKEIPMVSLSPCHFKMLEKDKAFG-IGLE- 358
            GHV +A++LR YL  GLHSWVY+K+C +NLKKEI ++SLSPC FKM EK+KA    GLE 
Sbjct: 299  GHVMMAQSLRHYLRTGLHSWVYMKRCDINLKKEISLLSLSPCQFKMFEKNKALEENGLEV 358

Query: 359  LDN-KNHKTKKMLEKTSSGIYMDDGDLSAEDDIIAALSSEPSSKEDEEAVYQFENKKGLE 417
            LD+  NHKTK ML +T+S  YM+  D S  ++  AALS E    EDE+   Q  ++KGL+
Sbjct: 359  LDSLTNHKTKSMLLETNSDTYMNISDWSTHEEFAAALSFESPGSEDEKTSSQSGSRKGLQ 418

Query: 418  CLLHTWLLAQLTAVASNIGSEFNTLVLSNETLLHFEVKGYKSGTYGKVPASCNGALENKT 477
             LL  W LA L A+ SN G+E ++LV+ NETLLHF V   K GT GK  AS NG+ +N++
Sbjct: 419  SLLQAWFLAHLDAINSNAGTEIDSLVVGNETLLHFNVTSDKFGTLGKFQASSNGSSKNRS 478

Query: 478  KARELRTEIFCVLTFSEESLHGGKNNAYELTLEARGQQNNNTEAVRQLFGKLNSGDSVSF 537
               +L  EI  +L  SEES H GK NAYEL+   R ++NNN   +  L G L  G+ VSF
Sbjct: 479  SYGDLSVEILYILAISEESQHSGKFNAYELSFPERNKRNNNLGNLELLVGNLRLGEPVSF 538

Query: 538  YTVKERGSTQGFDSNVSSLSWMGTTASDVINRIKVLLSPDSGLWFSTYHLPLPGHILIHG 597
            Y +KER S +GF    SSLSW+GT ASD+INR+  LLSP SG+WFSTY+LPLPGH+LI+G
Sbjct: 539  YCMKERTSAKGFSLTASSLSWIGTAASDIINRLTTLLSPASGMWFSTYNLPLPGHVLIYG 598

Query: 598  PPGSGKTSLAKAVAKSLEHHKDLVAHIVFVCCSRLSLEKGPIIRQALSNFISEALDHAPS 657
            PPGSGKT LA+ VAK+LE  +DL+ HIVFV CS+L+LEK   IRQALS+++S+ALDH PS
Sbjct: 599  PPGSGKTLLARTVAKALEEQEDLLTHIVFVSCSQLALEKAVTIRQALSSYLSDALDHVPS 658

Query: 658  IVIFDNLDSIISSSSDPEGSQPSTSVIALTKFLVDIMDEYGEKRKSSCGIGPIAFVASAQ 717
            +VIFD+LD IISSSSD EGSQPSTSV ALT++L DI+DEYGEKRK+SCGIGP+AF+ASAQ
Sbjct: 659  LVIFDDLDLIISSSSDLEGSQPSTSVTALTEYLTDILDEYGEKRKNSCGIGPLAFIASAQ 718

Query: 718  SLEKIPQSLTSSGRFDFHVQLPAPAASERKAILEHEIQRRSLECSDEILLDVASKCDGYD 777
            SLE +PQSL+SSGRFDFHVQLPAPAA+ER AIL+HEIQ+RSL+C+D+IL DVASKCDGYD
Sbjct: 719  SLENVPQSLSSSGRFDFHVQLPAPAATERMAILKHEIQKRSLQCADDILSDVASKCDGYD 778

Query: 778  AYDLEILVDRTVHAAVGRYLHSDSSFEKHIKPTLVRDDFSQAMHEFLPVAMRDITKTSAE 837
            AYDLEILVDRT+HAA+GR+  S+S+F+K  KPTLVRDDFSQAMHEFLPVAMRDITK+++E
Sbjct: 779  AYDLEILVDRTIHAAIGRFFPSNSAFDKSEKPTLVRDDFSQAMHEFLPVAMRDITKSASE 838

Query: 838  GGRSGWDDVGGLTDIQNAIKEMIELPSKFPNIFAQAPLRLRSNVLLYGPPGCGKTHIVGA 897
            GGRSGW+DVGGL DI+NAIKEMIELPSKFP+IFAQ+PLRLRSNVLLYGPPGCGKTHIVGA
Sbjct: 839  GGRSGWEDVGGLVDIRNAIKEMIELPSKFPSIFAQSPLRLRSNVLLYGPPGCGKTHIVGA 898

Query: 898  AAAACSLRFISVKGPELLNKYIGASEQAVRDIFSKATAAAPCLLFFDEFDSIAPKRGHDN 957
            AAAACSLRFISVKGPELLNKYIGASEQAVRDIF KA+AA+PCLLFFDEFDSIAPKRGHDN
Sbjct: 899  AAAACSLRFISVKGPELLNKYIGASEQAVRDIFLKASAASPCLLFFDEFDSIAPKRGHDN 958

Query: 958  TGVTDRVVNQVSSTSYLFIIYFWEVGKKEGVVPYDIYILVNFLISACPCFQQFLTELDGV 1017
            TGVTDRVVN                                          QFLTELDGV
Sbjct: 959  TGVTDRVVN------------------------------------------QFLTELDGV 976

Query: 1018 EVLTGVFVFAATR---------LEFFHYNVLLFCSF 1044
            EVLTGVFVFAAT          L     + LLFC F
Sbjct: 977  EVLTGVFVFAATSRPDLLDAALLRPGRLDRLLFCDF 1012

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|255553055|ref|XP_002517570.1| peroxisome biogenesis factor, putative [Ricinus communis] gi|223543202|gb|EEF44734.1| peroxisome biogenesis factor, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|302143245|emb|CBI20540.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|356521604|ref|XP_003529444.1| PREDICTED: peroxisome biogenesis protein 1-like [Glycine max] Back     alignment and taxonomy information
>gi|449487682|ref|XP_004157748.1| PREDICTED: peroxisome biogenesis protein 1-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|297806891|ref|XP_002871329.1| peroxisome biogenesis protein PEX1 [Arabidopsis lyrata subsp. lyrata] gi|297317166|gb|EFH47588.1| peroxisome biogenesis protein PEX1 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|30682405|ref|NP_196464.2| peroxisome 1 [Arabidopsis thaliana] gi|322967561|sp|Q9FNP1.2|PEX1_ARATH RecName: Full=Peroxisome biogenesis protein 1; AltName: Full=Peroxin-1; Short=AtPEX1 gi|332003924|gb|AED91307.1| peroxisome 1 [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|12006272|gb|AAG44817.1| peroxisome biogenesis protein PEX1 [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|9759341|dbj|BAB09996.1| unnamed protein product [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|242081873|ref|XP_002445705.1| hypothetical protein SORBIDRAFT_07g024470 [Sorghum bicolor] gi|241942055|gb|EES15200.1| hypothetical protein SORBIDRAFT_07g024470 [Sorghum bicolor] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query1052
TAIR|locus:21595571130 PEX1 "peroxisome 1" [Arabidops 0.902 0.839 0.583 9.3e-297
DICTYBASE|DDB_G0289867 1227 pex1 "peroxisomal biogenesis f 0.243 0.208 0.435 6.7e-82
MGI|MGI:1918632 1284 Pex1 "peroxisomal biogenesis f 0.382 0.313 0.372 2.9e-79
UNIPROTKB|O43933 1283 PEX1 "Peroxisome biogenesis fa 0.345 0.282 0.405 1.4e-78
RGD|1559939 1283 Pex1 "peroxisomal biogenesis f 0.345 0.282 0.387 2.6e-78
UNIPROTKB|E1BY08 1290 PEX1 "Uncharacterized protein" 0.344 0.280 0.409 8.8e-78
UNIPROTKB|E1BPU3 1281 PEX1 "Uncharacterized protein" 0.345 0.283 0.395 2.4e-77
UNIPROTKB|E2RLT2 1267 PEX1 "Uncharacterized protein" 0.345 0.286 0.392 5.5e-77
ZFIN|ZDB-GENE-070530-1 1237 pex1 "peroxisome biogenesis fa 0.339 0.288 0.397 7.4e-77
UNIPROTKB|E2RCK9 1416 PEX1 "Uncharacterized protein" 0.345 0.256 0.392 5.3e-75
TAIR|locus:2159557 PEX1 "peroxisome 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 2771 (980.5 bits), Expect = 9.3e-297, Sum P(2) = 9.3e-297
 Identities = 567/972 (58%), Positives = 710/972 (73%)

Query:     1 MELE--VRVVGGVENCFVSLPLKLIETLESTRSAHLLPQVLSLELRSRSNQRWVVAWSGA 58
             ME E  V  V GV+ CFVSLP +L+  L+ST S+ L P +L +ELRS  ++RW VAWSG+
Sbjct:    14 METEAVVNTVAGVD-CFVSLPRQLLHALQSTSSSPL-PPLLPVELRS-GDRRWSVAWSGS 70

Query:    59 TSSSSFIEVARQFAECISLADHTIVQVRVVSNVLKATLVTIEPLTEDDWEVLELNSEHAE 118
             +SSSS IE+AR FAE ISL D T+V+VRV+ NV KATLVT+EP TEDDWEVLELN+E AE
Sbjct:    71 SSSSSAIEIARVFAESISLPDGTVVKVRVLPNVPKATLVTVEPETEDDWEVLELNAELAE 130

Query:   119 AAILNQVRIVHEAMRFPLWLHGRTIITFHVVSTFPKKPVVQLVPGTEVAVAPKRRKNNVK 178
             AAIL+QVRI+HE M+FPLWLH RT+I F VVSTFP K VVQLVPGTEVAVAPKRR  N+K
Sbjct:   131 AAILSQVRILHETMKFPLWLHDRTVIRFSVVSTFPSKGVVQLVPGTEVAVAPKRRDRNLK 190

Query:   179 KHEDSYMQAFNESTSIAKALLRVQDSDEGLSHKCNVKGVELGVALTSVAFINPETAENVS 238
               +    +  N      KALLRVQ++D    H+ +VKG EL VALTS+A+I+PETA+  S
Sbjct:   191 AKKSQEKECNN-----VKALLRVQETDRSAFHEADVKGFELRVALTSIAYIHPETAKKHS 245

Query:   239 LCSLELVAILPRLSSKENNPENNAPRIKSNLTSKEISGGASTDKKECRQAVVHLLFSDSV 298
             L SL+L+++ PR+  K +  ++ A  +K++  SK    G S+ KKE RQA++ L+FSD  
Sbjct:   246 LESLQLISVSPRIPLKGSAKKDEALNMKNSEASKVAENGTSSAKKEPRQAILRLVFSDLA 305

Query:   299 AKGHVKIARALRLYLNAGLHSWVYLKKCTVNLKKEIPMVSLSPCHFKMLEKDKAFGIGLE 358
             AKGH+ +  +LRLYL AGLHSWVYL+ C VN  KEIP +SLSPC FK+ E +K    G +
Sbjct:   306 AKGHLMMVESLRLYLGAGLHSWVYLRGCNVNEDKEIPALSLSPCVFKISENEKVLDKGTD 365

Query:   359 -LDNKNHKTKKMLEKTSSGIYMDDGDLSAEDDIIAALSSEPSSKEDEEAVYQFENKKGLE 417
              L N N   K     +    Y+D  D S  D ++ ALSSE    E        +NKKGLE
Sbjct:   366 RLGNNNSVRKSSHPPSGLSTYVDVVDWSVHDKVVTALSSEGLHDEGNHD----KNKKGLE 421

Query:   418 CLLHTWLLAQLTAVASNIGSEFNTLVLSNETLLHFEVKGYKSGTYGKVPA--SCNGALEN 475
              L   W LAQL A+AS  G + ++L++  ET  HFEV+G +S  Y  +    S N   E+
Sbjct:   422 YLTRLWSLAQLDAMASVTGVDVSSLIVGRETFFHFEVRGLES--YKSIDGQPSVNDRWES 479

Query:   476 KTKARELRTEIFCVLTFSEESLHGGKNNAYELTLEARGQQNNNTEAVRQLFGKLNSGDSV 535
               K +    EI  V+T S+ESL G K   Y+L+L+ R ++++N   +  +  K+N G+ +
Sbjct:   480 GKKDKHTPLEILYVMTVSDESLLGDKFAGYDLSLD-RSEKSDNVVHIEPVLEKMNLGEPI 538

Query:   536 SFYTVKERGSTQGFDSNVSSLSWMGTTASDVINRIKVLLSPDSGLWFSTYHLPLPGHILI 595
                + KE    +G   ++SSL+WMG   SDVI R+ VLLSP +G+WFS + +P PGHILI
Sbjct:   539 YLKSAKETHCNKGVSPDISSLTWMGPIVSDVIKRMTVLLSPAAGMWFSKFKIPSPGHILI 598

Query:   596 HGPPGSGKTSLAKAVAKSLEHHKDLVAHIVFVCCSRLSLEKGPIIRQALSNFISEALDHA 655
             +GPPGSGKT LA+A AK  E  KDL+AH++ V CS L+LEK   I   LS+ I+E L+HA
Sbjct:   599 YGPPGSGKTILARAAAKYFEEQKDLLAHVILVSCSTLALEKVQHIHHVLSSVIAEGLEHA 658

Query:   656 PSIVIFDNLXXXXXXXXXXXXXXXXXXVIALTKFLVDIMDEYGEKRKSSCGIGPIAFVAS 715
             PS++I D+L                  V  LTKFL D++D+YGE R SSCGIGP+AFVAS
Sbjct:   659 PSVIILDDLDSIISSSSDTEGTQASVGVTMLTKFLTDVIDDYGEYRNSSCGIGPLAFVAS 718

Query:   716 AQSLEKIPQSLTSSGRFDFHVQLPAPAASERKAILEHEIQRRSLECSDEILLDVASKCDG 775
              QSLE+IPQ+L+SSGRFDFHVQL APA SER AIL+HEIQ+R L+CS++ILL++A+KC+G
Sbjct:   719 VQSLEQIPQTLSSSGRFDFHVQLAAPATSERGAILKHEIQKRLLDCSEDILLNLAAKCEG 778

Query:   776 YDAYDLEILVDRTVHAAVGRYLHSDSSFEKHIKPTLVRDDFSQAMHEFLPVAMRDITKTS 835
             YDAYDLEILVDR VHAA+GR+L  +S+  K+    LV++DF++AMH+F+PVAMRDITK++
Sbjct:   779 YDAYDLEILVDRAVHAAIGRHLPLESNISKY---NLVKEDFTRAMHDFVPVAMRDITKSA 835

Query:   836 AEGGRSGWDDVGGLTDIQNAIKEMIELPSKFPNIFAQAPLRLRSNVLLYGPPGCGKTHIV 895
             +EGGR GW+DVGG+TDI+NAIKEMIELPSKFP IFA++PLRLRSNVLLYGPPGCGKTHIV
Sbjct:   836 SEGGRLGWEDVGGVTDIKNAIKEMIELPSKFPKIFAKSPLRLRSNVLLYGPPGCGKTHIV 895

Query:   896 GAAAAACSLRFISVKGPELLNKYIGASEQAVRDIFSKATAAAPCLLFFDEFDSIAPKRGH 955
             GAAAAACSLRFISVKGPELLNKYIGASEQAVRDIFSKA AAAPC+LFFDEFDSIAPKRGH
Sbjct:   896 GAAAAACSLRFISVKGPELLNKYIGASEQAVRDIFSKAAAAAPCILFFDEFDSIAPKRGH 955

Query:   956 DNTGVTDRVVNQ 967
             DNTGVTDRVVNQ
Sbjct:   956 DNTGVTDRVVNQ 967
GO:0000166 "nucleotide binding" evidence=IEA
GO:0005524 "ATP binding" evidence=IEA
GO:0005886 "plasma membrane" evidence=ISM
GO:0007031 "peroxisome organization" evidence=IEA;RCA
GO:0016887 "ATPase activity" evidence=ISS
GO:0017111 "nucleoside-triphosphatase activity" evidence=IEA
GO:0006635 "fatty acid beta-oxidation" evidence=RCA;IMP
GO:0016558 "protein import into peroxisome matrix" evidence=RCA;IMP
GO:0005515 "protein binding" evidence=IPI
DICTYBASE|DDB_G0289867 pex1 "peroxisomal biogenesis factor 1" [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms
MGI|MGI:1918632 Pex1 "peroxisomal biogenesis factor 1" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|O43933 PEX1 "Peroxisome biogenesis factor 1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
RGD|1559939 Pex1 "peroxisomal biogenesis factor 1" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|E1BY08 PEX1 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|E1BPU3 PEX1 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|E2RLT2 PEX1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-070530-1 pex1 "peroxisome biogenesis factor 1" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|E2RCK9 PEX1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q9FNP1PEX1_ARATHNo assigned EC number0.57100.93720.8725yesno

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer2.7.4LOW CONFIDENCE prediction!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query1052
TIGR01243 733 TIGR01243, CDC48, AAA family ATPase, CDC48 subfami 1e-59
COG0464494 COG0464, SpoVK, ATPases of the AAA+ class [Posttra 8e-58
pfam00004131 pfam00004, AAA, ATPase family associated with vari 4e-31
TIGR03689 512 TIGR03689, pup_AAA, proteasome ATPase 2e-30
TIGR01243 733 TIGR01243, CDC48, AAA family ATPase, CDC48 subfami 3e-29
COG1222406 COG1222, RPT1, ATP-dependent 26S proteasome regula 3e-29
pfam0926278 pfam09262, PEX-1N, Peroxisome biogenesis factor 1, 5e-27
PRK03992389 PRK03992, PRK03992, proteasome-activating nucleoti 1e-26
TIGR01242364 TIGR01242, 26Sp45, 26S proteasome subunit P45 fami 9e-26
PTZ00454398 PTZ00454, PTZ00454, 26S protease regulatory subuni 7e-25
COG0464494 COG0464, SpoVK, ATPases of the AAA+ class [Posttra 5e-21
PTZ00361438 PTZ00361, PTZ00361, 26 proteosome regulatory subun 6e-20
CHL00176 638 CHL00176, ftsH, cell division protein; Validated 1e-17
pfam00004131 pfam00004, AAA, ATPase family associated with vari 4e-17
COG1223368 COG1223, COG1223, Predicted ATPase (AAA+ superfami 4e-17
TIGR01241 495 TIGR01241, FtsH_fam, ATP-dependent metalloprotease 6e-17
COG0464 494 COG0464, SpoVK, ATPases of the AAA+ class [Posttra 9e-16
PRK10733 644 PRK10733, hflB, ATP-dependent metalloprotease; Rev 1e-15
cd00009151 cd00009, AAA, The AAA+ (ATPases Associated with a 5e-14
TIGR01243733 TIGR01243, CDC48, AAA family ATPase, CDC48 subfami 3e-12
cd00009151 cd00009, AAA, The AAA+ (ATPases Associated with a 1e-10
TIGR01241495 TIGR01241, FtsH_fam, ATP-dependent metalloprotease 5e-10
COG1222406 COG1222, RPT1, ATP-dependent 26S proteasome regula 7e-10
COG0465 596 COG0465, HflB, ATP-dependent Zn proteases [Posttra 9e-10
TIGR01242364 TIGR01242, 26Sp45, 26S proteasome subunit P45 fami 3e-08
smart00382148 smart00382, AAA, ATPases associated with a variety 3e-08
smart00382148 smart00382, AAA, ATPases associated with a variety 4e-08
PTZ00454398 PTZ00454, PTZ00454, 26S protease regulatory subuni 3e-07
PRK03992389 PRK03992, PRK03992, proteasome-activating nucleoti 5e-07
PRK10733644 PRK10733, hflB, ATP-dependent metalloprotease; Rev 1e-06
COG0465596 COG0465, HflB, ATP-dependent Zn proteases [Posttra 2e-06
TIGR03689512 TIGR03689, pup_AAA, proteasome ATPase 3e-06
PTZ00361438 PTZ00361, PTZ00361, 26 proteosome regulatory subun 4e-06
PRK00080328 PRK00080, ruvB, Holliday junction DNA helicase Ruv 6e-05
CHL00195489 CHL00195, ycf46, Ycf46; Provisional 9e-05
CHL00176638 CHL00176, ftsH, cell division protein; Validated 1e-04
pfam13481154 pfam13481, AAA_25, AAA domain 1e-04
pfam13191154 pfam13191, AAA_16, AAA ATPase domain 1e-04
pfam13401124 pfam13401, AAA_22, AAA domain 2e-04
pfam13207114 pfam13207, AAA_17, AAA domain 2e-04
COG1223368 COG1223, COG1223, Predicted ATPase (AAA+ superfami 4e-04
COG2255332 COG2255, RuvB, Holliday junction resolvasome, heli 5e-04
COG0593 408 COG0593, DnaA, ATPase involved in DNA replication 0.001
TIGR02928365 TIGR02928, TIGR02928, orc1/cdc6 family replication 0.001
PRK13342413 PRK13342, PRK13342, recombination factor protein R 0.001
pfam05496231 pfam05496, RuvB_N, Holliday junction DNA helicase 0.001
pfam07726131 pfam07726, AAA_3, ATPase family associated with va 0.001
PRK12402337 PRK12402, PRK12402, replication factor C small sub 0.002
COG0593408 COG0593, DnaA, ATPase involved in DNA replication 0.003
TIGR00635305 TIGR00635, ruvB, Holliday junction DNA helicase, R 0.004
COG0714329 COG0714, COG0714, MoxR-like ATPases [General funct 0.004
>gnl|CDD|233328 TIGR01243, CDC48, AAA family ATPase, CDC48 subfamily Back     alignment and domain information 
 Score =  218 bits (557), Expect = 1e-59
 Identities = 146/458 (31%), Positives = 220/458 (48%), Gaps = 90/458 (19%)

Query: 590  PGHILIHGPPGSGKTSLAKAVAKSLEHHKDLVAHIVFVCCSRLSLEKGPII--------R 641
            P  +L++GPPG+GKT LAKAVA          A   F+  +      GP I         
Sbjct: 212  PKGVLLYGPPGTGKTLLAKAVANE--------AGAYFISIN------GPEIMSKYYGESE 257

Query: 642  QALSNFISEALDHAPSIVIFDNLDSIISSSSDPEGSQPSTSVIALTKFLVDIMDEYGEKR 701
            + L     EA ++APSI+  D +D+I     +  G +    V+A    L+ +MD  G K 
Sbjct: 258  ERLREIFKEAEENAPSIIFIDEIDAIAPKREEVTG-EVEKRVVAQ---LLTLMD--GLK- 310

Query: 702  KSSCGIGPIAFVASAQSLEKIPQSLTSSGRFDFHVQLPAPAASERKAILEHEIQRRSLEC 761
                G G +  + +    + +  +L   GRFD  + +  P    RK IL+  +  R++  
Sbjct: 311  ----GRGRVIVIGATNRPDALDPALRRPGRFDREIVIRVPDKRARKEILK--VHTRNMPL 364

Query: 762  SDEILLD-VASKCDGYDAYDLEILVDRTVHAAVGRYLHSDS-SFEKHIKPTLV------- 812
            ++++ LD +A    G+   DL  L      AA+ R++     +FE    P  V       
Sbjct: 365  AEDVDLDKLAEVTHGFVGADLAALAKEAAMAALRRFIREGKINFEAEEIPAEVLKELKVT 424

Query: 813  RDDFSQAMHEFLPVAMRDITKTSAEGGRSGWDDVGGLTDIQNAIKEMIELPSKFPNIFAQ 872
              DF +A+    P A+R++     E     W D+GGL +++  ++E +E P K P IF +
Sbjct: 425  MKDFMEALKMVEPSAIREVL---VEVPNVRWSDIGGLEEVKQELREAVEWPLKHPEIFEK 481

Query: 873  APLRLRSNVLLYGPPGCGKTHIVGAAAAACSLRFISVKGPELLNKYIGASEQAVRDIFSK 932
              +R    VLL+GPPG GKT +  A A      FI+V+GPE+L+K++G SE+A+R+IF K
Sbjct: 482  MGIRPPKGVLLFGPPGTGKTLLAKAVATESGANFIAVRGPEILSKWVGESEKAIREIFRK 541

Query: 933  ATAAAPCLLFFDEFDSIAPKRGHD-NTGVTDRVVNQVSSTSYLFIIYFWEVGKKEGVVPY 991
            A  AAP ++FFDE D+IAP RG   +T VTDR+VNQ+                       
Sbjct: 542  ARQAAPAIIFFDEIDAIAPARGARFDTSVTDRIVNQL----------------------- 578

Query: 992  DIYILVNFLISACPCFQQFLTELDGVEVLTGVFVFAAT 1029
                               LTE+DG++ L+ V V AAT
Sbjct: 579  -------------------LTEMDGIQELSNVVVIAAT 597

This subfamily of the AAA family ATPases includes two members each from three archaeal species. It also includes yeast CDC48 (cell division control protein 48) and the human ortholog, transitional endoplasmic reticulum ATPase (valosin-containing protein). These proteins in eukaryotes are involved in the budding and transfer of membrane from the transitional endoplasmic reticulum to the Golgi apparatus. Length = 733
>gnl|CDD|223540 COG0464, SpoVK, ATPases of the AAA+ class [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|215649 pfam00004, AAA, ATPase family associated with various cellular activities (AAA) Back     alignment and domain information
>gnl|CDD|200312 TIGR03689, pup_AAA, proteasome ATPase Back     alignment and domain information
>gnl|CDD|233328 TIGR01243, CDC48, AAA family ATPase, CDC48 subfamily Back     alignment and domain information
>gnl|CDD|224143 COG1222, RPT1, ATP-dependent 26S proteasome regulatory subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|220158 pfam09262, PEX-1N, Peroxisome biogenesis factor 1, N-terminal Back     alignment and domain information
>gnl|CDD|179699 PRK03992, PRK03992, proteasome-activating nucleotidase; Provisional Back     alignment and domain information
>gnl|CDD|130309 TIGR01242, 26Sp45, 26S proteasome subunit P45 family Back     alignment and domain information
>gnl|CDD|240423 PTZ00454, PTZ00454, 26S protease regulatory subunit 6B-like protein; Provisional Back     alignment and domain information
>gnl|CDD|223540 COG0464, SpoVK, ATPases of the AAA+ class [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|185575 PTZ00361, PTZ00361, 26 proteosome regulatory subunit 4-like protein; Provisional Back     alignment and domain information
>gnl|CDD|214386 CHL00176, ftsH, cell division protein; Validated Back     alignment and domain information
>gnl|CDD|215649 pfam00004, AAA, ATPase family associated with various cellular activities (AAA) Back     alignment and domain information
>gnl|CDD|224144 COG1223, COG1223, Predicted ATPase (AAA+ superfamily) [General function prediction only] Back     alignment and domain information
>gnl|CDD|233327 TIGR01241, FtsH_fam, ATP-dependent metalloprotease FtsH Back     alignment and domain information
>gnl|CDD|223540 COG0464, SpoVK, ATPases of the AAA+ class [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|182683 PRK10733, hflB, ATP-dependent metalloprotease; Reviewed Back     alignment and domain information
>gnl|CDD|99707 cd00009, AAA, The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold Back     alignment and domain information
>gnl|CDD|233328 TIGR01243, CDC48, AAA family ATPase, CDC48 subfamily Back     alignment and domain information
>gnl|CDD|99707 cd00009, AAA, The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold Back     alignment and domain information
>gnl|CDD|233327 TIGR01241, FtsH_fam, ATP-dependent metalloprotease FtsH Back     alignment and domain information
>gnl|CDD|224143 COG1222, RPT1, ATP-dependent 26S proteasome regulatory subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|223541 COG0465, HflB, ATP-dependent Zn proteases [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|130309 TIGR01242, 26Sp45, 26S proteasome subunit P45 family Back     alignment and domain information
>gnl|CDD|214640 smart00382, AAA, ATPases associated with a variety of cellular activities Back     alignment and domain information
>gnl|CDD|214640 smart00382, AAA, ATPases associated with a variety of cellular activities Back     alignment and domain information
>gnl|CDD|240423 PTZ00454, PTZ00454, 26S protease regulatory subunit 6B-like protein; Provisional Back     alignment and domain information
>gnl|CDD|179699 PRK03992, PRK03992, proteasome-activating nucleotidase; Provisional Back     alignment and domain information
>gnl|CDD|182683 PRK10733, hflB, ATP-dependent metalloprotease; Reviewed Back     alignment and domain information
>gnl|CDD|223541 COG0465, HflB, ATP-dependent Zn proteases [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|200312 TIGR03689, pup_AAA, proteasome ATPase Back     alignment and domain information
>gnl|CDD|185575 PTZ00361, PTZ00361, 26 proteosome regulatory subunit 4-like protein; Provisional Back     alignment and domain information
>gnl|CDD|234619 PRK00080, ruvB, Holliday junction DNA helicase RuvB; Reviewed Back     alignment and domain information
>gnl|CDD|177094 CHL00195, ycf46, Ycf46; Provisional Back     alignment and domain information
>gnl|CDD|214386 CHL00176, ftsH, cell division protein; Validated Back     alignment and domain information
>gnl|CDD|222165 pfam13481, AAA_25, AAA domain Back     alignment and domain information
>gnl|CDD|221970 pfam13191, AAA_16, AAA ATPase domain Back     alignment and domain information
>gnl|CDD|222104 pfam13401, AAA_22, AAA domain Back     alignment and domain information
>gnl|CDD|221983 pfam13207, AAA_17, AAA domain Back     alignment and domain information
>gnl|CDD|224144 COG1223, COG1223, Predicted ATPase (AAA+ superfamily) [General function prediction only] Back     alignment and domain information
>gnl|CDD|225164 COG2255, RuvB, Holliday junction resolvasome, helicase subunit [DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|223666 COG0593, DnaA, ATPase involved in DNA replication initiation [DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|234063 TIGR02928, TIGR02928, orc1/cdc6 family replication initiation protein Back     alignment and domain information
>gnl|CDD|237355 PRK13342, PRK13342, recombination factor protein RarA; Reviewed Back     alignment and domain information
>gnl|CDD|203260 pfam05496, RuvB_N, Holliday junction DNA helicase ruvB N-terminus Back     alignment and domain information
>gnl|CDD|116340 pfam07726, AAA_3, ATPase family associated with various cellular activities (AAA) Back     alignment and domain information
>gnl|CDD|237090 PRK12402, PRK12402, replication factor C small subunit 2; Reviewed Back     alignment and domain information
>gnl|CDD|223666 COG0593, DnaA, ATPase involved in DNA replication initiation [DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|129721 TIGR00635, ruvB, Holliday junction DNA helicase, RuvB subunit Back     alignment and domain information
>gnl|CDD|223786 COG0714, COG0714, MoxR-like ATPases [General function prediction only] Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 1052
KOG0735 952 consensus AAA+-type ATPase [Posttranslational modi 100.0
KOG0733 802 consensus Nuclear AAA ATPase (VCP subfamily) [Post 100.0
KOG0730693 consensus AAA+-type ATPase [Posttranslational modi 100.0
KOG0736 953 consensus Peroxisome assembly factor 2 containing 100.0
TIGR01243 733 CDC48 AAA family ATPase, CDC48 subfamily. This sub 100.0
COG0464494 SpoVK ATPases of the AAA+ class [Posttranslational 100.0
COG1222406 RPT1 ATP-dependent 26S proteasome regulatory subun 100.0
KOG0741744 consensus AAA+-type ATPase [Posttranslational modi 100.0
COG1222406 RPT1 ATP-dependent 26S proteasome regulatory subun 100.0
KOG0730693 consensus AAA+-type ATPase [Posttranslational modi 100.0
KOG0733802 consensus Nuclear AAA ATPase (VCP subfamily) [Post 100.0
KOG0727408 consensus 26S proteasome regulatory complex, ATPas 99.98
CHL00195489 ycf46 Ycf46; Provisional 99.98
KOG0728404 consensus 26S proteasome regulatory complex, ATPas 99.97
KOG0734 752 consensus AAA+-type ATPase containing the peptidas 99.97
KOG0734752 consensus AAA+-type ATPase containing the peptidas 99.97
KOG0726440 consensus 26S proteasome regulatory complex, ATPas 99.97
KOG0729435 consensus 26S proteasome regulatory complex, ATPas 99.97
KOG0738491 consensus AAA+-type ATPase [Posttranslational modi 99.97
KOG0732 1080 consensus AAA+-type ATPase containing the bromodom 99.97
KOG0739 439 consensus AAA+-type ATPase [Posttranslational modi 99.97
TIGR02639731 ClpA ATP-dependent Clp protease ATP-binding subuni 99.96
KOG0652424 consensus 26S proteasome regulatory complex, ATPas 99.96
KOG0736953 consensus Peroxisome assembly factor 2 containing 99.96
KOG0738 491 consensus AAA+-type ATPase [Posttranslational modi 99.96
KOG0739439 consensus AAA+-type ATPase [Posttranslational modi 99.96
CHL00195489 ycf46 Ycf46; Provisional 99.96
PF0926280 PEX-1N: Peroxisome biogenesis factor 1, N-terminal 99.96
PTZ00454398 26S protease regulatory subunit 6B-like protein; P 99.96
KOG0728404 consensus 26S proteasome regulatory complex, ATPas 99.96
KOG0731774 consensus AAA+-type ATPase containing the peptidas 99.96
PRK11034758 clpA ATP-dependent Clp protease ATP-binding subuni 99.96
KOG0652424 consensus 26S proteasome regulatory complex, ATPas 99.95
KOG0727408 consensus 26S proteasome regulatory complex, ATPas 99.95
KOG0731 774 consensus AAA+-type ATPase containing the peptidas 99.95
KOG0737386 consensus AAA+-type ATPase [Posttranslational modi 99.95
COG1223368 Predicted ATPase (AAA+ superfamily) [General funct 99.95
PRK03992389 proteasome-activating nucleotidase; Provisional 99.95
KOG0726440 consensus 26S proteasome regulatory complex, ATPas 99.95
COG1223368 Predicted ATPase (AAA+ superfamily) [General funct 99.95
PTZ00361438 26 proteosome regulatory subunit 4-like protein; P 99.94
COG0464494 SpoVK ATPases of the AAA+ class [Posttranslational 99.94
TIGR01243733 CDC48 AAA family ATPase, CDC48 subfamily. This sub 99.94
KOG0735952 consensus AAA+-type ATPase [Posttranslational modi 99.94
KOG0651388 consensus 26S proteasome regulatory complex, ATPas 99.94
TIGR03689 512 pup_AAA proteasome ATPase. In the Actinobacteria, 99.94
PTZ00454398 26S protease regulatory subunit 6B-like protein; P 99.93
TIGR01241495 FtsH_fam ATP-dependent metalloprotease FtsH. HflB( 99.93
KOG0729435 consensus 26S proteasome regulatory complex, ATPas 99.93
COG0465 596 HflB ATP-dependent Zn proteases [Posttranslational 99.93
COG0465596 HflB ATP-dependent Zn proteases [Posttranslational 99.93
CHL00176638 ftsH cell division protein; Validated 99.93
TIGR03345852 VI_ClpV1 type VI secretion ATPase, ClpV1 family. M 99.93
KOG0737 386 consensus AAA+-type ATPase [Posttranslational modi 99.93
PRK03992389 proteasome-activating nucleotidase; Provisional 99.93
TIGR01242364 26Sp45 26S proteasome subunit P45 family. Many pro 99.93
CHL00095821 clpC Clp protease ATP binding subunit 99.92
TIGR03689512 pup_AAA proteasome ATPase. In the Actinobacteria, 99.92
PLN00020 413 ribulose bisphosphate carboxylase/oxygenase activa 99.92
COG0542786 clpA ATP-binding subunits of Clp protease and DnaK 99.92
CHL00206 2281 ycf2 Ycf2; Provisional 99.92
PTZ00361438 26 proteosome regulatory subunit 4-like protein; P 99.92
KOG0732 1080 consensus AAA+-type ATPase containing the bromodom 99.91
KOG0740428 consensus AAA+-type ATPase [Posttranslational modi 99.91
TIGR01241 495 FtsH_fam ATP-dependent metalloprotease FtsH. HflB( 99.91
TIGR03346 852 chaperone_ClpB ATP-dependent chaperone ClpB. Membe 99.91
KOG0741 744 consensus AAA+-type ATPase [Posttranslational modi 99.9
PRK10733644 hflB ATP-dependent metalloprotease; Reviewed 99.9
KOG0651388 consensus 26S proteasome regulatory complex, ATPas 99.9
PLN00020413 ribulose bisphosphate carboxylase/oxygenase activa 99.89
PRK10865 857 protein disaggregation chaperone; Provisional 99.89
TIGR01242364 26Sp45 26S proteasome subunit P45 family. Many pro 99.89
KOG0740 428 consensus AAA+-type ATPase [Posttranslational modi 99.89
CHL00176 638 ftsH cell division protein; Validated 99.88
CHL00206 2281 ycf2 Ycf2; Provisional 99.86
PRK10733 644 hflB ATP-dependent metalloprotease; Reviewed 99.85
TIGR02881261 spore_V_K stage V sporulation protein K. Members o 99.79
PF00004132 AAA: ATPase family associated with various cellula 99.78
CHL00181287 cbbX CbbX; Provisional 99.76
TIGR02880284 cbbX_cfxQ probable Rubsico expression protein CbbX 99.75
PF0926387 PEX-2N: Peroxisome biogenesis factor 1, N-terminal 99.74
PF00004132 AAA: ATPase family associated with various cellula 99.71
KOG0744423 consensus AAA+-type ATPase [Posttranslational modi 99.7
KOG0743457 consensus AAA+-type ATPase [Posttranslational modi 99.67
CHL00181287 cbbX CbbX; Provisional 99.66
PF05496233 RuvB_N: Holliday junction DNA helicase ruvB N-term 99.66
KOG0743457 consensus AAA+-type ATPase [Posttranslational modi 99.64
KOG0742630 consensus AAA+-type ATPase [Posttranslational modi 99.64
TIGR02880284 cbbX_cfxQ probable Rubsico expression protein CbbX 99.64
KOG0744423 consensus AAA+-type ATPase [Posttranslational modi 99.63
TIGR02881261 spore_V_K stage V sporulation protein K. Members o 99.59
PRK00080328 ruvB Holliday junction DNA helicase RuvB; Reviewed 99.59
TIGR00635305 ruvB Holliday junction DNA helicase, RuvB subunit. 99.56
COG2255332 RuvB Holliday junction resolvasome, helicase subun 99.56
KOG1051 898 consensus Chaperone HSP104 and related ATP-depende 99.55
TIGR00763775 lon ATP-dependent protease La. This protein is ind 99.52
PRK14956484 DNA polymerase III subunits gamma and tau; Provisi 99.48
PRK07003 830 DNA polymerase III subunits gamma and tau; Validat 99.46
KOG0989346 consensus Replication factor C, subunit RFC4 [Repl 99.44
PRK06893229 DNA replication initiation factor; Validated 99.43
KOG0742 630 consensus AAA+-type ATPase [Posttranslational modi 99.42
PRK12323 700 DNA polymerase III subunits gamma and tau; Provisi 99.42
PF05496233 RuvB_N: Holliday junction DNA helicase ruvB N-term 99.42
TIGR02902531 spore_lonB ATP-dependent protease LonB. Members of 99.42
PRK14960 702 DNA polymerase III subunits gamma and tau; Provisi 99.41
PRK00149450 dnaA chromosomal replication initiation protein; R 99.41
COG0466782 Lon ATP-dependent Lon protease, bacterial type [Po 99.41
PRK14949 944 DNA polymerase III subunits gamma and tau; Provisi 99.4
PTZ001121164 origin recognition complex 1 protein; Provisional 99.4
PRK14088440 dnaA chromosomal replication initiation protein; P 99.39
TIGR02928365 orc1/cdc6 family replication initiation protein. M 99.39
COG2256 436 MGS1 ATPase related to the helicase subunit of the 99.39
PRK14962472 DNA polymerase III subunits gamma and tau; Provisi 99.38
PRK14964491 DNA polymerase III subunits gamma and tau; Provisi 99.38
PRK14086617 dnaA chromosomal replication initiation protein; P 99.38
PRK14958509 DNA polymerase III subunits gamma and tau; Provisi 99.38
PRK07994 647 DNA polymerase III subunits gamma and tau; Validat 99.38
PRK06645507 DNA polymerase III subunits gamma and tau; Validat 99.37
TIGR00362405 DnaA chromosomal replication initiator protein Dna 99.37
PRK08691 709 DNA polymerase III subunits gamma and tau; Validat 99.36
COG2256436 MGS1 ATPase related to the helicase subunit of the 99.36
PRK14961363 DNA polymerase III subunits gamma and tau; Provisi 99.35
PRK00411394 cdc6 cell division control protein 6; Reviewed 99.35
TIGR02639 731 ClpA ATP-dependent Clp protease ATP-binding subuni 99.35
TIGR03420226 DnaA_homol_Hda DnaA regulatory inactivator Hda. Me 99.34
PLN03025319 replication factor C subunit; Provisional 99.34
PRK08084235 DNA replication initiation factor; Provisional 99.33
PRK14963504 DNA polymerase III subunits gamma and tau; Provisi 99.32
KOG2004906 consensus Mitochondrial ATP-dependent protease PIM 99.31
PRK10787784 DNA-binding ATP-dependent protease La; Provisional 99.3
PRK05563559 DNA polymerase III subunits gamma and tau; Validat 99.3
PRK14957546 DNA polymerase III subunits gamma and tau; Provisi 99.29
PRK04195482 replication factor C large subunit; Provisional 99.29
PHA02544316 44 clamp loader, small subunit; Provisional 99.29
PRK14952584 DNA polymerase III subunits gamma and tau; Provisi 99.29
PRK05896 605 DNA polymerase III subunits gamma and tau; Validat 99.29
PF05673249 DUF815: Protein of unknown function (DUF815); Inte 99.29
PRK12422445 chromosomal replication initiation protein; Provis 99.29
PRK07764 824 DNA polymerase III subunits gamma and tau; Validat 99.28
PRK14951 618 DNA polymerase III subunits gamma and tau; Provisi 99.28
PRK12402337 replication factor C small subunit 2; Reviewed 99.28
PRK13342413 recombination factor protein RarA; Reviewed 99.28
PRK05342412 clpX ATP-dependent protease ATP-binding subunit Cl 99.28
TIGR00763 775 lon ATP-dependent protease La. This protein is ind 99.28
PRK07133 725 DNA polymerase III subunits gamma and tau; Validat 99.27
PRK08903227 DnaA regulatory inactivator Hda; Validated 99.27
PF00308219 Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013 99.27
PRK11034758 clpA ATP-dependent Clp protease ATP-binding subuni 99.26
PRK14969527 DNA polymerase III subunits gamma and tau; Provisi 99.26
PRK08451535 DNA polymerase III subunits gamma and tau; Validat 99.26
TIGR02397355 dnaX_nterm DNA polymerase III, subunit gamma and t 99.26
PRK07940394 DNA polymerase III subunit delta'; Validated 99.25
PRK10865 857 protein disaggregation chaperone; Provisional 99.24
PRK14965576 DNA polymerase III subunits gamma and tau; Provisi 99.24
PRK08727233 hypothetical protein; Validated 99.24
PRK14970367 DNA polymerase III subunits gamma and tau; Provisi 99.24
PRK14959 624 DNA polymerase III subunits gamma and tau; Provisi 99.24
PRK05642234 DNA replication initiation factor; Validated 99.24
PRK09111598 DNA polymerase III subunits gamma and tau; Validat 99.23
CHL00095 821 clpC Clp protease ATP binding subunit 99.23
PRK06647563 DNA polymerase III subunits gamma and tau; Validat 99.21
PRK14953486 DNA polymerase III subunits gamma and tau; Provisi 99.21
PRK13341 725 recombination factor protein RarA/unknown domain f 99.21
PRK06305451 DNA polymerase III subunits gamma and tau; Validat 99.2
PRK05342 412 clpX ATP-dependent protease ATP-binding subunit Cl 99.19
TIGR00390 441 hslU ATP-dependent protease HslVU, ATPase subunit. 99.19
PRK00440319 rfc replication factor C small subunit; Reviewed 99.18
TIGR00382413 clpX endopeptidase Clp ATP-binding regulatory subu 99.18
PRK05201 443 hslU ATP-dependent protease ATP-binding subunit Hs 99.17
COG1474366 CDC6 Cdc6-related protein, AAA superfamily ATPase 99.16
PRK14087450 dnaA chromosomal replication initiation protein; P 99.16
TIGR00382 413 clpX endopeptidase Clp ATP-binding regulatory subu 99.16
PRK06620214 hypothetical protein; Validated 99.15
TIGR03345 852 VI_ClpV1 type VI secretion ATPase, ClpV1 family. M 99.15
TIGR00390441 hslU ATP-dependent protease HslVU, ATPase subunit. 99.14
COG2812515 DnaX DNA polymerase III, gamma/tau subunits [DNA r 99.14
PRK05201443 hslU ATP-dependent protease ATP-binding subunit Hs 99.14
PRK14948 620 DNA polymerase III subunits gamma and tau; Provisi 99.14
COG0466 782 Lon ATP-dependent Lon protease, bacterial type [Po 99.13
COG2255 332 RuvB Holliday junction resolvasome, helicase subun 99.12
TIGR02903615 spore_lon_C ATP-dependent protease, Lon family. Me 99.11
PRK14950585 DNA polymerase III subunits gamma and tau; Provisi 99.1
PRK14955397 DNA polymerase III subunits gamma and tau; Provisi 99.1
COG3829 560 RocR Transcriptional regulator containing PAS, AAA 99.1
KOG2028 554 consensus ATPase related to the helicase subunit o 99.09
PRK14954 620 DNA polymerase III subunits gamma and tau; Provisi 99.09
TIGR02640262 gas_vesic_GvpN gas vesicle protein GvpN. Members o 99.09
PRK09087226 hypothetical protein; Validated 99.08
KOG2004 906 consensus Mitochondrial ATP-dependent protease PIM 99.07
COG0593408 DnaA ATPase involved in DNA replication initiation 99.07
TIGR03346852 chaperone_ClpB ATP-dependent chaperone ClpB. Membe 99.06
PF00158168 Sigma54_activat: Sigma-54 interaction domain; Inte 99.06
TIGR01650327 PD_CobS cobaltochelatase, CobS subunit. This model 99.06
PRK14971 614 DNA polymerase III subunits gamma and tau; Provisi 99.04
COG3604 550 FhlA Transcriptional regulator containing GAF, AAA 99.02
PRK10787 784 DNA-binding ATP-dependent protease La; Provisional 99.02
COG2607287 Predicted ATPase (AAA+ superfamily) [General funct 99.01
PRK00080 328 ruvB Holliday junction DNA helicase RuvB; Reviewed 99.01
KOG1969 877 consensus DNA replication checkpoint protein CHL12 99.01
TIGR00635 305 ruvB Holliday junction DNA helicase, RuvB subunit. 99.0
TIGR03015269 pepcterm_ATPase putative secretion ATPase, PEP-CTE 98.98
PF07724171 AAA_2: AAA domain (Cdc48 subfamily); InterPro: IPR 98.98
COG0542786 clpA ATP-binding subunits of Clp protease and DnaK 98.98
TIGR00678188 holB DNA polymerase III, delta' subunit. At positi 98.98
COG1224450 TIP49 DNA helicase TIP49, TBP-interacting protein 98.96
PRK14956 484 DNA polymerase III subunits gamma and tau; Provisi 98.95
cd00009151 AAA The AAA+ (ATPases Associated with a wide varie 98.95
PRK13342 413 recombination factor protein RarA; Reviewed 98.94
TIGR02974329 phageshock_pspF psp operon transcriptional activat 98.93
COG5271 4600 MDN1 AAA ATPase containing von Willebrand factor t 98.93
PRK12323 700 DNA polymerase III subunits gamma and tau; Provisi 98.92
PRK11608326 pspF phage shock protein operon transcriptional ac 98.9
KOG0989 346 consensus Replication factor C, subunit RFC4 [Repl 98.9
PRK07940 394 DNA polymerase III subunit delta'; Validated 98.89
cd00009151 AAA The AAA+ (ATPases Associated with a wide varie 98.89
PRK07003 830 DNA polymerase III subunits gamma and tau; Validat 98.89
COG1219 408 ClpX ATP-dependent protease Clp, ATPase subunit [P 98.88
PRK14962 472 DNA polymerase III subunits gamma and tau; Provisi 98.88
TIGR01650327 PD_CobS cobaltochelatase, CobS subunit. This model 98.87
TIGR02640262 gas_vesic_GvpN gas vesicle protein GvpN. Members o 98.87
COG2204 464 AtoC Response regulator containing CheY-like recei 98.87
KOG0991333 consensus Replication factor C, subunit RFC2 [Repl 98.86
KOG2028554 consensus ATPase related to the helicase subunit o 98.85
COG1219408 ClpX ATP-dependent protease Clp, ATPase subunit [P 98.85
PRK04132846 replication factor C small subunit; Provisional 98.84
PRK13407334 bchI magnesium chelatase subunit I; Provisional 98.84
PRK04195 482 replication factor C large subunit; Provisional 98.84
PRK13531498 regulatory ATPase RavA; Provisional 98.83
COG2204464 AtoC Response regulator containing CheY-like recei 98.83
TIGR01817534 nifA Nif-specific regulatory protein. This model r 98.82
PRK14960 702 DNA polymerase III subunits gamma and tau; Provisi 98.82
KOG0745564 consensus Putative ATP-dependent Clp-type protease 98.82
smart00382148 AAA ATPases associated with a variety of cellular 98.82
COG1221403 PspF Transcriptional regulators containing an AAA- 98.81
PHA02544 316 44 clamp loader, small subunit; Provisional 98.8
TIGR02030337 BchI-ChlI magnesium chelatase ATPase subunit I. Th 98.8
PRK14949 944 DNA polymerase III subunits gamma and tau; Provisi 98.8
PRK09112351 DNA polymerase III subunit delta'; Validated 98.79
PRK10820520 DNA-binding transcriptional regulator TyrR; Provis 98.79
PRK14961 363 DNA polymerase III subunits gamma and tau; Provisi 98.79
COG3604550 FhlA Transcriptional regulator containing GAF, AAA 98.78
PRK15429686 formate hydrogenlyase transcriptional activator Fh 98.77
COG0714329 MoxR-like ATPases [General function prediction onl 98.77
PF07728139 AAA_5: AAA domain (dynein-related subfamily); Inte 98.77
COG3829560 RocR Transcriptional regulator containing PAS, AAA 98.77
PRK07994 647 DNA polymerase III subunits gamma and tau; Validat 98.76
KOG0745 564 consensus Putative ATP-dependent Clp-type protease 98.76
PRK14958 509 DNA polymerase III subunits gamma and tau; Provisi 98.75
smart00382148 AAA ATPases associated with a variety of cellular 98.75
PRK11388638 DNA-binding transcriptional regulator DhaR; Provis 98.75
PRK05022509 anaerobic nitric oxide reductase transcription reg 98.74
PRK08691 709 DNA polymerase III subunits gamma and tau; Validat 98.74
PRK05564313 DNA polymerase III subunit delta'; Validated 98.74
CHL00081350 chlI Mg-protoporyphyrin IX chelatase 98.74
PF07724171 AAA_2: AAA domain (Cdc48 subfamily); InterPro: IPR 98.73
PRK07471365 DNA polymerase III subunit delta'; Validated 98.73
PRK15424 538 propionate catabolism operon regulatory protein Pr 98.73
PRK06645 507 DNA polymerase III subunits gamma and tau; Validat 98.73
TIGR02329526 propionate_PrpR propionate catabolism operon regul 98.71
PF05673249 DUF815: Protein of unknown function (DUF815); Inte 98.71
PHA02244383 ATPase-like protein 98.69
PF01078206 Mg_chelatase: Magnesium chelatase, subunit ChlI; I 98.69
PLN03025 319 replication factor C subunit; Provisional 98.69
PRK05563 559 DNA polymerase III subunits gamma and tau; Validat 98.69
PRK05707328 DNA polymerase III subunit delta'; Validated 98.69
PRK15424538 propionate catabolism operon regulatory protein Pr 98.69
PRK14964 491 DNA polymerase III subunits gamma and tau; Provisi 98.68
PRK14963 504 DNA polymerase III subunits gamma and tau; Provisi 98.66
PRK14952 584 DNA polymerase III subunits gamma and tau; Provisi 98.66
PF00158168 Sigma54_activat: Sigma-54 interaction domain; Inte 98.65
COG0714 329 MoxR-like ATPases [General function prediction onl 98.65
TIGR02903 615 spore_lon_C ATP-dependent protease, Lon family. Me 98.65
PRK14957 546 DNA polymerase III subunits gamma and tau; Provisi 98.65
PF07726131 AAA_3: ATPase family associated with various cellu 98.64
PHA02244383 ATPase-like protein 98.64
PRK12402337 replication factor C small subunit 2; Reviewed 98.64
KOG2035351 consensus Replication factor C, subunit RFC3 [Cell 98.64
PF06068398 TIP49: TIP49 C-terminus; InterPro: IPR010339 This 98.63
TIGR02329 526 propionate_PrpR propionate catabolism operon regul 98.63
PRK14969 527 DNA polymerase III subunits gamma and tau; Provisi 98.63
smart00350509 MCM minichromosome maintenance proteins. 98.63
KOG0991 333 consensus Replication factor C, subunit RFC2 [Repl 98.63
KOG1514767 consensus Origin recognition complex, subunit 1, a 98.62
PRK07764 824 DNA polymerase III subunits gamma and tau; Validat 98.62
PRK14965 576 DNA polymerase III subunits gamma and tau; Provisi 98.62
TIGR02974 329 phageshock_pspF psp operon transcriptional activat 98.62
PRK14951 618 DNA polymerase III subunits gamma and tau; Provisi 98.62
PRK14959 624 DNA polymerase III subunits gamma and tau; Provisi 98.62
PF12775272 AAA_7: P-loop containing dynein motor region D3; P 98.61
TIGR02031 589 BchD-ChlD magnesium chelatase ATPase subunit D. Th 98.59
PF05621302 TniB: Bacterial TniB protein; InterPro: IPR008868 98.59
PRK11331459 5-methylcytosine-specific restriction enzyme subun 98.59
TIGR02442 633 Cob-chelat-sub cobaltochelatase subunit. A number 98.59
PRK13341 725 recombination factor protein RarA/unknown domain f 98.57
PRK14948 620 DNA polymerase III subunits gamma and tau; Provisi 98.57
PRK05022 509 anaerobic nitric oxide reductase transcription reg 98.57
PRK07133 725 DNA polymerase III subunits gamma and tau; Validat 98.56
PRK05896 605 DNA polymerase III subunits gamma and tau; Validat 98.56
PRK07399314 DNA polymerase III subunit delta'; Validated 98.56
TIGR01817 534 nifA Nif-specific regulatory protein. This model r 98.55
TIGR02902 531 spore_lonB ATP-dependent protease LonB. Members of 98.55
PRK11388 638 DNA-binding transcriptional regulator DhaR; Provis 98.54
PRK14970 367 DNA polymerase III subunits gamma and tau; Provisi 98.54
TIGR02397 355 dnaX_nterm DNA polymerase III, subunit gamma and t 98.54
TIGR00602637 rad24 checkpoint protein rad24. This family is bas 98.54
COG0470325 HolB ATPase involved in DNA replication [DNA repli 98.54
PRK11608 326 pspF phage shock protein operon transcriptional ac 98.54
PF07728139 AAA_5: AAA domain (dynein-related subfamily); Inte 98.52
PRK07993334 DNA polymerase III subunit delta'; Validated 98.52
TIGR02915445 PEP_resp_reg putative PEP-CTERM system response re 98.51
PRK06871325 DNA polymerase III subunit delta'; Validated 98.51
PF14532138 Sigma54_activ_2: Sigma-54 interaction domain; PDB: 98.5
PRK14955 397 DNA polymerase III subunits gamma and tau; Provisi 98.5
PRK06305 451 DNA polymerase III subunits gamma and tau; Validat 98.49
PRK00149 450 dnaA chromosomal replication initiation protein; R 98.49
PF13177162 DNA_pol3_delta2: DNA polymerase III, delta subunit 98.48
PRK15429 686 formate hydrogenlyase transcriptional activator Fh 98.47
PRK10820 520 DNA-binding transcriptional regulator TyrR; Provis 98.47
COG2812 515 DnaX DNA polymerase III, gamma/tau subunits [DNA r 98.46
TIGR00362405 DnaA chromosomal replication initiator protein Dna 98.46
COG5271 4600 MDN1 AAA ATPase containing von Willebrand factor t 98.45
PRK13407 334 bchI magnesium chelatase subunit I; Provisional 98.44
KOG0990360 consensus Replication factor C, subunit RFC5 [Repl 98.43
PRK14953 486 DNA polymerase III subunits gamma and tau; Provisi 98.43
TIGR02928 365 orc1/cdc6 family replication initiation protein. M 98.43
PRK08058329 DNA polymerase III subunit delta'; Validated 98.42
PRK13531 498 regulatory ATPase RavA; Provisional 98.42
PRK06647 563 DNA polymerase III subunits gamma and tau; Validat 98.42
PRK06964342 DNA polymerase III subunit delta'; Validated 98.42
PRK10923469 glnG nitrogen regulation protein NR(I); Provisiona 98.42
PRK08769319 DNA polymerase III subunit delta'; Validated 98.41
PRK00411 394 cdc6 cell division control protein 6; Reviewed 98.41
PRK14954 620 DNA polymerase III subunits gamma and tau; Provisi 98.4
PRK11331459 5-methylcytosine-specific restriction enzyme subun 98.39
PRK08903227 DnaA regulatory inactivator Hda; Validated 98.39
PRK09111 598 DNA polymerase III subunits gamma and tau; Validat 98.38
TIGR03420226 DnaA_homol_Hda DnaA regulatory inactivator Hda. Me 98.37
COG1221 403 PspF Transcriptional regulators containing an AAA- 98.36
PRK14088 440 dnaA chromosomal replication initiation protein; P 98.35
KOG1942456 consensus DNA helicase, TBP-interacting protein [R 98.35
PRK14950 585 DNA polymerase III subunits gamma and tau; Provisi 98.35
COG1220444 HslU ATP-dependent protease HslVU (ClpYQ), ATPase 98.34
PRK11361457 acetoacetate metabolism regulatory protein AtoC; P 98.33
CHL00081 350 chlI Mg-protoporyphyrin IX chelatase 98.33
KOG2227529 consensus Pre-initiation complex, subunit CDC6, AA 98.32
PRK08699325 DNA polymerase III subunit delta'; Validated 98.32
PF13173128 AAA_14: AAA domain 98.32
PRK08451 535 DNA polymerase III subunits gamma and tau; Validat 98.32
COG5245 3164 DYN1 Dynein, heavy chain [Cytoskeleton] 98.31
PF14532138 Sigma54_activ_2: Sigma-54 interaction domain; PDB: 98.31
TIGR02655484 circ_KaiC circadian clock protein KaiC. Members of 98.3
PF05729166 NACHT: NACHT domain 98.3
PTZ00112 1164 origin recognition complex 1 protein; Provisional 98.3
TIGR02442 633 Cob-chelat-sub cobaltochelatase subunit. A number 98.3
PF01637234 Arch_ATPase: Archaeal ATPase; InterPro: IPR011579 98.29
TIGR01818463 ntrC nitrogen regulation protein NR(I). This model 98.29
PRK06090319 DNA polymerase III subunit delta'; Validated 98.27
PRK15115444 response regulator GlrR; Provisional 98.26
TIGR00764608 lon_rel lon-related putative ATP-dependent proteas 98.24
KOG1051898 consensus Chaperone HSP104 and related ATP-depende 98.24
PRK06893229 DNA replication initiation factor; Validated 98.23
PRK12422 445 chromosomal replication initiation protein; Provis 98.23
KOG2680454 consensus DNA helicase TIP49, TBP-interacting prot 98.23
PRK14086 617 dnaA chromosomal replication initiation protein; P 98.22
KOG1969 877 consensus DNA replication checkpoint protein CHL12 98.21
PRK08116268 hypothetical protein; Validated 98.18
TIGR00368 499 Mg chelatase-related protein. The N-terminal end m 98.18
PF03215519 Rad17: Rad17 cell cycle checkpoint protein 98.16
PRK00440 319 rfc replication factor C small subunit; Reviewed 98.16
PRK07952244 DNA replication protein DnaC; Validated 98.15
PF03152176 UFD1: Ubiquitin fusion degradation protein UFD1; I 98.15
PF07726131 AAA_3: ATPase family associated with various cellu 98.14
PRK08116268 hypothetical protein; Validated 98.14
PRK14971 614 DNA polymerase III subunits gamma and tau; Provisi 98.14
PRK08084235 DNA replication initiation factor; Provisional 98.13
PRK08181269 transposase; Validated 98.11
TIGR02030 337 BchI-ChlI magnesium chelatase ATPase subunit I. Th 98.11
smart00763361 AAA_PrkA PrkA AAA domain. This is a family of PrkA 98.1
PF06068 398 TIP49: TIP49 C-terminus; InterPro: IPR010339 This 98.09
PF01078206 Mg_chelatase: Magnesium chelatase, subunit ChlI; I 98.08
PRK09302509 circadian clock protein KaiC; Reviewed 98.08
TIGR00368499 Mg chelatase-related protein. The N-terminal end m 98.07
PRK12377248 putative replication protein; Provisional 98.07
PF00931287 NB-ARC: NB-ARC domain; InterPro: IPR002182 This is 98.07
COG1239423 ChlI Mg-chelatase subunit ChlI [Coenzyme metabolis 98.06
COG2607287 Predicted ATPase (AAA+ superfamily) [General funct 98.06
PRK09112 351 DNA polymerase III subunit delta'; Validated 98.06
TIGR00678188 holB DNA polymerase III, delta' subunit. At positi 98.06
PRK08181269 transposase; Validated 98.05
PRK06835329 DNA replication protein DnaC; Validated 98.04
COG0470 325 HolB ATPase involved in DNA replication [DNA repli 98.04
PRK06526254 transposase; Provisional 98.03
COG3283 511 TyrR Transcriptional regulator of aromatic amino a 98.03
PRK07471 365 DNA polymerase III subunit delta'; Validated 98.02
PRK10365441 transcriptional regulatory protein ZraR; Provision 98.02
PRK05564 313 DNA polymerase III subunit delta'; Validated 98.02
COG0606 490 Predicted ATPase with chaperone activity [Posttran 98.02
PF13401131 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S 98.02
TIGR02915445 PEP_resp_reg putative PEP-CTERM system response re 98.0
PF13173128 AAA_14: AAA domain 98.0
PTZ00111915 DNA replication licensing factor MCM4; Provisional 98.0
PF12774231 AAA_6: Hydrolytic ATP binding site of dynein motor 98.0
COG3284 606 AcoR Transcriptional activator of acetoin/glycerol 97.99
COG1224 450 TIP49 DNA helicase TIP49, TBP-interacting protein 97.99
PRK09183259 transposase/IS protein; Provisional 97.98
PRK08727233 hypothetical protein; Validated 97.97
PF01695178 IstB_IS21: IstB-like ATP binding protein; InterPro 97.96
PRK05917290 DNA polymerase III subunit delta'; Validated 97.96
PRK11361 457 acetoacetate metabolism regulatory protein AtoC; P 97.96
PRK12377248 putative replication protein; Provisional 97.95
PRK05642234 DNA replication initiation factor; Validated 97.93
PRK10923 469 glnG nitrogen regulation protein NR(I); Provisiona 97.92
PRK06526254 transposase; Provisional 97.92
PRK09862506 putative ATP-dependent protease; Provisional 97.91
COG1123539 ATPase components of various ABC-type transport sy 97.9
PRK15115 444 response regulator GlrR; Provisional 97.89
PRK09862506 putative ATP-dependent protease; Provisional 97.89
smart00350509 MCM minichromosome maintenance proteins. 97.88
PF14516331 AAA_35: AAA-like domain 97.87
KOG3595 1395 consensus Dyneins, heavy chain [Cytoskeleton] 97.85
PRK09183259 transposase/IS protein; Provisional 97.85
PRK07952244 DNA replication protein DnaC; Validated 97.85
TIGR02237209 recomb_radB DNA repair and recombination protein R 97.84
COG3283511 TyrR Transcriptional regulator of aromatic amino a 97.84
PTZ00111 915 DNA replication licensing factor MCM4; Provisional 97.83
TIGR00602 637 rad24 checkpoint protein rad24. This family is bas 97.82
PRK08939306 primosomal protein DnaI; Reviewed 97.82
COG1484254 DnaC DNA replication protein [DNA replication, rec 97.82
PRK05707 328 DNA polymerase III subunit delta'; Validated 97.79
PRK06835329 DNA replication protein DnaC; Validated 97.79
PRK06921266 hypothetical protein; Provisional 97.78
COG1474 366 CDC6 Cdc6-related protein, AAA superfamily ATPase 97.78
PRK06921266 hypothetical protein; Provisional 97.78
PRK14087 450 dnaA chromosomal replication initiation protein; P 97.77
PRK06851367 hypothetical protein; Provisional 97.76
COG1220 444 HslU ATP-dependent protease HslVU (ClpYQ), ATPase 97.75
PRK08058 329 DNA polymerase III subunit delta'; Validated 97.75
PRK13406584 bchD magnesium chelatase subunit D; Provisional 97.74
COG1239 423 ChlI Mg-chelatase subunit ChlI [Coenzyme metabolis 97.74
PRK10365441 transcriptional regulatory protein ZraR; Provision 97.73
PF01695178 IstB_IS21: IstB-like ATP binding protein; InterPro 97.72
PF13177162 DNA_pol3_delta2: DNA polymerase III, delta subunit 97.7
COG1241682 MCM2 Predicted ATPase involved in replication cont 97.7
smart00763361 AAA_PrkA PrkA AAA domain. This is a family of PrkA 97.68
KOG0478804 consensus DNA replication licensing factor, MCM4 c 97.68
PRK07399 314 DNA polymerase III subunit delta'; Validated 97.68
KOG1970634 consensus Checkpoint RAD17-RFC complex, RAD17/RAD2 97.67
cd01120165 RecA-like_NTPases RecA-like NTPases. This family i 97.67
PRK08939306 primosomal protein DnaI; Reviewed 97.67
PF00308219 Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013 97.67
PF13401131 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S 97.66
TIGR02031 589 BchD-ChlD magnesium chelatase ATPase subunit D. Th 97.66
COG3267269 ExeA Type II secretory pathway, component ExeA (pr 97.66
cd01120165 RecA-like_NTPases RecA-like NTPases. This family i 97.64
TIGR01818 463 ntrC nitrogen regulation protein NR(I). This model 97.62
KOG0990 360 consensus Replication factor C, subunit RFC5 [Repl 97.59
PF00910107 RNA_helicase: RNA helicase; InterPro: IPR000605 He 97.55
COG1484254 DnaC DNA replication protein [DNA replication, rec 97.55
PRK06964 342 DNA polymerase III subunit delta'; Validated 97.54
PLN03210 1153 Resistant to P. syringae 6; Provisional 97.53
COG0606490 Predicted ATPase with chaperone activity [Posttran 97.53
PRK13765637 ATP-dependent protease Lon; Provisional 97.53
KOG2170344 consensus ATPase of the AAA+ superfamily [General 97.48
PRK07132299 DNA polymerase III subunit delta'; Validated 97.44
COG3284606 AcoR Transcriptional activator of acetoin/glycerol 97.43
TIGR01618220 phage_P_loop phage nucleotide-binding protein. Thi 97.42
PRK05818261 DNA polymerase III subunit delta'; Validated 97.4
PRK09361225 radB DNA repair and recombination protein RadB; Pr 97.4
PRK07276290 DNA polymerase III subunit delta'; Validated 97.38
PRK06620214 hypothetical protein; Validated 97.38
PRK09087226 hypothetical protein; Validated 97.37
TIGR02237209 recomb_radB DNA repair and recombination protein R 97.37
PRK04132 846 replication factor C small subunit; Provisional 97.36
TIGR02012321 tigrfam_recA protein RecA. This model describes or 97.35
TIGR00764 608 lon_rel lon-related putative ATP-dependent proteas 97.35
PF12774231 AAA_6: Hydrolytic ATP binding site of dynein motor 97.35
PRK06871 325 DNA polymerase III subunit delta'; Validated 97.33
cd00983325 recA RecA is a bacterial enzyme which has roles in 97.31
cd01121372 Sms Sms (bacterial radA) DNA repair protein. This 97.31
COG1618179 Predicted nucleotide kinase [Nucleotide transport 97.31
PF00493331 MCM: MCM2/3/5 family This family extends the MCM d 97.27
KOG1968871 consensus Replication factor C, subunit RFC1 (larg 97.27
PF00910107 RNA_helicase: RNA helicase; InterPro: IPR000605 He 97.27
PRK11823446 DNA repair protein RadA; Provisional 97.26
TIGR02012321 tigrfam_recA protein RecA. This model describes or 97.26
PHA00729226 NTP-binding motif containing protein 97.24
KOG0927614 consensus Predicted transporter (ABC superfamily) 97.24
PF03969362 AFG1_ATPase: AFG1-like ATPase; InterPro: IPR005654 97.17
PF13207121 AAA_17: AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6 97.17
KOG1942 456 consensus DNA helicase, TBP-interacting protein [R 97.16
PRK08118167 topology modulation protein; Reviewed 97.15
COG0488530 Uup ATPase components of ABC transporters with dup 97.15
cd01123235 Rad51_DMC1_radA Rad51_DMC1_radA,B. This group of r 97.14
PRK07993 334 DNA polymerase III subunit delta'; Validated 97.12
cd01394218 radB RadB. The archaeal protein radB shares simila 97.12
cd03216163 ABC_Carb_Monos_I This family represents the domain 97.11
PRK08533230 flagellar accessory protein FlaH; Reviewed 97.11
cd01131198 PilT Pilus retraction ATPase PilT. PilT is a nucle 97.09
PRK07261171 topology modulation protein; Provisional 97.09
KOG2228408 consensus Origin recognition complex, subunit 4 [R 97.08
>KOG0735 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information 
Probab=100.00  E-value=5e-115  Score=991.25  Aligned_cols=826  Identities=35%  Similarity=0.509  Sum_probs=610.9

Q ss_pred             CeeEEEEeCCcccceeeCCHHHHHHHhhccccCCCCceEEEEEEeCCCC--eEEEEecCCcCCCCceEecHHHHhhcCCC
Q 001560            1 MELEVRVVGGVENCFVSLPLKLIETLESTRSAHLLPQVLSLELRSRSNQ--RWVVAWSGATSSSSFIEVARQFAECISLA   78 (1052)
Q Consensus         1 ~~~~v~~~~~~~~~~v~lp~~l~~~l~~~~~~~~~~q~~~~el~~~~~~--~~~~gW~g~~s~~~~iei~~~~a~~lgl~   78 (1052)
                      |++.|++.+ +|+||||||..++..+...      .|+.+|+..|.+..  .+++-|.|..++.+.||||+++|++|||.
T Consensus         3 ~a~vV~~~~-~r~cfv~lP~ql~~ai~~~------~~~~av~~v~~~~~~~~s~~~g~~s~~se~~ieIn~~~A~~l~L~   75 (952)
T KOG0735|consen    3 MACVVNYKS-LRSCFVNLPEQLLEAISEP------VQNYAVQAVVSKNPIKKSWVFGHGSGSSENVIEINRVYAHTLGLA   75 (952)
T ss_pred             ceEEEEeee-chhhhhccHHHHHHHHhcc------ccCceeEEEEcCCChhheeecccCCCCccceEEeehhhHhhccCC
Confidence            677888888 9999999999999999863      45688999887643  23333455556668999999999999999


Q ss_pred             CCCEEEEEEecCcccceEEEEecCCcchHHHHHhcHHHHHHHHhcccceecCCCEEeEEecCceEEEEEEcccCCCCCeE
Q 001560           79 DHTIVQVRVVSNVLKATLVTIEPLTEDDWEVLELNSEHAEAAILNQVRIVHEAMRFPLWLHGRTIITFHVVSTFPKKPVV  158 (1052)
Q Consensus        79 ~~~~v~~~~~~~~~~~~~v~veP~t~dDWEilel~a~~le~~lL~Q~r~v~~~~~~~~~~~~~~~~~~~v~~~~p~~~~~  158 (1052)
                      +|+.|.++++.+++.|++|+|||+|+|||||||+||+.+|.+||+|+|||++ ++||+|++++|+|+|+|.++.|+..||
T Consensus        76 e~~~V~l~~~~~v~~~~~V~VeP~TsdDWEIiElnA~~~e~~lL~Q~RIv~~-~~f~iwl~~~t~i~fqv~rl~Ps~~~g  154 (952)
T KOG0735|consen   76 ENQEVKLSIIDHVHEATQVEVEPVTSDDWEIIELNAEWLEENLLVQTRIVTP-EIFIIWLPSGTVIQFQVDRLIPSMLYG  154 (952)
T ss_pred             CCCeEEEEEcCCccceeEEEEeeccCccHHHHHhhHHHHhhhhhhheeeccc-ceeEEEEcCccEEEEEEeeeeccccee
Confidence            9999999999999999999999999999999999999999999999999999 999999999999999999999999999


Q ss_pred             EecCCCEEEEcccCCCCCCcccccchhhcccCccccccceeeeccCCCCcccccccCCceecccccceEEECCCcccccc
Q 001560          159 QLVPGTEVAVAPKRRKNNVKKHEDSYMQAFNESTSIAKALLRVQDSDEGLSHKCNVKGVELGVALTSVAFINPETAENVS  238 (1052)
Q Consensus       159 ~l~~~tev~vaPk~r~~~~~~~~~~~~~~~~~~~~~~~~~~r~~~~~~~~~~~~~~~~~~~~~~~~~~~~i~~~~~~~~~  238 (1052)
                      ||.++|||+||||+|+...+.+++.....+...    +..+|.      ....+...|..+....+++|||  +++.   
T Consensus       155 Rl~~~Tev~VaPK~~k~~l~~~~~g~~e~n~lk----s~~lr~------~~lrs~v~~~~~p~~n~s~vyi--~~aq---  219 (952)
T KOG0735|consen  155 RLLRGTEVLVAPKPNKSALNVKENGVIEENTLK----SRSLRK------VQLRSVVEGRLLPDSNSSTVYI--NTAQ---  219 (952)
T ss_pred             eecCCceEEEecCcccchhhhhcccchhhhhhh----hhhhhh------hhhhhheecccccCcccceeee--cccc---
Confidence            999999999999999988644332222111110    112221      1245566777777777889998  4332   


Q ss_pred             ccCceEEEeccCCCcCCCCCCCCCccccCccccccccCCCCCCccccceeEEEEEeeCcccccceeecHHHHHHHhcccc
Q 001560          239 LCSLELVAILPRLSSKENNPENNAPRIKSNLTSKEISGGASTDKKECRQAVVHLLFSDSVAKGHVKIARALRLYLNAGLH  318 (1052)
Q Consensus       239 ~~~~~~v~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~v~~~~~l~~~l~~~~~  318 (1052)
                      ....+....+++.+.++.+. +       .+.-.  ..|.    ...+-+-..++|...+|..|.+++.++|.++.+...
T Consensus       220 l~t~q~~~~~~k~~Lr~ssr-~-------d~~~~--~~g~----~~Skvv~~~~~c~~q~P~~H~ai~~~l~~~~~tpe~  285 (952)
T KOG0735|consen  220 LVTAQGPALSVKLPLRQSSR-S-------DEVYN--DGGN----LKSKVVEQDVVCPKQIPEFHFAISKSLWLSYSTPED  285 (952)
T ss_pred             ceeccCceeeeeccccCCcc-c-------hhHhh--ccCc----chhhhhcccccCCCCCCcceeeEehhHHHhhcCCcc
Confidence            22233323344444333110 0       00000  0110    111222333677778899999999999999974100


Q ss_pred             ceEEEEeecccccCCCCceecccceeeeccccccccccccccccccccccccccccCCccccCCCCcchhhHHhhhcCCC
Q 001560          319 SWVYLKKCTVNLKKEIPMVSLSPCHFKMLEKDKAFGIGLELDNKNHKTKKMLEKTSSGIYMDDGDLSAEDDIIAALSSEP  398 (1052)
Q Consensus       319 ~~v~~~~~~~~~~~~~~~~~l~p~~~k~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  398 (1052)
                                            .  +|       .+.++                        ..|..++.+..+.+-. 
T Consensus       286 ----------------------d--ik-------~~l~~------------------------~iw~~~n~i~~~~~i~-  309 (952)
T KOG0735|consen  286 ----------------------D--IK-------TGLKF------------------------VIWNLNNPISSSKFIE-  309 (952)
T ss_pred             ----------------------c--hh-------cCcee------------------------eeeccccchhhhhhhH-
Confidence                                  0  11       11111                        1122222221111000 


Q ss_pred             CCchhhHHHH-hhhcchhhHHHHHHHHHHHhhhhccccccccccccccCCceEEEEEeccccCCCCCCCCCcCcccchhh
Q 001560          399 SSKEDEEAVY-QFENKKGLECLLHTWLLAQLTAVASNIGSEFNTLVLSNETLLHFEVKGYKSGTYGKVPASCNGALENKT  477 (1052)
Q Consensus       399 ~~~~~~~~~~-~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  477 (1052)
                        ..+-  .| .-++++++.        .++.++    +..+++++.+  ++.+|++....++.....+..++..+.+..
T Consensus       310 --~l~~--vg~p~~tkk~l~--------~eL~A~----~~~ts~li~~--t~k~~~ie~~es~~~l~nq~eV~~~w~q~~  371 (952)
T KOG0735|consen  310 --ELKR--VGLPDETKKNLS--------SELVAA----KLKTSYLIDG--TLKLFEIEVLESVSSLSNQEEVVRLWDQLK  371 (952)
T ss_pred             --HHHh--ccCCcccccchh--------Hhhhhh----hhccccccCC--ceEEEEeeccccccccccchHHhhHHHhhc
Confidence              0000  00 011222232        122111    1333555555  678888876322221111112222222111


Q ss_pred             hhhccchhhhhhcccccccccCCCCchhhhhHHhhccCCCCHHHHHHHhcccCCCCcccceeeccccccccccccccccc
Q 001560          478 KARELRTEIFCVLTFSEESLHGGKNNAYELTLEARGQQNNNTEAVRQLFGKLNSGDSVSFYTVKERGSTQGFDSNVSSLS  557 (1052)
Q Consensus       478 ~~~~~~~~~~~ll~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~kl~~~~p~~~~~~~~~~~~~~~~~~~~~l~  557 (1052)
                      .-+..+.|..+.-.+..+.+.+.|..                             ++.    .....+.    .++..  
T Consensus       372 vt~~~~~ei~~~~~v~~~~~~g~K~~-----------------------------~~~----l~~~~~e----~d~i~--  412 (952)
T KOG0735|consen  372 VTKMPPLEIKITSDVNLPVLAGIKEN-----------------------------SPD----LVMSPFE----HDFIQ--  412 (952)
T ss_pred             cccCCchheeeeeeecchhhhcchhc-----------------------------Ccc----cccCcCC----Cceee--
Confidence            11111111111111111111110000                             000    0000000    11111  


Q ss_pred             cchhHHHHHHHHHHHhcCCCccccccccCCCCCceEEEEcCCCchHHHHHHHHHHHhccCccceeeEEEEecccccCCch
Q 001560          558 WMGTTASDVINRIKVLLSPDSGLWFSTYHLPLPGHILIHGPPGSGKTSLAKAVAKSLEHHKDLVAHIVFVCCSRLSLEKG  637 (1052)
Q Consensus       558 G~~~~i~~i~~~l~~ll~~~~~~~~~~~~~~~p~~vLL~GppGTGKTtLAraLA~~L~~~~~~~~~v~~v~~s~L~~~~~  637 (1052)
                       .....++..+   ..++|          ...++++||+||+|||||.|++++++++..+  ..+|+.+++|+.+.+...
T Consensus       413 -~~s~kke~~n---~~~sp----------v~~~~~Ill~G~~GsGKT~L~kal~~~~~k~--~~~hv~~v~Cs~l~~~~~  476 (952)
T KOG0735|consen  413 -VPSYKKENAN---QELSP----------VFRHGNILLNGPKGSGKTNLVKALFDYYSKD--LIAHVEIVSCSTLDGSSL  476 (952)
T ss_pred             -cchhhhhhhh---hhccc----------ccccccEEEeCCCCCCHhHHHHHHHHHhccc--cceEEEEEechhccchhH
Confidence             1111111111   23333          3456789999999999999999999998743  448999999999999999


Q ss_pred             hhHHHHhhhhHHHhhccCCeEEEEeccchhccCCCCCCCCCCchhHHHHHHHHHHHHHHhccccCCccCcCcEEEEEecC
Q 001560          638 PIIRQALSNFISEALDHAPSIVIFDNLDSIISSSSDPEGSQPSTSVIALTKFLVDIMDEYGEKRKSSCGIGPIAFVASAQ  717 (1052)
Q Consensus       638 ~~~~~~l~~~f~~a~~~~PsIL~IDEiD~L~~~~~~~e~~~~~~~~~~l~~~L~~~ld~~~~~~~~~~~~~~V~vIattn  717 (1052)
                      +.+++.+..+|.+|.|++|+|++|||+|.|++ .++.++++......++..++.+.+..+...+.      .+.+||+.+
T Consensus       477 e~iQk~l~~vfse~~~~~PSiIvLDdld~l~~-~s~~e~~q~~~~~~rla~flnqvi~~y~~~~~------~ia~Iat~q  549 (952)
T KOG0735|consen  477 EKIQKFLNNVFSEALWYAPSIIVLDDLDCLAS-ASSNENGQDGVVSERLAAFLNQVIKIYLKRNR------KIAVIATGQ  549 (952)
T ss_pred             HHHHHHHHHHHHHHHhhCCcEEEEcchhhhhc-cCcccCCcchHHHHHHHHHHHHHHHHHHccCc------EEEEEEech
Confidence            99999999999999999999999999999997 34556666777788888888888887776543      489999999


Q ss_pred             CCCCCchhhhcCCCcceeeeCCCCCHHHHHHHHHHHHhhccCCCCHHHHHHHhhhcCCCCHHHHHHHHHHHHHHHHhhhc
Q 001560          718 SLEKIPQSLTSSGRFDFHVQLPAPAASERKAILEHEIQRRSLECSDEILLDVASKCDGYDAYDLEILVDRTVHAAVGRYL  797 (1052)
Q Consensus       718 ~~~~Ld~aL~r~gRF~~~i~i~~Pd~~eR~~IL~~~l~~~~~~~sd~~l~~La~~teG~s~~DL~~Lv~~A~~~a~~r~~  797 (1052)
                      ....+++.|.++++|+.++.+++|+..+|.+||+..+++....+..+.++.++..|+||.+.||..+++||+|.++....
T Consensus       550 e~qtl~~~L~s~~~Fq~~~~L~ap~~~~R~~IL~~~~s~~~~~~~~~dLd~ls~~TEGy~~~DL~ifVeRai~~a~leri  629 (952)
T KOG0735|consen  550 ELQTLNPLLVSPLLFQIVIALPAPAVTRRKEILTTIFSKNLSDITMDDLDFLSVKTEGYLATDLVIFVERAIHEAFLERI  629 (952)
T ss_pred             hhhhcChhhcCccceEEEEecCCcchhHHHHHHHHHHHhhhhhhhhHHHHHHHHhcCCccchhHHHHHHHHHHHHHHHHh
Confidence            99999999999999999999999999999999999999887777777888899999999999999999999999984432


Q ss_pred             ccCCcccccccccccccccccccccccccccccccccccCCCCCCccccccchhHHHHHHHHhhcccCChhhhhcCCccc
Q 001560          798 HSDSSFEKHIKPTLVRDDFSQAMHEFLPVAMRDITKTSAEGGRSGWDDVGGLTDIQNAIKEMIELPSKFPNIFAQAPLRL  877 (1052)
Q Consensus       798 ~~~~~~~~~~~~~lt~eDf~~Al~~~~P~~lr~v~~~~~~~~~~~~~~i~g~~~vk~~l~~~i~~~~~~~~~~~~~~~~~  877 (1052)
                      .      . ....++.++|.+++++|.|.++|++....+.  ..+|+|++|+.++++.+.+.++||.+|+.+|.+++++.
T Consensus       630 s------~-~~klltke~f~ksL~~F~P~aLR~ik~~k~t--gi~w~digg~~~~k~~l~~~i~~P~kyp~if~~~plr~  700 (952)
T KOG0735|consen  630 S------N-GPKLLTKELFEKSLKDFVPLALRGIKLVKST--GIRWEDIGGLFEAKKVLEEVIEWPSKYPQIFANCPLRL  700 (952)
T ss_pred             c------c-CcccchHHHHHHHHHhcChHHhhhccccccC--CCCceecccHHHHHHHHHHHHhccccchHHHhhCCccc
Confidence            1      1 2237999999999999999999999998886  48999999999999999999999999999999999999


Q ss_pred             CCceeEecCCCCchhhHHHHHHHHcCCeEEEeechhhhhhhhcccHHHHHHHHHHHhcCCCEEEEEeCCCccCCcCCCCC
Q 001560          878 RSNVLLYGPPGCGKTHIVGAAAAACSLRFISVKGPELLNKYIGASEQAVRDIFSKATAAAPCLLFFDEFDSIAPKRGHDN  957 (1052)
Q Consensus       878 ~~~iLL~GppGtGKT~lA~alA~~~~~~~i~v~~s~l~~~yvGese~~ir~lf~~A~~~~p~ILfiDEid~l~~~r~~~~  957 (1052)
                      +.|+|||||||||||.+|.++|..++++||++++++++++|+|++|+++|++|.+|+..+||||||||+|+++|+||+++
T Consensus       701 ~~giLLyGppGcGKT~la~a~a~~~~~~fisvKGPElL~KyIGaSEq~vR~lF~rA~~a~PCiLFFDEfdSiAPkRGhDs  780 (952)
T KOG0735|consen  701 RTGILLYGPPGCGKTLLASAIASNSNLRFISVKGPELLSKYIGASEQNVRDLFERAQSAKPCILFFDEFDSIAPKRGHDS  780 (952)
T ss_pred             ccceEEECCCCCcHHHHHHHHHhhCCeeEEEecCHHHHHHHhcccHHHHHHHHHHhhccCCeEEEeccccccCcccCCCC
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             cccchhhhhccccccceeeeeeeccCcccCccccchhhhhhhcccccchhHHHhhhhcCCcccCCeEEEEeCCC------
Q 001560          958 TGVTDRVVNQVSSTSYLFIIYFWEVGKKEGVVPYDIYILVNFLISACPCFQQFLTELDGVEVLTGVFVFAATRL------ 1031 (1052)
Q Consensus       958 ~~~~~r~v~~~~~~~~~~i~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~lL~~ldg~~~~~~v~vi~aTn~------ 1031 (1052)
                      +|++||+|||                                          |||+|||+++.+||+|+|||.|      
T Consensus       781 TGVTDRVVNQ------------------------------------------lLTelDG~Egl~GV~i~aaTsRpdliDp  818 (952)
T KOG0735|consen  781 TGVTDRVVNQ------------------------------------------LLTELDGAEGLDGVYILAATSRPDLIDP  818 (952)
T ss_pred             CCchHHHHHH------------------------------------------HHHhhccccccceEEEEEecCCccccCH
Confidence            9999999999                                          9999999999999999999999      


Q ss_pred             ---CCCCcceEEEecCCccccc
Q 001560         1032 ---EFFHYNVLLFCSFIIFLIL 1050 (1052)
Q Consensus      1032 ---r~gRfd~~i~~~~p~~~~~ 1050 (1052)
                         ||||||+.+||++|+.+-.
T Consensus       819 ALLRpGRlD~~v~C~~P~~~eR  840 (952)
T KOG0735|consen  819 ALLRPGRLDKLVYCPLPDEPER  840 (952)
T ss_pred             hhcCCCccceeeeCCCCCcHHH
Confidence               9999999999999997643

>KOG0733 consensus Nuclear AAA ATPase (VCP subfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0730 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0736 consensus Peroxisome assembly factor 2 containing the AAA+-type ATPase domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR01243 CDC48 AAA family ATPase, CDC48 subfamily Back     alignment and domain information
>COG0464 SpoVK ATPases of the AAA+ class [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG1222 RPT1 ATP-dependent 26S proteasome regulatory subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0741 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG1222 RPT1 ATP-dependent 26S proteasome regulatory subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0730 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0733 consensus Nuclear AAA ATPase (VCP subfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0727 consensus 26S proteasome regulatory complex, ATPase RPT3 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>CHL00195 ycf46 Ycf46; Provisional Back     alignment and domain information
>KOG0728 consensus 26S proteasome regulatory complex, ATPase RPT6 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0734 consensus AAA+-type ATPase containing the peptidase M41 domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0734 consensus AAA+-type ATPase containing the peptidase M41 domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0726 consensus 26S proteasome regulatory complex, ATPase RPT2 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0729 consensus 26S proteasome regulatory complex, ATPase RPT1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0738 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0732 consensus AAA+-type ATPase containing the bromodomain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0739 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR02639 ClpA ATP-dependent Clp protease ATP-binding subunit clpA Back     alignment and domain information
>KOG0652 consensus 26S proteasome regulatory complex, ATPase RPT5 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0736 consensus Peroxisome assembly factor 2 containing the AAA+-type ATPase domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0738 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0739 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>CHL00195 ycf46 Ycf46; Provisional Back     alignment and domain information
>PF09262 PEX-1N: Peroxisome biogenesis factor 1, N-terminal ; InterPro: IPR015342 This domain adopts a double psi beta-barrel fold, similar in structure to the Cdc48 N-terminal domain Back     alignment and domain information
>PTZ00454 26S protease regulatory subunit 6B-like protein; Provisional Back     alignment and domain information
>KOG0728 consensus 26S proteasome regulatory complex, ATPase RPT6 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0731 consensus AAA+-type ATPase containing the peptidase M41 domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK11034 clpA ATP-dependent Clp protease ATP-binding subunit; Provisional Back     alignment and domain information
>KOG0652 consensus 26S proteasome regulatory complex, ATPase RPT5 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0727 consensus 26S proteasome regulatory complex, ATPase RPT3 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0731 consensus AAA+-type ATPase containing the peptidase M41 domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0737 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG1223 Predicted ATPase (AAA+ superfamily) [General function prediction only] Back     alignment and domain information
>PRK03992 proteasome-activating nucleotidase; Provisional Back     alignment and domain information
>KOG0726 consensus 26S proteasome regulatory complex, ATPase RPT2 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG1223 Predicted ATPase (AAA+ superfamily) [General function prediction only] Back     alignment and domain information
>PTZ00361 26 proteosome regulatory subunit 4-like protein; Provisional Back     alignment and domain information
>COG0464 SpoVK ATPases of the AAA+ class [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR01243 CDC48 AAA family ATPase, CDC48 subfamily Back     alignment and domain information
>KOG0735 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0651 consensus 26S proteasome regulatory complex, ATPase RPT4 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR03689 pup_AAA proteasome ATPase Back     alignment and domain information
>PTZ00454 26S protease regulatory subunit 6B-like protein; Provisional Back     alignment and domain information
>TIGR01241 FtsH_fam ATP-dependent metalloprotease FtsH Back     alignment and domain information
>KOG0729 consensus 26S proteasome regulatory complex, ATPase RPT1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG0465 HflB ATP-dependent Zn proteases [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG0465 HflB ATP-dependent Zn proteases [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>CHL00176 ftsH cell division protein; Validated Back     alignment and domain information
>TIGR03345 VI_ClpV1 type VI secretion ATPase, ClpV1 family Back     alignment and domain information
>KOG0737 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK03992 proteasome-activating nucleotidase; Provisional Back     alignment and domain information
>TIGR01242 26Sp45 26S proteasome subunit P45 family Back     alignment and domain information
>CHL00095 clpC Clp protease ATP binding subunit Back     alignment and domain information
>TIGR03689 pup_AAA proteasome ATPase Back     alignment and domain information
>PLN00020 ribulose bisphosphate carboxylase/oxygenase activase -RuBisCO activase (RCA); Provisional Back     alignment and domain information
>COG0542 clpA ATP-binding subunits of Clp protease and DnaK/DnaJ chaperones [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>CHL00206 ycf2 Ycf2; Provisional Back     alignment and domain information
>PTZ00361 26 proteosome regulatory subunit 4-like protein; Provisional Back     alignment and domain information
>KOG0732 consensus AAA+-type ATPase containing the bromodomain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0740 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR01241 FtsH_fam ATP-dependent metalloprotease FtsH Back     alignment and domain information
>TIGR03346 chaperone_ClpB ATP-dependent chaperone ClpB Back     alignment and domain information
>KOG0741 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK10733 hflB ATP-dependent metalloprotease; Reviewed Back     alignment and domain information
>KOG0651 consensus 26S proteasome regulatory complex, ATPase RPT4 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PLN00020 ribulose bisphosphate carboxylase/oxygenase activase -RuBisCO activase (RCA); Provisional Back     alignment and domain information
>PRK10865 protein disaggregation chaperone; Provisional Back     alignment and domain information
>TIGR01242 26Sp45 26S proteasome subunit P45 family Back     alignment and domain information
>KOG0740 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>CHL00176 ftsH cell division protein; Validated Back     alignment and domain information
>CHL00206 ycf2 Ycf2; Provisional Back     alignment and domain information
>PRK10733 hflB ATP-dependent metalloprotease; Reviewed Back     alignment and domain information
>TIGR02881 spore_V_K stage V sporulation protein K Back     alignment and domain information
>PF00004 AAA: ATPase family associated with various cellular activities (AAA); InterPro: IPR003959 AAA ATPases (ATPases Associated with diverse cellular Activities) form a large protein family and play a number of roles in the cell including cell-cycle regulation, protein proteolysis and disaggregation, organelle biogenesis and intracellular transport Back     alignment and domain information
>CHL00181 cbbX CbbX; Provisional Back     alignment and domain information
>TIGR02880 cbbX_cfxQ probable Rubsico expression protein CbbX Back     alignment and domain information
>PF09263 PEX-2N: Peroxisome biogenesis factor 1, N-terminal ; InterPro: IPR015343 This domain adopts a Cdc48 domain 2-like fold, with a beta-alpha-beta(3) arrangement Back     alignment and domain information
>PF00004 AAA: ATPase family associated with various cellular activities (AAA); InterPro: IPR003959 AAA ATPases (ATPases Associated with diverse cellular Activities) form a large protein family and play a number of roles in the cell including cell-cycle regulation, protein proteolysis and disaggregation, organelle biogenesis and intracellular transport Back     alignment and domain information
>KOG0744 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0743 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>CHL00181 cbbX CbbX; Provisional Back     alignment and domain information
>PF05496 RuvB_N: Holliday junction DNA helicase ruvB N-terminus; InterPro: IPR008824 The RuvB protein makes up part of the RuvABC revolvasome which catalyses the resolution of Holliday junctions that arise during genetic recombination and DNA repair Back     alignment and domain information
>KOG0743 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0742 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR02880 cbbX_cfxQ probable Rubsico expression protein CbbX Back     alignment and domain information
>KOG0744 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR02881 spore_V_K stage V sporulation protein K Back     alignment and domain information
>PRK00080 ruvB Holliday junction DNA helicase RuvB; Reviewed Back     alignment and domain information
>TIGR00635 ruvB Holliday junction DNA helicase, RuvB subunit Back     alignment and domain information
>COG2255 RuvB Holliday junction resolvasome, helicase subunit [DNA replication, recombination, and repair] Back     alignment and domain information
>KOG1051 consensus Chaperone HSP104 and related ATP-dependent Clp proteases [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR00763 lon ATP-dependent protease La Back     alignment and domain information
>PRK14956 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK07003 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>KOG0989 consensus Replication factor C, subunit RFC4 [Replication, recombination and repair] Back     alignment and domain information
>PRK06893 DNA replication initiation factor; Validated Back     alignment and domain information
>KOG0742 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK12323 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PF05496 RuvB_N: Holliday junction DNA helicase ruvB N-terminus; InterPro: IPR008824 The RuvB protein makes up part of the RuvABC revolvasome which catalyses the resolution of Holliday junctions that arise during genetic recombination and DNA repair Back     alignment and domain information
>TIGR02902 spore_lonB ATP-dependent protease LonB Back     alignment and domain information
>PRK14960 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK00149 dnaA chromosomal replication initiation protein; Reviewed Back     alignment and domain information
>COG0466 Lon ATP-dependent Lon protease, bacterial type [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK14949 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PTZ00112 origin recognition complex 1 protein; Provisional Back     alignment and domain information
>PRK14088 dnaA chromosomal replication initiation protein; Provisional Back     alignment and domain information
>TIGR02928 orc1/cdc6 family replication initiation protein Back     alignment and domain information
>COG2256 MGS1 ATPase related to the helicase subunit of the Holliday junction resolvase [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK14962 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14964 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14086 dnaA chromosomal replication initiation protein; Provisional Back     alignment and domain information
>PRK14958 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK07994 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK06645 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>TIGR00362 DnaA chromosomal replication initiator protein DnaA Back     alignment and domain information
>PRK08691 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>COG2256 MGS1 ATPase related to the helicase subunit of the Holliday junction resolvase [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK14961 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK00411 cdc6 cell division control protein 6; Reviewed Back     alignment and domain information
>TIGR02639 ClpA ATP-dependent Clp protease ATP-binding subunit clpA Back     alignment and domain information
>TIGR03420 DnaA_homol_Hda DnaA regulatory inactivator Hda Back     alignment and domain information
>PLN03025 replication factor C subunit; Provisional Back     alignment and domain information
>PRK08084 DNA replication initiation factor; Provisional Back     alignment and domain information
>PRK14963 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>KOG2004 consensus Mitochondrial ATP-dependent protease PIM1/LON [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK10787 DNA-binding ATP-dependent protease La; Provisional Back     alignment and domain information
>PRK05563 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK14957 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK04195 replication factor C large subunit; Provisional Back     alignment and domain information
>PHA02544 44 clamp loader, small subunit; Provisional Back     alignment and domain information
>PRK14952 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK05896 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PF05673 DUF815: Protein of unknown function (DUF815); InterPro: IPR008533 This domain consists of several bacterial proteins of unknown function Back     alignment and domain information
>PRK12422 chromosomal replication initiation protein; Provisional Back     alignment and domain information
>PRK07764 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK14951 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK12402 replication factor C small subunit 2; Reviewed Back     alignment and domain information
>PRK13342 recombination factor protein RarA; Reviewed Back     alignment and domain information
>PRK05342 clpX ATP-dependent protease ATP-binding subunit ClpX; Provisional Back     alignment and domain information
>TIGR00763 lon ATP-dependent protease La Back     alignment and domain information
>PRK07133 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK08903 DnaA regulatory inactivator Hda; Validated Back     alignment and domain information
>PF00308 Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013317 This entry represents the central domain of bacterial DnaA proteins [, , ] that play an important role in initiating and regulating chromosomal replication Back     alignment and domain information
>PRK11034 clpA ATP-dependent Clp protease ATP-binding subunit; Provisional Back     alignment and domain information
>PRK14969 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK08451 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>TIGR02397 dnaX_nterm DNA polymerase III, subunit gamma and tau Back     alignment and domain information
>PRK07940 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK10865 protein disaggregation chaperone; Provisional Back     alignment and domain information
>PRK14965 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK08727 hypothetical protein; Validated Back     alignment and domain information
>PRK14970 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14959 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK05642 DNA replication initiation factor; Validated Back     alignment and domain information
>PRK09111 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>CHL00095 clpC Clp protease ATP binding subunit Back     alignment and domain information
>PRK06647 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK14953 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK13341 recombination factor protein RarA/unknown domain fusion protein; Reviewed Back     alignment and domain information
>PRK06305 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK05342 clpX ATP-dependent protease ATP-binding subunit ClpX; Provisional Back     alignment and domain information
>TIGR00390 hslU ATP-dependent protease HslVU, ATPase subunit Back     alignment and domain information
>PRK00440 rfc replication factor C small subunit; Reviewed Back     alignment and domain information
>TIGR00382 clpX endopeptidase Clp ATP-binding regulatory subunit (clpX) Back     alignment and domain information
>PRK05201 hslU ATP-dependent protease ATP-binding subunit HslU; Provisional Back     alignment and domain information
>COG1474 CDC6 Cdc6-related protein, AAA superfamily ATPase [DNA replication, recombination, and repair / Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK14087 dnaA chromosomal replication initiation protein; Provisional Back     alignment and domain information
>TIGR00382 clpX endopeptidase Clp ATP-binding regulatory subunit (clpX) Back     alignment and domain information
>PRK06620 hypothetical protein; Validated Back     alignment and domain information
>TIGR03345 VI_ClpV1 type VI secretion ATPase, ClpV1 family Back     alignment and domain information
>TIGR00390 hslU ATP-dependent protease HslVU, ATPase subunit Back     alignment and domain information
>COG2812 DnaX DNA polymerase III, gamma/tau subunits [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK05201 hslU ATP-dependent protease ATP-binding subunit HslU; Provisional Back     alignment and domain information
>PRK14948 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>COG0466 Lon ATP-dependent Lon protease, bacterial type [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG2255 RuvB Holliday junction resolvasome, helicase subunit [DNA replication, recombination, and repair] Back     alignment and domain information
>TIGR02903 spore_lon_C ATP-dependent protease, Lon family Back     alignment and domain information
>PRK14950 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14955 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>COG3829 RocR Transcriptional regulator containing PAS, AAA-type ATPase, and DNA-binding domains [Transcription / Signal transduction mechanisms] Back     alignment and domain information
>KOG2028 consensus ATPase related to the helicase subunit of the Holliday junction resolvase [Replication, recombination and repair] Back     alignment and domain information
>PRK14954 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>TIGR02640 gas_vesic_GvpN gas vesicle protein GvpN Back     alignment and domain information
>PRK09087 hypothetical protein; Validated Back     alignment and domain information
>KOG2004 consensus Mitochondrial ATP-dependent protease PIM1/LON [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG0593 DnaA ATPase involved in DNA replication initiation [DNA replication, recombination, and repair] Back     alignment and domain information
>TIGR03346 chaperone_ClpB ATP-dependent chaperone ClpB Back     alignment and domain information
>PF00158 Sigma54_activat: Sigma-54 interaction domain; InterPro: IPR002078 Some bacterial regulatory proteins activate the expression of genes from promoters recognised by core RNA polymerase associated with the alternative sigma-54 factor Back     alignment and domain information
>TIGR01650 PD_CobS cobaltochelatase, CobS subunit Back     alignment and domain information
>PRK14971 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>COG3604 FhlA Transcriptional regulator containing GAF, AAA-type ATPase, and DNA binding domains [Transcription / Signal transduction mechanisms] Back     alignment and domain information
>PRK10787 DNA-binding ATP-dependent protease La; Provisional Back     alignment and domain information
>COG2607 Predicted ATPase (AAA+ superfamily) [General function prediction only] Back     alignment and domain information
>PRK00080 ruvB Holliday junction DNA helicase RuvB; Reviewed Back     alignment and domain information
>KOG1969 consensus DNA replication checkpoint protein CHL12/CTF18 [Cell cycle control, cell division, chromosome partitioning; Replication, recombination and repair] Back     alignment and domain information
>TIGR00635 ruvB Holliday junction DNA helicase, RuvB subunit Back     alignment and domain information
>TIGR03015 pepcterm_ATPase putative secretion ATPase, PEP-CTERM locus subfamily Back     alignment and domain information
>PF07724 AAA_2: AAA domain (Cdc48 subfamily); InterPro: IPR013093 ATPases Associated to a variety of cellular Activities (AAA) are a family distinguished by a highly conserved module of 230 amino acids [] Back     alignment and domain information
>COG0542 clpA ATP-binding subunits of Clp protease and DnaK/DnaJ chaperones [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR00678 holB DNA polymerase III, delta' subunit Back     alignment and domain information
>COG1224 TIP49 DNA helicase TIP49, TBP-interacting protein [Transcription] Back     alignment and domain information
>PRK14956 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>cd00009 AAA The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold Back     alignment and domain information
>PRK13342 recombination factor protein RarA; Reviewed Back     alignment and domain information
>TIGR02974 phageshock_pspF psp operon transcriptional activator PspF Back     alignment and domain information
>COG5271 MDN1 AAA ATPase containing von Willebrand factor type A (vWA) domain [General function prediction only] Back     alignment and domain information
>PRK12323 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK11608 pspF phage shock protein operon transcriptional activator; Provisional Back     alignment and domain information
>KOG0989 consensus Replication factor C, subunit RFC4 [Replication, recombination and repair] Back     alignment and domain information
>PRK07940 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>cd00009 AAA The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold Back     alignment and domain information
>PRK07003 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>COG1219 ClpX ATP-dependent protease Clp, ATPase subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK14962 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>TIGR01650 PD_CobS cobaltochelatase, CobS subunit Back     alignment and domain information
>TIGR02640 gas_vesic_GvpN gas vesicle protein GvpN Back     alignment and domain information
>COG2204 AtoC Response regulator containing CheY-like receiver, AAA-type ATPase, and DNA-binding domains [Signal transduction mechanisms] Back     alignment and domain information
>KOG0991 consensus Replication factor C, subunit RFC2 [Replication, recombination and repair] Back     alignment and domain information
>KOG2028 consensus ATPase related to the helicase subunit of the Holliday junction resolvase [Replication, recombination and repair] Back     alignment and domain information
>COG1219 ClpX ATP-dependent protease Clp, ATPase subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK04132 replication factor C small subunit; Provisional Back     alignment and domain information
>PRK13407 bchI magnesium chelatase subunit I; Provisional Back     alignment and domain information
>PRK04195 replication factor C large subunit; Provisional Back     alignment and domain information
>PRK13531 regulatory ATPase RavA; Provisional Back     alignment and domain information
>COG2204 AtoC Response regulator containing CheY-like receiver, AAA-type ATPase, and DNA-binding domains [Signal transduction mechanisms] Back     alignment and domain information
>TIGR01817 nifA Nif-specific regulatory protein Back     alignment and domain information
>PRK14960 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>KOG0745 consensus Putative ATP-dependent Clp-type protease (AAA+ ATPase superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>smart00382 AAA ATPases associated with a variety of cellular activities Back     alignment and domain information
>COG1221 PspF Transcriptional regulators containing an AAA-type ATPase domain and a DNA-binding domain [Transcription / Signal transduction mechanisms] Back     alignment and domain information
>PHA02544 44 clamp loader, small subunit; Provisional Back     alignment and domain information
>TIGR02030 BchI-ChlI magnesium chelatase ATPase subunit I Back     alignment and domain information
>PRK14949 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK09112 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK10820 DNA-binding transcriptional regulator TyrR; Provisional Back     alignment and domain information
>PRK14961 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>COG3604 FhlA Transcriptional regulator containing GAF, AAA-type ATPase, and DNA binding domains [Transcription / Signal transduction mechanisms] Back     alignment and domain information
>PRK15429 formate hydrogenlyase transcriptional activator FhlA; Provisional Back     alignment and domain information
>COG0714 MoxR-like ATPases [General function prediction only] Back     alignment and domain information
>PF07728 AAA_5: AAA domain (dynein-related subfamily); InterPro: IPR011704 The ATPases Associated to a variety of cellular Activities (AAA) are a family distinguished by a highly conserved module of 230 amino acids [] Back     alignment and domain information
>COG3829 RocR Transcriptional regulator containing PAS, AAA-type ATPase, and DNA-binding domains [Transcription / Signal transduction mechanisms] Back     alignment and domain information
>PRK07994 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>KOG0745 consensus Putative ATP-dependent Clp-type protease (AAA+ ATPase superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK14958 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>smart00382 AAA ATPases associated with a variety of cellular activities Back     alignment and domain information
>PRK11388 DNA-binding transcriptional regulator DhaR; Provisional Back     alignment and domain information
>PRK05022 anaerobic nitric oxide reductase transcription regulator; Provisional Back     alignment and domain information
>PRK08691 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK05564 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>CHL00081 chlI Mg-protoporyphyrin IX chelatase Back     alignment and domain information
>PF07724 AAA_2: AAA domain (Cdc48 subfamily); InterPro: IPR013093 ATPases Associated to a variety of cellular Activities (AAA) are a family distinguished by a highly conserved module of 230 amino acids [] Back     alignment and domain information
>PRK07471 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK15424 propionate catabolism operon regulatory protein PrpR; Provisional Back     alignment and domain information
>PRK06645 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>TIGR02329 propionate_PrpR propionate catabolism operon regulatory protein PrpR Back     alignment and domain information
>PF05673 DUF815: Protein of unknown function (DUF815); InterPro: IPR008533 This domain consists of several bacterial proteins of unknown function Back     alignment and domain information
>PHA02244 ATPase-like protein Back     alignment and domain information
>PF01078 Mg_chelatase: Magnesium chelatase, subunit ChlI; InterPro: IPR000523 Magnesium-chelatase is a three-component enzyme that catalyses the insertion of Mg2+ into protoporphyrin IX Back     alignment and domain information
>PLN03025 replication factor C subunit; Provisional Back     alignment and domain information
>PRK05563 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK05707 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK15424 propionate catabolism operon regulatory protein PrpR; Provisional Back     alignment and domain information
>PRK14964 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14963 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14952 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PF00158 Sigma54_activat: Sigma-54 interaction domain; InterPro: IPR002078 Some bacterial regulatory proteins activate the expression of genes from promoters recognised by core RNA polymerase associated with the alternative sigma-54 factor Back     alignment and domain information
>COG0714 MoxR-like ATPases [General function prediction only] Back     alignment and domain information
>TIGR02903 spore_lon_C ATP-dependent protease, Lon family Back     alignment and domain information
>PRK14957 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PF07726 AAA_3: ATPase family associated with various cellular activities (AAA); InterPro: IPR011703 This entry includes some of the AAA proteins not detected by the IPR003959 from INTERPRO model Back     alignment and domain information
>PHA02244 ATPase-like protein Back     alignment and domain information
>PRK12402 replication factor C small subunit 2; Reviewed Back     alignment and domain information
>KOG2035 consensus Replication factor C, subunit RFC3 [Cell cycle control, cell division, chromosome partitioning; Replication, recombination and repair] Back     alignment and domain information
>PF06068 TIP49: TIP49 C-terminus; InterPro: IPR010339 This family consists of the C-terminal region of several eukaryotic and archaeal RuvB-like 1 (Pontin or TIP49a) and RuvB-like 2 (Reptin or TIP49b) proteins Back     alignment and domain information
>TIGR02329 propionate_PrpR propionate catabolism operon regulatory protein PrpR Back     alignment and domain information
>PRK14969 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>smart00350 MCM minichromosome maintenance proteins Back     alignment and domain information
>KOG0991 consensus Replication factor C, subunit RFC2 [Replication, recombination and repair] Back     alignment and domain information
>KOG1514 consensus Origin recognition complex, subunit 1, and related proteins [Replication, recombination and repair] Back     alignment and domain information
>PRK07764 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK14965 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>TIGR02974 phageshock_pspF psp operon transcriptional activator PspF Back     alignment and domain information
>PRK14951 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14959 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PF12775 AAA_7: P-loop containing dynein motor region D3; PDB: 4AKI_A 4AI6_B 4AKH_A 4AKG_A 3QMZ_A 3VKH_A 3VKG_A Back     alignment and domain information
>TIGR02031 BchD-ChlD magnesium chelatase ATPase subunit D Back     alignment and domain information
>PF05621 TniB: Bacterial TniB protein; InterPro: IPR008868 This family consists of several bacterial TniB NTP-binding proteins Back     alignment and domain information
>PRK11331 5-methylcytosine-specific restriction enzyme subunit McrB; Provisional Back     alignment and domain information
>TIGR02442 Cob-chelat-sub cobaltochelatase subunit Back     alignment and domain information
>PRK13341 recombination factor protein RarA/unknown domain fusion protein; Reviewed Back     alignment and domain information
>PRK14948 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK05022 anaerobic nitric oxide reductase transcription regulator; Provisional Back     alignment and domain information
>PRK07133 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK05896 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK07399 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>TIGR01817 nifA Nif-specific regulatory protein Back     alignment and domain information
>TIGR02902 spore_lonB ATP-dependent protease LonB Back     alignment and domain information
>PRK11388 DNA-binding transcriptional regulator DhaR; Provisional Back     alignment and domain information
>PRK14970 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>TIGR02397 dnaX_nterm DNA polymerase III, subunit gamma and tau Back     alignment and domain information
>TIGR00602 rad24 checkpoint protein rad24 Back     alignment and domain information
>COG0470 HolB ATPase involved in DNA replication [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK11608 pspF phage shock protein operon transcriptional activator; Provisional Back     alignment and domain information
>PF07728 AAA_5: AAA domain (dynein-related subfamily); InterPro: IPR011704 The ATPases Associated to a variety of cellular Activities (AAA) are a family distinguished by a highly conserved module of 230 amino acids [] Back     alignment and domain information
>PRK07993 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>TIGR02915 PEP_resp_reg putative PEP-CTERM system response regulator Back     alignment and domain information
>PRK06871 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PF14532 Sigma54_activ_2: Sigma-54 interaction domain; PDB: 3CO5_B 3N70_H Back     alignment and domain information
>PRK14955 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK06305 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK00149 dnaA chromosomal replication initiation protein; Reviewed Back     alignment and domain information
>PF13177 DNA_pol3_delta2: DNA polymerase III, delta subunit; PDB: 1NJF_B 3GLG_G 1XXH_I 1NJG_A 3GLF_B 3GLI_G 1IQP_E 2GNO_A 1SXJ_E 1A5T_A Back     alignment and domain information
>PRK15429 formate hydrogenlyase transcriptional activator FhlA; Provisional Back     alignment and domain information
>PRK10820 DNA-binding transcriptional regulator TyrR; Provisional Back     alignment and domain information
>COG2812 DnaX DNA polymerase III, gamma/tau subunits [DNA replication, recombination, and repair] Back     alignment and domain information
>TIGR00362 DnaA chromosomal replication initiator protein DnaA Back     alignment and domain information
>COG5271 MDN1 AAA ATPase containing von Willebrand factor type A (vWA) domain [General function prediction only] Back     alignment and domain information
>PRK13407 bchI magnesium chelatase subunit I; Provisional Back     alignment and domain information
>KOG0990 consensus Replication factor C, subunit RFC5 [Replication, recombination and repair] Back     alignment and domain information
>PRK14953 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>TIGR02928 orc1/cdc6 family replication initiation protein Back     alignment and domain information
>PRK08058 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK13531 regulatory ATPase RavA; Provisional Back     alignment and domain information
>PRK06647 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK06964 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK10923 glnG nitrogen regulation protein NR(I); Provisional Back     alignment and domain information
>PRK08769 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK00411 cdc6 cell division control protein 6; Reviewed Back     alignment and domain information
>PRK14954 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK11331 5-methylcytosine-specific restriction enzyme subunit McrB; Provisional Back     alignment and domain information
>PRK08903 DnaA regulatory inactivator Hda; Validated Back     alignment and domain information
>PRK09111 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>TIGR03420 DnaA_homol_Hda DnaA regulatory inactivator Hda Back     alignment and domain information
>COG1221 PspF Transcriptional regulators containing an AAA-type ATPase domain and a DNA-binding domain [Transcription / Signal transduction mechanisms] Back     alignment and domain information
>PRK14088 dnaA chromosomal replication initiation protein; Provisional Back     alignment and domain information
>KOG1942 consensus DNA helicase, TBP-interacting protein [Replication, recombination and repair] Back     alignment and domain information
>PRK14950 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>COG1220 HslU ATP-dependent protease HslVU (ClpYQ), ATPase subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK11361 acetoacetate metabolism regulatory protein AtoC; Provisional Back     alignment and domain information
>CHL00081 chlI Mg-protoporyphyrin IX chelatase Back     alignment and domain information
>KOG2227 consensus Pre-initiation complex, subunit CDC6, AAA+ superfamily ATPase [Replication, recombination and repair; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PRK08699 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PF13173 AAA_14: AAA domain Back     alignment and domain information
>PRK08451 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>COG5245 DYN1 Dynein, heavy chain [Cytoskeleton] Back     alignment and domain information
>PF14532 Sigma54_activ_2: Sigma-54 interaction domain; PDB: 3CO5_B 3N70_H Back     alignment and domain information
>TIGR02655 circ_KaiC circadian clock protein KaiC Back     alignment and domain information
>PF05729 NACHT: NACHT domain Back     alignment and domain information
>PTZ00112 origin recognition complex 1 protein; Provisional Back     alignment and domain information
>TIGR02442 Cob-chelat-sub cobaltochelatase subunit Back     alignment and domain information
>PF01637 Arch_ATPase: Archaeal ATPase; InterPro: IPR011579 This domain has been found in a number of bacterial and archaeal proteins, all of which contain a conserved P-loop motif that is involved in binding ATP Back     alignment and domain information
>TIGR01818 ntrC nitrogen regulation protein NR(I) Back     alignment and domain information
>PRK06090 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK15115 response regulator GlrR; Provisional Back     alignment and domain information
>TIGR00764 lon_rel lon-related putative ATP-dependent protease Back     alignment and domain information
>KOG1051 consensus Chaperone HSP104 and related ATP-dependent Clp proteases [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK06893 DNA replication initiation factor; Validated Back     alignment and domain information
>PRK12422 chromosomal replication initiation protein; Provisional Back     alignment and domain information
>KOG2680 consensus DNA helicase TIP49, TBP-interacting protein [Transcription] Back     alignment and domain information
>PRK14086 dnaA chromosomal replication initiation protein; Provisional Back     alignment and domain information
>KOG1969 consensus DNA replication checkpoint protein CHL12/CTF18 [Cell cycle control, cell division, chromosome partitioning; Replication, recombination and repair] Back     alignment and domain information
>PRK08116 hypothetical protein; Validated Back     alignment and domain information
>TIGR00368 Mg chelatase-related protein Back     alignment and domain information
>PF03215 Rad17: Rad17 cell cycle checkpoint protein Back     alignment and domain information
>PRK00440 rfc replication factor C small subunit; Reviewed Back     alignment and domain information
>PRK07952 DNA replication protein DnaC; Validated Back     alignment and domain information
>PF03152 UFD1: Ubiquitin fusion degradation protein UFD1; InterPro: IPR004854 Post-translational ubiquitin-protein conjugates are recognised for degradation by the ubiquitin fusion degradation (UFD) pathway Back     alignment and domain information
>PF07726 AAA_3: ATPase family associated with various cellular activities (AAA); InterPro: IPR011703 This entry includes some of the AAA proteins not detected by the IPR003959 from INTERPRO model Back     alignment and domain information
>PRK08116 hypothetical protein; Validated Back     alignment and domain information
>PRK14971 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK08084 DNA replication initiation factor; Provisional Back     alignment and domain information
>PRK08181 transposase; Validated Back     alignment and domain information
>TIGR02030 BchI-ChlI magnesium chelatase ATPase subunit I Back     alignment and domain information
>smart00763 AAA_PrkA PrkA AAA domain Back     alignment and domain information
>PF06068 TIP49: TIP49 C-terminus; InterPro: IPR010339 This family consists of the C-terminal region of several eukaryotic and archaeal RuvB-like 1 (Pontin or TIP49a) and RuvB-like 2 (Reptin or TIP49b) proteins Back     alignment and domain information
>PF01078 Mg_chelatase: Magnesium chelatase, subunit ChlI; InterPro: IPR000523 Magnesium-chelatase is a three-component enzyme that catalyses the insertion of Mg2+ into protoporphyrin IX Back     alignment and domain information
>PRK09302 circadian clock protein KaiC; Reviewed Back     alignment and domain information
>TIGR00368 Mg chelatase-related protein Back     alignment and domain information
>PRK12377 putative replication protein; Provisional Back     alignment and domain information
>PF00931 NB-ARC: NB-ARC domain; InterPro: IPR002182 This is the NB-ARC domain, a novel signalling motif found in bacteria and eukaryotes, shared by plant resistance gene products and regulators of cell death in animals [] Back     alignment and domain information
>COG1239 ChlI Mg-chelatase subunit ChlI [Coenzyme metabolism] Back     alignment and domain information
>COG2607 Predicted ATPase (AAA+ superfamily) [General function prediction only] Back     alignment and domain information
>PRK09112 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>TIGR00678 holB DNA polymerase III, delta' subunit Back     alignment and domain information
>PRK08181 transposase; Validated Back     alignment and domain information
>PRK06835 DNA replication protein DnaC; Validated Back     alignment and domain information
>COG0470 HolB ATPase involved in DNA replication [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK06526 transposase; Provisional Back     alignment and domain information
>COG3283 TyrR Transcriptional regulator of aromatic amino acids metabolism [Transcription / Amino acid transport and metabolism] Back     alignment and domain information
>PRK07471 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK10365 transcriptional regulatory protein ZraR; Provisional Back     alignment and domain information
>PRK05564 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>COG0606 Predicted ATPase with chaperone activity [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13401 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S_B Back     alignment and domain information
>TIGR02915 PEP_resp_reg putative PEP-CTERM system response regulator Back     alignment and domain information
>PF13173 AAA_14: AAA domain Back     alignment and domain information
>PTZ00111 DNA replication licensing factor MCM4; Provisional Back     alignment and domain information
>PF12774 AAA_6: Hydrolytic ATP binding site of dynein motor region D1; PDB: 3VKH_A 3VKG_A 4AKI_A 4AI6_B 4AKH_A 4AKG_A 3QMZ_A Back     alignment and domain information
>COG3284 AcoR Transcriptional activator of acetoin/glycerol metabolism [Secondary metabolites biosynthesis, transport, and catabolism / Transcription] Back     alignment and domain information
>COG1224 TIP49 DNA helicase TIP49, TBP-interacting protein [Transcription] Back     alignment and domain information
>PRK09183 transposase/IS protein; Provisional Back     alignment and domain information
>PRK08727 hypothetical protein; Validated Back     alignment and domain information
>PF01695 IstB_IS21: IstB-like ATP binding protein; InterPro: IPR002611 Proteins in this entry contain an ATP/GTP binding P-loop motif Back     alignment and domain information
>PRK05917 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK11361 acetoacetate metabolism regulatory protein AtoC; Provisional Back     alignment and domain information
>PRK12377 putative replication protein; Provisional Back     alignment and domain information
>PRK05642 DNA replication initiation factor; Validated Back     alignment and domain information
>PRK10923 glnG nitrogen regulation protein NR(I); Provisional Back     alignment and domain information
>PRK06526 transposase; Provisional Back     alignment and domain information
>PRK09862 putative ATP-dependent protease; Provisional Back     alignment and domain information
>COG1123 ATPase components of various ABC-type transport systems, contain duplicated ATPase [General function prediction only] Back     alignment and domain information
>PRK15115 response regulator GlrR; Provisional Back     alignment and domain information
>PRK09862 putative ATP-dependent protease; Provisional Back     alignment and domain information
>smart00350 MCM minichromosome maintenance proteins Back     alignment and domain information
>PF14516 AAA_35: AAA-like domain Back     alignment and domain information
>KOG3595 consensus Dyneins, heavy chain [Cytoskeleton] Back     alignment and domain information
>PRK09183 transposase/IS protein; Provisional Back     alignment and domain information
>PRK07952 DNA replication protein DnaC; Validated Back     alignment and domain information
>TIGR02237 recomb_radB DNA repair and recombination protein RadB Back     alignment and domain information
>COG3283 TyrR Transcriptional regulator of aromatic amino acids metabolism [Transcription / Amino acid transport and metabolism] Back     alignment and domain information
>PTZ00111 DNA replication licensing factor MCM4; Provisional Back     alignment and domain information
>TIGR00602 rad24 checkpoint protein rad24 Back     alignment and domain information
>PRK08939 primosomal protein DnaI; Reviewed Back     alignment and domain information
>COG1484 DnaC DNA replication protein [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK05707 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK06835 DNA replication protein DnaC; Validated Back     alignment and domain information
>PRK06921 hypothetical protein; Provisional Back     alignment and domain information
>COG1474 CDC6 Cdc6-related protein, AAA superfamily ATPase [DNA replication, recombination, and repair / Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK06921 hypothetical protein; Provisional Back     alignment and domain information
>PRK14087 dnaA chromosomal replication initiation protein; Provisional Back     alignment and domain information
>PRK06851 hypothetical protein; Provisional Back     alignment and domain information
>COG1220 HslU ATP-dependent protease HslVU (ClpYQ), ATPase subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK08058 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK13406 bchD magnesium chelatase subunit D; Provisional Back     alignment and domain information
>COG1239 ChlI Mg-chelatase subunit ChlI [Coenzyme metabolism] Back     alignment and domain information
>PRK10365 transcriptional regulatory protein ZraR; Provisional Back     alignment and domain information
>PF01695 IstB_IS21: IstB-like ATP binding protein; InterPro: IPR002611 Proteins in this entry contain an ATP/GTP binding P-loop motif Back     alignment and domain information
>PF13177 DNA_pol3_delta2: DNA polymerase III, delta subunit; PDB: 1NJF_B 3GLG_G 1XXH_I 1NJG_A 3GLF_B 3GLI_G 1IQP_E 2GNO_A 1SXJ_E 1A5T_A Back     alignment and domain information
>COG1241 MCM2 Predicted ATPase involved in replication control, Cdc46/Mcm family [DNA replication, recombination, and repair] Back     alignment and domain information
>smart00763 AAA_PrkA PrkA AAA domain Back     alignment and domain information
>KOG0478 consensus DNA replication licensing factor, MCM4 component [Replication, recombination and repair] Back     alignment and domain information
>PRK07399 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>KOG1970 consensus Checkpoint RAD17-RFC complex, RAD17/RAD24 component [Cell cycle control, cell division, chromosome partitioning; Replication, recombination and repair] Back     alignment and domain information
>cd01120 RecA-like_NTPases RecA-like NTPases Back     alignment and domain information
>PRK08939 primosomal protein DnaI; Reviewed Back     alignment and domain information
>PF00308 Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013317 This entry represents the central domain of bacterial DnaA proteins [, , ] that play an important role in initiating and regulating chromosomal replication Back     alignment and domain information
>PF13401 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S_B Back     alignment and domain information
>TIGR02031 BchD-ChlD magnesium chelatase ATPase subunit D Back     alignment and domain information
>COG3267 ExeA Type II secretory pathway, component ExeA (predicted ATPase) [Intracellular trafficking and secretion] Back     alignment and domain information
>cd01120 RecA-like_NTPases RecA-like NTPases Back     alignment and domain information
>TIGR01818 ntrC nitrogen regulation protein NR(I) Back     alignment and domain information
>KOG0990 consensus Replication factor C, subunit RFC5 [Replication, recombination and repair] Back     alignment and domain information
>PF00910 RNA_helicase: RNA helicase; InterPro: IPR000605 Helicases have been classified in 5 superfamilies (SF1-SF5) Back     alignment and domain information
>COG1484 DnaC DNA replication protein [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK06964 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>COG0606 Predicted ATPase with chaperone activity [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK13765 ATP-dependent protease Lon; Provisional Back     alignment and domain information
>KOG2170 consensus ATPase of the AAA+ superfamily [General function prediction only] Back     alignment and domain information
>PRK07132 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>COG3284 AcoR Transcriptional activator of acetoin/glycerol metabolism [Secondary metabolites biosynthesis, transport, and catabolism / Transcription] Back     alignment and domain information
>TIGR01618 phage_P_loop phage nucleotide-binding protein Back     alignment and domain information
>PRK05818 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK09361 radB DNA repair and recombination protein RadB; Provisional Back     alignment and domain information
>PRK07276 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK06620 hypothetical protein; Validated Back     alignment and domain information
>PRK09087 hypothetical protein; Validated Back     alignment and domain information
>TIGR02237 recomb_radB DNA repair and recombination protein RadB Back     alignment and domain information
>PRK04132 replication factor C small subunit; Provisional Back     alignment and domain information
>TIGR02012 tigrfam_recA protein RecA Back     alignment and domain information
>TIGR00764 lon_rel lon-related putative ATP-dependent protease Back     alignment and domain information
>PF12774 AAA_6: Hydrolytic ATP binding site of dynein motor region D1; PDB: 3VKH_A 3VKG_A 4AKI_A 4AI6_B 4AKH_A 4AKG_A 3QMZ_A Back     alignment and domain information
>PRK06871 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>cd00983 recA RecA is a bacterial enzyme which has roles in homologous recombination, DNA repair, and the induction of the SOS response Back     alignment and domain information
>cd01121 Sms Sms (bacterial radA) DNA repair protein Back     alignment and domain information
>COG1618 Predicted nucleotide kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>PF00493 MCM: MCM2/3/5 family This family extends the MCM domain of Prosite Back     alignment and domain information
>KOG1968 consensus Replication factor C, subunit RFC1 (large subunit) [Replication, recombination and repair] Back     alignment and domain information
>PF00910 RNA_helicase: RNA helicase; InterPro: IPR000605 Helicases have been classified in 5 superfamilies (SF1-SF5) Back     alignment and domain information
>PRK11823 DNA repair protein RadA; Provisional Back     alignment and domain information
>TIGR02012 tigrfam_recA protein RecA Back     alignment and domain information
>PHA00729 NTP-binding motif containing protein Back     alignment and domain information
>KOG0927 consensus Predicted transporter (ABC superfamily) [General function prediction only] Back     alignment and domain information
>PF03969 AFG1_ATPase: AFG1-like ATPase; InterPro: IPR005654 ATPase family gene 1 (AFG1) ATPase is a 377 amino acid putative protein with an ATPase motif typical of the protein family including SEC18p PAS1, CDC48-VCP and TBP Back     alignment and domain information
>PF13207 AAA_17: AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6_G 2QT1_A 2QSZ_A 2QSY_A 2QT0_A 2QG6_A 2P0E_A Back     alignment and domain information
>KOG1942 consensus DNA helicase, TBP-interacting protein [Replication, recombination and repair] Back     alignment and domain information
>PRK08118 topology modulation protein; Reviewed Back     alignment and domain information
>COG0488 Uup ATPase components of ABC transporters with duplicated ATPase domains [General function prediction only] Back     alignment and domain information
>cd01123 Rad51_DMC1_radA Rad51_DMC1_radA,B Back     alignment and domain information
>PRK07993 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>cd01394 radB RadB Back     alignment and domain information
>cd03216 ABC_Carb_Monos_I This family represents the domain I of the carbohydrate uptake proteins that transport only monosaccharides (Monos) Back     alignment and domain information
>PRK08533 flagellar accessory protein FlaH; Reviewed Back     alignment and domain information
>cd01131 PilT Pilus retraction ATPase PilT Back     alignment and domain information
>PRK07261 topology modulation protein; Provisional Back     alignment and domain information
>KOG2228 consensus Origin recognition complex, subunit 4 [Replication, recombination and repair] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query1052
1r7r_A 816 The Crystal Structure Of Murine P97VCP AT 3.6A Leng 2e-45
1r7r_A 816 The Crystal Structure Of Murine P97VCP AT 3.6A Leng 2e-23
3cf1_A 806 Structure Of P97VCP IN COMPLEX WITH ADPADP.ALFX Len 3e-45
3cf1_A 806 Structure Of P97VCP IN COMPLEX WITH ADPADP.ALFX Len 4e-23
2x8a_A274 Human Nuclear Valosin Containing Protein Like (Nvl) 7e-31
3cf0_A301 Structure Of D2 Subdomain Of P97VCP IN COMPLEX WITH 1e-30
1e32_A458 Structure Of The N-Terminal Domain And The D1 Aaa D 2e-23
3hu3_A489 Structure Of P97 N-D1 R155h Mutant In Complex With 3e-23
3hu2_A489 Structure Of P97 N-D1 R86a Mutant In Complex With A 3e-23
3hu1_A489 Structure Of P97 N-D1 R95g Mutant In Complex With A 3e-23
4b4t_K428 Near-Atomic Resolution Structural Model Of The Yeas 5e-22
4b4t_L437 Near-Atomic Resolution Structural Model Of The Yeas 6e-22
4b4t_J405 Near-Atomic Resolution Structural Model Of The Yeas 7e-22
3h4m_A285 Aaa Atpase Domain Of The Proteasome- Activating Nuc 1e-21
2rko_A331 Crystal Structure Of The Vps4p-Dimer Length = 331 5e-20
2qp9_X355 Crystal Structure Of S.Cerevisiae Vps4 Length = 355 9e-20
3eih_A340 Crystal Structure Of S.Cerevisiae Vps4 In The Prese 1e-19
3eie_A322 Crystal Structure Of S.Cerevisiae Vps4 In The So4-B 1e-19
4b4t_I437 Near-Atomic Resolution Structural Model Of The Yeas 1e-18
4b4t_H467 Near-Atomic Resolution Structural Model Of The Yeas 1e-18
4b4t_M434 Near-Atomic Resolution Structural Model Of The Yeas 8e-18
2zam_A 444 Crystal Structure Of Mouse Skd1VPS4B APO-Form Lengt 2e-17
1xwi_A 322 Crystal Structure Of Vps4b Length = 322 2e-17
2ce7_A 476 Edta Treated Length = 476 3e-17
3kds_E 465 Apo-ftsh Crystal Structure Length = 465 1e-16
3b9p_A297 Spastin Length = 297 2e-16
2dhr_A 499 Whole Cytosolic Region Of Atp-Dependent Metalloprot 4e-16
4eiw_A 508 Whole Cytosolic Region Of Atp-Dependent Metalloprot 4e-16
1lv7_A257 Crystal Structure Of The Aaa Domain Of Ftsh Length 6e-16
1ixz_A254 Crystal Structure Of The Ftsh Atpase Domain From Th 7e-16
1iy2_A278 Crystal Structure Of The Ftsh Atpase Domain From Th 8e-16
3vfd_A389 Human Spastin Aaa Domain Length = 389 1e-14
1wlf_A179 Structure Of The N-Terminal Domain Of Pex1 Aaa-Atpa 1e-14
2qz4_A262 Human Paraplegin, Aaa Domain In Complex With Adp Le 3e-14
3d8b_A357 Crystal Structure Of Human Fidgetin-Like Protein 1 3e-14
2r62_A268 Crystal Structure Of Helicobacter Pylori Atp Depend 2e-12
1ofh_A310 Asymmetric Complex Between Hslv And I-domain Delete 3e-04
>pdb|1R7R|A Chain A, The Crystal Structure Of Murine P97VCP AT 3.6A Length = 816 Back     alignment and structure 
Iteration: 1

 Score =  181 bits (458), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 135/413 (32%), Positives = 207/413 (50%), Gaps = 39/413 (9%)
Query: 582 FSTYHLPLPGHILIHGPPGSGKTSLAKAVAKSLEHHKDLVAHIVFVCCSRLSLEKGPIIR 641
           F    +  P  IL++GPPG+GKT +A+AVA        L+     +  S+L+ E    +R
Sbjct: 230 FKAIGVKPPRGILLYGPPGTGKTLIARAVANETGAFFFLINGPEIM--SKLAGESESNLR 287
Query: 642 QALSNFISEALDHAPSIVIFDNLXXXXXXXXXXXXXXXXXXVIALTKFLVDIMDEYGEKR 701
           +A      EA  +AP+I+  D L                  V  L    + +MD  G K+
Sbjct: 288 KAFE----EAEKNAPAIIFIDELDAIAPKREKTHGEVERRIVSQL----LTLMD--GLKQ 337
Query: 702 KSSCGIGPIAFVASAQSLEKIPQSLTSSGRFDFHVQLPAPAASERKAILEHEIQRRSLEC 761
           ++      +  +A+      I  +L   GRFD  V +  P A+ R  IL+  I  ++++ 
Sbjct: 338 RAH-----VIVMAATNRPNSIDPALRRFGRFDREVDIGIPDATGRLEILQ--IHTKNMKL 390
Query: 762 SDEILLD-VASKCDGYDAYDLEILVDRTVHAAVGRYLH----SDSSFEKHIKPTL--VRD 814
           +D++ L+ VA++  G+   DL  L       A+ + +      D + +  +  +L    D
Sbjct: 391 ADDVDLEQVANETHGHVGADLAALCSEAALQAIRKKMDLIDLEDETIDAEVMNSLAVTMD 450
Query: 815 DFSQAMHEFLPVAMRDITKTSAEGGRSGWDDVGGLTDIQNAIKEMIELPSKFPNIFAQAP 874
           DF  A+ +  P A+R+   T  E  +  W+D+GGL D++  ++E+++ P + P+ F +  
Sbjct: 451 DFRWALSQSNPSALRE---TVVEVPQVTWEDIGGLEDVKRELQELVQYPVEHPDKFLKFG 507
Query: 875 LRLRSNVLLYGPPGCGKTHIVGAAAAACSLRFISVKGPELLNKYIGASEQAVRDIFSKAT 934
           +     VL YGPPGCGKT +  A A  C   FIS+KGPELL  + G SE  VR+IF KA 
Sbjct: 508 MTPSKGVLFYGPPGCGKTLLAKAIANECQANFISIKGPELLTMWFGESEANVREIFDKAR 567
Query: 935 AAAPCLLFFDEFDSIAPKR---GHDNTGVTDRVVNQV-------SSTSYLFII 977
            AAPC+LFFDE DSIA  R     D  G  DRV+NQ+       S+   +FII
Sbjct: 568 QAAPCVLFFDELDSIAKARGGNIGDGGGAADRVINQILTEMDGMSTKKNVFII 620
>pdb|1R7R|A Chain A, The Crystal Structure Of Murine P97VCP AT 3.6A Length = 816 Back     alignment and structure
>pdb|3CF1|A Chain A, Structure Of P97VCP IN COMPLEX WITH ADPADP.ALFX Length = 806 Back     alignment and structure
>pdb|3CF1|A Chain A, Structure Of P97VCP IN COMPLEX WITH ADPADP.ALFX Length = 806 Back     alignment and structure
>pdb|2X8A|A Chain A, Human Nuclear Valosin Containing Protein Like (Nvl), C- Terminal Aaa-Atpase Domain Length = 274 Back     alignment and structure
>pdb|3CF0|A Chain A, Structure Of D2 Subdomain Of P97VCP IN COMPLEX WITH ADP Length = 301 Back     alignment and structure
>pdb|1E32|A Chain A, Structure Of The N-Terminal Domain And The D1 Aaa Domain Of Membrane Fusion Atpase P97 Length = 458 Back     alignment and structure
>pdb|3HU3|A Chain A, Structure Of P97 N-D1 R155h Mutant In Complex With Atpgs Length = 489 Back     alignment and structure
>pdb|3HU2|A Chain A, Structure Of P97 N-D1 R86a Mutant In Complex With Atpgs Length = 489 Back     alignment and structure
>pdb|3HU1|A Chain A, Structure Of P97 N-D1 R95g Mutant In Complex With Atpgs Length = 489 Back     alignment and structure
>pdb|4B4T|K Chain K, Near-Atomic Resolution Structural Model Of The Yeast 26s Proteasome Length = 428 Back     alignment and structure
>pdb|4B4T|L Chain L, Near-Atomic Resolution Structural Model Of The Yeast 26s Proteasome Length = 437 Back     alignment and structure
>pdb|4B4T|J Chain J, Near-Atomic Resolution Structural Model Of The Yeast 26s Proteasome Length = 405 Back     alignment and structure
>pdb|3H4M|A Chain A, Aaa Atpase Domain Of The Proteasome- Activating Nucleotidase Length = 285 Back     alignment and structure
>pdb|2RKO|A Chain A, Crystal Structure Of The Vps4p-Dimer Length = 331 Back     alignment and structure
>pdb|2QP9|X Chain X, Crystal Structure Of S.Cerevisiae Vps4 Length = 355 Back     alignment and structure
>pdb|3EIH|A Chain A, Crystal Structure Of S.Cerevisiae Vps4 In The Presence Of Atpgammas Length = 340 Back     alignment and structure
>pdb|3EIE|A Chain A, Crystal Structure Of S.Cerevisiae Vps4 In The So4-Bound State Length = 322 Back     alignment and structure
>pdb|4B4T|I Chain I, Near-Atomic Resolution Structural Model Of The Yeast 26s Proteasome Length = 437 Back     alignment and structure
>pdb|4B4T|H Chain H, Near-Atomic Resolution Structural Model Of The Yeast 26s Proteasome Length = 467 Back     alignment and structure
>pdb|4B4T|M Chain M, Near-Atomic Resolution Structural Model Of The Yeast 26s Proteasome Length = 434 Back     alignment and structure
>pdb|2ZAM|A Chain A, Crystal Structure Of Mouse Skd1VPS4B APO-Form Length = 444 Back     alignment and structure
>pdb|1XWI|A Chain A, Crystal Structure Of Vps4b Length = 322 Back     alignment and structure
>pdb|2CE7|A Chain A, Edta Treated Length = 476 Back     alignment and structure
>pdb|3KDS|E Chain E, Apo-ftsh Crystal Structure Length = 465 Back     alignment and structure
>pdb|3B9P|A Chain A, Spastin Length = 297 Back     alignment and structure
>pdb|2DHR|A Chain A, Whole Cytosolic Region Of Atp-Dependent Metalloprotease Ftsh (G399l) Length = 499 Back     alignment and structure
>pdb|4EIW|A Chain A, Whole Cytosolic Region Of Atp-Dependent Metalloprotease Ftsh (G399l) Length = 508 Back     alignment and structure
>pdb|1LV7|A Chain A, Crystal Structure Of The Aaa Domain Of Ftsh Length = 257 Back     alignment and structure
>pdb|1IXZ|A Chain A, Crystal Structure Of The Ftsh Atpase Domain From Thermus Thermophilus Length = 254 Back     alignment and structure
>pdb|1IY2|A Chain A, Crystal Structure Of The Ftsh Atpase Domain From Thermus Thermophilus Length = 278 Back     alignment and structure
>pdb|3VFD|A Chain A, Human Spastin Aaa Domain Length = 389 Back     alignment and structure
>pdb|1WLF|A Chain A, Structure Of The N-Terminal Domain Of Pex1 Aaa-Atpase: Characterization Of A Putative Adaptor-Binding Domain Length = 179 Back     alignment and structure
>pdb|2QZ4|A Chain A, Human Paraplegin, Aaa Domain In Complex With Adp Length = 262 Back     alignment and structure
>pdb|3D8B|A Chain A, Crystal Structure Of Human Fidgetin-Like Protein 1 In Complex With Adp Length = 357 Back     alignment and structure
>pdb|2R62|A Chain A, Crystal Structure Of Helicobacter Pylori Atp Dependent Protease, Ftsh Length = 268 Back     alignment and structure
>pdb|1OFH|A Chain A, Asymmetric Complex Between Hslv And I-domain Deleted Hslu (h. Influenzae) Length = 310 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query1052
1ypw_A 806 Transitional endoplasmic reticulum ATPase; AAA, P9 1e-118
1ypw_A 806 Transitional endoplasmic reticulum ATPase; AAA, P9 9e-42
1ypw_A806 Transitional endoplasmic reticulum ATPase; AAA, P9 2e-24
2x8a_A274 Nuclear valosin-containing protein-like; nuclear p 4e-74
2x8a_A274 Nuclear valosin-containing protein-like; nuclear p 2e-18
3cf0_A 301 Transitional endoplasmic reticulum ATPase; AAA, P9 1e-65
3cf0_A301 Transitional endoplasmic reticulum ATPase; AAA, P9 2e-18
1wlf_A179 PEX1, peroxisome biogenesis factor 1; N-terminal d 6e-49
3hu3_A 489 Transitional endoplasmic reticulum ATPase; VCP, tr 5e-43
3hu3_A489 Transitional endoplasmic reticulum ATPase; VCP, tr 4e-27
3eie_A 322 Vacuolar protein sorting-associated protein 4; AAA 6e-43
3eie_A322 Vacuolar protein sorting-associated protein 4; AAA 1e-14
2qp9_X 355 Vacuolar protein sorting-associated protein 4; ATP 5e-42
2qp9_X355 Vacuolar protein sorting-associated protein 4; ATP 1e-12
1xwi_A 322 SKD1 protein; VPS4B, AAA ATPase, protein transport 1e-41
1xwi_A322 SKD1 protein; VPS4B, AAA ATPase, protein transport 9e-15
3h4m_A285 Proteasome-activating nucleotidase; ATPase, PAN, A 1e-40
3h4m_A285 Proteasome-activating nucleotidase; ATPase, PAN, A 2e-13
2zan_A 444 Vacuolar protein sorting-associating protein 4B; S 4e-39
2zan_A444 Vacuolar protein sorting-associating protein 4B; S 1e-13
3t15_A293 Ribulose bisphosphate carboxylase/oxygenase activ 6e-38
3t15_A293 Ribulose bisphosphate carboxylase/oxygenase activ 3e-14
3b9p_A297 CG5977-PA, isoform A; AAA ATPase, ATP-binding, nuc 9e-38
3b9p_A297 CG5977-PA, isoform A; AAA ATPase, ATP-binding, nuc 1e-15
3d8b_A 357 Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, s 4e-37
3d8b_A357 Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, s 5e-16
3vfd_A 389 Spastin; ATPase, microtubule severing, hydrolase; 5e-37
3vfd_A389 Spastin; ATPase, microtubule severing, hydrolase; 5e-16
1d2n_A272 N-ethylmaleimide-sensitive fusion protein; hexamer 6e-31
1d2n_A272 N-ethylmaleimide-sensitive fusion protein; hexamer 1e-12
1iy2_A278 ATP-dependent metalloprotease FTSH; AAA domain fol 3e-18
1iy2_A278 ATP-dependent metalloprotease FTSH; AAA domain fol 1e-06
1ixz_A254 ATP-dependent metalloprotease FTSH; AAA domain fol 8e-18
1ixz_A254 ATP-dependent metalloprotease FTSH; AAA domain fol 1e-06
1lv7_A257 FTSH; alpha/beta domain, four helix bundle, hydrol 1e-17
1lv7_A257 FTSH; alpha/beta domain, four helix bundle, hydrol 6e-07
2r62_A268 Cell division protease FTSH homolog; ATPase domain 7e-17
2r62_A268 Cell division protease FTSH homolog; ATPase domain 6e-06
2qz4_A262 Paraplegin; AAA+, SPG7, protease, ADP, structural 2e-16
2qz4_A262 Paraplegin; AAA+, SPG7, protease, ADP, structural 6e-07
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 3e-14
2dhr_A 499 FTSH; AAA+ protein, hexameric Zn metalloprotease, 4e-13
2ce7_A 476 Cell division protein FTSH; metalloprotease; HET: 2e-12
1sxj_A516 Activator 1 95 kDa subunit; clamp loader, processi 2e-10
3syl_A309 Protein CBBX; photosynthesis, rubisco activase, AA 7e-10
3syl_A309 Protein CBBX; photosynthesis, rubisco activase, AA 1e-09
2chq_A319 Replication factor C small subunit; DNA-binding pr 2e-08
1iqp_A327 RFCS; clamp loader, extended AAA-ATPase domain, co 1e-07
1sxj_C340 Activator 1 40 kDa subunit; clamp loader, processi 9e-07
1sxj_B323 Activator 1 37 kDa subunit; clamp loader, processi 1e-06
2chg_A226 Replication factor C small subunit; DNA-binding pr 2e-06
1fnn_A389 CDC6P, cell division control protein 6; ORC1, AAA 9e-06
2qby_B384 CDC6 homolog 3, cell division control protein 6 ho 1e-05
3ec2_A180 DNA replication protein DNAC; helicase loader, rep 2e-05
2qby_A386 CDC6 homolog 1, cell division control protein 6 ho 3e-05
2qgz_A308 Helicase loader, putative primosome component; str 3e-05
2w58_A202 DNAI, primosome component (helicase loader); ATP-b 4e-05
1sxj_E354 Activator 1 40 kDa subunit; clamp loader, processi 6e-05
1sxj_D353 Activator 1 41 kDa subunit; clamp loader, processi 7e-05
2c9o_A 456 RUVB-like 1; hexameric helicase, AAA+-ATPase, ATP- 9e-05
2c9o_A456 RUVB-like 1; hexameric helicase, AAA+-ATPase, ATP- 2e-04
3nbx_X500 ATPase RAVA; AAA+ ATPase, alpha-beta-alpha structu 2e-04
2rhm_A193 Putative kinase; P-loop containing nucleoside trip 3e-04
>2x8a_A Nuclear valosin-containing protein-like; nuclear protein; 2.60A {Homo sapiens} Length = 274 Back     alignment and structure
>2x8a_A Nuclear valosin-containing protein-like; nuclear protein; 2.60A {Homo sapiens} Length = 274 Back     alignment and structure
>3cf0_A Transitional endoplasmic reticulum ATPase; AAA, P97/VCP, ERAD, CDC48, ATP-binding, lipid-binding, nucle binding, nucleus, phosphoprotein, transport; HET: ADP; 3.00A {Mus musculus} Length = 301 Back     alignment and structure
>3cf0_A Transitional endoplasmic reticulum ATPase; AAA, P97/VCP, ERAD, CDC48, ATP-binding, lipid-binding, nucle binding, nucleus, phosphoprotein, transport; HET: ADP; 3.00A {Mus musculus} Length = 301 Back     alignment and structure
>1wlf_A PEX1, peroxisome biogenesis factor 1; N-terminal domain, protein transport; 2.05A {Mus musculus} SCOP: b.52.2.3 d.31.1.1 Length = 179 Back     alignment and structure
>3hu3_A Transitional endoplasmic reticulum ATPase; VCP, transport protein; HET: AGS; 2.20A {Homo sapiens} PDB: 3hu2_A* 3hu1_A* 1e32_A* 1s3s_A* 2pjh_B Length = 489 Back     alignment and structure
>3hu3_A Transitional endoplasmic reticulum ATPase; VCP, transport protein; HET: AGS; 2.20A {Homo sapiens} PDB: 3hu2_A* 3hu1_A* 1e32_A* 1s3s_A* 2pjh_B Length = 489 Back     alignment and structure
>3eie_A Vacuolar protein sorting-associated protein 4; AAA ATPase, ATP-binding cassette, ATP-binding, endosome, MEM nucleotide-binding; 2.70A {Saccharomyces cerevisiae} PDB: 3eih_A* 2rko_A 3mhv_C Length = 322 Back     alignment and structure
>3eie_A Vacuolar protein sorting-associated protein 4; AAA ATPase, ATP-binding cassette, ATP-binding, endosome, MEM nucleotide-binding; 2.70A {Saccharomyces cerevisiae} PDB: 3eih_A* 2rko_A 3mhv_C Length = 322 Back     alignment and structure
>2qp9_X Vacuolar protein sorting-associated protein 4; ATPase domain, beta domain, C-terminal helix, ATP-binding, E nucleotide-binding; 2.90A {Saccharomyces cerevisiae} PDB: 2qpa_A* Length = 355 Back     alignment and structure
>2qp9_X Vacuolar protein sorting-associated protein 4; ATPase domain, beta domain, C-terminal helix, ATP-binding, E nucleotide-binding; 2.90A {Saccharomyces cerevisiae} PDB: 2qpa_A* Length = 355 Back     alignment and structure
>1xwi_A SKD1 protein; VPS4B, AAA ATPase, protein transport; 2.80A {Homo sapiens} Length = 322 Back     alignment and structure
>1xwi_A SKD1 protein; VPS4B, AAA ATPase, protein transport; 2.80A {Homo sapiens} Length = 322 Back     alignment and structure
>3h4m_A Proteasome-activating nucleotidase; ATPase, PAN, ATP-binding, nucleotide-binding, HY; HET: ADP; 3.11A {Methanocaldococcus jannaschii} Length = 285 Back     alignment and structure
>3h4m_A Proteasome-activating nucleotidase; ATPase, PAN, ATP-binding, nucleotide-binding, HY; HET: ADP; 3.11A {Methanocaldococcus jannaschii} Length = 285 Back     alignment and structure
>2zan_A Vacuolar protein sorting-associating protein 4B; SKD1, VPS4B, AAA ATPase, ATP-binding, coiled coil, membrane, nucleotide-binding, phosphorylation; HET: ATP; 3.00A {Mus musculus} PDB: 2zam_A* 2zao_A* 2jqh_A 2jqk_A 1wr0_A 2jq9_A 2k3w_A 1yxr_A Length = 444 Back     alignment and structure
>2zan_A Vacuolar protein sorting-associating protein 4B; SKD1, VPS4B, AAA ATPase, ATP-binding, coiled coil, membrane, nucleotide-binding, phosphorylation; HET: ATP; 3.00A {Mus musculus} PDB: 2zam_A* 2zao_A* 2jqh_A 2jqk_A 1wr0_A 2jq9_A 2k3w_A 1yxr_A Length = 444 Back     alignment and structure
>3t15_A Ribulose bisphosphate carboxylase/oxygenase activ chloroplastic; photosynthesis, rubisco activase, AAA+ protein; 2.95A {Nicotiana tabacum} PDB: 3zw6_A Length = 293 Back     alignment and structure
>3t15_A Ribulose bisphosphate carboxylase/oxygenase activ chloroplastic; photosynthesis, rubisco activase, AAA+ protein; 2.95A {Nicotiana tabacum} PDB: 3zw6_A Length = 293 Back     alignment and structure
>3b9p_A CG5977-PA, isoform A; AAA ATPase, ATP-binding, nucleotide-binding, hydrolase; 2.70A {Drosophila melanogaster} Length = 297 Back     alignment and structure
>3b9p_A CG5977-PA, isoform A; AAA ATPase, ATP-binding, nucleotide-binding, hydrolase; 2.70A {Drosophila melanogaster} Length = 297 Back     alignment and structure
>3d8b_A Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, structural genomics consortium, ATP- hydrolase, magnesium, metal-binding, nucleotide-binding; HET: ADP; 2.00A {Homo sapiens} Length = 357 Back     alignment and structure
>3d8b_A Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, structural genomics consortium, ATP- hydrolase, magnesium, metal-binding, nucleotide-binding; HET: ADP; 2.00A {Homo sapiens} Length = 357 Back     alignment and structure
>3vfd_A Spastin; ATPase, microtubule severing, hydrolase; 3.30A {Homo sapiens} Length = 389 Back     alignment and structure
>3vfd_A Spastin; ATPase, microtubule severing, hydrolase; 3.30A {Homo sapiens} Length = 389 Back     alignment and structure
>1d2n_A N-ethylmaleimide-sensitive fusion protein; hexamerization domain, ATPase, transport; HET: ANP; 1.75A {Cricetulus griseus} SCOP: c.37.1.20 PDB: 1nsf_A* Length = 272 Back     alignment and structure
>1d2n_A N-ethylmaleimide-sensitive fusion protein; hexamerization domain, ATPase, transport; HET: ANP; 1.75A {Cricetulus griseus} SCOP: c.37.1.20 PDB: 1nsf_A* Length = 272 Back     alignment and structure
>1iy2_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 3.20A {Thermus thermophilus} SCOP: c.37.1.20 Length = 278 Back     alignment and structure
>1iy2_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 3.20A {Thermus thermophilus} SCOP: c.37.1.20 Length = 278 Back     alignment and structure
>1ixz_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 2.20A {Thermus thermophilus} SCOP: c.37.1.20 PDB: 1iy0_A* 1iy1_A* Length = 254 Back     alignment and structure
>1ixz_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 2.20A {Thermus thermophilus} SCOP: c.37.1.20 PDB: 1iy0_A* 1iy1_A* Length = 254 Back     alignment and structure
>1lv7_A FTSH; alpha/beta domain, four helix bundle, hydrolase; 1.50A {Escherichia coli} SCOP: c.37.1.20 Length = 257 Back     alignment and structure
>1lv7_A FTSH; alpha/beta domain, four helix bundle, hydrolase; 1.50A {Escherichia coli} SCOP: c.37.1.20 Length = 257 Back     alignment and structure
>2r62_A Cell division protease FTSH homolog; ATPase domain, ATP-binding, cell CELL division, hydrolase, membrane, metal-binding; 3.30A {Helicobacter pylori} PDB: 2r65_A* Length = 268 Back     alignment and structure
>2r62_A Cell division protease FTSH homolog; ATPase domain, ATP-binding, cell CELL division, hydrolase, membrane, metal-binding; 3.30A {Helicobacter pylori} PDB: 2r65_A* Length = 268 Back     alignment and structure
>2qz4_A Paraplegin; AAA+, SPG7, protease, ADP, structural genomics, structural G consortium, SGC, ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.22A {Homo sapiens} Length = 262 Back     alignment and structure
>2qz4_A Paraplegin; AAA+, SPG7, protease, ADP, structural genomics, structural G consortium, SGC, ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.22A {Homo sapiens} Length = 262 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>2dhr_A FTSH; AAA+ protein, hexameric Zn metalloprotease, hydrolase; HET: ADP; 3.90A {Thermus thermophilus} Length = 499 Back     alignment and structure
>2ce7_A Cell division protein FTSH; metalloprotease; HET: ADP; 2.44A {Thermotoga maritima} SCOP: a.269.1.1 c.37.1.20 PDB: 2cea_A* 3kds_E* Length = 476 Back     alignment and structure
>1sxj_A Activator 1 95 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Length = 516 Back     alignment and structure
>3syl_A Protein CBBX; photosynthesis, rubisco activase, AAA+ protein, calvin cycle chaperone; 3.00A {Rhodobacter sphaeroides} PDB: 3syk_A 3zuh_A* Length = 309 Back     alignment and structure
>3syl_A Protein CBBX; photosynthesis, rubisco activase, AAA+ protein, calvin cycle chaperone; 3.00A {Rhodobacter sphaeroides} PDB: 3syk_A 3zuh_A* Length = 309 Back     alignment and structure
>2chq_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATP ATP-binding, nucleotide-binding; HET: ANP; 3.5A {Archaeoglobus fulgidus} PDB: 2chv_A Length = 319 Back     alignment and structure
>1iqp_A RFCS; clamp loader, extended AAA-ATPase domain, complex with ADP, replication; HET: ADP; 2.80A {Pyrococcus furiosus} SCOP: a.80.1.1 c.37.1.20 Length = 327 Back     alignment and structure
>1sxj_C Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Length = 340 Back     alignment and structure
>1sxj_B Activator 1 37 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Length = 323 Back     alignment and structure
>2chg_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATPase, ATP-binding, nucleotide-binding; HET: ANP; 2.1A {Archaeoglobus fulgidus} Length = 226 Back     alignment and structure
>1fnn_A CDC6P, cell division control protein 6; ORC1, AAA protein, DNA replication initation factor, cell cycle control factor; HET: ADP; 2.00A {Pyrobaculum aerophilum} SCOP: a.4.5.11 c.37.1.20 Length = 389 Back     alignment and structure
>2qby_B CDC6 homolog 3, cell division control protein 6 homolog 3; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} Length = 384 Back     alignment and structure
>3ec2_A DNA replication protein DNAC; helicase loader, replication initiation factor, ATP-binding, nucleotide-binding; HET: DNA ADP; 2.70A {Aquifex aeolicus} PDB: 3ecc_A* Length = 180 Back     alignment and structure
>2qby_A CDC6 homolog 1, cell division control protein 6 homolog 1; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} Length = 386 Back     alignment and structure
>2qgz_A Helicase loader, putative primosome component; structural genomics, PSI-2, protein structure initiative; 2.40A {Streptococcus pyogenes serotype M3} Length = 308 Back     alignment and structure
>2w58_A DNAI, primosome component (helicase loader); ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.50A {Geobacillus kaustophilus HTA426} Length = 202 Back     alignment and structure
>1sxj_E Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Length = 354 Back     alignment and structure
>1sxj_D Activator 1 41 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Length = 353 Back     alignment and structure
>2c9o_A RUVB-like 1; hexameric helicase, AAA+-ATPase, ATP-binding, chromatin regulator, growth regulation, hydrolase, nuclear protein, DNA recombination; HET: ADP; 2.2A {Homo sapiens} PDB: 2xsz_A* Length = 456 Back     alignment and structure
>2c9o_A RUVB-like 1; hexameric helicase, AAA+-ATPase, ATP-binding, chromatin regulator, growth regulation, hydrolase, nuclear protein, DNA recombination; HET: ADP; 2.2A {Homo sapiens} PDB: 2xsz_A* Length = 456 Back     alignment and structure
>3nbx_X ATPase RAVA; AAA+ ATPase, alpha-beta-alpha structure, rossman fold, hydro; HET: ADP; 2.91A {Escherichia coli} Length = 500 Back     alignment and structure
>2rhm_A Putative kinase; P-loop containing nucleoside triphosphate hydrolases fold, S genomics, joint center for structural genomics, JCSG; HET: MSE; 1.70A {Chloroflexus aurantiacus} Length = 193 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

No hit with probability above 80.00

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 1052
d1lv7a_256 c.37.1.20 (A:) AAA domain of cell division protein 1e-41
d1lv7a_256 c.37.1.20 (A:) AAA domain of cell division protein 8e-25
d1ixza_247 c.37.1.20 (A:) AAA domain of cell division protein 4e-41
d1ixza_247 c.37.1.20 (A:) AAA domain of cell division protein 2e-26
d1r7ra3265 c.37.1.20 (A:471-735) Membrane fusion ATPase VCP/p 7e-34
d1r7ra3265 c.37.1.20 (A:471-735) Membrane fusion ATPase VCP/p 6e-15
d1wlfa180 d.31.1.1 (A:100-179) Peroxisome biogenesis factor 2e-30
d1e32a2258 c.37.1.20 (A:201-458) Membrane fusion ATPase VCP/p 2e-29
d1e32a2258 c.37.1.20 (A:201-458) Membrane fusion ATPase VCP/p 4e-16
d1w44a_321 c.37.1.11 (A:) NTPase P4 {Bacteriophage phi-12 [Ta 1e-27
d1w44a_321 c.37.1.11 (A:) NTPase P4 {Bacteriophage phi-12 [Ta 9e-12
d1svma_362 c.37.1.20 (A:) Papillomavirus large T antigen heli 7e-13
d1svma_362 c.37.1.20 (A:) Papillomavirus large T antigen heli 3e-07
d1d2na_246 c.37.1.20 (A:) Hexamerization domain of N-ethylmal 9e-12
d1d2na_246 c.37.1.20 (A:) Hexamerization domain of N-ethylmal 6e-09
d1gvnb_273 c.37.1.21 (B:) Plasmid maintenance system epsilon/ 3e-10
d1gvnb_273 c.37.1.21 (B:) Plasmid maintenance system epsilon/ 3e-10
d1ofha_309 c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId 8e-10
d1ofha_309 c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId 5e-08
d1ixsb2239 c.37.1.20 (B:4-242) Holliday junction helicase Ruv 6e-09
d1ixsb2239 c.37.1.20 (B:4-242) Holliday junction helicase Ruv 5e-08
d1njfa_239 c.37.1.20 (A:) delta prime subunit of DNA polymera 3e-07
d1fnna2276 c.37.1.20 (A:1-276) CDC6, N-domain {Archaeon Pyrob 4e-07
d1fnna2276 c.37.1.20 (A:1-276) CDC6, N-domain {Archaeon Pyrob 6e-07
d1in4a2238 c.37.1.20 (A:17-254) Holliday junction helicase Ru 2e-06
d1in4a2238 c.37.1.20 (A:17-254) Holliday junction helicase Ru 5e-05
d2fnaa2283 c.37.1.20 (A:1-283) Archaeal ATPase SSO1545 {Sulfo 3e-06
d1a5ta2207 c.37.1.20 (A:1-207) delta prime subunit of DNA pol 6e-06
d1sxja2253 c.37.1.20 (A:295-547) Replication factor C1 {Baker 2e-05
d1sxja2253 c.37.1.20 (A:295-547) Replication factor C1 {Baker 4e-04
d1w5sa2287 c.37.1.20 (A:7-293) CDC6-like protein APE0152, N-t 5e-05
d1w5sa2287 c.37.1.20 (A:7-293) CDC6-like protein APE0152, N-t 0.001
d1g8pa_333 c.37.1.20 (A:) ATPase subunit of magnesium chelata 4e-04
d2i3ba1189 c.37.1.11 (A:1-189) Cancer-related NTPase, C1orf57 4e-04
d2bdta1176 c.37.1.25 (A:1-176) Hypothetical protein BH3686 {B 6e-04
d1qhxa_178 c.37.1.3 (A:) Chloramphenicol phosphotransferase { 8e-04
d1yj5a2172 c.37.1.1 (A:351-522) 5' polynucleotide kinase-3' p 9e-04
d2gnoa2198 c.37.1.20 (A:11-208) gamma subunit of DNA polymera 0.001
d1ckea_225 c.37.1.1 (A:) CMP kinase {Escherichia coli [TaxId: 0.001
d1lw7a2192 c.37.1.1 (A:220-411) Transcriptional regulator Nad 0.002
d1sxjd2237 c.37.1.20 (D:26-262) Replication factor C2 {Baker' 0.002
d1zp6a1176 c.37.1.25 (A:6-181) Hypothetical protein Atu3015 { 0.002
d1sxje2252 c.37.1.20 (E:4-255) Replication factor C5 {Baker's 0.002
d1g41a_443 c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId 0.002
d1g41a_ 443 c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId 0.004
d1khta_190 c.37.1.1 (A:) Adenylate kinase {Archaeon Methanoco 0.002
d1rkba_173 c.37.1.1 (A:) Adenylate kinase {Human (Homo sapien 0.003
d1ly1a_152 c.37.1.1 (A:) Polynucleotide kinase, kinase domain 0.003
d1y63a_174 c.37.1.1 (A:) Probable kinase LmjF30.1890 {Leishma 0.003
d1q3ta_223 c.37.1.1 (A:) CMP kinase {Streptococcus pneumoniae 0.003
d1kaga_169 c.37.1.2 (A:) Shikimate kinase (AroK) {Escherichia 0.004
d1m8pa3183 c.37.1.15 (A:391-573) ATP sulfurylase C-terminal d 0.004
d1zaka1189 c.37.1.1 (A:3-127,A:159-222) Adenylate kinase {Mai 0.004
>d1lv7a_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Escherichia coli [TaxId: 562]} Length = 256 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Extended AAA-ATPase domain
domain: AAA domain of cell division protein FtsH
species: Escherichia coli [TaxId: 562]

 Score =  151 bits (382), Expect = 1e-41
 Identities = 49/190 (25%), Positives = 81/190 (42%), Gaps = 46/190 (24%)

Query: 843  WDDVGGLTDIQNAIKEMIELPSKFPNIFAQAPLRLRSNVLLYGPPGCGKTHIVGAAAAAC 902
            + DV G  + +  + E++E   + P+ F +   ++   VL+ GPPG GKT +  A A   
Sbjct: 11   FADVAGCDEAKEEVAELVEYL-REPSRFQKLGGKIPKGVLMVGPPGTGKTLLAKAIAGEA 69

Query: 903  SLRFISVKGPELLNKYIGASEQAVRDIFSKATAAAPCLLFFDEFDSIAPKRGHDNTG--- 959
             + F ++ G + +  ++G     VRD+F +A  AAPC++F DE D++  +RG    G   
Sbjct: 70   KVPFFTISGSDFVEMFVGVGASRVRDMFEQAKKAAPCIIFIDEIDAVGRQRGAGLGGGHD 129

Query: 960  VTDRVVNQVSSTSYLFIIYFWEVGKKEGVVPYDIYILVNFLISACPCFQQFLTELDGVEV 1019
              ++ +N                                          Q L E+DG E 
Sbjct: 130  EREQTLN------------------------------------------QMLVEMDGFEG 147

Query: 1020 LTGVFVFAAT 1029
              G+ V AAT
Sbjct: 148  NEGIIVIAAT 157
>d1lv7a_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Escherichia coli [TaxId: 562]} Length = 256 Back     information, alignment and structure
>d1ixza_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Thermus thermophilus [TaxId: 274]} Length = 247 Back     information, alignment and structure
>d1ixza_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Thermus thermophilus [TaxId: 274]} Length = 247 Back     information, alignment and structure
>d1r7ra3 c.37.1.20 (A:471-735) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Length = 265 Back     information, alignment and structure
>d1r7ra3 c.37.1.20 (A:471-735) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Length = 265 Back     information, alignment and structure
>d1wlfa1 d.31.1.1 (A:100-179) Peroxisome biogenesis factor 1 (PEX-1), domain 2 {Mouse (Mus musculus) [TaxId: 10090]} Length = 80 Back     information, alignment and structure
>d1e32a2 c.37.1.20 (A:201-458) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Length = 258 Back     information, alignment and structure
>d1e32a2 c.37.1.20 (A:201-458) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Length = 258 Back     information, alignment and structure
>d1w44a_ c.37.1.11 (A:) NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} Length = 321 Back     information, alignment and structure
>d1w44a_ c.37.1.11 (A:) NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} Length = 321 Back     information, alignment and structure
>d1svma_ c.37.1.20 (A:) Papillomavirus large T antigen helicase domain {Simian virus 40 [TaxId: 10633]} Length = 362 Back     information, alignment and structure
>d1svma_ c.37.1.20 (A:) Papillomavirus large T antigen helicase domain {Simian virus 40 [TaxId: 10633]} Length = 362 Back     information, alignment and structure
>d1d2na_ c.37.1.20 (A:) Hexamerization domain of N-ethylmalemide-sensitive fusion (NSF) protein {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Length = 246 Back     information, alignment and structure
>d1d2na_ c.37.1.20 (A:) Hexamerization domain of N-ethylmalemide-sensitive fusion (NSF) protein {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Length = 246 Back     information, alignment and structure
>d1gvnb_ c.37.1.21 (B:) Plasmid maintenance system epsilon/zeta, toxin zeta subunit {Streptococcus pyogenes [TaxId: 1314]} Length = 273 Back     information, alignment and structure
>d1gvnb_ c.37.1.21 (B:) Plasmid maintenance system epsilon/zeta, toxin zeta subunit {Streptococcus pyogenes [TaxId: 1314]} Length = 273 Back     information, alignment and structure
>d1ofha_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Length = 309 Back     information, alignment and structure
>d1ofha_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Length = 309 Back     information, alignment and structure
>d1ixsb2 c.37.1.20 (B:4-242) Holliday junction helicase RuvB {Thermus thermophilus [TaxId: 274]} Length = 239 Back     information, alignment and structure
>d1ixsb2 c.37.1.20 (B:4-242) Holliday junction helicase RuvB {Thermus thermophilus [TaxId: 274]} Length = 239 Back     information, alignment and structure
>d1njfa_ c.37.1.20 (A:) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} Length = 239 Back     information, alignment and structure
>d1fnna2 c.37.1.20 (A:1-276) CDC6, N-domain {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Length = 276 Back     information, alignment and structure
>d1fnna2 c.37.1.20 (A:1-276) CDC6, N-domain {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Length = 276 Back     information, alignment and structure
>d1in4a2 c.37.1.20 (A:17-254) Holliday junction helicase RuvB {Thermotoga maritima [TaxId: 2336]} Length = 238 Back     information, alignment and structure
>d1in4a2 c.37.1.20 (A:17-254) Holliday junction helicase RuvB {Thermotoga maritima [TaxId: 2336]} Length = 238 Back     information, alignment and structure
>d2fnaa2 c.37.1.20 (A:1-283) Archaeal ATPase SSO1545 {Sulfolobus solfataricus [TaxId: 2287]} Length = 283 Back     information, alignment and structure
>d1a5ta2 c.37.1.20 (A:1-207) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} Length = 207 Back     information, alignment and structure
>d1sxja2 c.37.1.20 (A:295-547) Replication factor C1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 253 Back     information, alignment and structure
>d1sxja2 c.37.1.20 (A:295-547) Replication factor C1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 253 Back     information, alignment and structure
>d1w5sa2 c.37.1.20 (A:7-293) CDC6-like protein APE0152, N-terminal domain {Aeropyrum pernix [TaxId: 56636]} Length = 287 Back     information, alignment and structure
>d1w5sa2 c.37.1.20 (A:7-293) CDC6-like protein APE0152, N-terminal domain {Aeropyrum pernix [TaxId: 56636]} Length = 287 Back     information, alignment and structure
>d1g8pa_ c.37.1.20 (A:) ATPase subunit of magnesium chelatase, BchI {Rhodobacter capsulatus [TaxId: 1061]} Length = 333 Back     information, alignment and structure
>d2i3ba1 c.37.1.11 (A:1-189) Cancer-related NTPase, C1orf57 {Human (Homo sapiens) [TaxId: 9606]} Length = 189 Back     information, alignment and structure
>d2bdta1 c.37.1.25 (A:1-176) Hypothetical protein BH3686 {Bacillus halodurans [TaxId: 86665]} Length = 176 Back     information, alignment and structure
>d1qhxa_ c.37.1.3 (A:) Chloramphenicol phosphotransferase {Streptomyces venezuelae [TaxId: 54571]} Length = 178 Back     information, alignment and structure
>d1yj5a2 c.37.1.1 (A:351-522) 5' polynucleotide kinase-3' phosphatase, C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 172 Back     information, alignment and structure
>d2gnoa2 c.37.1.20 (A:11-208) gamma subunit of DNA polymerase III, N-domain {Thermotoga maritima [TaxId: 2336]} Length = 198 Back     information, alignment and structure
>d1ckea_ c.37.1.1 (A:) CMP kinase {Escherichia coli [TaxId: 562]} Length = 225 Back     information, alignment and structure
>d1lw7a2 c.37.1.1 (A:220-411) Transcriptional regulator NadR, ribosylnicotinamide kinase domain {Haemophilus influenzae [TaxId: 727]} Length = 192 Back     information, alignment and structure
>d1sxjd2 c.37.1.20 (D:26-262) Replication factor C2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 237 Back     information, alignment and structure
>d1zp6a1 c.37.1.25 (A:6-181) Hypothetical protein Atu3015 {Agrobacterium tumefaciens [TaxId: 358]} Length = 176 Back     information, alignment and structure
>d1sxje2 c.37.1.20 (E:4-255) Replication factor C5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 252 Back     information, alignment and structure
>d1g41a_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Length = 443 Back     information, alignment and structure
>d1g41a_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Length = 443 Back     information, alignment and structure
>d1khta_ c.37.1.1 (A:) Adenylate kinase {Archaeon Methanococcus voltae [TaxId: 2188]} Length = 190 Back     information, alignment and structure
>d1rkba_ c.37.1.1 (A:) Adenylate kinase {Human (Homo sapiens), isoenzyme 6 [TaxId: 9606]} Length = 173 Back     information, alignment and structure
>d1ly1a_ c.37.1.1 (A:) Polynucleotide kinase, kinase domain {Bacteriophage T4 [TaxId: 10665]} Length = 152 Back     information, alignment and structure
>d1y63a_ c.37.1.1 (A:) Probable kinase LmjF30.1890 {Leishmania major [TaxId: 5664]} Length = 174 Back     information, alignment and structure
>d1q3ta_ c.37.1.1 (A:) CMP kinase {Streptococcus pneumoniae [TaxId: 1313]} Length = 223 Back     information, alignment and structure
>d1kaga_ c.37.1.2 (A:) Shikimate kinase (AroK) {Escherichia coli [TaxId: 562]} Length = 169 Back     information, alignment and structure
>d1m8pa3 c.37.1.15 (A:391-573) ATP sulfurylase C-terminal domain {Fungus (Penicillium chrysogenum) [TaxId: 5076]} Length = 183 Back     information, alignment and structure
>d1zaka1 c.37.1.1 (A:3-127,A:159-222) Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} Length = 189 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query1052
d1lv7a_256 AAA domain of cell division protein FtsH {Escheric 100.0
d1ixza_247 AAA domain of cell division protein FtsH {Thermus 100.0
d1e32a2258 Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu 100.0
d1r7ra3265 Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu 100.0
d1lv7a_256 AAA domain of cell division protein FtsH {Escheric 100.0
d1ixza_247 AAA domain of cell division protein FtsH {Thermus 99.98
d1e32a2258 Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu 99.98
d1r7ra3265 Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu 99.96
d1w44a_321 NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} 99.95
d1wlfa180 Peroxisome biogenesis factor 1 (PEX-1), domain 2 { 99.94
d1d2na_246 Hexamerization domain of N-ethylmalemide-sensitive 99.89
d1ofha_309 HslU {Haemophilus influenzae [TaxId: 727]} 99.88
d1d2na_246 Hexamerization domain of N-ethylmalemide-sensitive 99.87
d1w44a_321 NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} 99.84
d1in4a2238 Holliday junction helicase RuvB {Thermotoga mariti 99.82
d1ofha_ 309 HslU {Haemophilus influenzae [TaxId: 727]} 99.81
d1ixsb2239 Holliday junction helicase RuvB {Thermus thermophi 99.79
d1iqpa2231 Replication factor C {Archaeon Pyrococcus furiosus 99.74
d1njfa_239 delta prime subunit of DNA polymerase III, N-domai 99.72
d1sxjc2227 Replication factor C3 {Baker's yeast (Saccharomyce 99.7
d1sxja2253 Replication factor C1 {Baker's yeast (Saccharomyce 99.7
d1sxjd2237 Replication factor C2 {Baker's yeast (Saccharomyce 99.68
d1sxjb2224 Replication factor C4 {Baker's yeast (Saccharomyce 99.68
d1r6bx2268 ClpA, an Hsp100 chaperone, AAA+ modules {Escherich 99.65
d1fnna2276 CDC6, N-domain {Archaeon Pyrobaculum aerophilum [T 99.65
d1sxje2252 Replication factor C5 {Baker's yeast (Saccharomyce 99.63
d1w5sa2287 CDC6-like protein APE0152, N-terminal domain {Aero 99.62
d1qvra2387 ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 99.6
d1r6bx3315 ClpA, an Hsp100 chaperone, AAA+ modules {Escherich 99.58
d1qvra3315 ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 99.57
d1in4a2238 Holliday junction helicase RuvB {Thermotoga mariti 99.57
d1wlfa287 Peroxisome biogenesis factor 1 (PEX-1), N-terminal 99.55
d1l8qa2213 Chromosomal replication initiation factor DnaA {Aq 99.55
d1a5ta2207 delta prime subunit of DNA polymerase III, N-domai 99.48
d1svma_362 Papillomavirus large T antigen helicase domain {Si 99.48
d1svma_362 Papillomavirus large T antigen helicase domain {Si 99.47
d1jbka_195 ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} 99.46
d1ixsb2239 Holliday junction helicase RuvB {Thermus thermophi 99.45
d1um8a_364 ClpX {Helicobacter pylori [TaxId: 210]} 99.42
d1r6bx3315 ClpA, an Hsp100 chaperone, AAA+ modules {Escherich 99.37
d1r6bx2268 ClpA, an Hsp100 chaperone, AAA+ modules {Escherich 99.37
d1g41a_443 HslU {Haemophilus influenzae [TaxId: 727]} 99.34
d1qvra3315 ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 99.32
d1sxja2253 Replication factor C1 {Baker's yeast (Saccharomyce 99.3
d1um8a_ 364 ClpX {Helicobacter pylori [TaxId: 210]} 99.29
d1g8pa_333 ATPase subunit of magnesium chelatase, BchI {Rhodo 99.26
d1iqpa2231 Replication factor C {Archaeon Pyrococcus furiosus 99.23
d1jbka_195 ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} 99.21
d1ny5a2247 Transcriptional activator sigm54 (NtrC1), C-termin 99.21
d1qvra2 387 ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 99.21
d1g41a_443 HslU {Haemophilus influenzae [TaxId: 727]} 99.1
d1njfa_239 delta prime subunit of DNA polymerase III, N-domai 99.09
d1sxjc2227 Replication factor C3 {Baker's yeast (Saccharomyce 99.07
d1g8pa_ 333 ATPase subunit of magnesium chelatase, BchI {Rhodo 99.04
d2fnaa2283 Archaeal ATPase SSO1545 {Sulfolobus solfataricus [ 99.04
d2gnoa2198 gamma subunit of DNA polymerase III, N-domain {The 99.03
d1sxjb2224 Replication factor C4 {Baker's yeast (Saccharomyce 99.0
d1sxje2252 Replication factor C5 {Baker's yeast (Saccharomyce 98.98
d1sxjd2237 Replication factor C2 {Baker's yeast (Saccharomyce 98.89
d1gvnb_273 Plasmid maintenance system epsilon/zeta, toxin zet 98.81
d1w5sa2287 CDC6-like protein APE0152, N-terminal domain {Aero 98.8
d1a5ta2207 delta prime subunit of DNA polymerase III, N-domai 98.63
d1ny5a2247 Transcriptional activator sigm54 (NtrC1), C-termin 98.62
d1fnna2276 CDC6, N-domain {Archaeon Pyrobaculum aerophilum [T 98.52
d2a5yb3277 CED-4, NB-ARC domain {Caenorhabditis elegans [TaxI 98.43
d1gvnb_273 Plasmid maintenance system epsilon/zeta, toxin zet 98.39
d1l8qa2213 Chromosomal replication initiation factor DnaA {Aq 98.38
d2gnoa2198 gamma subunit of DNA polymerase III, N-domain {The 98.23
d1ye8a1178 Hypothetical kinase-like protein Aq_1292 {Aquifex 98.21
d1tf7a2242 Circadian clock protein KaiC {Synechococcus sp. st 97.85
d1kaga_169 Shikimate kinase (AroK) {Escherichia coli [TaxId: 97.81
d2fnaa2283 Archaeal ATPase SSO1545 {Sulfolobus solfataricus [ 97.8
d1u94a1263 RecA protein, ATPase-domain {Escherichia coli [Tax 97.75
d1cr2a_277 Gene 4 protein (g4p, DNA primase), helicase domain 97.72
d1ye8a1178 Hypothetical kinase-like protein Aq_1292 {Aquifex 97.71
d1xp8a1268 RecA protein, ATPase-domain {Deinococcus radiodura 97.66
d1tf7a1242 Circadian clock protein KaiC {Synechococcus sp. st 97.64
d1mo6a1269 RecA protein, ATPase-domain {Mycobacterium tubercu 97.57
d1lw7a2192 Transcriptional regulator NadR, ribosylnicotinamid 97.52
d1viaa_161 Shikimate kinase (AroK) {Campylobacter jejuni [Tax 97.52
d2pmka1241 Haemolysin B ATP-binding protein {Escherichia coli 97.49
d1rkba_173 Adenylate kinase {Human (Homo sapiens), isoenzyme 97.45
d2iyva1165 Shikimate kinase (AroK) {Mycobacterium tuberculosi 97.45
d1p9ra_401 Extracellular secretion NTPase EpsE {Vibrio choler 97.43
d3b60a1253 Multidrug resistance ABC transporter MsbA, C-termi 97.43
d1lw7a2192 Transcriptional regulator NadR, ribosylnicotinamid 97.41
d1e6ca_170 Shikimate kinase (AroK) {Erwinia chrysanthemi [Tax 97.4
d1l2ta_230 MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 97.38
d1zaka1189 Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} 97.37
d1bifa1213 6-phosphofructo-2-kinase/fructose-2,6-bisphosphata 97.34
d1kaga_169 Shikimate kinase (AroK) {Escherichia coli [TaxId: 97.33
d3dhwc1240 Methionine import ATP-binding protein MetN {Escher 97.32
d1zp6a1176 Hypothetical protein Atu3015 {Agrobacterium tumefa 97.32
d2hyda1255 Putative multidrug export ATP-binding/permease pro 97.3
d1v43a3239 Hypothetical protein PH0022, N-terminal domain {Py 97.3
d1nlfa_274 Hexameric replicative helicase repA {Escherichia c 97.29
d1okkd2207 GTPase domain of the signal recognition particle r 97.28
d1rkba_173 Adenylate kinase {Human (Homo sapiens), isoenzyme 97.27
d1y63a_174 Probable kinase LmjF30.1890 {Leishmania major [Tax 97.27
d2i3ba1189 Cancer-related NTPase, C1orf57 {Human (Homo sapien 97.26
d1g2912240 Maltose transport protein MalK, N-terminal domain 97.25
d1w36d1359 Exodeoxyribonuclease V alpha chain (RecD) {Escheri 97.24
d1jj7a_251 Peptide transporter Tap1, C-terminal ABC domain {H 97.24
d1qhxa_178 Chloramphenicol phosphotransferase {Streptomyces v 97.18
d2qy9a2211 GTPase domain of the signal recognition particle r 97.17
d1qhxa_178 Chloramphenicol phosphotransferase {Streptomyces v 97.16
d2awna2232 Maltose transport protein MalK, N-terminal domain 97.15
d3d31a2229 Sulfate/molybdate ABC transporter, ATP-binding pro 97.15
d1oxxk2242 Glucose transport protein GlcV, N-terminal domain 97.12
d1tuea_205 Replication protein E1 helicase domain {Human papi 97.12
d1ak2a1190 Adenylate kinase {Cow (Bos taurus), mitochondrial 97.11
d3adka_194 Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} 97.07
d1m8pa3183 ATP sulfurylase C-terminal domain {Fungus (Penicil 97.07
d2bdta1176 Hypothetical protein BH3686 {Bacillus halodurans [ 97.07
d1ak2a1190 Adenylate kinase {Cow (Bos taurus), mitochondrial 97.07
d2iyva1165 Shikimate kinase (AroK) {Mycobacterium tuberculosi 97.06
d1p9ra_401 Extracellular secretion NTPase EpsE {Vibrio choler 97.03
d1e6ca_170 Shikimate kinase (AroK) {Erwinia chrysanthemi [Tax 97.03
d1y63a_174 Probable kinase LmjF30.1890 {Leishmania major [Tax 97.03
d1zp6a1176 Hypothetical protein Atu3015 {Agrobacterium tumefa 97.03
d1zina1182 Adenylate kinase {Bacillus stearothermophilus [Tax 97.02
d2bdta1176 Hypothetical protein BH3686 {Bacillus halodurans [ 97.02
d1knqa_171 Gluconate kinase {Escherichia coli [TaxId: 562]} 97.02
d1j8yf2211 GTPase domain of the signal sequence recognition p 97.02
d1knqa_171 Gluconate kinase {Escherichia coli [TaxId: 562]} 97.01
d1sgwa_200 Putative ABC transporter PF0895 {Pyrococcus furios 97.0
d1x6va3195 Adenosine-5'phosphosulfate kinase (APS kinase) {Hu 97.0
d1zaka1189 Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} 97.0
d1szpa2251 DNA repair protein Rad51, catalytic domain {Baker' 96.99
d1viaa_161 Shikimate kinase (AroK) {Campylobacter jejuni [Tax 96.99
d1yj5a2172 5' polynucleotide kinase-3' phosphatase, C-termina 96.97
d2ak3a1189 Adenylate kinase {Cow (Bos taurus), mitochondrial 96.96
d2cdna1181 Adenylate kinase {Mycobacterium tuberculosis [TaxI 96.96
d1ukza_196 Uridylate kinase {Baker's yeast (Saccharomyces cer 96.94
d1okkd2207 GTPase domain of the signal recognition particle r 96.94
d1qf9a_194 UMP/CMP kinase {Dictyostelium discoideum [TaxId: 4 96.92
d1vmaa2213 GTPase domain of the signal recognition particle r 96.88
d1g6oa_323 Hexameric traffic ATPase, HP0525 {Helicobacter pyl 96.88
d2qy9a2211 GTPase domain of the signal recognition particle r 96.88
d1akya1180 Adenylate kinase {Baker's yeast (Saccharomyces cer 96.88
d1s3ga1182 Adenylate kinase {Bacillus globisporus [TaxId: 145 96.87
d1u94a1263 RecA protein, ATPase-domain {Escherichia coli [Tax 96.86
d1u0ja_267 Rep 40 protein helicase domain {Adeno-associated v 96.86
d1ukza_196 Uridylate kinase {Baker's yeast (Saccharomyces cer 96.85
d1bifa1213 6-phosphofructo-2-kinase/fructose-2,6-bisphosphata 96.82
d1ls1a2207 GTPase domain of the signal sequence recognition p 96.8
d2ak3a1189 Adenylate kinase {Cow (Bos taurus), mitochondrial 96.8
d1qf9a_194 UMP/CMP kinase {Dictyostelium discoideum [TaxId: 4 96.8
d3adka_194 Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} 96.78
d1e4va1179 Adenylate kinase {Escherichia coli [TaxId: 562]} 96.77
d1yj5a2172 5' polynucleotide kinase-3' phosphatase, C-termina 96.77
d1zina1182 Adenylate kinase {Bacillus stearothermophilus [Tax 96.76
d1ckea_225 CMP kinase {Escherichia coli [TaxId: 562]} 96.73
d1teva_194 UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606] 96.71
d1xp8a1268 RecA protein, ATPase-domain {Deinococcus radiodura 96.7
d2onka1240 Molybdate/tungstate import ATP-binding protein Wtp 96.7
d1q3ta_223 CMP kinase {Streptococcus pneumoniae [TaxId: 1313] 96.69
d1teva_194 UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606] 96.69
d2i3ba1189 Cancer-related NTPase, C1orf57 {Human (Homo sapien 96.67
d2cdna1181 Adenylate kinase {Mycobacterium tuberculosis [TaxI 96.66
d1ckea_225 CMP kinase {Escherichia coli [TaxId: 562]} 96.64
d1s3ga1182 Adenylate kinase {Bacillus globisporus [TaxId: 145 96.62
d1ji0a_240 Branched chain aminoacid ABC transporter {Thermoto 96.62
d1j8yf2211 GTPase domain of the signal sequence recognition p 96.62
d1mv5a_242 Multidrug resistance ABC transporter LmrA, C-termi 96.61
d1akya1180 Adenylate kinase {Baker's yeast (Saccharomyces cer 96.6
d1np6a_170 Molybdopterin-guanine dinucleotide biosynthesis pr 96.52
d1ly1a_152 Polynucleotide kinase, kinase domain {Bacteriophag 96.51
d1m8pa3183 ATP sulfurylase C-terminal domain {Fungus (Penicil 96.51
d1g6oa_323 Hexameric traffic ATPase, HP0525 {Helicobacter pyl 96.51
d1ly1a_152 Polynucleotide kinase, kinase domain {Bacteriophag 96.49
d1mo6a1269 RecA protein, ATPase-domain {Mycobacterium tubercu 96.48
d1e4va1179 Adenylate kinase {Escherichia coli [TaxId: 562]} 96.47
d1g6ha_254 MJ1267 {Archaeon Methanococcus jannaschii [TaxId: 96.46
d1q3ta_223 CMP kinase {Streptococcus pneumoniae [TaxId: 1313] 96.44
d1v5wa_258 Meiotic recombination protein DMC1/LIM15 homolog { 96.4
d1khta_190 Adenylate kinase {Archaeon Methanococcus voltae [T 96.4
d2a5yb3277 CED-4, NB-ARC domain {Caenorhabditis elegans [TaxI 96.4
d1vpla_238 Putative ABC transporter TM0544 {Thermotoga mariti 96.35
d1tf7a2242 Circadian clock protein KaiC {Synechococcus sp. st 96.34
d1ls1a2207 GTPase domain of the signal sequence recognition p 96.32
d1w36d1359 Exodeoxyribonuclease V alpha chain (RecD) {Escheri 96.32
d1vmaa2213 GTPase domain of the signal recognition particle r 96.29
d2pmka1241 Haemolysin B ATP-binding protein {Escherichia coli 96.28
d3b60a1253 Multidrug resistance ABC transporter MsbA, C-termi 96.27
d1x6va3195 Adenosine-5'phosphosulfate kinase (APS kinase) {Hu 96.25
d1rz3a_198 Hypothetical protein rbstp0775 {Bacillus stearothe 96.2
d1m7ga_208 Adenosine-5'phosphosulfate kinase (APS kinase) {Fu 96.19
d1a1va1136 HCV helicase domain {Human hepatitis C virus (HCV) 96.18
d1m7ga_208 Adenosine-5'phosphosulfate kinase (APS kinase) {Fu 96.14
d1nksa_194 Adenylate kinase {Archaeon Sulfolobus acidocaldari 96.11
d1g2912240 Maltose transport protein MalK, N-terminal domain 96.1
d1odfa_286 Hypothetical protein Ygr205W {Baker's yeast (Sacch 96.07
d1a1va1136 HCV helicase domain {Human hepatitis C virus (HCV) 96.07
d1jj7a_251 Peptide transporter Tap1, C-terminal ABC domain {H 96.05
d1khta_190 Adenylate kinase {Archaeon Methanococcus voltae [T 95.97
d2hyda1255 Putative multidrug export ATP-binding/permease pro 95.95
d1gkya_186 Guanylate kinase {Baker's yeast (Saccharomyces cer 95.85
d1lvga_190 Guanylate kinase {Mouse (Mus musculus) [TaxId: 100 95.83
d1b0ua_258 ATP-binding subunit of the histidine permease {Sal 95.83
d1pzna2254 DNA repair protein Rad51, catalytic domain {Archae 95.64
d1nksa_194 Adenylate kinase {Archaeon Sulfolobus acidocaldari 95.64
d1np6a_170 Molybdopterin-guanine dinucleotide biosynthesis pr 95.6
d3dhwc1240 Methionine import ATP-binding protein MetN {Escher 95.55
d1v43a3239 Hypothetical protein PH0022, N-terminal domain {Py 95.54
d1r0wa_281 Cystic fibrosis transmembrane conductance regulato 95.52
d1yksa1140 YFV helicase domain {Yellow fever virus [TaxId: 11 95.52
d3d31a2229 Sulfate/molybdate ABC transporter, ATP-binding pro 95.51
d1oxxk2242 Glucose transport protein GlcV, N-terminal domain 95.49
d1n0wa_242 DNA repair protein Rad51, catalytic domain {Human 95.49
d2awna2232 Maltose transport protein MalK, N-terminal domain 95.48
d2onka1240 Molybdate/tungstate import ATP-binding protein Wtp 95.4
d1tf7a1242 Circadian clock protein KaiC {Synechococcus sp. st 95.39
d1pjra1318 DEXX box DNA helicase {Bacillus stearothermophilus 95.35
d1xjca_165 Molybdopterin-guanine dinucleotide biosynthesis pr 95.33
d1xjca_165 Molybdopterin-guanine dinucleotide biosynthesis pr 95.32
d1szpa2251 DNA repair protein Rad51, catalytic domain {Baker' 95.27
d1l2ta_230 MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 95.27
d1lvga_190 Guanylate kinase {Mouse (Mus musculus) [TaxId: 100 95.26
d1l7vc_231 ABC transporter involved in vitamin B12 uptake, Bt 95.22
d1sq5a_308 Pantothenate kinase PanK {Escherichia coli [TaxId: 95.2
d1gkya_186 Guanylate kinase {Baker's yeast (Saccharomyces cer 95.05
d1znwa1182 Guanylate kinase {Mycobacterium tuberculosis [TaxI 95.04
d1uj2a_213 Uridine-cytidine kinase 2 {Human (Homo sapiens) [T 94.97
d1nlfa_274 Hexameric replicative helicase repA {Escherichia c 94.91
d1cr2a_277 Gene 4 protein (g4p, DNA primase), helicase domain 94.86
d2p67a1327 LAO/AO transport system kinase ArgK {Escherichia c 94.84
d1wb9a2234 DNA repair protein MutS, the C-terminal domain {Es 94.67
d1uaaa1306 DEXX box DNA helicase {Escherichia coli, RepD [Tax 94.53
d1yrba1244 ATP(GTP)-binding protein PAB0955 {Pyrococcus abyss 94.52
d1nn5a_209 Thymidylate kinase {Human (Homo sapiens) [TaxId: 9 94.43
d2i1qa2258 DNA repair protein Rad51, catalytic domain {Archae 94.34
d1kgda_178 Guanylate kinase-like domain of Cask {Human (Homo 94.31
d1mv5a_242 Multidrug resistance ABC transporter LmrA, C-termi 94.26
d1tmka_214 Thymidylate kinase {Baker's yeast (Saccharomyces c 94.24
d1tuea_205 Replication protein E1 helicase domain {Human papi 94.2
d2p6ra3202 Hel308 helicase {Archaeoglobus fulgidus [TaxId: 22 94.12
d2fz4a1206 DNA repair protein RAD25 {Archaeoglobus fulgidus [ 94.07
d4tmka_210 Thymidylate kinase {Escherichia coli [TaxId: 562]} 94.02
d2fz4a1206 DNA repair protein RAD25 {Archaeoglobus fulgidus [ 94.02
d1rz3a_198 Hypothetical protein rbstp0775 {Bacillus stearothe 94.01
d1r0wa_281 Cystic fibrosis transmembrane conductance regulato 94.0
d2qm8a1323 Metallochaperone MeaB {Methylobacterium extorquens 93.97
d1htwa_158 Hypothetical protein HI0065 {Haemophilus influenza 93.96
d1v5wa_258 Meiotic recombination protein DMC1/LIM15 homolog { 93.95
d2g9na1218 Initiation factor 4a {Human (Homo sapiens) [TaxId: 93.85
d1s96a_205 Guanylate kinase {Escherichia coli [TaxId: 562]} 93.85
d1a7ja_288 Phosphoribulokinase {Rhodobacter sphaeroides [TaxI 93.82
d1n0wa_242 DNA repair protein Rad51, catalytic domain {Human 93.81
d1gsia_208 Thymidylate kinase {Mycobacterium tuberculosis [Ta 93.81
d1ji0a_240 Branched chain aminoacid ABC transporter {Thermoto 93.72
d1htwa_158 Hypothetical protein HI0065 {Haemophilus influenza 93.72
d1pzna2254 DNA repair protein Rad51, catalytic domain {Archae 93.69
d1vpla_238 Putative ABC transporter TM0544 {Thermotoga mariti 93.67
d1sq5a_308 Pantothenate kinase PanK {Escherichia coli [TaxId: 93.66
d1znwa1182 Guanylate kinase {Mycobacterium tuberculosis [TaxI 93.54
d1wf3a1178 GTPase Era, N-terminal domain {Thermus thermophilu 93.52
d1gm5a3264 RecG helicase domain {Thermotoga maritima [TaxId: 93.41
d1svia_195 Probable GTPase EngB {Bacillus subtilis [TaxId: 14 93.4
d1ewqa2224 DNA repair protein MutS, the C-terminal domain {Th 93.36
d1odfa_286 Hypothetical protein Ygr205W {Baker's yeast (Sacch 93.36
d1yksa1140 YFV helicase domain {Yellow fever virus [TaxId: 11 93.29
d2ocpa1241 Deoxyguanosine kinase {Human (Homo sapiens) [TaxId 93.27
d1xpua3289 Transcription termination factor Rho, ATPase domai 93.25
d1u0ja_267 Rep 40 protein helicase domain {Adeno-associated v 93.22
d1e9ra_433 Bacterial conjugative coupling protein TrwB {Esche 92.98
d1wb9a2234 DNA repair protein MutS, the C-terminal domain {Es 92.97
d1kkma_176 HPr kinase HprK C-terminal domain {Lactobacillus c 92.95
d1r8sa_160 ADP-ribosylation factor {Human (Homo sapiens), ARF 92.82
d1zcba2200 Transducin (alpha subunit) {Mouse (Mus musculus) [ 92.54
d1kgda_178 Guanylate kinase-like domain of Cask {Human (Homo 92.53
d1ihua1296 Arsenite-translocating ATPase ArsA {Escherichia co 92.47
d2fh5b1207 Signal recognition particle receptor beta-subunit 92.47
d2vp4a1197 Deoxyribonucleoside kinase {Fruit fly (Drosophila 92.46
d1veca_206 DEAD box RNA helicase rck/p54 {Human (Homo sapiens 92.38
d2p67a1327 LAO/AO transport system kinase ArgK {Escherichia c 92.36
d1uf9a_191 Dephospho-CoA kinase {Thermus thermophilus [TaxId: 92.32
d1knxa2177 HPr kinase HprK C-terminal domain {Mycoplasma pneu 92.32
d1zj6a1177 ADP-ribosylation factor {Human (Homo sapiens), ARL 92.31
d1uf9a_191 Dephospho-CoA kinase {Thermus thermophilus [TaxId: 92.16
d1deka_241 Deoxynucleoside monophosphate kinase {Bacteriophag 92.13
d1nrjb_209 Signal recognition particle receptor beta-subunit 92.09
d1ko7a2169 HPr kinase HprK C-terminal domain {Staphylococcus 92.08
d1kkma_176 HPr kinase HprK C-terminal domain {Lactobacillus c 92.08
d2gj8a1161 Probable tRNA modification GTPase TrmE (MnmE), G d 91.91
d1ihua1296 Arsenite-translocating ATPase ArsA {Escherichia co 91.79
d1mkya1171 Probable GTPase Der, N-terminal and middle domains 91.75
d2fn4a1173 r-Ras {Human (Homo sapiens) [TaxId: 9606]} 91.74
d1yrba1244 ATP(GTP)-binding protein PAB0955 {Pyrococcus abyss 91.72
d2qm8a1323 Metallochaperone MeaB {Methylobacterium extorquens 91.66
d2i1qa2258 DNA repair protein Rad51, catalytic domain {Archae 91.65
g1f2t.1292 Rad50 {Archaeon Pyrococcus furiosus [TaxId: 2261]} 91.52
d1cz5a294 C-terminal domain of VAT-N, VAT-Nc {Archaeon Therm 91.47
d1u8za_168 Ras-related protein RalA {Cotton-top tamarin (Sagu 91.44
d1upta_169 ADP-ribosylation factor {Human (Homo sapiens), ARL 91.4
d2a5ja1173 Rab2b {Human (Homo sapiens) [TaxId: 9606]} 91.39
d1gm5a3264 RecG helicase domain {Thermotoga maritima [TaxId: 91.17
d2gj8a1161 Probable tRNA modification GTPase TrmE (MnmE), G d 91.13
d1vhta_208 Dephospho-CoA kinase {Escherichia coli [TaxId: 562 90.93
d2j0sa1222 Probable ATP-dependent RNA helicase DDX48 {Human ( 90.82
d2bmfa2305 Dengue virus helicase {Dengue virus type 2 [TaxId: 90.81
d2qtvb1166 SAR1 {Baker's yeast (Saccharomyces cerevisiae) [Ta 90.79
d3raba_169 Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} 90.74
d1a7ja_288 Phosphoribulokinase {Rhodobacter sphaeroides [TaxI 90.7
d2bmfa2305 Dengue virus helicase {Dengue virus type 2 [TaxId: 90.7
d1z2aa1164 Rab23 {Mouse (Mus musculus) [TaxId: 10090]} 90.69
d1z0fa1166 Rab14 {Human (Homo sapiens) [TaxId: 9606]} 90.63
d1uaaa1306 DEXX box DNA helicase {Escherichia coli, RepD [Tax 90.63
d1ksha_165 ADP-ribosylation factor {Mouse (Mus musculus), ARL 90.6
d1vhta_208 Dephospho-CoA kinase {Escherichia coli [TaxId: 562 90.56
d1qdea_212 Initiation factor 4a {Baker's yeast (Saccharomyces 90.55
d1ko7a2169 HPr kinase HprK C-terminal domain {Staphylococcus 90.52
d1kaoa_167 Rap2a {Human (Homo sapiens) [TaxId: 9606]} 90.51
d1e9ra_433 Bacterial conjugative coupling protein TrwB {Esche 90.48
d2atva1168 Ras-like estrogen-regulated growth inhibitor, RERG 90.46
d2ew1a1171 Rab30 {Human (Homo sapiens) [TaxId: 9606]} 90.37
d1knxa2177 HPr kinase HprK C-terminal domain {Mycoplasma pneu 90.36
d2f7sa1186 Rab27b {Human (Homo sapiens) [TaxId: 9606]} 90.35
d1wf3a1178 GTPase Era, N-terminal domain {Thermus thermophilu 90.33
d2erya1171 r-Ras2 {Human (Homo sapiens) [TaxId: 9606]} 90.27
d1z08a1167 Rab21 {Human (Homo sapiens) [TaxId: 9606]} 90.25
d1jjva_205 Dephospho-CoA kinase {Haemophilus influenzae [TaxI 90.23
d1deka_241 Deoxynucleoside monophosphate kinase {Bacteriophag 90.21
d1f6ba_186 SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: 90.16
d1pjra1318 DEXX box DNA helicase {Bacillus stearothermophilus 90.16
d1zd9a1164 ADP-ribosylation factor {Human (Homo sapiens), ARL 90.15
d1p5zb_241 Deoxycytidine kinase {Human (Homo sapiens) [TaxId: 90.13
d1r2qa_170 Rab5a {Human (Homo sapiens) [TaxId: 9606]} 90.06
d1vg8a_184 Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]} 90.01
d2f9la1175 Rab11b {Human (Homo sapiens) [TaxId: 9606]} 89.99
d2eyqa3233 Transcription-repair coupling factor, TRCF {Escher 89.84
d1ewqa2224 DNA repair protein MutS, the C-terminal domain {Th 89.84
d1azta2221 Transducin (alpha subunit) {Cow (Bos taurus) [TaxI 89.78
d1ihua2279 Arsenite-translocating ATPase ArsA {Escherichia co 89.62
d1ky3a_175 Rab-related protein ypt7p {Baker's yeast (Saccharo 89.49
d1g16a_166 Rab-related protein Sec4 {Baker's yeast (Saccharom 89.43
d2vp4a1197 Deoxyribonucleoside kinase {Fruit fly (Drosophila 89.4
d2erxa1171 di-Ras2 {Human (Homo sapiens) [TaxId: 9606]} 89.4
d1c1ya_167 Rap1A {Human (Homo sapiens) [TaxId: 9606]} 89.34
d2bmea1174 Rab4a {Human (Homo sapiens) [TaxId: 9606]} 89.31
d1z06a1165 Rab-33b {Mouse (Mus musculus) [TaxId: 10090]} 89.29
d1ctqa_166 cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9 89.22
d1s2ma1206 Putative ATP-dependent RNA helicase DHH1 {Baker's 89.21
d1z0ja1167 Rab-22a {Mouse (Mus musculus) [TaxId: 10090]} 89.21
d1jjva_205 Dephospho-CoA kinase {Haemophilus influenzae [TaxI 89.08
g1ii8.1369 Rad50 {Archaeon Pyrococcus furiosus [TaxId: 2261]} 89.08
d1kmqa_177 RhoA {Human (Homo sapiens) [TaxId: 9606]} 89.07
d1ihua2279 Arsenite-translocating ATPase ArsA {Escherichia co 89.02
d1xtqa1167 GTP-binding protein RheB {Human (Homo sapiens) [Ta 88.99
d1p6xa_333 Thymidine kinase {Equine herpesvirus type 4 [TaxId 88.94
d2g6ba1170 Rab26 {Human (Homo sapiens) [TaxId: 9606]} 88.93
d1x3sa1177 Rab18 {Human (Homo sapiens) [TaxId: 9606]} 88.91
d1yzqa1164 Rab6 {Human (Homo sapiens) [TaxId: 9606]} 88.89
d1wmsa_174 Rab9a {Human (Homo sapiens) [TaxId: 9606]} 88.87
d2bcgy1194 GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisi 88.74
g1xew.1329 Smc head domain {Pyrococcus furiosus [TaxId: 2261] 88.68
d1xpua3289 Transcription termination factor Rho, ATPase domai 88.68
g1xew.1329 Smc head domain {Pyrococcus furiosus [TaxId: 2261] 88.58
d1sgwa_200 Putative ABC transporter PF0895 {Pyrococcus furios 88.53
d2gjsa1168 Rad {Human (Homo sapiens) [TaxId: 9606]} 88.51
d2ocpa1241 Deoxyguanosine kinase {Human (Homo sapiens) [TaxId 88.49
d1ek0a_170 Ypt51 {Baker's yeast (Saccharomyces cerevisiae) [T 88.4
d2atxa1185 RhoQ {Human (Homo sapiens) [TaxId: 9606]} 88.4
d2ngra_191 CDC42 {Human (Homo sapiens) [TaxId: 9606]} 88.37
d1m7ba_179 RhoE (RND3) {Mouse (Mus musculus) [TaxId: 10090]} 88.31
d1fzqa_176 ADP-ribosylation factor {Mouse (Mus musculus), ARL 88.18
d1x1ra1169 Ras-related protein M-Ras (XRas) {Mouse (Mus muscu 88.09
d1mh1a_183 Rac {Human (Homo sapiens) [TaxId: 9606]} 88.07
d2g3ya1172 GTP-binding protein GEM {Human (Homo sapiens) [Tax 88.02
d1h65a_257 Chloroplast protein translocon GTPase Toc34 {Garde 87.99
d1rifa_282 DNA helicase UvsW {Bacteriophage T4 [TaxId: 10665] 87.83
d1h65a_257 Chloroplast protein translocon GTPase Toc34 {Garde 87.69
d2cxxa1184 GTP-binding protein engB {Pyrococcus horikoshii [T 87.68
d1r8sa_160 ADP-ribosylation factor {Human (Homo sapiens), ARF 87.53
d1w1wa_427 Smc head domain {Baker's yeast (Saccharomyces cere 87.53
d1b0ua_258 ATP-binding subunit of the histidine permease {Sal 87.46
d1osna_331 Thymidine kinase {Varicella-zoster virus [TaxId: 1 87.28
d1u0la2225 Probable GTPase EngC (YjeQ), C-terminal domain {Th 87.23
d2b8ta1139 Thymidine kinase, TK1, N-terminal domain {Ureaplas 87.17
d1wp9a1200 putative ATP-dependent RNA helicase PF2015 {Pyroco 87.06
d1e0sa_173 ADP-ribosylation factor {Human (Homo sapiens), ARF 86.77
d2fu5c1173 Rab8a {Mouse (Mus musculus) [TaxId: 10090]} 86.63
d2fh5b1207 Signal recognition particle receptor beta-subunit 86.53
d1nrjb_209 Signal recognition particle receptor beta-subunit 86.34
d1moza_182 ADP-ribosylation factor {Baker's yeast (Saccharomy 86.31
d1br2a2710 Myosin S1, motor domain {Chicken (Gallus gallus), 86.17
d1p5zb_241 Deoxycytidine kinase {Human (Homo sapiens) [TaxId: 86.11
d1cp2a_269 Nitrogenase iron protein {Clostridium pasteurianum 86.04
d1lkxa_684 Myosin S1, motor domain {Dictyostelium discoideum, 85.86
d1egaa1179 GTPase Era, N-terminal domain {Escherichia coli [T 85.8
d1cp2a_269 Nitrogenase iron protein {Clostridium pasteurianum 85.5
d1byia_224 Dethiobiotin synthetase {Escherichia coli [TaxId: 85.47
d1d0xa2712 Myosin S1, motor domain {Dictyostelium discoideum 85.37
d1tq4a_400 Interferon-inducible GTPase {Mouse (Mus musculus) 85.36
d1upta_169 ADP-ribosylation factor {Human (Homo sapiens), ARL 85.2
g1f2t.1292 Rad50 {Archaeon Pyrococcus furiosus [TaxId: 2261]} 84.97
d2mysa2794 Myosin S1, motor domain {Chicken (Gallus gallus), 84.96
d2qtvb1166 SAR1 {Baker's yeast (Saccharomyces cerevisiae) [Ta 84.94
d1i2ma_170 Ran {Human (Homo sapiens) [TaxId: 9606]} 84.9
d1nija1222 Hypothetical protein YjiA, N-terminal domain {Esch 84.65
d1wrba1238 putative ATP-dependent RNA helicase VlgB {Flatworm 84.39
d1ksha_165 ADP-ribosylation factor {Mouse (Mus musculus), ARL 84.37
d1w7ja2730 Myosin S1, motor domain {Chicken (Gallus gallus), 84.3
d1f6ba_186 SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: 84.28
d2bmja1175 Centaurin gamma 1, G domain {Human (Homo sapiens) 84.26
d2eyqa3233 Transcription-repair coupling factor, TRCF {Escher 84.25
d2f7sa1186 Rab27b {Human (Homo sapiens) [TaxId: 9606]} 84.21
d1w1wa_427 Smc head domain {Baker's yeast (Saccharomyces cere 84.2
d1wp9a1200 putative ATP-dependent RNA helicase PF2015 {Pyroco 83.8
d3raba_169 Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} 83.77
d1w36b1485 Exodeoxyribonuclease V beta chain (RecB), N-termin 83.67
d1oywa2206 RecQ helicase domain {Escherichia coli [TaxId: 562 83.64
d1mkya2186 Probable GTPase Der, N-terminal and middle domains 83.53
d1zj6a1177 ADP-ribosylation factor {Human (Homo sapiens), ARL 83.34
d2bcjq2200 Transducin (alpha subunit) {Mouse (Mus musculus) [ 83.32
d1z2aa1164 Rab23 {Mouse (Mus musculus) [TaxId: 10090]} 83.21
d1e69a_308 Smc head domain {Thermotoga maritima [TaxId: 2336] 83.18
d1kk8a2789 Myosin S1, motor domain {Bay scallop (Aequipecten 83.17
d1hv8a1208 Putative DEAD box RNA helicase {Archaeon Methanoco 83.13
d1zd9a1164 ADP-ribosylation factor {Human (Homo sapiens), ARL 82.97
d1g6ha_254 MJ1267 {Archaeon Methanococcus jannaschii [TaxId: 82.88
d1t9ha2231 Probable GTPase EngC (YjeQ), C-terminal domain {Ba 82.83
d1e2ka_329 Thymidine kinase {Herpes simplex virus type 1, dif 82.75
d1p6xa_333 Thymidine kinase {Equine herpesvirus type 4 [TaxId 82.73
d1kaoa_167 Rap2a {Human (Homo sapiens) [TaxId: 9606]} 82.4
d1z0fa1166 Rab14 {Human (Homo sapiens) [TaxId: 9606]} 82.34
d1udxa2180 Obg GTP-binding protein middle domain {Thermus the 82.14
d1xzpa2160 TrmE GTPase domain {Thermotoga maritima [TaxId: 23 81.97
d2ew1a1171 Rab30 {Human (Homo sapiens) [TaxId: 9606]} 81.94
d1r2qa_170 Rab5a {Human (Homo sapiens) [TaxId: 9606]} 81.86
d1svia_195 Probable GTPase EngB {Bacillus subtilis [TaxId: 14 81.66
d2afhe1289 Nitrogenase iron protein {Azotobacter vinelandii [ 81.53
d1lnza2185 Obg GTP-binding protein middle domain {Bacillus su 81.5
d2erya1171 r-Ras2 {Human (Homo sapiens) [TaxId: 9606]} 81.22
d1fx0a3276 Central domain of alpha subunit of F1 ATP synthase 81.2
g1ii8.1369 Rad50 {Archaeon Pyrococcus furiosus [TaxId: 2261]} 80.84
d1puia_188 Probable GTPase EngB {Escherichia coli [TaxId: 562 80.77
d1l7vc_231 ABC transporter involved in vitamin B12 uptake, Bt 80.6
d1osna_331 Thymidine kinase {Varicella-zoster virus [TaxId: 1 80.37
d1xzpa2160 TrmE GTPase domain {Thermotoga maritima [TaxId: 23 80.36
d2erxa1171 di-Ras2 {Human (Homo sapiens) [TaxId: 9606]} 80.19
d1ctqa_166 cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9 80.15
d1fzqa_176 ADP-ribosylation factor {Mouse (Mus musculus), ARL 80.05
d1qhla_222 Cell division protein MukB {Escherichia coli [TaxI 80.03
>d1lv7a_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Extended AAA-ATPase domain
domain: AAA domain of cell division protein FtsH
species: Escherichia coli [TaxId: 562]

Probab=100.00  E-value=2.6e-36  Score=260.11  Aligned_cols=247  Identities=21%  Similarity=0.279  Sum_probs=208.1

Q ss_pred             CCCCCCCCCCCCHHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCEEEEECCCCCHHHHHHHHHHHHHCCCCCCEEEEEEE
Q ss_conf             65654444333125899999999974299842100013789996299996899639999999999941476620069998
Q 001560          548 GFDSNVSSLSWMGTTASDVINRIKVLLSPDSGLWFSTYHLPLPGHILIHGPPGSGKTSLAKAVAKSLEHHKDLVAHIVFV  627 (1052)
Q Consensus       548 ~~~~~~~~l~G~~~~l~~i~~~l~~ll~~~~~~~~~~~~~~~p~~ILL~GppGTGKTtLaraLa~~L~~~~~~~~~v~~i  627 (1052)
                      .++.++.+++|++..++.+.+.+..+..   ++.|...+...|+++||+||||||||++|+++|++++      .+++.+
T Consensus         6 ~~~~t~~Di~Gl~~~k~~l~e~v~~~~~---~~~~~~~g~~~~~~iLL~GppGtGKT~la~~iA~~~~------~~~~~i   76 (256)
T d1lv7a_           6 QIKTTFADVAGCDEAKEEVAELVEYLRE---PSRFQKLGGKIPKGVLMVGPPGTGKTLLAKAIAGEAK------VPFFTI   76 (256)
T ss_dssp             SSCCCGGGSCSCHHHHHHTHHHHHHHHC---GGGC-----CCCCEEEEECCTTSCHHHHHHHHHHHHT------CCEEEE
T ss_pred             CCCCCHHHHHCHHHHHHHHHHHHHHHHC---HHHHHHCCCCCCCEEEEECCCCCCCCHHHHHHHHHCC------CCEEEE
T ss_conf             9998999981639999999999999879---9999986999888678668998882289999999829------987998


Q ss_pred             ECCCCCCCCHHHHHHHHHHHHHHHHCCCCEEEEEECCCHHCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHCCCCCCCCCC
Q ss_conf             33655577224699876656997520499199990530010589999999981269999999999998713246775576
Q 001560          628 CCSRLSLEKGPIIRQALSNFISEALDHAPSIVIFDNLDSIISSSSDPEGSQPSTSVIALTKFLVDIMDEYGEKRKSSCGI  707 (1052)
Q Consensus       628 ~~s~L~~~~~~~~~~~l~~~f~~a~~~~PsILiIDEiD~L~~~~~~~e~~~~~~~~~~l~~~L~~~ld~~~~~~~~~~~~  707 (1052)
                      +++++...+.+...+.++.+|..|..++|+||||||+|.+++.+........ .....+...|+..++.+....      
T Consensus        77 ~~~~l~~~~~g~~~~~l~~~f~~A~~~~P~il~iDeiD~l~~~r~~~~~~~~-~~~~~~~~~ll~~~d~~~~~~------  149 (256)
T d1lv7a_          77 SGSDFVEMFVGVGASRVRDMFEQAKKAAPCIIFIDEIDAVGRQRGAGLGGGH-DEREQTLNQMLVEMDGFEGNE------  149 (256)
T ss_dssp             CSCSSTTSCCCCCHHHHHHHHHHHHTTCSEEEEETTHHHHTCCCSTTSCCTT-CHHHHHHHHHHHHHHTCCSSS------
T ss_pred             EHHHHHHCCHHHHHHHHHHHHHHHHHCCCEEEEEECHHHHCCCCCCCCCCCC-HHHHHHHHHHHHHHHCCCCCC------
T ss_conf             8699426001078999999999999759989999775665756789888874-899999999999953877779------


Q ss_pred             CCEEEEEECCCCCCCCHHHHCCCCCCEEEECCCCCHHHHHHHHHHHHHHCCCCCCHHHHHHHHHHCCCCCHHHHHHHHHH
Q ss_conf             76899993489987752321178854155278987999999999988623478898899988631689987899999999
Q 001560          708 GPIAFVASAQSLEKIPQSLTSSGRFDFHVQLPAPAASERKAILEHEIQRRSLECSDEILLDVASKCDGYDAYDLEILVDR  787 (1052)
Q Consensus       708 ~~V~vIattn~~~~L~~~L~s~gRF~~~i~i~~Pd~~eR~~IL~~~l~~~~~~~sd~~l~~La~~teG~s~~DL~~Lv~r  787 (1052)
                       ++++|+|||.++.+|++++|++||+..+++++|+.++|.+|++.++++..+. .+..+..++..|+||+++|+..++++
T Consensus       150 -~v~vIatTn~~~~ld~al~R~gRfd~~i~i~~P~~~~R~~il~~~l~~~~~~-~~~~~~~la~~t~G~s~adi~~l~~~  227 (256)
T d1lv7a_         150 -GIIVIAATNRPDVLDPALLRPGRFDRQVVVGLPDVRGREQILKVHMRRVPLA-PDIDAAIIARGTPGFSGADLANLVNE  227 (256)
T ss_dssp             -CEEEEEEESCTTTSCGGGGSTTSSCEEEECCCCCHHHHHHHHHHHHTTSCBC-TTCCHHHHHHTCTTCCHHHHHHHHHH
T ss_pred             -CEEEEEECCCCCCCCHHHCCCCCCCEEEECCCCCHHHHHHHHHHHCCCCCCC-CCCCHHHHHHHCCCCCHHHHHHHHHH
T ss_conf             -9899980799310798576898787798779959999999999842599868-65699999986899899999999999


Q ss_pred             HHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             999998510036885333445632222200000013
Q 001560          788 TVHAAVGRYLHSDSSFEKHIKPTLVRDDFSQAMHEF  823 (1052)
Q Consensus       788 A~~~a~~R~~~~~~~~~~~~~~~It~eDf~~Al~~~  823 (1052)
                      |...+..+           ....++..||..|++..
T Consensus       228 A~~~a~~~-----------~~~~i~~~d~~~Al~rv  252 (256)
T d1lv7a_         228 AALFAARG-----------NKRVVSMVEFEKAKDKI  252 (256)
T ss_dssp             HHHHHHHT-----------TCSSBCHHHHHHHHHHH
T ss_pred             HHHHHHHC-----------CCCCCCHHHHHHHHHHH
T ss_conf             99999982-----------89834899999999999
>d1ixza_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1e32a2 c.37.1.20 (A:201-458) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1r7ra3 c.37.1.20 (A:471-735) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1lv7a_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ixza_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1e32a2 c.37.1.20 (A:201-458) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1r7ra3 c.37.1.20 (A:471-735) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1w44a_ c.37.1.11 (A:) NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} Back     information, alignment and structure
>d1wlfa1 d.31.1.1 (A:100-179) Peroxisome biogenesis factor 1 (PEX-1), domain 2 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1d2na_ c.37.1.20 (A:) Hexamerization domain of N-ethylmalemide-sensitive fusion (NSF) protein {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d1ofha_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1d2na_ c.37.1.20 (A:) Hexamerization domain of N-ethylmalemide-sensitive fusion (NSF) protein {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d1w44a_ c.37.1.11 (A:) NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} Back     information, alignment and structure
>d1in4a2 c.37.1.20 (A:17-254) Holliday junction helicase RuvB {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1ofha_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1ixsb2 c.37.1.20 (B:4-242) Holliday junction helicase RuvB {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1iqpa2 c.37.1.20 (A:2-232) Replication factor C {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1njfa_ c.37.1.20 (A:) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1sxjc2 c.37.1.20 (C:12-238) Replication factor C3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1sxja2 c.37.1.20 (A:295-547) Replication factor C1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1sxjd2 c.37.1.20 (D:26-262) Replication factor C2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1sxjb2 c.37.1.20 (B:7-230) Replication factor C4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1r6bx2 c.37.1.20 (X:169-436) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1fnna2 c.37.1.20 (A:1-276) CDC6, N-domain {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d1sxje2 c.37.1.20 (E:4-255) Replication factor C5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1w5sa2 c.37.1.20 (A:7-293) CDC6-like protein APE0152, N-terminal domain {Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1qvra2 c.37.1.20 (A:149-535) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1r6bx3 c.37.1.20 (X:437-751) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1qvra3 c.37.1.20 (A:536-850) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1in4a2 c.37.1.20 (A:17-254) Holliday junction helicase RuvB {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1wlfa2 b.52.2.3 (A:13-99) Peroxisome biogenesis factor 1 (PEX-1), N-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1l8qa2 c.37.1.20 (A:77-289) Chromosomal replication initiation factor DnaA {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1a5ta2 c.37.1.20 (A:1-207) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1svma_ c.37.1.20 (A:) Papillomavirus large T antigen helicase domain {Simian virus 40 [TaxId: 10633]} Back     information, alignment and structure
>d1svma_ c.37.1.20 (A:) Papillomavirus large T antigen helicase domain {Simian virus 40 [TaxId: 10633]} Back     information, alignment and structure
>d1jbka_ c.37.1.20 (A:) ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ixsb2 c.37.1.20 (B:4-242) Holliday junction helicase RuvB {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1um8a_ c.37.1.20 (A:) ClpX {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1r6bx3 c.37.1.20 (X:437-751) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1r6bx2 c.37.1.20 (X:169-436) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1g41a_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1qvra3 c.37.1.20 (A:536-850) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1sxja2 c.37.1.20 (A:295-547) Replication factor C1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1um8a_ c.37.1.20 (A:) ClpX {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1g8pa_ c.37.1.20 (A:) ATPase subunit of magnesium chelatase, BchI {Rhodobacter capsulatus [TaxId: 1061]} Back     information, alignment and structure
>d1iqpa2 c.37.1.20 (A:2-232) Replication factor C {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1jbka_ c.37.1.20 (A:) ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ny5a2 c.37.1.20 (A:138-384) Transcriptional activator sigm54 (NtrC1), C-terminal domain {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1qvra2 c.37.1.20 (A:149-535) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1g41a_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1njfa_ c.37.1.20 (A:) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1sxjc2 c.37.1.20 (C:12-238) Replication factor C3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1g8pa_ c.37.1.20 (A:) ATPase subunit of magnesium chelatase, BchI {Rhodobacter capsulatus [TaxId: 1061]} Back     information, alignment and structure
>d2fnaa2 c.37.1.20 (A:1-283) Archaeal ATPase SSO1545 {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d2gnoa2 c.37.1.20 (A:11-208) gamma subunit of DNA polymerase III, N-domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1sxjb2 c.37.1.20 (B:7-230) Replication factor C4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1sxje2 c.37.1.20 (E:4-255) Replication factor C5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1sxjd2 c.37.1.20 (D:26-262) Replication factor C2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1gvnb_ c.37.1.21 (B:) Plasmid maintenance system epsilon/zeta, toxin zeta subunit {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1w5sa2 c.37.1.20 (A:7-293) CDC6-like protein APE0152, N-terminal domain {Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1a5ta2 c.37.1.20 (A:1-207) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ny5a2 c.37.1.20 (A:138-384) Transcriptional activator sigm54 (NtrC1), C-terminal domain {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1fnna2 c.37.1.20 (A:1-276) CDC6, N-domain {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d2a5yb3 c.37.1.20 (B:109-385) CED-4, NB-ARC domain {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1gvnb_ c.37.1.21 (B:) Plasmid maintenance system epsilon/zeta, toxin zeta subunit {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1l8qa2 c.37.1.20 (A:77-289) Chromosomal replication initiation factor DnaA {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d2gnoa2 c.37.1.20 (A:11-208) gamma subunit of DNA polymerase III, N-domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1ye8a1 c.37.1.11 (A:1-178) Hypothetical kinase-like protein Aq_1292 {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1tf7a2 c.37.1.11 (A:256-497) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} Back     information, alignment and structure
>d1kaga_ c.37.1.2 (A:) Shikimate kinase (AroK) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2fnaa2 c.37.1.20 (A:1-283) Archaeal ATPase SSO1545 {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1u94a1 c.37.1.11 (A:6-268) RecA protein, ATPase-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1cr2a_ c.37.1.11 (A:) Gene 4 protein (g4p, DNA primase), helicase domain {Bacteriophage T7 [TaxId: 10760]} Back     information, alignment and structure
>d1ye8a1 c.37.1.11 (A:1-178) Hypothetical kinase-like protein Aq_1292 {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1xp8a1 c.37.1.11 (A:15-282) RecA protein, ATPase-domain {Deinococcus radiodurans [TaxId: 1299]} Back     information, alignment and structure
>d1tf7a1 c.37.1.11 (A:14-255) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} Back     information, alignment and structure
>d1mo6a1 c.37.1.11 (A:1-269) RecA protein, ATPase-domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1lw7a2 c.37.1.1 (A:220-411) Transcriptional regulator NadR, ribosylnicotinamide kinase domain {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1viaa_ c.37.1.2 (A:) Shikimate kinase (AroK) {Campylobacter jejuni [TaxId: 197]} Back     information, alignment and structure
>d2pmka1 c.37.1.12 (A:467-707) Haemolysin B ATP-binding protein {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1rkba_ c.37.1.1 (A:) Adenylate kinase {Human (Homo sapiens), isoenzyme 6 [TaxId: 9606]} Back     information, alignment and structure
>d2iyva1 c.37.1.2 (A:2-166) Shikimate kinase (AroK) {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1p9ra_ c.37.1.11 (A:) Extracellular secretion NTPase EpsE {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d3b60a1 c.37.1.12 (A:329-581) Multidrug resistance ABC transporter MsbA, C-terminal domain {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1lw7a2 c.37.1.1 (A:220-411) Transcriptional regulator NadR, ribosylnicotinamide kinase domain {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1e6ca_ c.37.1.2 (A:) Shikimate kinase (AroK) {Erwinia chrysanthemi [TaxId: 556]} Back     information, alignment and structure
>d1l2ta_ c.37.1.12 (A:) MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1zaka1 c.37.1.1 (A:3-127,A:159-222) Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} Back     information, alignment and structure
>d1bifa1 c.37.1.7 (A:37-249) 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase, kinase domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1kaga_ c.37.1.2 (A:) Shikimate kinase (AroK) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d3dhwc1 c.37.1.12 (C:1-240) Methionine import ATP-binding protein MetN {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1zp6a1 c.37.1.25 (A:6-181) Hypothetical protein Atu3015 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d2hyda1 c.37.1.12 (A:324-578) Putative multidrug export ATP-binding/permease protein SAV1866 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1v43a3 c.37.1.12 (A:7-245) Hypothetical protein PH0022, N-terminal domain {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1nlfa_ c.37.1.11 (A:) Hexameric replicative helicase repA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1okkd2 c.37.1.10 (D:97-303) GTPase domain of the signal recognition particle receptor FtsY {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1rkba_ c.37.1.1 (A:) Adenylate kinase {Human (Homo sapiens), isoenzyme 6 [TaxId: 9606]} Back     information, alignment and structure
>d1y63a_ c.37.1.1 (A:) Probable kinase LmjF30.1890 {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d2i3ba1 c.37.1.11 (A:1-189) Cancer-related NTPase, C1orf57 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g2912 c.37.1.12 (1:1-240) Maltose transport protein MalK, N-terminal domain {Archaeon Thermococcus litoralis [TaxId: 2265]} Back     information, alignment and structure
>d1w36d1 c.37.1.19 (D:2-360) Exodeoxyribonuclease V alpha chain (RecD) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1jj7a_ c.37.1.12 (A:) Peptide transporter Tap1, C-terminal ABC domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qhxa_ c.37.1.3 (A:) Chloramphenicol phosphotransferase {Streptomyces venezuelae [TaxId: 54571]} Back     information, alignment and structure
>d2qy9a2 c.37.1.10 (A:285-495) GTPase domain of the signal recognition particle receptor FtsY {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1qhxa_ c.37.1.3 (A:) Chloramphenicol phosphotransferase {Streptomyces venezuelae [TaxId: 54571]} Back     information, alignment and structure
>d2awna2 c.37.1.12 (A:4-235) Maltose transport protein MalK, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d3d31a2 c.37.1.12 (A:1-229) Sulfate/molybdate ABC transporter, ATP-binding protein {Methanosarcina acetivorans [TaxId: 2214]} Back     information, alignment and structure
>d1oxxk2 c.37.1.12 (K:1-242) Glucose transport protein GlcV, N-terminal domain {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1tuea_ c.37.1.20 (A:) Replication protein E1 helicase domain {Human papillomavirus type 18 [TaxId: 333761]} Back     information, alignment and structure
>d1ak2a1 c.37.1.1 (A:14-146,A:177-233) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-2 [TaxId: 9913]} Back     information, alignment and structure
>d3adka_ c.37.1.1 (A:) Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1m8pa3 c.37.1.15 (A:391-573) ATP sulfurylase C-terminal domain {Fungus (Penicillium chrysogenum) [TaxId: 5076]} Back     information, alignment and structure
>d2bdta1 c.37.1.25 (A:1-176) Hypothetical protein BH3686 {Bacillus halodurans [TaxId: 86665]} Back     information, alignment and structure
>d1ak2a1 c.37.1.1 (A:14-146,A:177-233) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-2 [TaxId: 9913]} Back     information, alignment and structure
>d2iyva1 c.37.1.2 (A:2-166) Shikimate kinase (AroK) {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1p9ra_ c.37.1.11 (A:) Extracellular secretion NTPase EpsE {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1e6ca_ c.37.1.2 (A:) Shikimate kinase (AroK) {Erwinia chrysanthemi [TaxId: 556]} Back     information, alignment and structure
>d1y63a_ c.37.1.1 (A:) Probable kinase LmjF30.1890 {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d1zp6a1 c.37.1.25 (A:6-181) Hypothetical protein Atu3015 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1zina1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d2bdta1 c.37.1.25 (A:1-176) Hypothetical protein BH3686 {Bacillus halodurans [TaxId: 86665]} Back     information, alignment and structure
>d1knqa_ c.37.1.17 (A:) Gluconate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1j8yf2 c.37.1.10 (F:87-297) GTPase domain of the signal sequence recognition protein Ffh {Archaeon Acidianus ambivalens [TaxId: 2283]} Back     information, alignment and structure
>d1knqa_ c.37.1.17 (A:) Gluconate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1sgwa_ c.37.1.12 (A:) Putative ABC transporter PF0895 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1x6va3 c.37.1.4 (A:34-228) Adenosine-5'phosphosulfate kinase (APS kinase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zaka1 c.37.1.1 (A:3-127,A:159-222) Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} Back     information, alignment and structure
>d1szpa2 c.37.1.11 (A:145-395) DNA repair protein Rad51, catalytic domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1viaa_ c.37.1.2 (A:) Shikimate kinase (AroK) {Campylobacter jejuni [TaxId: 197]} Back     information, alignment and structure
>d1yj5a2 c.37.1.1 (A:351-522) 5' polynucleotide kinase-3' phosphatase, C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2ak3a1 c.37.1.1 (A:0-124,A:162-225) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-3 [TaxId: 9913]} Back     information, alignment and structure
>d2cdna1 c.37.1.1 (A:1-181) Adenylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1ukza_ c.37.1.1 (A:) Uridylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1okkd2 c.37.1.10 (D:97-303) GTPase domain of the signal recognition particle receptor FtsY {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1qf9a_ c.37.1.1 (A:) UMP/CMP kinase {Dictyostelium discoideum [TaxId: 44689]} Back     information, alignment and structure
>d1vmaa2 c.37.1.10 (A:82-294) GTPase domain of the signal recognition particle receptor FtsY {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1g6oa_ c.37.1.11 (A:) Hexameric traffic ATPase, HP0525 {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d2qy9a2 c.37.1.10 (A:285-495) GTPase domain of the signal recognition particle receptor FtsY {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1akya1 c.37.1.1 (A:3-130,A:169-220) Adenylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1s3ga1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus globisporus [TaxId: 1459]} Back     information, alignment and structure
>d1u94a1 c.37.1.11 (A:6-268) RecA protein, ATPase-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1u0ja_ c.37.1.20 (A:) Rep 40 protein helicase domain {Adeno-associated virus 2, AAV2 [TaxId: 10804]} Back     information, alignment and structure
>d1ukza_ c.37.1.1 (A:) Uridylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1bifa1 c.37.1.7 (A:37-249) 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase, kinase domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1ls1a2 c.37.1.10 (A:89-295) GTPase domain of the signal sequence recognition protein Ffh {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d2ak3a1 c.37.1.1 (A:0-124,A:162-225) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-3 [TaxId: 9913]} Back     information, alignment and structure
>d1qf9a_ c.37.1.1 (A:) UMP/CMP kinase {Dictyostelium discoideum [TaxId: 44689]} Back     information, alignment and structure
>d3adka_ c.37.1.1 (A:) Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1e4va1 c.37.1.1 (A:1-121,A:157-214) Adenylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1yj5a2 c.37.1.1 (A:351-522) 5' polynucleotide kinase-3' phosphatase, C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1zina1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1ckea_ c.37.1.1 (A:) CMP kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1teva_ c.37.1.1 (A:) UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xp8a1 c.37.1.11 (A:15-282) RecA protein, ATPase-domain {Deinococcus radiodurans [TaxId: 1299]} Back     information, alignment and structure
>d2onka1 c.37.1.12 (A:1-240) Molybdate/tungstate import ATP-binding protein WtpC (ModC) {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1q3ta_ c.37.1.1 (A:) CMP kinase {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d1teva_ c.37.1.1 (A:) UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2i3ba1 c.37.1.11 (A:1-189) Cancer-related NTPase, C1orf57 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cdna1 c.37.1.1 (A:1-181) Adenylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1ckea_ c.37.1.1 (A:) CMP kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1s3ga1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus globisporus [TaxId: 1459]} Back     information, alignment and structure
>d1ji0a_ c.37.1.12 (A:) Branched chain aminoacid ABC transporter {Thermotoga maritima, TM1139 [TaxId: 2336]} Back     information, alignment and structure
>d1j8yf2 c.37.1.10 (F:87-297) GTPase domain of the signal sequence recognition protein Ffh {Archaeon Acidianus ambivalens [TaxId: 2283]} Back     information, alignment and structure
>d1mv5a_ c.37.1.12 (A:) Multidrug resistance ABC transporter LmrA, C-terminal domain {Lactococcus lactis [TaxId: 1358]} Back     information, alignment and structure
>d1akya1 c.37.1.1 (A:3-130,A:169-220) Adenylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1np6a_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ly1a_ c.37.1.1 (A:) Polynucleotide kinase, kinase domain {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d1m8pa3 c.37.1.15 (A:391-573) ATP sulfurylase C-terminal domain {Fungus (Penicillium chrysogenum) [TaxId: 5076]} Back     information, alignment and structure
>d1g6oa_ c.37.1.11 (A:) Hexameric traffic ATPase, HP0525 {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1ly1a_ c.37.1.1 (A:) Polynucleotide kinase, kinase domain {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d1mo6a1 c.37.1.11 (A:1-269) RecA protein, ATPase-domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1e4va1 c.37.1.1 (A:1-121,A:157-214) Adenylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1g6ha_ c.37.1.12 (A:) MJ1267 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1q3ta_ c.37.1.1 (A:) CMP kinase {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d1v5wa_ c.37.1.11 (A:) Meiotic recombination protein DMC1/LIM15 homolog {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1khta_ c.37.1.1 (A:) Adenylate kinase {Archaeon Methanococcus voltae [TaxId: 2188]} Back     information, alignment and structure
>d2a5yb3 c.37.1.20 (B:109-385) CED-4, NB-ARC domain {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1vpla_ c.37.1.12 (A:) Putative ABC transporter TM0544 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1tf7a2 c.37.1.11 (A:256-497) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} Back     information, alignment and structure
>d1ls1a2 c.37.1.10 (A:89-295) GTPase domain of the signal sequence recognition protein Ffh {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1w36d1 c.37.1.19 (D:2-360) Exodeoxyribonuclease V alpha chain (RecD) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1vmaa2 c.37.1.10 (A:82-294) GTPase domain of the signal recognition particle receptor FtsY {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2pmka1 c.37.1.12 (A:467-707) Haemolysin B ATP-binding protein {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d3b60a1 c.37.1.12 (A:329-581) Multidrug resistance ABC transporter MsbA, C-terminal domain {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1x6va3 c.37.1.4 (A:34-228) Adenosine-5'phosphosulfate kinase (APS kinase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rz3a_ c.37.1.6 (A:) Hypothetical protein rbstp0775 {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1m7ga_ c.37.1.4 (A:) Adenosine-5'phosphosulfate kinase (APS kinase) {Fungus (Penicillium chrysogenum) [TaxId: 5076]} Back     information, alignment and structure
>d1a1va1 c.37.1.14 (A:190-325) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} Back     information, alignment and structure
>d1m7ga_ c.37.1.4 (A:) Adenosine-5'phosphosulfate kinase (APS kinase) {Fungus (Penicillium chrysogenum) [TaxId: 5076]} Back     information, alignment and structure
>d1nksa_ c.37.1.1 (A:) Adenylate kinase {Archaeon Sulfolobus acidocaldarius [TaxId: 2285]} Back     information, alignment and structure
>d1g2912 c.37.1.12 (1:1-240) Maltose transport protein MalK, N-terminal domain {Archaeon Thermococcus litoralis [TaxId: 2265]} Back     information, alignment and structure
>d1odfa_ c.37.1.6 (A:) Hypothetical protein Ygr205W {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1a1va1 c.37.1.14 (A:190-325) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} Back     information, alignment and structure
>d1jj7a_ c.37.1.12 (A:) Peptide transporter Tap1, C-terminal ABC domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1khta_ c.37.1.1 (A:) Adenylate kinase {Archaeon Methanococcus voltae [TaxId: 2188]} Back     information, alignment and structure
>d2hyda1 c.37.1.12 (A:324-578) Putative multidrug export ATP-binding/permease protein SAV1866 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1gkya_ c.37.1.1 (A:) Guanylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1lvga_ c.37.1.1 (A:) Guanylate kinase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1b0ua_ c.37.1.12 (A:) ATP-binding subunit of the histidine permease {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1pzna2 c.37.1.11 (A:96-349) DNA repair protein Rad51, catalytic domain {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1nksa_ c.37.1.1 (A:) Adenylate kinase {Archaeon Sulfolobus acidocaldarius [TaxId: 2285]} Back     information, alignment and structure
>d1np6a_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d3dhwc1 c.37.1.12 (C:1-240) Methionine import ATP-binding protein MetN {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1v43a3 c.37.1.12 (A:7-245) Hypothetical protein PH0022, N-terminal domain {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1r0wa_ c.37.1.12 (A:) Cystic fibrosis transmembrane conductance regulator, CFTR, nucleotide-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1yksa1 c.37.1.14 (A:185-324) YFV helicase domain {Yellow fever virus [TaxId: 11089]} Back     information, alignment and structure
>d3d31a2 c.37.1.12 (A:1-229) Sulfate/molybdate ABC transporter, ATP-binding protein {Methanosarcina acetivorans [TaxId: 2214]} Back     information, alignment and structure
>d1oxxk2 c.37.1.12 (K:1-242) Glucose transport protein GlcV, N-terminal domain {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1n0wa_ c.37.1.11 (A:) DNA repair protein Rad51, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2awna2 c.37.1.12 (A:4-235) Maltose transport protein MalK, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2onka1 c.37.1.12 (A:1-240) Molybdate/tungstate import ATP-binding protein WtpC (ModC) {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1tf7a1 c.37.1.11 (A:14-255) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} Back     information, alignment and structure
>d1pjra1 c.37.1.19 (A:1-318) DEXX box DNA helicase {Bacillus stearothermophilus, PcrA [TaxId: 1422]} Back     information, alignment and structure
>d1xjca_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1xjca_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1szpa2 c.37.1.11 (A:145-395) DNA repair protein Rad51, catalytic domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1l2ta_ c.37.1.12 (A:) MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1lvga_ c.37.1.1 (A:) Guanylate kinase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1l7vc_ c.37.1.12 (C:) ABC transporter involved in vitamin B12 uptake, BtuD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1sq5a_ c.37.1.6 (A:) Pantothenate kinase PanK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1gkya_ c.37.1.1 (A:) Guanylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1znwa1 c.37.1.1 (A:20-201) Guanylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1uj2a_ c.37.1.6 (A:) Uridine-cytidine kinase 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nlfa_ c.37.1.11 (A:) Hexameric replicative helicase repA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1cr2a_ c.37.1.11 (A:) Gene 4 protein (g4p, DNA primase), helicase domain {Bacteriophage T7 [TaxId: 10760]} Back     information, alignment and structure
>d2p67a1 c.37.1.10 (A:1-327) LAO/AO transport system kinase ArgK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1wb9a2 c.37.1.12 (A:567-800) DNA repair protein MutS, the C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1uaaa1 c.37.1.19 (A:2-307) DEXX box DNA helicase {Escherichia coli, RepD [TaxId: 562]} Back     information, alignment and structure
>d1yrba1 c.37.1.10 (A:1-244) ATP(GTP)-binding protein PAB0955 {Pyrococcus abyssi [TaxId: 29292]} Back     information, alignment and structure
>d1nn5a_ c.37.1.1 (A:) Thymidylate kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2i1qa2 c.37.1.11 (A:65-322) DNA repair protein Rad51, catalytic domain {Archaeon Methanococcus voltae [TaxId: 2188]} Back     information, alignment and structure
>d1kgda_ c.37.1.1 (A:) Guanylate kinase-like domain of Cask {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mv5a_ c.37.1.12 (A:) Multidrug resistance ABC transporter LmrA, C-terminal domain {Lactococcus lactis [TaxId: 1358]} Back     information, alignment and structure
>d1tmka_ c.37.1.1 (A:) Thymidylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1tuea_ c.37.1.20 (A:) Replication protein E1 helicase domain {Human papillomavirus type 18 [TaxId: 333761]} Back     information, alignment and structure
>d2p6ra3 c.37.1.19 (A:1-202) Hel308 helicase {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2fz4a1 c.37.1.19 (A:24-229) DNA repair protein RAD25 {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d4tmka_ c.37.1.1 (A:) Thymidylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2fz4a1 c.37.1.19 (A:24-229) DNA repair protein RAD25 {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1rz3a_ c.37.1.6 (A:) Hypothetical protein rbstp0775 {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1r0wa_ c.37.1.12 (A:) Cystic fibrosis transmembrane conductance regulator, CFTR, nucleotide-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2qm8a1 c.37.1.10 (A:5-327) Metallochaperone MeaB {Methylobacterium extorquens [TaxId: 408]} Back     information, alignment and structure
>d1htwa_ c.37.1.18 (A:) Hypothetical protein HI0065 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1v5wa_ c.37.1.11 (A:) Meiotic recombination protein DMC1/LIM15 homolog {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2g9na1 c.37.1.19 (A:21-238) Initiation factor 4a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1s96a_ c.37.1.1 (A:) Guanylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1a7ja_ c.37.1.6 (A:) Phosphoribulokinase {Rhodobacter sphaeroides [TaxId: 1063]} Back     information, alignment and structure
>d1n0wa_ c.37.1.11 (A:) DNA repair protein Rad51, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gsia_ c.37.1.1 (A:) Thymidylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1ji0a_ c.37.1.12 (A:) Branched chain aminoacid ABC transporter {Thermotoga maritima, TM1139 [TaxId: 2336]} Back     information, alignment and structure
>d1htwa_ c.37.1.18 (A:) Hypothetical protein HI0065 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1pzna2 c.37.1.11 (A:96-349) DNA repair protein Rad51, catalytic domain {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1vpla_ c.37.1.12 (A:) Putative ABC transporter TM0544 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1sq5a_ c.37.1.6 (A:) Pantothenate kinase PanK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1znwa1 c.37.1.1 (A:20-201) Guanylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1wf3a1 c.37.1.8 (A:3-180) GTPase Era, N-terminal domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1gm5a3 c.37.1.19 (A:286-549) RecG helicase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1svia_ c.37.1.8 (A:) Probable GTPase EngB {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1ewqa2 c.37.1.12 (A:542-765) DNA repair protein MutS, the C-terminal domain {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1odfa_ c.37.1.6 (A:) Hypothetical protein Ygr205W {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1yksa1 c.37.1.14 (A:185-324) YFV helicase domain {Yellow fever virus [TaxId: 11089]} Back     information, alignment and structure
>d2ocpa1 c.37.1.1 (A:37-277) Deoxyguanosine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xpua3 c.37.1.11 (A:129-417) Transcription termination factor Rho, ATPase domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1u0ja_ c.37.1.20 (A:) Rep 40 protein helicase domain {Adeno-associated virus 2, AAV2 [TaxId: 10804]} Back     information, alignment and structure
>d1e9ra_ c.37.1.11 (A:) Bacterial conjugative coupling protein TrwB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1wb9a2 c.37.1.12 (A:567-800) DNA repair protein MutS, the C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1kkma_ c.91.1.2 (A:) HPr kinase HprK C-terminal domain {Lactobacillus casei [TaxId: 1582]} Back     information, alignment and structure
>d1r8sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF1 [TaxId: 9606]} Back     information, alignment and structure
>d1zcba2 c.37.1.8 (A:47-75,A:202-372) Transducin (alpha subunit) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1kgda_ c.37.1.1 (A:) Guanylate kinase-like domain of Cask {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ihua1 c.37.1.10 (A:1-296) Arsenite-translocating ATPase ArsA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2fh5b1 c.37.1.8 (B:63-269) Signal recognition particle receptor beta-subunit {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2vp4a1 c.37.1.1 (A:12-208) Deoxyribonucleoside kinase {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1veca_ c.37.1.19 (A:) DEAD box RNA helicase rck/p54 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2p67a1 c.37.1.10 (A:1-327) LAO/AO transport system kinase ArgK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1uf9a_ c.37.1.1 (A:) Dephospho-CoA kinase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1knxa2 c.91.1.2 (A:133-309) HPr kinase HprK C-terminal domain {Mycoplasma pneumoniae [TaxId: 2104]} Back     information, alignment and structure
>d1zj6a1 c.37.1.8 (A:2-178) ADP-ribosylation factor {Human (Homo sapiens), ARL5A [TaxId: 9606]} Back     information, alignment and structure
>d1uf9a_ c.37.1.1 (A:) Dephospho-CoA kinase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1deka_ c.37.1.1 (A:) Deoxynucleoside monophosphate kinase {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d1nrjb_ c.37.1.8 (B:) Signal recognition particle receptor beta-subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ko7a2 c.91.1.2 (A:130-298) HPr kinase HprK C-terminal domain {Staphylococcus xylosus [TaxId: 1288]} Back     information, alignment and structure
>d1kkma_ c.91.1.2 (A:) HPr kinase HprK C-terminal domain {Lactobacillus casei [TaxId: 1582]} Back     information, alignment and structure
>d2gj8a1 c.37.1.8 (A:216-376) Probable tRNA modification GTPase TrmE (MnmE), G domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ihua1 c.37.1.10 (A:1-296) Arsenite-translocating ATPase ArsA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1mkya1 c.37.1.8 (A:2-172) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2fn4a1 c.37.1.8 (A:24-196) r-Ras {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yrba1 c.37.1.10 (A:1-244) ATP(GTP)-binding protein PAB0955 {Pyrococcus abyssi [TaxId: 29292]} Back     information, alignment and structure
>d2qm8a1 c.37.1.10 (A:5-327) Metallochaperone MeaB {Methylobacterium extorquens [TaxId: 408]} Back     information, alignment and structure
>d2i1qa2 c.37.1.11 (A:65-322) DNA repair protein Rad51, catalytic domain {Archaeon Methanococcus voltae [TaxId: 2188]} Back     information, alignment and structure
>d1cz5a2 d.31.1.1 (A:92-185) C-terminal domain of VAT-N, VAT-Nc {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1u8za_ c.37.1.8 (A:) Ras-related protein RalA {Cotton-top tamarin (Saguinus oedipus) [TaxId: 9490]} Back     information, alignment and structure
>d1upta_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARL1 [TaxId: 9606]} Back     information, alignment and structure
>d2a5ja1 c.37.1.8 (A:9-181) Rab2b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gm5a3 c.37.1.19 (A:286-549) RecG helicase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2gj8a1 c.37.1.8 (A:216-376) Probable tRNA modification GTPase TrmE (MnmE), G domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1vhta_ c.37.1.1 (A:) Dephospho-CoA kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2j0sa1 c.37.1.19 (A:22-243) Probable ATP-dependent RNA helicase DDX48 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bmfa2 c.37.1.14 (A:178-482) Dengue virus helicase {Dengue virus type 2 [TaxId: 11060]} Back     information, alignment and structure
>d2qtvb1 c.37.1.8 (B:24-189) SAR1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d3raba_ c.37.1.8 (A:) Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1a7ja_ c.37.1.6 (A:) Phosphoribulokinase {Rhodobacter sphaeroides [TaxId: 1063]} Back     information, alignment and structure
>d2bmfa2 c.37.1.14 (A:178-482) Dengue virus helicase {Dengue virus type 2 [TaxId: 11060]} Back     information, alignment and structure
>d1z2aa1 c.37.1.8 (A:8-171) Rab23 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1z0fa1 c.37.1.8 (A:8-173) Rab14 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uaaa1 c.37.1.19 (A:2-307) DEXX box DNA helicase {Escherichia coli, RepD [TaxId: 562]} Back     information, alignment and structure
>d1ksha_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL2 [TaxId: 10090]} Back     information, alignment and structure
>d1vhta_ c.37.1.1 (A:) Dephospho-CoA kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1qdea_ c.37.1.19 (A:) Initiation factor 4a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ko7a2 c.91.1.2 (A:130-298) HPr kinase HprK C-terminal domain {Staphylococcus xylosus [TaxId: 1288]} Back     information, alignment and structure
>d1kaoa_ c.37.1.8 (A:) Rap2a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1e9ra_ c.37.1.11 (A:) Bacterial conjugative coupling protein TrwB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2atva1 c.37.1.8 (A:5-172) Ras-like estrogen-regulated growth inhibitor, RERG {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ew1a1 c.37.1.8 (A:4-174) Rab30 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1knxa2 c.91.1.2 (A:133-309) HPr kinase HprK C-terminal domain {Mycoplasma pneumoniae [TaxId: 2104]} Back     information, alignment and structure
>d2f7sa1 c.37.1.8 (A:5-190) Rab27b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wf3a1 c.37.1.8 (A:3-180) GTPase Era, N-terminal domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2erya1 c.37.1.8 (A:10-180) r-Ras2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z08a1 c.37.1.8 (A:17-183) Rab21 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jjva_ c.37.1.1 (A:) Dephospho-CoA kinase {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1deka_ c.37.1.1 (A:) Deoxynucleoside monophosphate kinase {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d1f6ba_ c.37.1.8 (A:) SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d1pjra1 c.37.1.19 (A:1-318) DEXX box DNA helicase {Bacillus stearothermophilus, PcrA [TaxId: 1422]} Back     information, alignment and structure
>d1zd9a1 c.37.1.8 (A:18-181) ADP-ribosylation factor {Human (Homo sapiens), ARL8A [TaxId: 9606]} Back     information, alignment and structure
>d1p5zb_ c.37.1.1 (B:) Deoxycytidine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1r2qa_ c.37.1.8 (A:) Rab5a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vg8a_ c.37.1.8 (A:) Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2f9la1 c.37.1.8 (A:8-182) Rab11b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2eyqa3 c.37.1.19 (A:546-778) Transcription-repair coupling factor, TRCF {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ewqa2 c.37.1.12 (A:542-765) DNA repair protein MutS, the C-terminal domain {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1azta2 c.37.1.8 (A:35-65,A:202-391) Transducin (alpha subunit) {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1ihua2 c.37.1.10 (A:308-586) Arsenite-translocating ATPase ArsA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ky3a_ c.37.1.8 (A:) Rab-related protein ypt7p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1g16a_ c.37.1.8 (A:) Rab-related protein Sec4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2vp4a1 c.37.1.1 (A:12-208) Deoxyribonucleoside kinase {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2erxa1 c.37.1.8 (A:6-176) di-Ras2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1c1ya_ c.37.1.8 (A:) Rap1A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bmea1 c.37.1.8 (A:6-179) Rab4a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z06a1 c.37.1.8 (A:32-196) Rab-33b {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ctqa_ c.37.1.8 (A:) cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1s2ma1 c.37.1.19 (A:46-251) Putative ATP-dependent RNA helicase DHH1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1z0ja1 c.37.1.8 (A:2-168) Rab-22a {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1jjva_ c.37.1.1 (A:) Dephospho-CoA kinase {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1kmqa_ c.37.1.8 (A:) RhoA {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ihua2 c.37.1.10 (A:308-586) Arsenite-translocating ATPase ArsA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xtqa1 c.37.1.8 (A:3-169) GTP-binding protein RheB {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p6xa_ c.37.1.1 (A:) Thymidine kinase {Equine herpesvirus type 4 [TaxId: 10331]} Back     information, alignment and structure
>d2g6ba1 c.37.1.8 (A:58-227) Rab26 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x3sa1 c.37.1.8 (A:2-178) Rab18 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yzqa1 c.37.1.8 (A:14-177) Rab6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wmsa_ c.37.1.8 (A:) Rab9a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bcgy1 c.37.1.8 (Y:3-196) GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1xpua3 c.37.1.11 (A:129-417) Transcription termination factor Rho, ATPase domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1sgwa_ c.37.1.12 (A:) Putative ABC transporter PF0895 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d2gjsa1 c.37.1.8 (A:91-258) Rad {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ocpa1 c.37.1.1 (A:37-277) Deoxyguanosine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ek0a_ c.37.1.8 (A:) Ypt51 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2atxa1 c.37.1.8 (A:9-193) RhoQ {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ngra_ c.37.1.8 (A:) CDC42 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m7ba_ c.37.1.8 (A:) RhoE (RND3) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1fzqa_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL3 [TaxId: 10090]} Back     information, alignment and structure
>d1x1ra1 c.37.1.8 (A:10-178) Ras-related protein M-Ras (XRas) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1mh1a_ c.37.1.8 (A:) Rac {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2g3ya1 c.37.1.8 (A:73-244) GTP-binding protein GEM {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h65a_ c.37.1.8 (A:) Chloroplast protein translocon GTPase Toc34 {Garden pea (Pisum sativum) [TaxId: 3888]} Back     information, alignment and structure
>d1rifa_ c.37.1.23 (A:) DNA helicase UvsW {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d1h65a_ c.37.1.8 (A:) Chloroplast protein translocon GTPase Toc34 {Garden pea (Pisum sativum) [TaxId: 3888]} Back     information, alignment and structure
>d2cxxa1 c.37.1.8 (A:2-185) GTP-binding protein engB {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1r8sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF1 [TaxId: 9606]} Back     information, alignment and structure
>d1w1wa_ c.37.1.12 (A:) Smc head domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1b0ua_ c.37.1.12 (A:) ATP-binding subunit of the histidine permease {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1osna_ c.37.1.1 (A:) Thymidine kinase {Varicella-zoster virus [TaxId: 10335]} Back     information, alignment and structure
>d1u0la2 c.37.1.8 (A:69-293) Probable GTPase EngC (YjeQ), C-terminal domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2b8ta1 c.37.1.24 (A:11-149) Thymidine kinase, TK1, N-terminal domain {Ureaplasma urealyticum [TaxId: 2130]} Back     information, alignment and structure
>d1wp9a1 c.37.1.19 (A:1-200) putative ATP-dependent RNA helicase PF2015 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1e0sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF6 [TaxId: 9606]} Back     information, alignment and structure
>d2fu5c1 c.37.1.8 (C:3-175) Rab8a {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2fh5b1 c.37.1.8 (B:63-269) Signal recognition particle receptor beta-subunit {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1nrjb_ c.37.1.8 (B:) Signal recognition particle receptor beta-subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1moza_ c.37.1.8 (A:) ADP-ribosylation factor {Baker's yeast (Saccharomyces cerevisiae), ARL1 [TaxId: 4932]} Back     information, alignment and structure
>d1br2a2 c.37.1.9 (A:80-789) Myosin S1, motor domain {Chicken (Gallus gallus), pectoral muscle [TaxId: 9031]} Back     information, alignment and structure
>d1p5zb_ c.37.1.1 (B:) Deoxycytidine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cp2a_ c.37.1.10 (A:) Nitrogenase iron protein {Clostridium pasteurianum [TaxId: 1501]} Back     information, alignment and structure
>d1lkxa_ c.37.1.9 (A:) Myosin S1, motor domain {Dictyostelium discoideum, class-I myosin MyoE [TaxId: 44689]} Back     information, alignment and structure
>d1egaa1 c.37.1.8 (A:4-182) GTPase Era, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1cp2a_ c.37.1.10 (A:) Nitrogenase iron protein {Clostridium pasteurianum [TaxId: 1501]} Back     information, alignment and structure
>d1byia_ c.37.1.10 (A:) Dethiobiotin synthetase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1d0xa2 c.37.1.9 (A:2-33,A:80-759) Myosin S1, motor domain {Dictyostelium discoideum [TaxId: 44689]} Back     information, alignment and structure
>d1tq4a_ c.37.1.8 (A:) Interferon-inducible GTPase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1upta_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARL1 [TaxId: 9606]} Back     information, alignment and structure
>d2mysa2 c.37.1.9 (A:4-33,A:80-843) Myosin S1, motor domain {Chicken (Gallus gallus), pectoral muscle [TaxId: 9031]} Back     information, alignment and structure
>d2qtvb1 c.37.1.8 (B:24-189) SAR1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1i2ma_ c.37.1.8 (A:) Ran {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nija1 c.37.1.10 (A:2-223) Hypothetical protein YjiA, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1wrba1 c.37.1.19 (A:164-401) putative ATP-dependent RNA helicase VlgB {Flatworm (Dugesia japonica) [TaxId: 6161]} Back     information, alignment and structure
>d1ksha_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL2 [TaxId: 10090]} Back     information, alignment and structure
>d1w7ja2 c.37.1.9 (A:63-792) Myosin S1, motor domain {Chicken (Gallus gallus), Va isoform [TaxId: 9031]} Back     information, alignment and structure
>d1f6ba_ c.37.1.8 (A:) SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d2bmja1 c.37.1.8 (A:66-240) Centaurin gamma 1, G domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2eyqa3 c.37.1.19 (A:546-778) Transcription-repair coupling factor, TRCF {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2f7sa1 c.37.1.8 (A:5-190) Rab27b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w1wa_ c.37.1.12 (A:) Smc head domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1wp9a1 c.37.1.19 (A:1-200) putative ATP-dependent RNA helicase PF2015 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d3raba_ c.37.1.8 (A:) Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1w36b1 c.37.1.19 (B:1-485) Exodeoxyribonuclease V beta chain (RecB), N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1oywa2 c.37.1.19 (A:1-206) RecQ helicase domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1mkya2 c.37.1.8 (A:173-358) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1zj6a1 c.37.1.8 (A:2-178) ADP-ribosylation factor {Human (Homo sapiens), ARL5A [TaxId: 9606]} Back     information, alignment and structure
>d2bcjq2 c.37.1.8 (Q:38-66,Q:184-354) Transducin (alpha subunit) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1z2aa1 c.37.1.8 (A:8-171) Rab23 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1e69a_ c.37.1.12 (A:) Smc head domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1kk8a2 c.37.1.9 (A:1-28,A:77-837) Myosin S1, motor domain {Bay scallop (Aequipecten irradians) [TaxId: 31199]} Back     information, alignment and structure
>d1hv8a1 c.37.1.19 (A:3-210) Putative DEAD box RNA helicase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1zd9a1 c.37.1.8 (A:18-181) ADP-ribosylation factor {Human (Homo sapiens), ARL8A [TaxId: 9606]} Back     information, alignment and structure
>d1g6ha_ c.37.1.12 (A:) MJ1267 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1t9ha2 c.37.1.8 (A:68-298) Probable GTPase EngC (YjeQ), C-terminal domain {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1e2ka_ c.37.1.1 (A:) Thymidine kinase {Herpes simplex virus type 1, different strains [TaxId: 10298]} Back     information, alignment and structure
>d1p6xa_ c.37.1.1 (A:) Thymidine kinase {Equine herpesvirus type 4 [TaxId: 10331]} Back     information, alignment and structure
>d1kaoa_ c.37.1.8 (A:) Rap2a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z0fa1 c.37.1.8 (A:8-173) Rab14 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1udxa2 c.37.1.8 (A:157-336) Obg GTP-binding protein middle domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1xzpa2 c.37.1.8 (A:212-371) TrmE GTPase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2ew1a1 c.37.1.8 (A:4-174) Rab30 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1r2qa_ c.37.1.8 (A:) Rab5a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1svia_ c.37.1.8 (A:) Probable GTPase EngB {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2afhe1 c.37.1.10 (E:1-289) Nitrogenase iron protein {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d1lnza2 c.37.1.8 (A:158-342) Obg GTP-binding protein middle domain {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2erya1 c.37.1.8 (A:10-180) r-Ras2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fx0a3 c.37.1.11 (A:97-372) Central domain of alpha subunit of F1 ATP synthase {Spinach (Spinacia oleracea), chloroplast [TaxId: 3562]} Back     information, alignment and structure
>d1puia_ c.37.1.8 (A:) Probable GTPase EngB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1l7vc_ c.37.1.12 (C:) ABC transporter involved in vitamin B12 uptake, BtuD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1osna_ c.37.1.1 (A:) Thymidine kinase {Varicella-zoster virus [TaxId: 10335]} Back     information, alignment and structure
>d1xzpa2 c.37.1.8 (A:212-371) TrmE GTPase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2erxa1 c.37.1.8 (A:6-176) di-Ras2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ctqa_ c.37.1.8 (A:) cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fzqa_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL3 [TaxId: 10090]} Back     information, alignment and structure
>d1qhla_ c.37.1.12 (A:) Cell division protein MukB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure