Citrus Sinensis ID: 001615

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820-------830-------840-------850-------860-------870-------880-------890-------900-------910-------920-------930-------940-------950-------960-------970-------980-------990------1000------1010------1020------1030------1040----
MSPRFLGATKSIFSRSKYLLVVAAPITRPRVLSTSSVSFPLKTAKPPVMSYRPNYQGGQRRGGGGPSTSGRGGRRGGRGGGGGRGGGGGGRGEQRWWDPVWRAERLRQQAAEMEVFDQNEWWGKLEQMKRGEEQEMIIKRKFSRADQQTLADMAHQLGLHFHAYNKGKALAVSKVPLPMYRPDLDERHGSTEKELQMSIETERRVGNLLNSSQGNVPVNDSGIESSEVARRPKLSVKVANTISPPQSDSAKERLNVILKERQEKLKSSDSGKAMLSFREKLPAFKMKAEFLKAVAENQVLVVSGETGCGKTTQLPQFILEEELSSLRGADCNIICTQPRRISAISVAARVSSERGENLGETVGYQIRLESKRSAQTRLLFCTTGVLLRQLVEDPDLSCVSHLLVDEIHERGMNEDFLLIILRDLLPRRPDLRLILMSATINADLFSKYFGNAPTVHIPGLTFPVTDLFLEDVLEKTRYKMNSKLDSFQGNSRRSRRQDSKKDHLTALFEDVDIDSNYKNYRASTRASLEAWSAEQIDLGLVESTIEYICRHEGDGAILVFLTGWNDISKLLDQIKVNKFLGDPNKFLVLPLHGSMPTINQREIFDRPPPNKRKIVLATNIAESSITIDDVVYVVDCGKAKETSYDALNKLACLLPSWISKASAHQRRGRAGRVQPGVCYKLYPRIIHDAMLPYQLPEILRTPLQELCLHIKSLQLGTVGSFLSKALQPPDPLAVQNAIELLKTIGALDDMENLTPLGRHLCTLPVDPNIGKMLLMGAIFQCLNPALTIAAALAHRNPFVLPVNMQKEVDEAKRSFAGDSCSDHIALLKAFDGYKDAKRNRRERDFCWENFLSPITLQMMEDMRSQFLDLLSDIGFVDKSKGPSAYNRYSHDLEMVCAILCAGLYPNVVQCKRKGKRAVFYTKEVGQVALHPSSVNANQNNFPLPYMVYSEMVKTNNINVYDSTNISEYALLLFGGNLIPSKTGEGIEMLGGYLHFSASKTVLELIRKLRGELDKLLNRKIEDPRVDLSVEGKAVVSAVVELLHG
ccccccccccEEEccccEEEEEccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHcccccccccccHHHHHHHHHHHHHcccEEEEEcccccHHHHHHHHHHHHHHHHHHHHcccccEEEEEEccccccccHHHHHcccccHHHcccHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccHHHHHHcHHHHHHHHHHHcccHHHHHHHHHHcccccHHHHHHHHHHHcccEEEEEcccccccccHHHHHHHHHHHHccccccEEEEEEccccHHHHHHHHHHHHHHcccccccEEEEEEEEEccccccEEEEEcHHHHHHHHHcccccccccEEEEEccccccccHHHHHHHHHHHcccccccEEEEEEccccHHHHHHHcccccEEEEcccccccEEEEHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHcccccccHHHHHHHHHHHHHccccccEEEEcccHHHHHHHHHHHHHcccccccccEEEEEcccccccHHHHccccccccccEEEEEEccccccccccccEEEEEEcccccEEEEcccccccccccEEEccccHHHHcccccccccccEEEcccHHHHHHccccccccEEEccHHHHHHHHHHcccccHHHHHHcccccccHHHHHHHHHHHHHcccccccccccHHHHHHHccccccHHHHHHHHHHHccccHHHHHHHHHHccccccccccccHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHccHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccHHHHHHHHHHHccccEEEccccccEEEEEEccccEEEEccccccccccccccccEEEEEEEEEccEEEEccccccHHHHHHcccccccccccccEEEEccEEEEEEEHHHHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHcc
ccccHccccHHHHccccEEEEEEcccccccEEcccccccccccccccEEEEcccccccccccccccccccccccccccccccccccccccccHHHcccHHHHHHHHHHHcccccccccHHHHHHHHHHHccccEEEEEcccccHHcHHHHHHHHHHHHHHHHHHHcccEEEEEcccccccccccHHHcccccEEEcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHccccHHHHHHHHHHHHcccEEEEEEccccccccccHHHHHHHcccccccccEEEEEccHHHHHHHHHHHHHHHHHccccccEEEEEEEEccccccccEEEEcccHHHHHHHHccccccccEEEEEEcHHHcccHHHHHHHHHHHHHHcccccEEEEEEEEccHHHHHHHHccccEEEEccccccHHHHHHHHHHHHHcccccccHHHHHHHHcHHccccccHHHHHHHHccccccccccccccEEEEHccccccccccHHHHHHHHHHHHcccccccEEEEEccHHHHHHHHHHHHHcccccccccEEEEEEEccccHHHHHHHHcccccccEEEEEEEccEEEEEEEccEEEEEccccEEEcccccccccccccccHHHHHHHHHHcccccccccccEEEEccHHHHHHHccccccHHHcccHHHHHHHHHHcccccHHHHHHHHcccccHHHHHHHHHHHHHHccccccccccHHHHHHccccccHHHHHHHHHHHHHccccHHHHHHHHHcccccccccccHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccEEccccccccccccccHHHHHHHHHHccccccEEEcccccEEEEEEEcccEEEEcccccccccccccccEEEEEEEEEEcHEHHHHcccccccEEEEEccccEEEcccccEEEcccEEEEcccHHHHHHHHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHcc
MSPRFLGATKSIFSRSKYLLVVaapitrprvlstssvsfplktakppvmsyrpnyqggqrrggggpstsgrggrrggrgggggrggggggrgeqrwwdpVWRAERLRQQAAEMEVFDQNEWWGKLEQMKRGEEQEMIIKRKFSRADQQTLADMAHQLGLHFHAYNKGKAlavskvplpmyrpdlderhgsteKELQMSIETERRVGNllnssqgnvpvndsgiessevarrpklsVKVAntisppqsdsAKERLNVILKERQeklkssdsgKAMLSFREKLPAFKMKAEFLKAVAENQVLVVSgetgcgkttqlpQFILEEELsslrgadcniictqprrISAISVAARVSsergenlgETVGYQIRLESKRSAQTRLLFCTTGVLLRqlvedpdlscvSHLLVDEIHERGMNEDFLLIILRDLLPRRPDLRLILMSATINADLfskyfgnaptvhipgltfpvtdlFLEDVLEKTRYKMNSKldsfqgnsrrsrrqdskkdHLTALFedvdidsnyknyrASTRASLEAWSAEQIDLGLVESTIEYICRHEGDGAILVFLTGWNDISKLLDQIKVnkflgdpnkflvlplhgsmptinqreifdrpppnkrkIVLATNiaessitidDVVYVVDCGKAKETSYDALNKLACLLPSWISKASAhqrrgragrvqpgvcyklypriihdamlpyqlpeilRTPLQELCLHIKslqlgtvgsflskalqppdplAVQNAIELLKTIgalddmenltplgrhlctlpvdpnigkMLLMGAIFQCLNPALTIAAALahrnpfvlpvnmQKEVDEAkrsfagdsCSDHIALLKAFDGykdakrnrrerdfcwenflsPITLQMMEDMRSQFLDLLSDigfvdkskgpsaynryshDLEMVCAILCAglypnvvqckrkgkravfytkevgqvalhpssvnanqnnfplpyMVYSEMvktnninvydstniSEYALLLFggnlipsktgegiemLGGYLHFSASKTVLELIRKLRGELDKLLNrkiedprvdlsvEGKAVVSAVVELLHG
msprflgatksifsrskYLLVVaapitrprvlstssvsfplktakppvmsyrpnyqggqrrggggpstsgrggrrggrgggggrggggggrgeqrwwDPVWRAERLRQQAAEmevfdqnewwgKLEQMKRGEEQEMIIKRKFSRADQQTLADMAHQLGLHFHAYNKGKALAVSKVPLPMYRPDLDERHGSTEKELQMSIETERRVGNllnssqgnvpvndsgiessevarrpklsvkvantisppqsdsakeRLNVILKErqeklkssdsgkaMLSFREKLPAFKMKAEFLKAVAENQVLVVSGETGCGKTTQLPQFILEEELSSLRGADCNIICTQPRRISAISVAarvssergenlgetvgYQIRLESKRSAQTRLLFCTTGVLLRQLVEDPDLSCVSHLLVDEIHERGMNEDFLLIILRDLLPRRPDLRLILMSATINADLFSKYFGNAPTVHIPGLTFPVTDLFLEDVLEKTRYKmnskldsfqgnsrrsrrqdskkdhltalfedvdidsnykNYRASTRASLEAWSAEQIDLGLVESTIEYICRHEGDGAILVFLTGWNDISKLLDQIKVNKFLGDPNKFLVLPLHGSMPTInqreifdrpppnKRKIVLAtniaessitiddvVYVVDCGKAKETSYDALNKLACLLPSWISKAsahqrrgragrvqpgVCYKLYPRIIHDAMLPYQLPEILRTPLQELCLHIKSLQLGTVGSFLSKALQPPDPLAVQNAIELLKTIGALDDMENLTPLGRHLCTLPVDPNIGKMLLMGAIFQCLNPALTIAAALAHRNPFVLPVNMQKEVDEAKRSFAGDSCSDHIALLKAfdgykdakrnrrerdfcWENFLSPITLQMMEDMRSQFLDLLSDIGFVDKSKGPSAYNRYSHDLEMVCAILCAGLYPNVVQCKRKGKRAVFYTKEVGqvalhpssvnanqnnFPLPYMVYSEMVKTNNINVYDSTNISEYALLLFGGNLIPSKTGEGIEMLGGYLHFSASKTVLELIRKLRGELDKLlnrkiedprvdlsvegkAVVSAVVELLHG
MSPRFLGATKSIFSRSKYLLVVAAPITRPRVLSTSSVSFPLKTAKPPVMSYRPNYQggqrrggggpstsgrggrrggrgggggrggggggrgEQRWWDPVWRAERLRQQAAEMEVFDQNEWWGKLEQMKRGEEQEMIIKRKFSRADQQTLADMAHQLGLHFHAYNKGKALAVSKVPLPMYRPDLDERHGSTEKELQMSIETERRVGNLLNSSQGNVPVNDSGIESSEVARRPKLSVKVANTISPPQSDSAKERLNVILKERQEKLKSSDSGKAMLSFREKLPAFKMKAEFLKAVAENQVLVVSGETGCGKTTQLPQFILEEELSSLRGADCNIICTQPrrisaisvaarvssERGENLGETVGYQIRLESKRSAQTRLLFCTTGVLLRQLVEDPDLSCVSHLLVDEIHERGMNEDFlliilrdllprrpdlrlilMSATINADLFSKYFGNAPTVHIPGLTFPVTDLFLEDVLEKTRYKMNSKLDSFQGNsrrsrrQDSKKDHLTALFEDVDIDSNYKNYRASTRASLEAWSAEQIDLGLVESTIEYICRHEGDGAILVFLTGWNDISKLLDQIKVNKFLGDPNKFLVLPLHGSMPTINQREIFDRPPPNKRKIVLATNIAESSITIDDVVYVVDCGKAKETSYDALNKLACLLPSWISKASAHQRRGRAGRVQPGVCYKLYPRIIHDAMLPYQLPEILRTPLQELCLHIKSLQLGTVGSFLSKALQPPDPLAVQNAIELLKTIGALDDMENLTPLGRHLCTLPVDPNIGKMLLMGAIFQCLNPALTIAAALAHRNPFVLPVNMQKEVDEAKRSFAGDSCSDHIALLKAFDGYKDAKRNRRERDFCWENFLSPITLQMMEDMRSQFLDLLSDIGFVDKSKGPSAYNRYSHDLEMVCAILCAGLYPNVVQCKRKGKRAVFYTKEVGQVALHPSSVNANQNNFPLPYMVYSEMVKTNNINVYDSTNISEYALLLFGGNLIPSKTGEGIEMLGGYLHFSASKTVLELIRKLRGELDKLLNRKIEDPRVDLSVEGKAVVSAVVELLHG
*******ATKSIFSRSKYLLVVAAPITRPRVL***************************************************************WWDPVWRAERLRQQAAEMEVFDQNEWWGKLE**********************TLADMAHQLGLHFHAYNKGKALAVSKVPL*******************************************************************************************************LPAFKMKAEFLKAVAENQVLVVSGETGCGKTTQLPQFILEEELSSLRGADCNIICTQPRRISAISVAARV*******LGETVGYQIRLESKRSAQTRLLFCTTGVLLRQLVEDPDLSCVSHLLVDEIHERGMNEDFLLIILRDLLPRRPDLRLILMSATINADLFSKYFGNAPTVHIPGLTFPVTDLFLEDVLEKTRY**************************TALFEDVDIDSNYKNYRASTRASLEAWSAEQIDLGLVESTIEYICRHEGDGAILVFLTGWNDISKLLDQIKVNKFLGDPNKFLVLPLHGSMPTINQREIFD*****KRKIVLATNIAESSITIDDVVYVVDCGKAKETSYDALNKLACLLPSWISKASAHQRRGRAGRVQPGVCYKLYPRIIHDAMLPYQLPEILRTPLQELCLHIKSLQLGTVGSFLSKALQPPDPLAVQNAIELLKTIGALDDMENLTPLGRHLCTLPVDPNIGKMLLMGAIFQCLNPALTIAAALAHRNPFVLPVNMQKEVD***RSFAGDSCSDHIALLKAFDGYKDAKRNRRERDFCWENFLSPITLQMMEDMRSQFLDLLSDIGFVDKSKGPSAYNRYSHDLEMVCAILCAGLYPNVVQCKRKGKRAVFYTKEVGQVALHPSSVNANQNNFPLPYMVYSEMVKTNNINVYDSTNISEYALLLFGGNLIPSKTGEGIEMLGGYLHFSASKTVLELIRKLRGELDKLLNRKIEDPRVDLSVEGKAVVSAVVEL***
***R***ATKSIFSRSKYLLVVAAPIT*******************************************************************************************NEWWGKLEQMKR*****************QTLADMAHQLGLHF***********SKVPLPMYRPDLD***********************************************************************************************LPAFKMKAEFLKAVAENQVLVVSGETGCGKTTQLPQFILEEELSSLRGADCNIICTQPRRISAISVAARVSSERGENLGETVGYQIRLESKRSAQTRLLFCTTGVLLRQLVEDPDLSCVSHLLVDEIHERGMNEDFLLIILRDLLPRRPDLRLILMSATINADLFSKYFGNAPTVHIPGLTFPVTDLFLEDVLEKTRYKMN****************DSKKDHLTALFEDVDID*********TRASLEAWSAEQIDLGLVESTIEYICRHEGDGAILVFLTGWNDISKLLDQIKVNKFLGDPNKFLVLPLHGSMPTINQREIFDRPPPNKRKIVLATNIAESSITIDDVVYVVDCGKAKETSYDALNKLACLLPSWISKASAHQRRGRAGRVQPGVCYKLYPRIIHDAMLPYQLPEILRTPLQELCLHIKSLQLGTVGSFLSKALQPPDPLAVQNAIELLKTIGALDDMENLTPLGRHLCTLPVDPNIGKMLLMGAIFQCLNPALTIAAALAHRNPFV***************FAGDSCSDHIALLKAFDGYKDAKRNRRERDFCWENFLSPITLQMMEDMRSQFLDLLSDIGFVDKSKGPSAYNRYSHDLEMVCAILCAGLYPNVVQCKRKGKRAVFYTKEVGQVALHPSSVNANQNNFPLPYMVYSEMVKTNNINVYDSTNISEYALLLFGGNLIPSKTGEGIEMLGGYLHFSASKTVLELIRKLRGELDKLLNRKIEDP*****V*GKAVVSAVVELLHG
********TKSIFSRSKYLLVVAAPITRPRVLSTSSVSFPLKTAKPPVMSYRPNY**************************************QRWWDPVWRAERLRQQAAEMEVFDQNEWWGKLEQMKRGEEQEMIIKRKFSRADQQTLADMAHQLGLHFHAYNKGKALAVSKVPLPMYRPDLDERHGSTEKELQMSIETERRVGNLLNSSQGNVPVNDSGIESSEVARRPKLSVKVANTISPPQSDSAKERLNVILKERQ********GKAMLSFREKLPAFKMKAEFLKAVAENQVLVVSGETGCGKTTQLPQFILEEELSSLRGADCNIICTQPRRISAISVAARVSSERGENLGETVGYQIRLESKRSAQTRLLFCTTGVLLRQLVEDPDLSCVSHLLVDEIHERGMNEDFLLIILRDLLPRRPDLRLILMSATINADLFSKYFGNAPTVHIPGLTFPVTDLFLEDVLEKTRYKMNSKL*****************DHLTALFEDVDIDSNYKNYRASTRASLEAWSAEQIDLGLVESTIEYICRHEGDGAILVFLTGWNDISKLLDQIKVNKFLGDPNKFLVLPLHGSMPTINQREIFDRPPPNKRKIVLATNIAESSITIDDVVYVVDCGKAKETSYDALNKLACLLPSWISK***********RVQPGVCYKLYPRIIHDAMLPYQLPEILRTPLQELCLHIKSLQLGTVGSFLSKALQPPDPLAVQNAIELLKTIGALDDMENLTPLGRHLCTLPVDPNIGKMLLMGAIFQCLNPALTIAAALAHRNPFVLPVNMQKEVDEAKRSFAGDSCSDHIALLKAFDGYKDAKRNRRERDFCWENFLSPITLQMMEDMRSQFLDLLSDIGFVDKSKGPSAYNRYSHDLEMVCAILCAGLYPNVVQCKRKGKRAVFYTKEVGQVALHPSSVNANQNNFPLPYMVYSEMVKTNNINVYDSTNISEYALLLFGGNLIPSKTGEGIEMLGGYLHFSASKTVLELIRKLRGELDKLLNRKIEDPRVDLSVEGKAVVSAVVELLHG
**********SIFSRSKYLLVVAAPITRPRVLSTSSVSFPLKTAKPPVMSYRPNYQ************************************EQRWWDPVWRAERLRQQA*EMEVFDQNEWWGKLEQMKRGEEQEMIIKRKFSRADQQTLADMAHQLGLHFHAYNKGKALAVSKVPLPMYRPDLDERHGSTEKELQMSIETERRVGNLLNSSQGNVPVN*************************PQSDSAK**LNVILKERQEKLKSSDSGKAMLSFREKLPAFKMKAEFLKAVAENQVLVVSGETGCGKTTQLPQFILEEELSSLRGADCNIICTQPRRISAISVAARVSSERGENLGETVGYQIRLESKRSAQTRLLFCTTGVLLRQLVEDPDLSCVSHLLVDEIHERGMNEDFLLIILRDLLPRRPDLRLILMSATINADLFSKYFGNAPTVHIPGLTFPVTDLFLEDVLEKTRYKMNSKLDSFQGNSRRSRRQDSKKDHLTALFEDVDIDSNYKNYRASTRASLEAWSAEQIDLGLVESTIEYICRHEGDGAILVFLTGWNDISKLLDQIKVNKFLGDPNKFLVLPLHGSMPTINQREIFDRPPPNKRKIVLATNIAESSITIDDVVYVVDCGKAKETSYDALNKLACLLPSWISKASAHQR**RAGRVQPGVCYKLYPRIIHDAMLPYQLPEILRTPLQELCLHIKSLQLGTVGSFLSKALQPPDPLAVQNAIELLKTIGALDDMENLTPLGRHLCTLPVDPNIGKMLLMGAIFQCLNPALTIAAALAHRNPFVLPVNMQKEVDEAKRSFAGDSCSDHIALLKAFDGYKDAKRNRRERDFCWENFLSPITLQMMEDMRSQFLDLLSDIGFVDKSKGPSAYNRYSHDLEMVCAILCAGLYPNVVQCKRKGKRAVFYTKEVGQVALHPSSVNANQNNFPLPYMVYSEMVKTNNINVYDSTNISEYALLLFGGNLIPSKTGEGIEMLGGYLHFSASKTVLELIRKLRGELDKLLNRKIEDPRVDLSVEGKAVVSAVVELLHG
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSPRFLGATKSIFSRSKYLLVVAAPITRPRVLSTSSVSFPLKTAKPPVMSYRPNYQGGQRRGGGGPSTSGRGGRRGGRGGGGGRGGGGGGRGEQRWWDPVWRAERLRQQAAEMEVFDQNEWWGKLEQMKRGEEQEMIIKRKFSRADQQTLADMAHQLGLHFHAYNKGKALAVSKVPLPMYRPDLDERHGSTEKELQMSIETERRVGNLLNSSQGNVPVNDSGIESSEVARRPKLSVKVANTISPPQSDSAKERLNVILKERQEKLKSSDSGKAMLSFREKLPAFKMKAEFLKAVAENQVLVVSGETGCGKTTQLPQFILEEELSSLRGADCNIICTQPRRISAISVAARVSSERGENLGETVGYQIRLESKRSAQTRLLFCTTGVLLRQLVEDPDLSCVSHLLVDEIHERGMNEDFLLIILRDLLPRRPDLRLILMSATINADLFSKYFGNAPTVHIPGLTFPVTDLFLEDVLEKTRYKMNSKLDSFQGNSRRSRRQDSKKDHLTALFEDVDIDSNYKNYRASTRASLEAWSAEQIDLGLVESTIEYICRHEGDGAILVFLTGWNDISKLLDQIKVNKFLGDPNKFLVLPLHGSMPTINQREIFDRPPPNKRKIVLATNIAESSITIDDVVYVVDCGKAKETSYDALNKLACLLPSWISKASAHQRRGRAGRVQPGVCYKLYPRIIHDAMLPYQLPEILRTPLQELCLHIKSLQLGTVGSFLSKALQPPDPLAVQNAIELLKTIGALDDMENLTPLGRHLCTLPVDPNIGKMLLMGAIFQCLNPALTIAAALAHRNPFVLPVNMQKEVDEAKRSFAGDSCSDHIALLKAFDGYKDAKRNRRERDFCWENFLSPITLQMMEDMRSQFLDLLSDIGFVDKSKGPSAYNRYSHDLEMVCAILCAGLYPNVVQCKRKGKRAVFYTKEVGQVALHPSSVNANQNNFPLPYMVYSEMVKTNNINVYDSTNISEYALLLFGGNLIPSKTGEGIEMLGGYLHFSASKTVLELIRKLRGELDKLLNRKIEDPRVDLSVEGKAVVSAVVELLHG
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query1044 2.2.26 [Sep-21-2011]
Q9H2U11008 Probable ATP-dependent RN yes no 0.729 0.755 0.462 0.0
Q8VHK91001 Probable ATP-dependent RN yes no 0.801 0.836 0.431 0.0
Q6P1581386 Putative ATP-dependent RN no no 0.741 0.558 0.410 1e-174
Q6P5D31388 Putative ATP-dependent RN no no 0.747 0.561 0.409 1e-171
Q6PGC11365 ATP-dependent RNA helicas no no 0.736 0.563 0.386 1e-154
Q7Z4781369 ATP-dependent RNA helicas no no 0.730 0.557 0.380 1e-152
A3KMI01362 ATP-dependent RNA helicas N/A no 0.727 0.557 0.386 1e-151
Q68FK8 1262 ATP-dependent RNA helicas N/A no 0.733 0.606 0.378 1e-144
Q08211 1270 ATP-dependent RNA helicas no no 0.727 0.598 0.374 1e-143
Q5R874 1269 ATP-dependent RNA helicas no no 0.727 0.598 0.374 1e-142
>sp|Q9H2U1|DHX36_HUMAN Probable ATP-dependent RNA helicase DHX36 OS=Homo sapiens GN=DHX36 PE=1 SV=2 Back     alignment and function desciption
 Score =  706 bits (1823), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 368/795 (46%), Positives = 523/795 (65%), Gaps = 33/795 (4%)

Query: 274  MLSFREKLPAFKMKAEFLKAVAENQVLVVSGETGCGKTTQLPQFILEEELSSLRGADCNI 333
            M  FREKLP++ M+ E +  +  +QV V+SGETGCGKTTQ+ QFIL+  +   +G+ C I
Sbjct: 200  MQHFREKLPSYGMQKELVNLIDNHQVTVISGETGCGKTTQVTQFILDNYIERGKGSACRI 259

Query: 334  ICTQPRRISAISVAARVSSERGENLG--ETVGYQIRLESKR-SAQTRLLFCTTGVLLRQL 390
            +CTQPRRISAISVA RV++ER E+ G   + GYQIRL+S+    Q  +L+CTTG++L+ L
Sbjct: 260  VCTQPRRISAISVAERVAAERAESCGSGNSTGYQIRLQSRLPRKQGSILYCTTGIILQWL 319

Query: 391  VEDPDLSCVSHLLVDEIHERGMNEDFLLIILRDLLPRRPDLRLILMSATINADLFSKYFG 450
              DP LS VSH+++DEIHER +  D L+ +++DLL  R DL++ILMSAT+NA+ FS+YFG
Sbjct: 320  QSDPYLSSVSHIVLDEIHERNLQSDVLMTVVKDLLNFRSDLKVILMSATLNAEKFSEYFG 379

Query: 451  NAPTVHIPGLTFPVTDLFLEDVLEKTRY-------KMNSKLDSFQGNSRRSRRQDSKKDH 503
            N P +HIPG TFPV +  LEDV+EK RY       +   K    QG+  R  +++ +   
Sbjct: 380  NCPMIHIPGFTFPVVEYLLEDVIEKIRYVPEQKEHRSQFKRGFMQGHVNRQEKEEKE--- 436

Query: 504  LTALFEDVDID---SNYKNYRASTRASLEAWSAEQIDLGLVESTIEYICRHEGDGAILVF 560
              A++++   D      + Y AST   +E    +++DL L+ + I YI   E DGAILVF
Sbjct: 437  --AIYKERWPDYVRELRRRYSASTVDVIEMMEDDKVDLNLIVALIRYIVLEEEDGAILVF 494

Query: 561  LTGWNDISKLLDQIKVNKFLGDPNKFLVLPLHGSMPTINQREIFDRPPPNKRKIVLATNI 620
            L GW++IS L D + +++ +   +KFL++PLH  MPT+NQ ++F R PP  RKIV+ATNI
Sbjct: 495  LPGWDNISTLHDLL-MSQVMFKSDKFLIIPLHSLMPTVNQTQVFKRTPPGVRKIVIATNI 553

Query: 621  AESSITIDDVVYVVDCGKAKETSYDALNKLACLLPSWISKASAHQRRGRAGRVQPGVCYK 680
            AE+SITIDDVVYV+D GK KET +D  N ++ +   W+SKA+A QR+GRAGRVQPG CY 
Sbjct: 554  AETSITIDDVVYVIDGGKIKETHFDTQNNISTMSAEWVSKANAKQRKGRAGRVQPGHCYH 613

Query: 681  LYPRIIHDAMLPYQLPEILRTPLQELCLHIKSLQLGTVGSFLSKALQPPDPLAVQNAIEL 740
            LY  +    +  YQLPEILRTPL+ELCL IK L+LG +  FLS+ + PP   AV  +I  
Sbjct: 614  LYNGLRASLLDDYQLPEILRTPLEELCLQIKILRLGGIAYFLSRLMDPPSNEAVLLSIRH 673

Query: 741  LKTIGALDDMENLTPLGRHLCTLPVDPNIGKMLLMGAIFQCLNPALTIAAALAHRNPFVL 800
            L  + ALD  E LTPLG HL  LPV+P+IGKM+L GA+F CL+P LTIAA+L+ ++PFV+
Sbjct: 674  LMELNALDKQEELTPLGVHLARLPVEPHIGKMILFGALFCCLDPVLTIAASLSFKDPFVI 733

Query: 801  PVNMQKEVDEAKRSFAGDSCSDHIALLKAFDGYKDAKRN--RRERDFCWENFLSPITLQM 858
            P+  +K  D  ++  A D+ SDH+ ++ AF+G+++A+R   R E+D+CWE FLS  TLQM
Sbjct: 734  PLGKEKIADARRKELAKDTRSDHLTVVNAFEGWEEARRRGFRYEKDYCWEYFLSSNTLQM 793

Query: 859  MEDMRSQFLDLLSDIGFVDKS--KGPSAYNRYSHDLEMVCAILCAGLYPNVVQCK----R 912
            + +M+ QF + L   GFV     K P + N  S + +++ A++CAGLYP V + +    +
Sbjct: 794  LHNMKGQFAEHLLGAGFVSSRNPKDPES-NINSDNEKIIKAVICAGLYPKVAKIRLNLGK 852

Query: 913  KGKRAVFYTKEVGQVALHPSSVNANQNNFPLPYMVYSEMVKTNNINVYDSTNISEYALLL 972
            K K    YTK  G VA+HP SVN  Q +F   +++Y   ++T++I +YD T +S Y LL 
Sbjct: 853  KRKMVKVYTKTDGLVAVHPKSVNVEQTDFHYNWLIYHLKMRTSSIYLYDCTEVSPYCLLF 912

Query: 973  FGGNL-IPSKTGEGIEMLGGYLHFSASKTVLELIRKLRGELDKLLNRKIEDPRV----DL 1027
            FGG++ I     +    +  ++ F +   +  L+++LR ELD LL  KIE P      D 
Sbjct: 913  FGGDISIQKDNDQETIAVDEWIVFQSPARIAHLVKELRKELDILLQEKIESPHPVDWNDT 972

Query: 1028 SVEGKAVVSAVVELL 1042
                 AV+SA+++L+
Sbjct: 973  KSRDCAVLSAIIDLI 987
Plays a role in degradation and deadenylation of mRNAs containing in their 3'-UTR the consensus ARE sequence element. May function in sex development and spermatogenesis.
Homo sapiens (taxid: 9606)
EC: 3EC: .EC: 6EC: .EC: 4EC: .EC: 1EC: 3
>sp|Q8VHK9|DHX36_MOUSE Probable ATP-dependent RNA helicase DHX36 OS=Mus musculus GN=Dhx36 PE=2 SV=2 Back     alignment and function description
>sp|Q6P158|DHX57_HUMAN Putative ATP-dependent RNA helicase DHX57 OS=Homo sapiens GN=DHX57 PE=1 SV=2 Back     alignment and function description
>sp|Q6P5D3|DHX57_MOUSE Putative ATP-dependent RNA helicase DHX57 OS=Mus musculus GN=Dhx57 PE=2 SV=2 Back     alignment and function description
>sp|Q6PGC1|DHX29_MOUSE ATP-dependent RNA helicase Dhx29 OS=Mus musculus GN=Dhx29 PE=2 SV=1 Back     alignment and function description
>sp|Q7Z478|DHX29_HUMAN ATP-dependent RNA helicase DHX29 OS=Homo sapiens GN=DHX29 PE=1 SV=2 Back     alignment and function description
>sp|A3KMI0|DHX29_XENLA ATP-dependent RNA helicase DHX29 OS=Xenopus laevis GN=dhx29 PE=2 SV=1 Back     alignment and function description
>sp|Q68FK8|DHX9_XENLA ATP-dependent RNA helicase A-like protein OS=Xenopus laevis GN=dhx9 PE=2 SV=1 Back     alignment and function description
>sp|Q08211|DHX9_HUMAN ATP-dependent RNA helicase A OS=Homo sapiens GN=DHX9 PE=1 SV=4 Back     alignment and function description
>sp|Q5R874|DHX9_PONAB ATP-dependent RNA helicase A OS=Pongo abelii GN=DHX9 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query1044
255566157994 ATP-dependent RNA helicase, putative [Ri 0.910 0.956 0.818 0.0
359481069991 PREDICTED: probable ATP-dependent RNA he 0.910 0.959 0.798 0.0
449501156999 PREDICTED: probable ATP-dependent RNA he 0.910 0.951 0.786 0.0
4494374761000 PREDICTED: probable ATP-dependent RNA he 0.910 0.951 0.785 0.0
356534552990 PREDICTED: probable ATP-dependent RNA he 0.908 0.957 0.781 0.0
2241382901022 predicted protein [Populus trichocarpa] 0.909 0.929 0.767 0.0
30686606995 helicase associated domain-containing pr 0.901 0.945 0.762 0.0
4510377993 putative ATP-dependent RNA helicase A [A 0.899 0.945 0.761 0.0
297823399996 helicase domain-containing protein [Arab 0.894 0.937 0.754 0.0
356498671989 PREDICTED: probable ATP-dependent RNA he 0.900 0.950 0.760 0.0
>gi|255566157|ref|XP_002524066.1| ATP-dependent RNA helicase, putative [Ricinus communis] gi|223536634|gb|EEF38276.1| ATP-dependent RNA helicase, putative [Ricinus communis] Back     alignment and taxonomy information
 Score = 1622 bits (4201), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 780/953 (81%), Positives = 859/953 (90%), Gaps = 2/953 (0%)

Query: 93   EQRWWDPVWRAERLRQQAAEMEVFDQNEWWGKLEQMKRGEEQEMIIKRKFSRADQQTLAD 152
            EQRWWDPVWRAERLRQQAAEMEV ++NEWW K+E+MK   +QEMI+KR +SR DQQTL+D
Sbjct: 36   EQRWWDPVWRAERLRQQAAEMEVLNENEWWDKMEKMKNSGDQEMIVKRNYSRTDQQTLSD 95

Query: 153  MAHQLGLHFHAYNKGKALAVSKVPLPMYRPDLDERHGSTEKELQMSIETERRVGNLLNSS 212
            MA+QLGL+FHAYNKGKAL VSKVPLP YR DLDERHGS +KE+QMS ETE+RV NLLN +
Sbjct: 96   MAYQLGLYFHAYNKGKALVVSKVPLPNYRADLDERHGSAQKEIQMSTETEKRVKNLLNCT 155

Query: 213  QGNVPVNDSGIESSEVARRPKLSVKVANTISPPQSDSAKERLNVILKERQEKLKSSDSGK 272
            Q   PVNDSG  S +   R     K+   +S  ++DSAKE+L++ LK+R++K  +SDS K
Sbjct: 156  QREAPVNDSGASSGQGDNRSSTGPKITKPVSTIETDSAKEKLSLELKQRRDKTMASDSLK 215

Query: 273  AMLSFREKLPAFKMKAEFLKAVAENQVLVVSGETGCGKTTQLPQFILEEELSSLRGADCN 332
             M SFREKLPAFKMK EFLKAVAENQVLV+SGETGCGKTTQLPQ+ILEEE++ LRGADCN
Sbjct: 216  EMQSFREKLPAFKMKGEFLKAVAENQVLVISGETGCGKTTQLPQYILEEEITRLRGADCN 275

Query: 333  IICTQPRRISAISVAARVSSERGENLGETVGYQIRLESKRSAQTRLLFCTTGVLLRQLVE 392
            IICTQPRRISAISVAAR+SSERGENLGETVGYQIRLE+KRSAQT LLFCTTGVLLRQLV+
Sbjct: 276  IICTQPRRISAISVAARISSERGENLGETVGYQIRLEAKRSAQTHLLFCTTGVLLRQLVQ 335

Query: 393  DPDLSCVSHLLVDEIHERGMNEDFLLIILRDLLPRRPDLRLILMSATINADLFSKYFGNA 452
            DPDL+ VSHLLVDEIHERGMNEDFLLIILRDLLPRRPDLRLILMSATINADLFSKYFGNA
Sbjct: 336  DPDLTGVSHLLVDEIHERGMNEDFLLIILRDLLPRRPDLRLILMSATINADLFSKYFGNA 395

Query: 453  PTVHIPGLTFPVTDLFLEDVLEKTRYKMNSKLDSFQGNSRRSR--RQDSKKDHLTALFED 510
            PT+HIPGLTFPVT+ FLED+LEK+ YK+ S+ D+F+G SRR R   QDSKKD LT L+ED
Sbjct: 396  PTMHIPGLTFPVTEFFLEDILEKSLYKIQSEPDNFRGTSRRRRRREQDSKKDPLTELYED 455

Query: 511  VDIDSNYKNYRASTRASLEAWSAEQIDLGLVESTIEYICRHEGDGAILVFLTGWNDISKL 570
            VDIDS YKNY +STR SLEAWS  Q+DLGLVE+TIEYICRHEG GAILVFLTGW++ISKL
Sbjct: 456  VDIDSEYKNYSSSTRVSLEAWSGSQLDLGLVEATIEYICRHEGGGAILVFLTGWDEISKL 515

Query: 571  LDQIKVNKFLGDPNKFLVLPLHGSMPTINQREIFDRPPPNKRKIVLATNIAESSITIDDV 630
            LD++K NK LGD +KFLVLPLHGSMPTINQREIFDRPPPNKRKIVLATNIAESSITIDDV
Sbjct: 516  LDRVKGNKLLGDQSKFLVLPLHGSMPTINQREIFDRPPPNKRKIVLATNIAESSITIDDV 575

Query: 631  VYVVDCGKAKETSYDALNKLACLLPSWISKASAHQRRGRAGRVQPGVCYKLYPRIIHDAM 690
            VYVVDCGKAKETSYDALNKLACLLPSWISKASAHQRRGRAGRVQPGVCY+LYP+IIHDAM
Sbjct: 576  VYVVDCGKAKETSYDALNKLACLLPSWISKASAHQRRGRAGRVQPGVCYRLYPKIIHDAM 635

Query: 691  LPYQLPEILRTPLQELCLHIKSLQLGTVGSFLSKALQPPDPLAVQNAIELLKTIGALDDM 750
            L YQLPEILRTPLQELCLHIKSLQLG VGSFL+KALQPPDPL+VQNAIELLKTIGALDD 
Sbjct: 636  LQYQLPEILRTPLQELCLHIKSLQLGAVGSFLAKALQPPDPLSVQNAIELLKTIGALDDN 695

Query: 751  ENLTPLGRHLCTLPVDPNIGKMLLMGAIFQCLNPALTIAAALAHRNPFVLPVNMQKEVDE 810
            E LTPLGRHLCTLP+DPNIGKMLLMG +FQCLNPALTIA+ALAHR+PFVLP+ M+ E D 
Sbjct: 696  EELTPLGRHLCTLPLDPNIGKMLLMGCVFQCLNPALTIASALAHRDPFVLPIEMKNEADA 755

Query: 811  AKRSFAGDSCSDHIALLKAFDGYKDAKRNRRERDFCWENFLSPITLQMMEDMRSQFLDLL 870
            AK+SFAGDSCSDHIAL+KAF+GY +AK NR ER FCWENFLSPITL+MMEDMR QFL+LL
Sbjct: 756  AKQSFAGDSCSDHIALVKAFEGYMEAKCNRNERAFCWENFLSPITLRMMEDMREQFLNLL 815

Query: 871  SDIGFVDKSKGPSAYNRYSHDLEMVCAILCAGLYPNVVQCKRKGKRAVFYTKEVGQVALH 930
            SDIGFVDKSKG SAYN+YSHDLEMV AILCAGLYPNVVQCKR+GKR  FYTKEVG+V LH
Sbjct: 816  SDIGFVDKSKGASAYNQYSHDLEMVSAILCAGLYPNVVQCKRRGKRTAFYTKEVGKVDLH 875

Query: 931  PSSVNANQNNFPLPYMVYSEMVKTNNINVYDSTNISEYALLLFGGNLIPSKTGEGIEMLG 990
            P+SVNA  + FPLPYMVYSE VKT  I V DSTNIS+YALLLFGGNLIPSK G+GIEMLG
Sbjct: 876  PASVNAGIHLFPLPYMVYSEKVKTTGIFVRDSTNISDYALLLFGGNLIPSKNGQGIEMLG 935

Query: 991  GYLHFSASKTVLELIRKLRGELDKLLNRKIEDPRVDLSVEGKAVVSAVVELLH 1043
            GYLHFSASK+VLELIRKLR ELDKLL+RKIE+P +D+S EGKAVVSAVVELLH
Sbjct: 936  GYLHFSASKSVLELIRKLRAELDKLLSRKIEEPSLDISFEGKAVVSAVVELLH 988

Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|359481069|ref|XP_002264021.2| PREDICTED: probable ATP-dependent RNA helicase DHX36-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|449501156|ref|XP_004161293.1| PREDICTED: probable ATP-dependent RNA helicase DHX36-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|449437476|ref|XP_004136518.1| PREDICTED: probable ATP-dependent RNA helicase DHX36-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|356534552|ref|XP_003535817.1| PREDICTED: probable ATP-dependent RNA helicase DHX36-like [Glycine max] Back     alignment and taxonomy information
>gi|224138290|ref|XP_002322777.1| predicted protein [Populus trichocarpa] gi|222867407|gb|EEF04538.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|30686606|ref|NP_850255.1| helicase associated domain-containing protein [Arabidopsis thaliana] gi|330254083|gb|AEC09177.1| helicase associated domain-containing protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|4510377|gb|AAD21465.1| putative ATP-dependent RNA helicase A [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|297823399|ref|XP_002879582.1| helicase domain-containing protein [Arabidopsis lyrata subsp. lyrata] gi|297325421|gb|EFH55841.1| helicase domain-containing protein [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|356498671|ref|XP_003518173.1| PREDICTED: probable ATP-dependent RNA helicase DHX36-like [Glycine max] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query1044
TAIR|locus:2039280995 AT2G35920 [Arabidopsis thalian 0.907 0.951 0.731 0.0
TAIR|locus:504954904 1161 ABO6 "ABA overly sensitive 6" 0.902 0.811 0.469 1.5e-223
TAIR|locus:2008144 1206 AT1G48650 [Arabidopsis thalian 0.881 0.762 0.462 2e-221
TAIR|locus:2038796 1113 AT2G01130 [Arabidopsis thalian 0.888 0.833 0.440 2.8e-208
UNIPROTKB|Q9H2U11008 DHX36 "Probable ATP-dependent 0.75 0.776 0.436 8e-172
MGI|MGI:19194121001 Dhx36 "DEAH (Asp-Glu-Ala-His) 0.858 0.895 0.394 2.7e-171
UNIPROTKB|Q05B791010 DHX36 "Uncharacterized protein 0.761 0.787 0.429 5.6e-171
UNIPROTKB|F6V8H11122 DHX36 "Uncharacterized protein 0.761 0.708 0.426 7.2e-171
RGD|13087671000 Dhx36 "DEAH (Asp-Glu-Ala-His) 0.858 0.896 0.397 1.5e-170
UNIPROTKB|E1C550985 DHX36 "Uncharacterized protein 0.748 0.792 0.423 1.1e-165
TAIR|locus:2039280 AT2G35920 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 3650 (1289.9 bits), Expect = 0., P = 0.
 Identities = 699/955 (73%), Positives = 815/955 (85%)

Query:    93 EQRWWDPVWRAERLRQQAAEMEVFDQNEWWGKLEQMKRGEEQEMIIKRKFSRADQQTLAD 152
             EQRWWDPVWRAERLRQQ AEMEV D+NEWW K+EQ K G EQEM+IKR FSR DQQTL+D
Sbjct:    39 EQRWWDPVWRAERLRQQQAEMEVLDENEWWNKIEQWKTGGEQEMLIKRNFSRGDQQTLSD 98

Query:   153 MAHQLGLHFHAYNKGKALAVSKVPLPMYRPDLDERHGSTEKELQMSIETERRVGNLLNSS 212
             MA Q+GL+FHAYNKGKAL VSKVPLP YR DLDERHGST+KE++MS ETER++G+LL ++
Sbjct:    99 MALQMGLYFHAYNKGKALVVSKVPLPDYRADLDERHGSTQKEIKMSTETERKLGSLLKTT 158

Query:   213 Q--GNVPVNDSGIESSEVARRPKLSVKVANTISPPQSDSAKERLNVILKERQEKLKSSDS 270
             Q  G+   + S     +  R   L +K  ++ S       KE+ +  LKERQEKLK+++S
Sbjct:   159 QESGSSGASASAFNDQQ-DRTSTLGLKRPDSASKLPDSLEKEKFSFALKERQEKLKATES 217

Query:   271 GKAMLSFREKLPAFKMKAEFLKAVAENQVLVVSGETGCGKTTQLPQFILEEELSSLRGAD 330
              KA+ +FREKLPAFKMK EFL +V++NQVLVVSGETGCGKTTQLPQFILEEE+SSLRGAD
Sbjct:   218 VKALKAFREKLPAFKMKEEFLNSVSQNQVLVVSGETGCGKTTQLPQFILEEEISSLRGAD 277

Query:   331 CNIICTQPXXXXXXXXXXXXXXERGENLGETVGYQIRLESKRSAQTRLLFCTTGVLLRQL 390
             CNIICTQP              ERGE++GE+VGYQIRLESKRS QTRLLFCTTGVLLR+L
Sbjct:   278 CNIICTQPRRISAISVASRISAERGESIGESVGYQIRLESKRSDQTRLLFCTTGVLLRRL 337

Query:   391 VEDPDLSCVSHLLVDEIHERGMNEDFXXXXXXXXXXXXXXXXXXXMSATINADLFSKYFG 450
             +EDP+L+ VSHLLVDEIHERGMNEDF                   MSATINAD+FS YFG
Sbjct:   338 IEDPNLTNVSHLLVDEIHERGMNEDFLLIILRDLLPRRPDLRLILMSATINADMFSTYFG 397

Query:   451 NAPTVHIPGLTFPVTDLFLEDVLEKTRYKMNSKLDS--FQGNXXXXXXQ-DSKKDHLTAL 507
             N+PT+HIPG TFPV +LFLEDVLEK+RY + S  DS  +QG+      + +SKKD LT L
Sbjct:   398 NSPTMHIPGFTFPVAELFLEDVLEKSRYNIKSS-DSGNYQGSSRGRRRESESKKDDLTTL 456

Query:   508 FEDVDIDSNYKNYRASTRASLEAWSAEQIDLGLVESTIEYICRHEGDGAILVFLTGWNDI 567
             FED+DI+S+YK+Y ++TR SLEAWS  QID+ LVE+TIE+ICR EG GAILVFLTGW++I
Sbjct:   457 FEDIDINSHYKSYSSATRNSLEAWSGAQIDVDLVEATIEHICRLEGGGAILVFLTGWDEI 516

Query:   568 SKLLDQIKVNKFLGDPNKFLVLPLHGSMPTINQREIFDRPPPNKRKIVLATNIAESSITI 627
             SKLL++I +N FLGD +KFLVLPLHGSMPT+NQREIFDRPPPNKRKIVLATNIAESSITI
Sbjct:   517 SKLLEKINMNNFLGDSSKFLVLPLHGSMPTVNQREIFDRPPPNKRKIVLATNIAESSITI 576

Query:   628 DDVVYVVDCGKAKETSYDALNKLACLLPSWISKASAHQRRGRAGRVQPGVCYKLYPRIIH 687
             DDVVYVVDCGKAKETSYDALNK+ACLLPSWISKASAHQRRGRAGRVQ GVCY+LYP++I+
Sbjct:   577 DDVVYVVDCGKAKETSYDALNKVACLLPSWISKASAHQRRGRAGRVQAGVCYRLYPKVIY 636

Query:   688 DAMLPYQLPEILRTPLQELCLHIKSLQLGTVGSFLSKALQPPDPLAVQNAIELLKTIGAL 747
             DA   YQLPEI+RTPLQELCLHIKSLQ+G++GSFL+KALQPPD LAV+NAIELLKTIGAL
Sbjct:   637 DAFPQYQLPEIIRTPLQELCLHIKSLQVGSIGSFLAKALQPPDALAVENAIELLKTIGAL 696

Query:   748 DDMENLTPLGRHLCTLPVDPNIGKMLLMGAIFQCLNPALTIAAALAHRNPFVLPVNMQKE 807
             +D+E LTPLGRHLCTLPVDPNIGKMLL+GAIFQC+NPALTIAAALA+R+PFVLP+N ++E
Sbjct:   697 NDVEELTPLGRHLCTLPVDPNIGKMLLIGAIFQCVNPALTIAAALAYRSPFVLPLNRKEE 756

Query:   808 VDEAKRSFAGDSCSDHIALLKAFDGYKDAKRNRRERDFCWENFLSPITLQMMEDMRSQFL 867
              DEAKR FAGDSCSDHIALLKA++GY+DAKR   E+DFCW+NFLSP+TL+MMEDMR+QFL
Sbjct:   757 ADEAKRYFAGDSCSDHIALLKAYEGYRDAKRGGNEKDFCWQNFLSPVTLRMMEDMRNQFL 816

Query:   868 DLLSDIGFVDKSKGPSAYNRYSHDLEMVCAILCAGLYPNVVQCKRKGKRAVFYTKEVGQV 927
             DLLSDIGFVDKSK P+AYN+YS+D+EM+ A+LCAGLYPNVVQCKR+GKR  FYTKE+G+V
Sbjct:   817 DLLSDIGFVDKSK-PNAYNQYSYDMEMISAVLCAGLYPNVVQCKRRGKRTAFYTKELGKV 875

Query:   928 ALHPSSVNANQNNFPLPYMVYSEMVKTNNINVYDSTNISEYALLLFGGNLIPSKTGEGIE 987
              +HP SVNA  N F LPY+VYSE VKT ++ + DSTNIS+YALL+FGGNLIPSKTGEGIE
Sbjct:   876 DIHPGSVNARVNLFSLPYLVYSEKVKTTSVYIRDSTNISDYALLMFGGNLIPSKTGEGIE 935

Query:   988 MLGGYLHFSASKTVLELIRKLRGELDKLLNRKIEDPRVDLSVEGKAVVSAVVELL 1042
             MLGGYLHFSASK +LELI++LRGE+DKLLN+KIEDP +D++VEGK VVSAVVELL
Sbjct:   936 MLGGYLHFSASKNILELIQRLRGEVDKLLNKKIEDPSLDITVEGKGVVSAVVELL 990
GO:0003676 "nucleic acid binding" evidence=IEA;ISS
GO:0004386 "helicase activity" evidence=IEA;ISS
GO:0005524 "ATP binding" evidence=IEA;ISS
GO:0005737 "cytoplasm" evidence=ISM
GO:0008026 "ATP-dependent helicase activity" evidence=IEA
GO:0006499 "N-terminal protein myristoylation" evidence=RCA
TAIR|locus:504954904 ABO6 "ABA overly sensitive 6" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2008144 AT1G48650 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2038796 AT2G01130 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|Q9H2U1 DHX36 "Probable ATP-dependent RNA helicase DHX36" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
MGI|MGI:1919412 Dhx36 "DEAH (Asp-Glu-Ala-His) box polypeptide 36" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|Q05B79 DHX36 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|F6V8H1 DHX36 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
RGD|1308767 Dhx36 "DEAH (Asp-Glu-Ala-His) box polypeptide 36" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|E1C550 DHX36 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q8VHK9DHX36_MOUSE3, ., 6, ., 4, ., 1, 30.43130.80170.8361yesno

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer3.6.4.13LOW CONFIDENCE prediction!
3rd Layer3.6.4LOW CONFIDENCE prediction!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query1044
COG1643845 COG1643, HrpA, HrpA-like helicases [DNA replicatio 1e-151
TIGR01967 1283 TIGR01967, DEAH_box_HrpA, ATP-dependent helicase H 1e-110
PRK11131 1294 PRK11131, PRK11131, ATP-dependent RNA helicase Hrp 7e-99
TIGR01970 819 TIGR01970, DEAH_box_HrpB, ATP-dependent helicase H 2e-40
PRK11664 812 PRK11664, PRK11664, ATP-dependent RNA helicase Hrp 3e-35
pfam0440891 pfam04408, HA2, Helicase associated domain (HA2) 3e-34
TIGR01970819 TIGR01970, DEAH_box_HrpB, ATP-dependent helicase H 2e-33
PRK11664812 PRK11664, PRK11664, ATP-dependent RNA helicase Hrp 1e-29
smart0084782 smart00847, HA2, Helicase associated domain (HA2) 2e-23
smart00487201 smart00487, DEXDc, DEAD-like helicases superfamily 4e-23
cd00046144 cd00046, DEXDc, DEAD-like helicases superfamily 9e-23
pfam07717109 pfam07717, OB_NTP_bind, Oligonucleotide/oligosacch 1e-21
PHA02653675 PHA02653, PHA02653, RNA helicase NPH-II; Provision 3e-16
smart0049082 smart00490, HELICc, helicase superfamily c-termina 1e-15
pfam0027178 pfam00271, Helicase_C, Helicase conserved C-termin 2e-14
cd00079131 cd00079, HELICc, Helicase superfamily c-terminal d 2e-11
PTZ00146293 PTZ00146, PTZ00146, fibrillarin; Provisional 8e-09
PTZ00146293 PTZ00146, PTZ00146, fibrillarin; Provisional 2e-07
pfam1096191 pfam10961, DUF2763, Protein of unknown function (D 4e-07
PTZ00146293 PTZ00146, PTZ00146, fibrillarin; Provisional 9e-07
pfam00270169 pfam00270, DEAD, DEAD/DEAH box helicase 1e-06
PTZ00146293 PTZ00146, PTZ00146, fibrillarin; Provisional 3e-06
PTZ00146293 PTZ00146, PTZ00146, fibrillarin; Provisional 3e-06
PTZ00146293 PTZ00146, PTZ00146, fibrillarin; Provisional 8e-06
PTZ00146293 PTZ00146, PTZ00146, fibrillarin; Provisional 2e-05
PTZ00146293 PTZ00146, PTZ00146, fibrillarin; Provisional 2e-05
PRK06958182 PRK06958, PRK06958, single-stranded DNA-binding pr 3e-05
pfam0717291 pfam07172, GRP, Glycine rich protein family 7e-05
PRK06958182 PRK06958, PRK06958, single-stranded DNA-binding pr 2e-04
pfam1386576 pfam13865, FoP_duplication, C-terminal duplication 2e-04
pfam12810248 pfam12810, Gly_rich, Glycine rich protein 2e-04
COG1512271 COG1512, COG1512, Beta-propeller domains of methan 2e-04
PTZ00070257 PTZ00070, PTZ00070, 40S ribosomal protein S2; Prov 3e-04
PRK06958182 PRK06958, PRK06958, single-stranded DNA-binding pr 4e-04
pfam0717291 pfam07172, GRP, Glycine rich protein family 5e-04
pfam0717291 pfam07172, GRP, Glycine rich protein family 5e-04
PRK06958182 PRK06958, PRK06958, single-stranded DNA-binding pr 6e-04
pfam0717291 pfam07172, GRP, Glycine rich protein family 6e-04
PRK06958182 PRK06958, PRK06958, single-stranded DNA-binding pr 8e-04
pfam0717291 pfam07172, GRP, Glycine rich protein family 0.001
pfam0717291 pfam07172, GRP, Glycine rich protein family 0.001
PLN03138796 PLN03138, PLN03138, Protein TOC75; Provisional 0.001
pfam0717291 pfam07172, GRP, Glycine rich protein family 0.002
pfam1175961 pfam11759, KRTAP, Keratin-associated matrix 0.002
PRK11634629 PRK11634, PRK11634, ATP-dependent RNA helicase Dea 0.002
PRK10590456 PRK10590, PRK10590, ATP-dependent RNA helicase Rhl 0.002
pfam0717291 pfam07172, GRP, Glycine rich protein family 0.003
PTZ00146293 PTZ00146, PTZ00146, fibrillarin; Provisional 0.004
pfam12764102 pfam12764, Gly-rich_Ago1, Glycine-rich region of a 0.004
>gnl|CDD|224557 COG1643, HrpA, HrpA-like helicases [DNA replication, recombination, and repair] Back     alignment and domain information 
 Score =  471 bits (1214), Expect = e-151
 Identities = 240/734 (32%), Positives = 344/734 (46%), Gaps = 105/734 (14%)

Query: 251 KERLNVILKERQEKLKSSDSGKAMLSFREKLPAFKMKAEFLKAVAENQVLVVSGETGCGK 310
           +E  N +     +    S +   +L +R  LP   ++ E LKA+ +NQV+++ GETG GK
Sbjct: 19  QEMKNQVRGSGMDARSRSANVPDILEYRSGLPVTAVRDEILKAIEQNQVVIIVGETGSGK 78

Query: 311 TTQLPQFILEEELSSLRGADCNIICTQPRRISAISVAARVSSERGENLGETVGYQIRLES 370
           TTQLPQF+LEE      G    I CTQPRR++A SVA RV+ E GE LGETVGY IR ES
Sbjct: 79  TTQLPQFLLEEG----LGIAGKIGCTQPRRLAARSVAERVAEELGEKLGETVGYSIRFES 134

Query: 371 KRSAQTRLLFCTTGVLLRQLVEDPDLSCVSHLLVDEIHERGMNEDFLLIILRDLLPRRPD 430
           K S +TR+   T G+LLR++  DP LS  S                  +I+ +   R   
Sbjct: 135 KVSPRTRIKVMTDGILLREIQNDPLLSGYSV-----------------VIIDEAHER--- 174

Query: 431 LRLILMSATINADLFSKYFGNAPTVHIPGLTFPVTDLFLEDVLEKTRYK-----MNSKLD 485
                   ++N D+            + GL        L+D+L + R       M++ LD
Sbjct: 175 --------SLNTDI------------LLGL--------LKDLLARRRDDLKLIIMSATLD 206

Query: 486 SFQGNSRRSRRQDSKKDHLTALFEDVD-IDSNYKNYRASTRASLEAWSAEQIDLGLVEST 544
           +               +  +A F +   I+   + Y    R   EA +   +   +V + 
Sbjct: 207 A---------------ERFSAYFGNAPVIEIEGRTYPVEIRYLPEAEADYILLDAIVAAV 251

Query: 545 IEYICRHEGDGAILVFLTGWNDISKLLDQIKVNKFLGDPNKFLVLPLHGSMPTINQREIF 604
             ++   EG G+ILVFL G  +I +  + ++    LGD     +LPL+G++    Q  +F
Sbjct: 252 DIHL--REGSGSILVFLPGQREIERTAEWLE-KAELGDD--LEILPLYGALSAEEQVRVF 306

Query: 605 DRPPPNKRKIVLATNIAESSITIDDVVYVVDCGKAKETSYDALNKLACLLPSWISKASAH 664
           +  P  KRK+VLATNIAE+S+TI  + YV+D G AKE  YD    L  L    ISKASA 
Sbjct: 307 EPAPGGKRKVVLATNIAETSLTIPGIRYVIDSGLAKEKRYDPRTGLTRLETEPISKASAD 366

Query: 665 QRRGRAGRVQPGVCYKLYPRIIHDAMLPYQLPEILRTPLQELCLHIKSLQLGTVGSFLSK 724
           QR GRAGR  PG+CY+LY      A   + LPEILRT L  L L +KSL +         
Sbjct: 367 QRAGRAGRTGPGICYRLYSEEDFLAFPEFTLPEILRTDLSGLVLQLKSLGI-GQDIAPFP 425

Query: 725 ALQPPDPLAVQNAIELLKTIGALDDMENLTPLGRHLCTLPVDPNIGKMLLMGAIFQCLNP 784
            L PP   A+Q A+ LL+ +GALDD   LTPLG+ +  LP+DP + +MLL      CL  
Sbjct: 426 FLDPPPEAAIQAALTLLQELGALDDSGKLTPLGKQMSLLPLDPRLARMLLTAPEGGCLGE 485

Query: 785 ALTIAAAL---AHRNPFVLPVNMQKEVDEA------KRSFAGDSCSDHIALLKAFDGYKD 835
           A TIA+ L      + F   V ++K+          KR  A D   DH+ LL+AF     
Sbjct: 486 AATIASMLSEQDRESDFSRDVKLRKQRTAQDLLKRLKRRNAADPRGDHLLLLEAFPDRIA 545

Query: 836 AKRNRRE---RDFCWENFLSPITLQMMEDMRSQFL--------DLLSDIGFVDKSKGPSA 884
            KR + E    + C         L     + +  L         +L+     +       
Sbjct: 546 RKRAKGEYLRANGCRAMLFPTKALSRAPWIIAALLVQTSALAGRILAAAEIDEDEWAAQH 605

Query: 885 YNRYSH---DLEMVCAILCAGLYPNVVQCKRKGKRAVFYTKEVGQVALHPSSVNANQNNF 941
              + +     + +   L AG   N+ Q +  G+  V    +   V  HPSSV       
Sbjct: 606 LPEHCYSEPIWDDIRGALAAGRKLNIAQLQLDGRPYVTL-SDNTPVFAHPSSV--RLGLV 662

Query: 942 PLPYMVYSEMVKTN 955
            L ++ Y+E ++T 
Sbjct: 663 LLEWIKYAEFLRTR 676

Length = 845
>gnl|CDD|233659 TIGR01967, DEAH_box_HrpA, ATP-dependent helicase HrpA Back     alignment and domain information
>gnl|CDD|182986 PRK11131, PRK11131, ATP-dependent RNA helicase HrpA; Provisional Back     alignment and domain information
>gnl|CDD|233660 TIGR01970, DEAH_box_HrpB, ATP-dependent helicase HrpB Back     alignment and domain information
>gnl|CDD|236950 PRK11664, PRK11664, ATP-dependent RNA helicase HrpB; Provisional Back     alignment and domain information
>gnl|CDD|218070 pfam04408, HA2, Helicase associated domain (HA2) Back     alignment and domain information
>gnl|CDD|233660 TIGR01970, DEAH_box_HrpB, ATP-dependent helicase HrpB Back     alignment and domain information
>gnl|CDD|236950 PRK11664, PRK11664, ATP-dependent RNA helicase HrpB; Provisional Back     alignment and domain information
>gnl|CDD|214852 smart00847, HA2, Helicase associated domain (HA2) Add an annotation Back     alignment and domain information
>gnl|CDD|214692 smart00487, DEXDc, DEAD-like helicases superfamily Back     alignment and domain information
>gnl|CDD|238005 cd00046, DEXDc, DEAD-like helicases superfamily Back     alignment and domain information
>gnl|CDD|219532 pfam07717, OB_NTP_bind, Oligonucleotide/oligosaccharide-binding (OB)-fold Back     alignment and domain information
>gnl|CDD|177443 PHA02653, PHA02653, RNA helicase NPH-II; Provisional Back     alignment and domain information
>gnl|CDD|197757 smart00490, HELICc, helicase superfamily c-terminal domain Back     alignment and domain information
>gnl|CDD|201125 pfam00271, Helicase_C, Helicase conserved C-terminal domain Back     alignment and domain information
>gnl|CDD|238034 cd00079, HELICc, Helicase superfamily c-terminal domain; associated with DEXDc-, DEAD-, and DEAH-box proteins, yeast initiation factor 4A, Ski2p, and Hepatitis C virus NS3 helicases; this domain is found in a wide variety of helicases and helicase related proteins; may not be an autonomously folding unit, but an integral part of the helicase; 4 helicase superfamilies at present according to the organization of their signature motifs; all helicases share the ability to unwind nucleic acid duplexes with a distinct directional polarity; they utilize the free energy from nucleoside triphosphate hydrolysis to fuel their translocation along DNA, unwinding the duplex in the process Back     alignment and domain information
>gnl|CDD|240291 PTZ00146, PTZ00146, fibrillarin; Provisional Back     alignment and domain information
>gnl|CDD|240291 PTZ00146, PTZ00146, fibrillarin; Provisional Back     alignment and domain information
>gnl|CDD|220915 pfam10961, DUF2763, Protein of unknown function (DUF2763) Back     alignment and domain information
>gnl|CDD|240291 PTZ00146, PTZ00146, fibrillarin; Provisional Back     alignment and domain information
>gnl|CDD|215832 pfam00270, DEAD, DEAD/DEAH box helicase Back     alignment and domain information
>gnl|CDD|240291 PTZ00146, PTZ00146, fibrillarin; Provisional Back     alignment and domain information
>gnl|CDD|240291 PTZ00146, PTZ00146, fibrillarin; Provisional Back     alignment and domain information
>gnl|CDD|240291 PTZ00146, PTZ00146, fibrillarin; Provisional Back     alignment and domain information
>gnl|CDD|240291 PTZ00146, PTZ00146, fibrillarin; Provisional Back     alignment and domain information
>gnl|CDD|240291 PTZ00146, PTZ00146, fibrillarin; Provisional Back     alignment and domain information
>gnl|CDD|180777 PRK06958, PRK06958, single-stranded DNA-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|219320 pfam07172, GRP, Glycine rich protein family Back     alignment and domain information
>gnl|CDD|180777 PRK06958, PRK06958, single-stranded DNA-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|222425 pfam13865, FoP_duplication, C-terminal duplication domain of Friend of PRMT1 Back     alignment and domain information
>gnl|CDD|221784 pfam12810, Gly_rich, Glycine rich protein Back     alignment and domain information
>gnl|CDD|224429 COG1512, COG1512, Beta-propeller domains of methanol dehydrogenase type [General function prediction only] Back     alignment and domain information
>gnl|CDD|240255 PTZ00070, PTZ00070, 40S ribosomal protein S2; Provisional Back     alignment and domain information
>gnl|CDD|180777 PRK06958, PRK06958, single-stranded DNA-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|219320 pfam07172, GRP, Glycine rich protein family Back     alignment and domain information
>gnl|CDD|219320 pfam07172, GRP, Glycine rich protein family Back     alignment and domain information
>gnl|CDD|180777 PRK06958, PRK06958, single-stranded DNA-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|219320 pfam07172, GRP, Glycine rich protein family Back     alignment and domain information
>gnl|CDD|180777 PRK06958, PRK06958, single-stranded DNA-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|219320 pfam07172, GRP, Glycine rich protein family Back     alignment and domain information
>gnl|CDD|219320 pfam07172, GRP, Glycine rich protein family Back     alignment and domain information
>gnl|CDD|215598 PLN03138, PLN03138, Protein TOC75; Provisional Back     alignment and domain information
>gnl|CDD|219320 pfam07172, GRP, Glycine rich protein family Back     alignment and domain information
>gnl|CDD|221210 pfam11759, KRTAP, Keratin-associated matrix Back     alignment and domain information
>gnl|CDD|236941 PRK11634, PRK11634, ATP-dependent RNA helicase DeaD; Provisional Back     alignment and domain information
>gnl|CDD|236722 PRK10590, PRK10590, ATP-dependent RNA helicase RhlE; Provisional Back     alignment and domain information
>gnl|CDD|219320 pfam07172, GRP, Glycine rich protein family Back     alignment and domain information
>gnl|CDD|240291 PTZ00146, PTZ00146, fibrillarin; Provisional Back     alignment and domain information
>gnl|CDD|221759 pfam12764, Gly-rich_Ago1, Glycine-rich region of argonaut Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 1044
KOG0920924 consensus ATP-dependent RNA helicase A [RNA proces 100.0
KOG0922674 consensus DEAH-box RNA helicase [RNA processing an 100.0
KOG09241042 consensus mRNA splicing factor ATP-dependent RNA h 100.0
KOG0923902 consensus mRNA splicing factor ATP-dependent RNA h 100.0
KOG0925699 consensus mRNA splicing factor ATP-dependent RNA h 100.0
PRK11131 1294 ATP-dependent RNA helicase HrpA; Provisional 100.0
TIGR01967 1283 DEAH_box_HrpA ATP-dependent helicase HrpA. This mo 100.0
COG1643845 HrpA HrpA-like helicases [DNA replication, recombi 100.0
KOG09261172 consensus DEAH-box RNA helicase [RNA processing an 100.0
KOG0921 1282 consensus Dosage compensation complex, subunit MLE 100.0
TIGR01970 819 DEAH_box_HrpB ATP-dependent helicase HrpB. This mo 100.0
PRK11664 812 ATP-dependent RNA helicase HrpB; Provisional 100.0
PHA02653675 RNA helicase NPH-II; Provisional 100.0
KOG0331519 consensus ATP-dependent RNA helicase [RNA processi 100.0
PTZ00110545 helicase; Provisional 100.0
KOG0330476 consensus ATP-dependent RNA helicase [RNA processi 100.0
KOG0335482 consensus ATP-dependent RNA helicase [RNA processi 100.0
KOG0333673 consensus U5 snRNP-like RNA helicase subunit [RNA 100.0
KOG0336629 consensus ATP-dependent RNA helicase [RNA processi 100.0
COG0513513 SrmB Superfamily II DNA and RNA helicases [DNA rep 100.0
KOG0338691 consensus ATP-dependent RNA helicase [RNA processi 100.0
PRK01172674 ski2-like helicase; Provisional 100.0
PRK11776460 ATP-dependent RNA helicase DbpA; Provisional 100.0
PRK04837423 ATP-dependent RNA helicase RhlB; Provisional 100.0
PRK10590456 ATP-dependent RNA helicase RhlE; Provisional 100.0
PRK11634629 ATP-dependent RNA helicase DeaD; Provisional 100.0
PRK02362737 ski2-like helicase; Provisional 100.0
PLN00206518 DEAD-box ATP-dependent RNA helicase; Provisional 100.0
KOG0343758 consensus RNA Helicase [RNA processing and modific 100.0
PRK04537572 ATP-dependent RNA helicase RhlB; Provisional 100.0
PRK11192434 ATP-dependent RNA helicase SrmB; Provisional 100.0
KOG0345567 consensus ATP-dependent RNA helicase [RNA processi 100.0
KOG0342543 consensus ATP-dependent RNA helicase pitchoune [RN 100.0
KOG0339731 consensus ATP-dependent RNA helicase [RNA processi 100.0
KOG0340442 consensus ATP-dependent RNA helicase [RNA processi 100.0
PRK01297475 ATP-dependent RNA helicase RhlB; Provisional 100.0
KOG0328400 consensus Predicted ATP-dependent RNA helicase FAL 100.0
PRK00254720 ski2-like helicase; Provisional 100.0
PTZ00424401 helicase 45; Provisional 100.0
KOG0348708 consensus ATP-dependent RNA helicase [RNA processi 100.0
KOG0341610 consensus DEAD-box protein abstrakt [RNA processin 100.0
TIGR03817742 DECH_helic helicase/secretion neighborhood putativ 100.0
KOG0326459 consensus ATP-dependent RNA helicase [RNA processi 100.0
KOG0347731 consensus RNA helicase [RNA processing and modific 100.0
TIGR00614470 recQ_fam ATP-dependent DNA helicase, RecQ family. 100.0
COG1202830 Superfamily II helicase, archaea-specific [General 100.0
PRK13767 876 ATP-dependent helicase; Provisional 100.0
PLN031371195 ATP-dependent DNA helicase; Q4-like; Provisional 100.0
KOG0332477 consensus ATP-dependent RNA helicase [RNA processi 100.0
KOG0334997 consensus RNA helicase [RNA processing and modific 100.0
PRK11057607 ATP-dependent DNA helicase RecQ; Provisional 100.0
KOG0350620 consensus DEAD-box ATP-dependent RNA helicase [RNA 100.0
KOG0346569 consensus RNA helicase [RNA processing and modific 100.0
COG1204766 Superfamily II helicase [General function predicti 100.0
KOG0344593 consensus ATP-dependent RNA helicase [RNA processi 100.0
TIGR01389591 recQ ATP-dependent DNA helicase RecQ. The ATP-depe 100.0
COG1201814 Lhr Lhr-like helicases [General function predictio 100.0
TIGR00580926 mfd transcription-repair coupling factor (mfd). Al 100.0
PRK09751 1490 putative ATP-dependent helicase Lhr; Provisional 100.0
TIGR02621844 cas3_GSU0051 CRISPR-associated helicase Cas3, Anae 100.0
COG1111542 MPH1 ERCC4-like helicases [DNA replication, recomb 100.0
KOG0327397 consensus Translation initiation factor 4F, helica 100.0
PRK10917681 ATP-dependent DNA helicase RecG; Provisional 99.98
PRK106891147 transcription-repair coupling factor; Provisional 99.98
KOG4284 980 consensus DEAD box protein [Transcription] 99.98
TIGR00643630 recG ATP-dependent DNA helicase RecG. 99.97
KOG0354746 consensus DEAD-box like helicase [General function 99.97
KOG0337529 consensus ATP-dependent RNA helicase [RNA processi 99.97
TIGR01587358 cas3_core CRISPR-associated helicase Cas3. This mo 99.97
KOG0921 1282 consensus Dosage compensation complex, subunit MLE 99.96
PHA02558501 uvsW UvsW helicase; Provisional 99.96
TIGR03158357 cas3_cyano CRISPR-associated helicase, Cyano-type. 99.96
PRK09401 1176 reverse gyrase; Reviewed 99.96
PRK13766773 Hef nuclease; Provisional 99.96
KOG0952 1230 consensus DNA/RNA helicase MER3/SLH1, DEAD-box sup 99.95
COG0514590 RecQ Superfamily II DNA helicase [DNA replication, 99.95
COG1205851 Distinct helicase family with a unique C-terminal 99.95
PRK14701 1638 reverse gyrase; Provisional 99.95
TIGR01054 1171 rgy reverse gyrase. Generally, these gyrases are e 99.94
TIGR03714762 secA2 accessory Sec system translocase SecA2. Memb 99.94
PRK12898656 secA preprotein translocase subunit SecA; Reviewed 99.93
KOG0947 1248 consensus Cytoplasmic exosomal RNA helicase SKI2, 99.93
PRK09200790 preprotein translocase subunit SecA; Reviewed 99.93
KOG0948 1041 consensus Nuclear exosomal RNA helicase MTR4, DEAD 99.93
KOG0951 1674 consensus RNA helicase BRR2, DEAD-box superfamily 99.93
TIGR00603732 rad25 DNA repair helicase rad25. All proteins in t 99.93
COG4581 1041 Superfamily II RNA helicase [DNA replication, reco 99.92
KOG0349725 consensus Putative DEAD-box RNA helicase DDX1 [RNA 99.92
KOG0352641 consensus ATP-dependent DNA helicase [Replication, 99.92
TIGR00963745 secA preprotein translocase, SecA subunit. The pro 99.91
PRK09694878 helicase Cas3; Provisional 99.91
PRK05580679 primosome assembly protein PriA; Validated 99.9
PRK114481123 hsdR type I restriction enzyme EcoKI subunit R; Pr 99.9
COG1061442 SSL2 DNA or RNA helicases of superfamily II [Trans 99.89
KOG0351941 consensus ATP-dependent DNA helicase [Replication, 99.89
KOG0329387 consensus ATP-dependent RNA helicase [RNA processi 99.89
COG1200677 RecG RecG-like helicase [DNA replication, recombin 99.88
KOG09501008 consensus DNA polymerase theta/eta, DEAD-box super 99.88
TIGR00595505 priA primosomal protein N'. All proteins in this f 99.87
COG4098441 comFA Superfamily II DNA/RNA helicase required for 99.87
PRK04914956 ATP-dependent helicase HepA; Validated 99.85
COG11971139 Mfd Transcription-repair coupling factor (superfam 99.85
KOG0353695 consensus ATP-dependent DNA helicase [General func 99.83
PRK13104896 secA preprotein translocase subunit SecA; Reviewed 99.82
cd00268203 DEADc DEAD-box helicases. A diverse family of prot 99.79
PRK12906796 secA preprotein translocase subunit SecA; Reviewed 99.77
PF00270169 DEAD: DEAD/DEAH box helicase; InterPro: IPR011545 99.77
PRK12904830 preprotein translocase subunit SecA; Reviewed 99.75
COG1203733 CRISPR-associated helicase Cas3 [Defense mechanism 99.73
PRK13107908 preprotein translocase subunit SecA; Reviewed 99.72
COG4096875 HsdR Type I site-specific restriction-modification 99.72
KOG09491330 consensus Predicted helicase, DEAD-box superfamily 99.72
PF07717114 OB_NTP_bind: Oligonucleotide/oligosaccharide-bindi 99.72
PRK12899 970 secA preprotein translocase subunit SecA; Reviewed 99.71
PF04408102 HA2: Helicase associated domain (HA2); InterPro: I 99.71
TIGR00348667 hsdR type I site-specific deoxyribonuclease, HsdR 99.62
PLN031421033 Probable chromatin-remodeling complex ATPase chain 99.6
smart0084792 HA2 Helicase associated domain (HA2) Add an annota 99.59
TIGR01407850 dinG_rel DnaQ family exonuclease/DinG family helic 99.56
COG1110 1187 Reverse gyrase [DNA replication, recombination, an 99.54
smart00487201 DEXDc DEAD-like helicases superfamily. 99.52
KOG0953700 consensus Mitochondrial RNA helicase SUV3, DEAD-bo 99.51
PRK129001025 secA preprotein translocase subunit SecA; Reviewed 99.47
cd00046144 DEXDc DEAD-like helicases superfamily. A diverse f 99.46
TIGR00631655 uvrb excinuclease ABC, B subunit. This family is b 99.42
cd00079131 HELICc Helicase superfamily c-terminal domain; ass 99.41
PF07652148 Flavi_DEAD: Flavivirus DEAD domain ; InterPro: IPR 99.38
KOG41501034 consensus Predicted ATP-dependent RNA helicase [RN 99.37
TIGR025621110 cas3_yersinia CRISPR-associated helicase Cas3. The 99.36
PRK05298652 excinuclease ABC subunit B; Provisional 99.36
PF0027178 Helicase_C: Helicase conserved C-terminal domain; 99.35
PRK12326764 preprotein translocase subunit SecA; Reviewed 99.34
COG1198730 PriA Primosomal protein N' (replication factor Y) 99.32
PF04851184 ResIII: Type III restriction enzyme, res subunit; 99.32
PRK07246820 bifunctional ATP-dependent DNA helicase/DNA polyme 99.3
PRK13103913 secA preprotein translocase subunit SecA; Reviewed 99.22
KOG1123776 consensus RNA polymerase II transcription initiati 99.2
COG0556663 UvrB Helicase subunit of the DNA excision repair c 99.17
smart0049082 HELICc helicase superfamily c-terminal domain. 99.16
KOG09511674 consensus RNA helicase BRR2, DEAD-box superfamily 99.15
KOG0385971 consensus Chromatin remodeling complex WSTF-ISWI, 99.07
PRK08074928 bifunctional ATP-dependent DNA helicase/DNA polyme 99.07
PRK12903925 secA preprotein translocase subunit SecA; Reviewed 99.03
CHL00122870 secA preprotein translocase subunit SecA; Validate 98.97
PF02399824 Herpes_ori_bp: Origin of replication binding prote 98.93
KOG0384 1373 consensus Chromodomain-helicase DNA-binding protei 98.79
PRK12902939 secA preprotein translocase subunit SecA; Reviewed 98.74
KOG0390776 consensus DNA repair protein, SNF2 family [Replica 98.74
COG4889 1518 Predicted helicase [General function prediction on 98.71
PRK11747697 dinG ATP-dependent DNA helicase DinG; Provisional 98.69
TIGR00604705 rad3 DNA repair helicase (rad3). All proteins in t 98.67
KOG0387923 consensus Transcription-coupled repair protein CSB 98.6
TIGR03117636 cas_csf4 CRISPR-associated DEAD/DEAH-box helicase 98.58
COG1199654 DinG Rad3-related DNA helicases [Transcription / D 98.54
PRK14873665 primosome assembly protein PriA; Provisional 98.48
PF06862442 DUF1253: Protein of unknown function (DUF1253); In 98.45
PRK129011112 secA preprotein translocase subunit SecA; Reviewed 98.41
PF00176299 SNF2_N: SNF2 family N-terminal domain; InterPro: I 98.29
KOG03921549 consensus SNF2 family DNA-dependent ATPase domain- 98.23
KOG1000689 consensus Chromatin remodeling protein HARP/SMARCA 98.22
KOG2340698 consensus Uncharacterized conserved protein [Funct 98.01
PF1324576 AAA_19: Part of AAA domain 97.96
PF13604196 AAA_30: AAA domain; PDB: 1W36_G 3K70_G 3UPU_B 3GPL 97.92
COG0610962 Type I site-specific restriction-modification syst 97.87
PF13401131 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S 97.85
TIGR00596 814 rad1 DNA repair protein (rad1). This family is bas 97.84
KOG0389941 consensus SNF2 family DNA-dependent ATPase [Chroma 97.81
TIGR01447586 recD exodeoxyribonuclease V, alpha subunit. This f 97.76
PF00448196 SRP54: SRP54-type protein, GTPase domain; InterPro 97.74
PRK12723388 flagellar biosynthesis regulator FlhF; Provisional 97.73
COG0653822 SecA Preprotein translocase subunit SecA (ATPase, 97.71
KOG09521230 consensus DNA/RNA helicase MER3/SLH1, DEAD-box sup 97.67
PRK10875615 recD exonuclease V subunit alpha; Provisional 97.65
PF02562205 PhoH: PhoH-like protein; InterPro: IPR003714 PhoH 97.62
KOG1803649 consensus DNA helicase [Replication, recombination 97.53
PF07517266 SecA_DEAD: SecA DEAD-like domain; InterPro: IPR011 97.53
PRK13889988 conjugal transfer relaxase TraA; Provisional 97.45
PRK14722374 flhF flagellar biosynthesis regulator FlhF; Provis 97.43
smart00488289 DEXDc2 DEAD-like helicases superfamily. 97.42
smart00489289 DEXDc3 DEAD-like helicases superfamily. 97.42
PF09848352 DUF2075: Uncharacterized conserved protein (DUF207 97.37
PRK10536262 hypothetical protein; Provisional 97.36
COG1419407 FlhF Flagellar GTP-binding protein [Cell motility 97.36
PRK11889436 flhF flagellar biosynthesis regulator FlhF; Provis 97.35
KOG03861157 consensus Chromatin remodeling complex SWI/SNF, co 97.35
PRK05703424 flhF flagellar biosynthesis regulator FlhF; Valida 97.35
PRK15483 986 type III restriction-modification system StyLTI en 97.34
TIGR01448720 recD_rel helicase, putative, RecD/TraA family. Thi 97.31
COG0553866 HepA Superfamily II DNA/RNA helicases, SNF2 family 97.22
PF12340229 DUF3638: Protein of unknown function (DUF3638); In 97.19
PF05729166 NACHT: NACHT domain 97.11
PRK12726407 flagellar biosynthesis regulator FlhF; Provisional 97.09
cd00009151 AAA The AAA+ (ATPases Associated with a wide varie 97.02
PF13086236 AAA_11: AAA domain; PDB: 2XZL_A 2XZO_A 2WJY_A 2WJV 97.02
PRK06526254 transposase; Provisional 96.94
TIGR02768744 TraA_Ti Ti-type conjugative transfer relaxase TraA 96.91
PF00580315 UvrD-helicase: UvrD/REP helicase N-terminal domain 96.9
cd0600759 R3H_DEXH_helicase R3H domain of a group of protein 96.89
PF05970364 PIF1: PIF1-like helicase; InterPro: IPR010285 This 96.88
PF13872303 AAA_34: P-loop containing NTP hydrolase pore-1 96.83
PRK12724432 flagellar biosynthesis regulator FlhF; Provisional 96.82
PRK12727559 flagellar biosynthesis regulator FlhF; Provisional 96.81
PF13307167 Helicase_C_2: Helicase C-terminal domain; PDB: 4A1 96.8
PRK138261102 Dtr system oriT relaxase; Provisional 96.77
PRK14723767 flhF flagellar biosynthesis regulator FlhF; Provis 96.77
cd0264060 R3H_NRF R3H domain of the NF-kappaB-repression fac 96.73
PRK08181269 transposase; Validated 96.67
PRK14974336 cell division protein FtsY; Provisional 96.62
PRK04296190 thymidine kinase; Provisional 96.6
PHA03333752 putative ATPase subunit of terminase; Provisional 96.57
TIGR00376637 DNA helicase, putative. The gene product may repre 96.52
PRK14721420 flhF flagellar biosynthesis regulator FlhF; Provis 96.48
KOG1802935 consensus RNA helicase nonsense mRNA reducing fact 96.37
PRK06731270 flhF flagellar biosynthesis regulator FlhF; Valida 96.3
KOG4439901 consensus RNA polymerase II transcription terminat 96.28
PRK06835329 DNA replication protein DnaC; Validated 96.12
PRK07952244 DNA replication protein DnaC; Validated 96.06
PRK07003830 DNA polymerase III subunits gamma and tau; Validat 96.01
TIGR03499282 FlhF flagellar biosynthetic protein FlhF. 95.96
PF01695178 IstB_IS21: IstB-like ATP binding protein; InterPro 95.96
PRK14949 944 DNA polymerase III subunits gamma and tau; Provisi 95.94
KOG1002791 consensus Nucleotide excision repair protein RAD16 95.93
PF05127177 Helicase_RecD: Helicase; InterPro: IPR007807 This 95.93
PF13173128 AAA_14: AAA domain 95.92
PRK06995484 flhF flagellar biosynthesis regulator FlhF; Valida 95.85
PRK09112351 DNA polymerase III subunit delta'; Validated 95.82
KOG0391 1958 consensus SNF2 family DNA-dependent ATPase [Genera 95.82
smart00382148 AAA ATPases associated with a variety of cellular 95.79
PRK07764824 DNA polymerase III subunits gamma and tau; Validat 95.71
cd0264160 R3H_Smubp-2_like R3H domain of Smubp-2_like protei 95.71
COG3587985 Restriction endonuclease [Defense mechanisms] 95.7
PRK07994647 DNA polymerase III subunits gamma and tau; Validat 95.68
PRK06893229 DNA replication initiation factor; Validated 95.65
PRK05642234 DNA replication initiation factor; Validated 95.59
PRK12323700 DNA polymerase III subunits gamma and tau; Provisi 95.53
PRK08727233 hypothetical protein; Validated 95.53
PF03354477 Terminase_1: Phage Terminase ; InterPro: IPR005021 95.52
PHA02533534 17 large terminase protein; Provisional 95.52
PRK14961363 DNA polymerase III subunits gamma and tau; Provisi 95.51
PRK10416318 signal recognition particle-docking protein FtsY; 95.51
PF05621302 TniB: Bacterial TniB protein; InterPro: IPR008868 95.43
TIGR03015269 pepcterm_ATPase putative secretion ATPase, PEP-CTE 95.41
PRK14956484 DNA polymerase III subunits gamma and tau; Provisi 95.39
PRK08903227 DnaA regulatory inactivator Hda; Validated 95.35
PTZ001121164 origin recognition complex 1 protein; Provisional 95.35
PRK14952584 DNA polymerase III subunits gamma and tau; Provisi 95.32
PRK09183259 transposase/IS protein; Provisional 95.29
PRK08116268 hypothetical protein; Validated 95.29
PRK14958509 DNA polymerase III subunits gamma and tau; Provisi 95.24
TIGR03420226 DnaA_homol_Hda DnaA regulatory inactivator Hda. Me 95.24
PTZ00146293 fibrillarin; Provisional 95.24
PRK14964491 DNA polymerase III subunits gamma and tau; Provisi 95.18
PRK09111598 DNA polymerase III subunits gamma and tau; Validat 95.15
KOG0989346 consensus Replication factor C, subunit RFC4 [Repl 95.15
PRK14951618 DNA polymerase III subunits gamma and tau; Provisi 95.14
PRK08691709 DNA polymerase III subunits gamma and tau; Validat 95.12
PRK08084235 DNA replication initiation factor; Provisional 95.09
PF13177162 DNA_pol3_delta2: DNA polymerase III, delta subunit 95.07
PRK07471365 DNA polymerase III subunit delta'; Validated 95.07
PRK11773721 uvrD DNA-dependent helicase II; Provisional 95.04
TIGR02760 1960 TraI_TIGR conjugative transfer relaxase protein Tr 95.0
PRK14957546 DNA polymerase III subunits gamma and tau; Provisi 95.0
PRK05707328 DNA polymerase III subunit delta'; Validated 94.93
PRK00771437 signal recognition particle protein Srp54; Provisi 94.87
PRK00149450 dnaA chromosomal replication initiation protein; R 94.85
COG3421812 Uncharacterized protein conserved in bacteria [Fun 94.85
TIGR00064272 ftsY signal recognition particle-docking protein F 94.85
PRK12377248 putative replication protein; Provisional 94.84
PRK11331459 5-methylcytosine-specific restriction enzyme subun 94.83
TIGR01425429 SRP54_euk signal recognition particle protein SRP5 94.78
PRK14960702 DNA polymerase III subunits gamma and tau; Provisi 94.72
COG1474366 CDC6 Cdc6-related protein, AAA superfamily ATPase 94.71
PHA03368738 DNA packaging terminase subunit 1; Provisional 94.7
TIGR01075715 uvrD DNA helicase II. Designed to identify uvrD me 94.66
PRK12402337 replication factor C small subunit 2; Reviewed 94.65
PRK06921266 hypothetical protein; Provisional 94.56
PRK10867433 signal recognition particle protein; Provisional 94.52
TIGR02782299 TrbB_P P-type conjugative transfer ATPase TrbB. Th 94.46
PRK14969527 DNA polymerase III subunits gamma and tau; Provisi 94.44
TIGR02785 1232 addA_Gpos recombination helicase AddA, Firmicutes 94.43
PRK11054684 helD DNA helicase IV; Provisional 94.42
TIGR02881261 spore_V_K stage V sporulation protein K. Members o 94.4
TIGR01074664 rep ATP-dependent DNA helicase Rep. Designed to id 94.37
PRK00411394 cdc6 cell division control protein 6; Reviewed 94.32
PRK13833323 conjugal transfer protein TrbB; Provisional 94.3
TIGR00959428 ffh signal recognition particle protein. This mode 94.25
TIGR00362405 DnaA chromosomal replication initiator protein Dna 94.21
PTZ00146293 fibrillarin; Provisional 94.17
PRK14086617 dnaA chromosomal replication initiation protein; P 94.13
PRK14959624 DNA polymerase III subunits gamma and tau; Provisi 94.06
TIGR00678188 holB DNA polymerase III, delta' subunit. At positi 94.06
cd01120165 RecA-like_NTPases RecA-like NTPases. This family i 94.06
PRK14962472 DNA polymerase III subunits gamma and tau; Provisi 94.04
PRK08769319 DNA polymerase III subunit delta'; Validated 93.96
PRK14965576 DNA polymerase III subunits gamma and tau; Provisi 93.92
PRK14087450 dnaA chromosomal replication initiation protein; P 93.92
PRK06645507 DNA polymerase III subunits gamma and tau; Validat 93.87
PRK10919672 ATP-dependent DNA helicase Rep; Provisional 93.83
COG1444758 Predicted P-loop ATPase fused to an acetyltransfer 93.83
PRK147121623 conjugal transfer nickase/helicase TraI; Provision 93.76
TIGR02928365 orc1/cdc6 family replication initiation protein. M 93.74
PRK14963504 DNA polymerase III subunits gamma and tau; Provisi 93.69
PRK08939306 primosomal protein DnaI; Reviewed 93.67
PRK07940394 DNA polymerase III subunit delta'; Validated 93.67
PRK14088440 dnaA chromosomal replication initiation protein; P 93.66
COG2804500 PulE Type II secretory pathway, ATPase PulE/Tfp pi 93.64
PF00004132 AAA: ATPase family associated with various cellula 93.61
PHA02544316 44 clamp loader, small subunit; Provisional 93.6
COG1435201 Tdk Thymidine kinase [Nucleotide transport and met 93.56
PRK12422445 chromosomal replication initiation protein; Provis 93.53
TIGR01547396 phage_term_2 phage terminase, large subunit, PBSX 93.53
PRK13894319 conjugal transfer ATPase TrbB; Provisional 93.49
cd01124187 KaiC KaiC is a circadian clock protein primarily f 93.47
COG3973747 Superfamily I DNA and RNA helicases [General funct 93.41
PF00437270 T2SE: Type II/IV secretion system protein; InterPr 93.3
PRK137091747 conjugal transfer nickase/helicase TraI; Provision 93.3
PRK13851344 type IV secretion system protein VirB11; Provision 93.3
KOG18051100 consensus DNA replication helicase [Replication, r 93.29
TIGR02760 1960 TraI_TIGR conjugative transfer relaxase protein Tr 93.29
PRK14955397 DNA polymerase III subunits gamma and tau; Provisi 93.27
PRK06964342 DNA polymerase III subunit delta'; Validated 93.26
cd03115173 SRP The signal recognition particle (SRP) mediates 93.26
PRK14950585 DNA polymerase III subunits gamma and tau; Provisi 93.2
COG0470325 HolB ATPase involved in DNA replication [DNA repli 93.19
COG1702348 PhoH Phosphate starvation-inducible protein PhoH, 93.19
PRK05563559 DNA polymerase III subunits gamma and tau; Validat 93.16
PF05496233 RuvB_N: Holliday junction DNA helicase ruvB N-term 93.16
PRK13900332 type IV secretion system ATPase VirB11; Provisiona 93.08
TIGR02880284 cbbX_cfxQ probable Rubsico expression protein CbbX 93.07
PRK05896605 DNA polymerase III subunits gamma and tau; Validat 93.02
PF00308219 Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013 92.86
KOG03881185 consensus SNF2 family DNA-dependent ATPase [Replic 92.79
PRK08451535 DNA polymerase III subunits gamma and tau; Validat 92.75
PRK07133725 DNA polymerase III subunits gamma and tau; Validat 92.75
COG4962355 CpaF Flp pilus assembly protein, ATPase CpaF [Intr 92.74
KOG0391 1958 consensus SNF2 family DNA-dependent ATPase [Genera 92.72
cd0263960 R3H_RRM R3H domain of mainly fungal proteins which 92.71
PLN03025319 replication factor C subunit; Provisional 92.6
PRK14948620 DNA polymerase III subunits gamma and tau; Provisi 92.6
PHA00729226 NTP-binding motif containing protein 92.6
KOG1132945 consensus Helicase of the DEAD superfamily [Replic 92.57
TIGR03345852 VI_ClpV1 type VI secretion ATPase, ClpV1 family. M 92.54
PRK06871325 DNA polymerase III subunit delta'; Validated 92.49
PTZ00293211 thymidine kinase; Provisional 92.47
cd0264658 R3H_G-patch R3H domain of a group of fungal and pl 92.47
COG4626546 Phage terminase-like protein, large subunit [Gener 92.46
PRK09087226 hypothetical protein; Validated 92.37
TIGR01073726 pcrA ATP-dependent DNA helicase PcrA. Designed to 92.36
COG2256436 MGS1 ATPase related to the helicase subunit of the 92.32
PRK14970367 DNA polymerase III subunits gamma and tau; Provisi 92.3
TIGR02397355 dnaX_nterm DNA polymerase III, subunit gamma and t 92.26
COG1484254 DnaC DNA replication protein [DNA replication, rec 92.19
PRK06620214 hypothetical protein; Validated 92.18
PRK00440319 rfc replication factor C small subunit; Reviewed 92.12
CHL00181287 cbbX CbbX; Provisional 92.1
PRK14953486 DNA polymerase III subunits gamma and tau; Provisi 92.06
PRK07399314 DNA polymerase III subunit delta'; Validated 91.99
PRK11823446 DNA repair protein RadA; Provisional 91.92
PF01637234 Arch_ATPase: Archaeal ATPase; InterPro: IPR011579 91.89
PRK13342413 recombination factor protein RarA; Reviewed 91.79
KOG2373514 consensus Predicted mitochondrial DNA helicase twi 91.73
PRK06067234 flagellar accessory protein FlaH; Validated 91.57
PRK04195482 replication factor C large subunit; Provisional 91.11
PF14617252 CMS1: U3-containing 90S pre-ribosomal complex subu 91.1
PRK14954620 DNA polymerase III subunits gamma and tau; Provisi 91.01
PF05876557 Terminase_GpA: Phage terminase large subunit (GpA) 91.0
PRK08533230 flagellar accessory protein FlaH; Reviewed 90.87
PRK08058329 DNA polymerase III subunit delta'; Validated 90.86
PRK06090319 DNA polymerase III subunit delta'; Validated 90.64
PF1355562 AAA_29: P-loop containing region of AAA domain 90.59
TIGR00767415 rho transcription termination factor Rho. Members 90.48
PF01443234 Viral_helicase1: Viral (Superfamily 1) RNA helicas 90.47
COG3267269 ExeA Type II secretory pathway, component ExeA (pr 90.45
PRK08699325 DNA polymerase III subunit delta'; Validated 90.44
PRK10865857 protein disaggregation chaperone; Provisional 90.33
PF00931287 NB-ARC: NB-ARC domain; InterPro: IPR002182 This is 90.3
cd01130186 VirB11-like_ATPase Type IV secretory pathway compo 90.26
cd01122271 GP4d_helicase GP4d_helicase is a homohexameric 5'- 90.22
cd01393226 recA_like RecA is a bacterial enzyme which has rol 90.09
PRK06647563 DNA polymerase III subunits gamma and tau; Validat 89.96
TIGR02524358 dot_icm_DotB Dot/Icm secretion system ATPase DotB. 89.86
PRK05564313 DNA polymerase III subunit delta'; Validated 89.86
cd03247178 ABCC_cytochrome_bd The CYD subfamily implicated in 89.76
PRK07993334 DNA polymerase III subunit delta'; Validated 89.65
PRK14971614 DNA polymerase III subunits gamma and tau; Provisi 89.64
TIGR02788308 VirB11 P-type DNA transfer ATPase VirB11. The VirB 89.46
KOG2028554 consensus ATPase related to the helicase subunit o 89.44
cd01121372 Sms Sms (bacterial radA) DNA repair protein. This 89.44
TIGR02688449 conserved hypothetical protein TIGR02688. Members 89.31
PF03237384 Terminase_6: Terminase-like family; InterPro: IPR0 89.28
COG2805353 PilT Tfp pilus assembly protein, pilus retraction 89.1
cd03221144 ABCF_EF-3 ABCF_EF-3 Elongation factor 3 (EF-3) is 88.93
COG0552340 FtsY Signal recognition particle GTPase [Intracell 88.81
TIGR03877237 thermo_KaiC_1 KaiC domain protein, Ph0284 family. 88.72
KOG2004906 consensus Mitochondrial ATP-dependent protease PIM 88.66
cd00544169 CobU Adenosylcobinamide kinase / adenosylcobinamid 88.65
PF12846304 AAA_10: AAA-like domain 88.6
TIGR02655484 circ_KaiC circadian clock protein KaiC. Members of 88.48
cd00267157 ABC_ATPase ABC (ATP-binding cassette) transporter 88.47
TIGR00631655 uvrb excinuclease ABC, B subunit. This family is b 88.39
PRK13341725 recombination factor protein RarA/unknown domain f 88.34
COG1221403 PspF Transcriptional regulators containing an AAA- 88.33
COG1110 1187 Reverse gyrase [DNA replication, recombination, an 88.3
COG1074 1139 RecB ATP-dependent exoDNAse (exonuclease V) beta s 88.19
TIGR00635305 ruvB Holliday junction DNA helicase, RuvB subunit. 87.86
COG0630312 VirB11 Type IV secretory pathway, VirB11 component 87.73
TIGR02525372 plasmid_TraJ plasmid transfer ATPase TraJ. Members 87.69
TIGR02639731 ClpA ATP-dependent Clp protease ATP-binding subuni 87.61
COG0541451 Ffh Signal recognition particle GTPase [Intracellu 87.59
cd01131198 PilT Pilus retraction ATPase PilT. PilT is a nucle 87.54
cd03228171 ABCC_MRP_Like The MRP (Mutidrug Resistance Protein 87.45
cd01128249 rho_factor Transcription termination factor rho is 87.45
COG2255332 RuvB Holliday junction resolvasome, helicase subun 87.24
KOG0741744 consensus AAA+-type ATPase [Posttranslational modi 87.17
cd01129264 PulE-GspE PulE/GspE The type II secretory pathway 87.15
PF05894333 Podovirus_Gp16: Podovirus DNA encapsidation protei 87.06
PHA00149331 DNA encapsidation protein 87.03
TIGR03689512 pup_AAA proteasome ATPase. In the Actinobacteria, 86.94
KOG2543438 consensus Origin recognition complex, subunit 5 [R 86.91
PRK04841 903 transcriptional regulator MalT; Provisional 86.84
PRK05580679 primosome assembly protein PriA; Validated 86.59
PRK05917290 DNA polymerase III subunit delta'; Validated 86.56
TIGR02640262 gas_vesic_GvpN gas vesicle protein GvpN. Members o 86.43
KOG2228408 consensus Origin recognition complex, subunit 4 [R 86.42
cd03222177 ABC_RNaseL_inhibitor The ABC ATPase RNase L inhibi 86.09
PRK06305451 DNA polymerase III subunits gamma and tau; Validat 86.07
PRK10917681 ATP-dependent DNA helicase RecG; Provisional 86.03
TIGR00602637 rad24 checkpoint protein rad24. This family is bas 85.91
PRK13764602 ATPase; Provisional 85.84
cd03246173 ABCC_Protease_Secretion This family represents the 85.7
PLN02165334 adenylate isopentenyltransferase 85.7
PRK05973237 replicative DNA helicase; Provisional 85.67
cd03238176 ABC_UvrA The excision repair protein UvrA; Nucleot 85.66
TIGR00595505 priA primosomal protein N'. All proteins in this f 85.57
COG0542786 clpA ATP-binding subunits of Clp protease and DnaK 85.4
TIGR01420343 pilT_fam pilus retraction protein PilT. This model 85.26
PF13207121 AAA_17: AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6 85.2
PRK00080328 ruvB Holliday junction DNA helicase RuvB; Reviewed 85.12
PRK03992389 proteasome-activating nucleotidase; Provisional 84.94
TIGR03819340 heli_sec_ATPase helicase/secretion neighborhood AT 84.74
TIGR02639731 ClpA ATP-dependent Clp protease ATP-binding subuni 84.67
COG1126240 GlnQ ABC-type polar amino acid transport system, A 84.4
PRK05986191 cob(I)alamin adenolsyltransferase/cobinamide ATP-d 84.33
COG0466782 Lon ATP-dependent Lon protease, bacterial type [Po 84.23
COG2812515 DnaX DNA polymerase III, gamma/tau subunits [DNA r 84.22
PRK10787784 DNA-binding ATP-dependent protease La; Provisional 84.22
TIGR03346852 chaperone_ClpB ATP-dependent chaperone ClpB. Membe 84.18
PRK11034758 clpA ATP-dependent Clp protease ATP-binding subuni 84.08
TIGR03117636 cas_csf4 CRISPR-associated DEAD/DEAH-box helicase 84.05
COG0513513 SrmB Superfamily II DNA and RNA helicases [DNA rep 84.03
TIGR01243733 CDC48 AAA family ATPase, CDC48 subfamily. This sub 83.97
PRK10436462 hypothetical protein; Provisional 83.92
PRK11034758 clpA ATP-dependent Clp protease ATP-binding subuni 83.91
PRK09376416 rho transcription termination factor Rho; Provisio 83.87
TIGR00708173 cobA cob(I)alamin adenosyltransferase. Alternate n 83.69
KOG1596317 consensus Fibrillarin and related nucleolar RNA-bi 83.69
KOG10151567 consensus Transcription regulator XNP/ATRX, DEAD-b 83.66
cd03229178 ABC_Class3 This class is comprised of all BPD (Bin 83.33
PF06745226 KaiC: KaiC; InterPro: IPR014774 This entry represe 83.25
COG0593408 DnaA ATPase involved in DNA replication initiation 83.07
COG2109198 BtuR ATP:corrinoid adenosyltransferase [Coenzyme m 83.06
PF13671143 AAA_33: AAA domain; PDB: 1LTQ_A 2IA5_K 1RC8_A 1LY1 82.93
PRK14873665 primosome assembly protein PriA; Provisional 82.92
TIGR01243733 CDC48 AAA family ATPase, CDC48 subfamily. This sub 82.88
TIGR03878259 thermo_KaiC_2 KaiC domain protein, AF_0795 family. 82.75
cd03216163 ABC_Carb_Monos_I This family represents the domain 82.7
cd03282204 ABC_MSH4_euk MutS4 homolog in eukaryotes. The MutS 82.69
KOG20361011 consensus Predicted P-loop ATPase fused to an acet 82.63
cd00984242 DnaB_C DnaB helicase C terminal domain. The hexame 82.57
COG3598402 RepA RecA-family ATPase [DNA replication, recombin 82.54
CHL00095821 clpC Clp protease ATP binding subunit 82.45
CHL00176638 ftsH cell division protein; Validated 82.45
PF13481193 AAA_25: AAA domain; PDB: 1G8Y_J 1OLO_A 1NLF_C. 82.45
KOG0701 1606 consensus dsRNA-specific nuclease Dicer and relate 82.39
TIGR02533486 type_II_gspE general secretory pathway protein E. 82.38
cd03227162 ABC_Class2 ABC-type Class 2 contains systems invol 82.36
TIGR03263180 guanyl_kin guanylate kinase. Members of this famil 82.22
COG1618179 Predicted nucleotide kinase [Nucleotide transport 82.22
cd01127410 TrwB Bacterial conjugation protein TrwB, ATP bindi 82.12
TIGR02538564 type_IV_pilB type IV-A pilus assembly ATPase PilB. 81.99
PF12775272 AAA_7: P-loop containing dynein motor region D3; P 81.71
COG2909 894 MalT ATP-dependent transcriptional regulator [Tran 81.68
KOG0738491 consensus AAA+-type ATPase [Posttranslational modi 81.47
KOG0347731 consensus RNA helicase [RNA processing and modific 81.44
cd01394218 radB RadB. The archaeal protein radB shares simila 81.34
TIGR00763775 lon ATP-dependent protease La. This protein is ind 81.16
PF13238129 AAA_18: AAA domain; PDB: 3IIK_A 3IIJ_A 3IIL_A 1RKB 81.04
cd03239178 ABC_SMC_head The structural maintenance of chromos 80.96
TIGR02784 1141 addA_alphas double-strand break repair helicase Ad 80.94
cd03276198 ABC_SMC6_euk Eukaryotic SMC6 proteins; SMC protein 80.82
KOG1970634 consensus Checkpoint RAD17-RFC complex, RAD17/RAD2 80.8
cd03281213 ABC_MSH5_euk MutS5 homolog in eukaryotes. The MutS 80.78
cd03213194 ABCG_EPDR ABCG transporters are involved in eye pi 80.63
KOG1969877 consensus DNA replication checkpoint protein CHL12 80.62
cd00561159 CobA_CobO_BtuR ATP:corrinoid adenosyltransferase B 80.41
PF01580205 FtsK_SpoIIIE: FtsK/SpoIIIE family; InterPro: IPR00 80.32
PRK14530215 adenylate kinase; Provisional 80.32
COG1219408 ClpX ATP-dependent protease Clp, ATPase subunit [P 80.2
TIGR02237209 recomb_radB DNA repair and recombination protein R 80.16
TIGR00643630 recG ATP-dependent DNA helicase RecG. 80.07
>KOG0920 consensus ATP-dependent RNA helicase A [RNA processing and modification] Back     alignment and domain information 
Probab=100.00  E-value=1.4e-140  Score=1250.88  Aligned_cols=751  Identities=56%  Similarity=0.920  Sum_probs=684.5

Q ss_pred             HHHHhccChhHHHHHHHhcCCCchHHHHHHHHHHHcCCeEEEEecCCCchhchHHHHHHHHHHhccCCCCcEEEEEcccH
Q 001615          261 RQEKLKSSDSGKAMLSFREKLPAFKMKAEFLKAVAENQVLVVSGETGCGKTTQLPQFILEEELSSLRGADCNIICTQPRR  340 (1044)
Q Consensus       261 ~~~~~~~~~~~~~~~~~r~~lpi~~~Q~~~i~~i~~~~~vii~a~TGSGKTt~~p~~il~~~~~~~~~~~~~ilv~~P~r  340 (1044)
                      .+.....+..+++++..|.+||+|.++++|++++.++++++|+|+||||||||+||+||+..+..+  +.|+|+||||||
T Consensus       152 ~~~~~~~s~~~~~~~~~R~~LPa~~~r~~Il~~i~~~qVvvIsGeTGcGKTTQvpQfiLd~~~~~~--~~~~IicTQPRR  229 (924)
T KOG0920|consen  152 RQSEPKKSESYKEMLRFRESLPAYKMRDTILDAIEENQVVVISGETGCGKTTQVPQFILDEAIESG--AACNIICTQPRR  229 (924)
T ss_pred             hhchhhhhhHHHHHHHHHHhCccHHHHHHHHHHHHhCceEEEeCCCCCCchhhhhHHHHHHHHhcC--CCCeEEecCCch
Confidence            555667789999999999999999999999999999999999999999999999999999998765  789999999999


Q ss_pred             HHHHHHHHHHHHHhCCCCCcEEEEEEeccccCCCCccEEEEchHHHHHHHhcCCCCCccceEEechhhhccchhHHHHHH
Q 001615          341 ISAISVAARVSSERGENLGETVGYQIRLESKRSAQTRLLFCTTGVLLRQLVEDPDLSCVSHLLVDEIHERGMNEDFLLII  420 (1044)
Q Consensus       341 ~la~qva~rv~~~~~~~~g~~vgy~ir~~~~~~~~~~I~v~T~g~Ll~~l~~~~~L~~~~~lIiDEaHeR~~~~d~ll~~  420 (1044)
                      +.|+++|+||++|+++..|..|||++|.+++.+..|.++|||+|+||+.|+.++.+.+++|||+||+|||++++||++.+
T Consensus       230 IsAIsvAeRVa~ER~~~~g~~VGYqvrl~~~~s~~t~L~fcTtGvLLr~L~~~~~l~~vthiivDEVHER~i~~DflLi~  309 (924)
T KOG0920|consen  230 ISAISVAERVAKERGESLGEEVGYQVRLESKRSRETRLLFCTTGVLLRRLQSDPTLSGVTHIIVDEVHERSINTDFLLIL  309 (924)
T ss_pred             HHHHHHHHHHHHHhccccCCeeeEEEeeecccCCceeEEEecHHHHHHHhccCcccccCceeeeeeEEEccCCcccHHHH
Confidence            99999999999999999999999999999999988999999999999999999999999999999999999999999999


Q ss_pred             HHHHcccCCcccEEEcccCCChHHHHhhhCCCCeecCCCCccccceeehHHHHHhhhcccCccccccccccccccccccc
Q 001615          421 LRDLLPRRPDLRLILMSATINADLFSKYFGNAPTVHIPGLTFPVTDLFLEDVLEKTRYKMNSKLDSFQGNSRRSRRQDSK  500 (1044)
Q Consensus       421 lk~~~~~~~~~qiilmSATl~~~~~~~~f~~~~~i~v~g~~~pv~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  500 (1044)
                      +|.++..+|++|+|+||||+|++.|++||+++|+++|+|++|||..+|++|++..+.|........ .. .        .
T Consensus       310 lk~lL~~~p~LkvILMSAT~dae~fs~YF~~~pvi~i~grtfpV~~~fLEDil~~~~~~~~~~~~~-~~-~--------~  379 (924)
T KOG0920|consen  310 LKDLLPRNPDLKVILMSATLDAELFSDYFGGCPVITIPGRTFPVKEYFLEDILSKTGYVSEDDSAR-SG-P--------E  379 (924)
T ss_pred             HHHHhhhCCCceEEEeeeecchHHHHHHhCCCceEeecCCCcchHHHHHHHHHHHhcccccccccc-cc-c--------c
Confidence            999999999999999999999999999999999999999999999999999999987766533222 00 0        0


Q ss_pred             hhhhhhhhhcccccccccchhhhhHHHHHhhhhhhhchHHHHHHHHHHHhccCCCCEEEEeCCHHHHHHHHHHHHccccC
Q 001615          501 KDHLTALFEDVDIDSNYKNYRASTRASLEAWSAEQIDLGLVESTIEYICRHEGDGAILVFLTGWNDISKLLDQIKVNKFL  580 (1044)
Q Consensus       501 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~li~~~l~~i~~~~~~g~iLVFl~~~~~i~~l~~~L~~~~~~  580 (1044)
                      ...+.                   ...+..|.. .+|++++.+++.+|+.....|.||||+||+.+|..+++.|..+..+
T Consensus       380 ~~~~~-------------------~~~~~~~~~-~id~~Li~~li~~I~~~~~~GaILVFLPG~~eI~~~~~~L~~~~~f  439 (924)
T KOG0920|consen  380 RSQLR-------------------LARLKLWEP-EIDYDLIEDLIEYIDEREFEGAILVFLPGWEEILQLKELLEVNLPF  439 (924)
T ss_pred             cCccc-------------------cccchhccc-cccHHHHHHHHHhcccCCCCceEEEEcCCHHHHHHHHHHhhhcccc
Confidence            00000                   000222222 2899999999999999988999999999999999999999877766


Q ss_pred             CCCCCeEEEEecCCCChHHHHhhhCCCCCCCcEEEEeecccccccCCCCeEEEEeCCCCcceeccccccccccccccccH
Q 001615          581 GDPNKFLVLPLHGSMPTINQREIFDRPPPNKRKIVLATNIAESSITIDDVVYVVDCGKAKETSYDALNKLACLLPSWISK  660 (1044)
Q Consensus       581 ~~~~~~~i~~lH~~l~~~er~~v~~~f~~g~~kIlvaTniae~GidIp~V~~VId~g~~k~~~yd~~~~~~~l~~~~iS~  660 (1044)
                      .+..++.++++|+.|+..||+.||...+.|.+|||+||||||+|||||||.||||+|+.|++.||+.++++++...|||+
T Consensus       440 ~~~~~~~ilplHs~~~s~eQ~~VF~~pp~g~RKIIlaTNIAETSITIdDVvyVIDsG~~Ke~~yD~~~~~s~l~~~wvSk  519 (924)
T KOG0920|consen  440 ADSLKFAILPLHSSIPSEEQQAVFKRPPKGTRKIILATNIAETSITIDDVVYVIDSGLVKEKSYDPERKVSCLLLSWVSK  519 (924)
T ss_pred             ccccceEEEeccccCChHHHHHhcCCCCCCcchhhhhhhhHhhcccccCeEEEEecCeeeeeeecccCCcchhheeeccc
Confidence            66678999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             hhHHHhcccCCCCCCcEEEEecChhhHhhcCC-CCCCccccCChHHHHHHHHhccCCchhhhhhcCCCCCCHHHHHHHHH
Q 001615          661 ASAHQRRGRAGRVQPGVCYKLYPRIIHDAMLP-YQLPEILRTPLQELCLHIKSLQLGTVGSFLSKALQPPDPLAVQNAIE  739 (1044)
Q Consensus       661 a~~~QR~GRAGR~~~G~c~~L~t~~~~~~l~~-~~~pei~r~~L~~~~L~~k~l~~~~~~~fl~~~~~pP~~~~i~~al~  739 (1044)
                      |++.||+|||||+++|+||+||++..|+.+.. +++|||+|.+|+++||++|.++.+++..||+.+++||+.+++..|++
T Consensus       520 Ana~QR~GRAGRv~~G~cy~L~~~~~~~~~~~~~q~PEilR~pL~~l~L~iK~l~~~~~~~fLskaldpP~~~~v~~a~~  599 (924)
T KOG0920|consen  520 ANAKQRRGRAGRVRPGICYHLYTRSRYEKLMLAYQLPEILRTPLEELCLHIKVLEQGSIKAFLSKALDPPPADAVDLAIE  599 (924)
T ss_pred             cchHHhcccccCccCCeeEEeechhhhhhcccccCChHHHhChHHHhhheeeeccCCCHHHHHHHhcCCCChHHHHHHHH
Confidence            99999999999999999999999999998877 99999999999999999999999999999999999999999999999


Q ss_pred             HHHHcCCCCCCCCcCccccccccccCChhhHHHHHHhhhccChHHHHHHHhcccCCCccccCcchHHHHHHHHhhcCCCC
Q 001615          740 LLKTIGALDDMENLTPLGRHLCTLPVDPNIGKMLLMGAIFQCLNPALTIAAALAHRNPFVLPVNMQKEVDEAKRSFAGDS  819 (1044)
Q Consensus       740 ~L~~lgal~~~~~lT~lG~~l~~lpl~p~~~k~ll~~~~~~c~~~~l~iaa~l~~~~~f~~p~~~~~~~~~~~~~~~~~~  819 (1044)
                      .|..+|||+.+++||+||++|+.||+||++|||+++|++|+|+||+++|||+|+.++||+.|.+++++++++++.|+.+.
T Consensus       600 ~L~~igaL~~~e~LT~LG~~la~lPvd~~igK~ll~g~if~cLdp~l~iaa~Ls~k~PF~~~~~~~~~~~~~~~~~~~~~  679 (924)
T KOG0920|consen  600 RLKQIGALDESEELTPLGLHLASLPVDVRIGKLLLFGAIFGCLDPALTIAAALSFKSPFVSPLGKREEADKAKKLLALDS  679 (924)
T ss_pred             HHHHhccccCcccchHHHHHHHhCCCccccchhheehhhccccchhhhHHHHhccCCCcccCCCchhHHHHHHHHhccCC
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999998777


Q ss_pred             CCcHHHHHHHHHHHHHHhcC--chhHHHHhhhcCChHHHHHHHHHHHHHHHHHHhcCCccCCC----CCCCCCCCCCCHH
Q 001615          820 CSDHIALLKAFDGYKDAKRN--RRERDFCWENFLSPITLQMMEDMRSQFLDLLSDIGFVDKSK----GPSAYNRYSHDLE  893 (1044)
Q Consensus       820 ~sD~l~~l~~f~~~~~~~~~--~~~~~~c~~~~l~~~~l~~~~~~r~ql~~~l~~~~~~~~~~----~~~~~n~~~~~~~  893 (1044)
                      .||||+++++|+.|+.....  ..+.+||++||||..+|+++.++|.||.+.|.++||+..+.    ....+|.++.+++
T Consensus       680 ~SD~la~~~ay~~w~~~~~~~~~~~~~fc~~~fLs~~~l~~i~~l~~q~~~~l~~~g~~~~~~~~~~~~~~~n~~s~~~~  759 (924)
T KOG0920|consen  680 ISDHLAVVRAYAGWREILRSGPSAEKDFCEENFLSSNTLQEISSLRVQFLELLSDIGLIPISSTAALTDSECNHNSQNPE  759 (924)
T ss_pred             cchHHHHHHHHHHHHHHHhccchHHHHHHHHhhccHHHHHHHHHHHHHHHHHhhhcccccCCcccccCchhhhhcCCCHH
Confidence            89999999999999998766  56789999999999999999999999999999999987642    3456788899999


Q ss_pred             HHHHHHHHhccCccccccc---CCcceeEEeccCceEEeCCCCcCCCCCCCCCCEEEEEEeeeccc-cccccccccChHH
Q 001615          894 MVCAILCAGLYPNVVQCKR---KGKRAVFYTKEVGQVALHPSSVNANQNNFPLPYMVYSEMVKTNN-INVYDSTNISEYA  969 (1044)
Q Consensus       894 ~v~~~L~ag~ypnva~~~~---~g~~~~~~t~~~~~v~iHPsSvl~~~~~~~~~~ivy~e~~~ts~-~~i~~~t~I~~~~  969 (1044)
                      +++++||+|+|||++++..   +.+...++++..+.|.|||+|+|++...+..+|++|+|+++|++ +|+|++|.|++++
T Consensus       760 ~iravl~a~lyP~i~~~~~~~~~~~~~~~~~~~~~~v~i~~~sv~~~~~~~~~p~l~~~~k~~t~~~~~~rd~T~v~~~~  839 (924)
T KOG0920|consen  760 LVRAVLCAGLYPNIAFVRRMEPKSKSVTFVTKADGRVIIHPSSVNEQSTGFQSPFLVFPEKVKSTRLVSLRDTTSVSSSA  839 (924)
T ss_pred             HHHHHHhccCCCceeeeecccCCcCcceeecCCceeEEEecchhhccccccCCcceEEeeecccCCcceeeecCCCCcHH
Confidence            9999999999999998765   44556677888889999999999988878888999999999988 9999999999999


Q ss_pred             HHHhcCCCCC-CCCCCCeE--EeCcEEEeecCHHHHHHHHHHHHHHHHHHHHHHcCCCCCC---CcchhHHHHHHHHHhc
Q 001615          970 LLLFGGNLIP-SKTGEGIE--MLGGYLHFSASKTVLELIRKLRGELDKLLNRKIEDPRVDL---SVEGKAVVSAVVELLH 1043 (1044)
Q Consensus       970 lllfgg~~~~-~~~~~~~~--~~d~~~~~~~~~~~~~l~~~lR~~ld~ll~~k~~~p~~~~---~~~~~~~l~~i~~l~~ 1043 (1044)
                      ++||||.... .....+..  ..|+|+.|.++.+++.+++.||.++|.+|++++++|...+   ...+..+...+..++.
T Consensus       840 ~llfgg~~~~~~~~~~~~~~~~~d~~~~~~~~~~~~~~~~~Lr~~l~~~l~~~~~~p~~~~~~~~~~~~~~~~~~~~~~~  919 (924)
T KOG0920|consen  840 LLLFGGGISTVRMKSGSLALLLPDGWLRFKALPKTARLLKELRRELDSLLSKKIRSPCASLPDSSGKGSESPSLIANLLV  919 (924)
T ss_pred             heeecCCceeecCCCCccceecCCceEEeecchhHHHHHHHHHHHHHHHHHHhccCccccccccccccccchhhhhhhhh
Confidence            9999998763 22333333  3499999999999999999999999999999999999665   2345556666776654

>KOG0922 consensus DEAH-box RNA helicase [RNA processing and modification] Back     alignment and domain information
>KOG0924 consensus mRNA splicing factor ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>KOG0923 consensus mRNA splicing factor ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>KOG0925 consensus mRNA splicing factor ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>PRK11131 ATP-dependent RNA helicase HrpA; Provisional Back     alignment and domain information
>TIGR01967 DEAH_box_HrpA ATP-dependent helicase HrpA Back     alignment and domain information
>COG1643 HrpA HrpA-like helicases [DNA replication, recombination, and repair] Back     alignment and domain information
>KOG0926 consensus DEAH-box RNA helicase [RNA processing and modification; Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG0921 consensus Dosage compensation complex, subunit MLE [Transcription] Back     alignment and domain information
>TIGR01970 DEAH_box_HrpB ATP-dependent helicase HrpB Back     alignment and domain information
>PRK11664 ATP-dependent RNA helicase HrpB; Provisional Back     alignment and domain information
>PHA02653 RNA helicase NPH-II; Provisional Back     alignment and domain information
>KOG0331 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>PTZ00110 helicase; Provisional Back     alignment and domain information
>KOG0330 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>KOG0335 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>KOG0333 consensus U5 snRNP-like RNA helicase subunit [RNA processing and modification] Back     alignment and domain information
>KOG0336 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>COG0513 SrmB Superfamily II DNA and RNA helicases [DNA replication, recombination, and repair / Transcription / Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG0338 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>PRK01172 ski2-like helicase; Provisional Back     alignment and domain information
>PRK11776 ATP-dependent RNA helicase DbpA; Provisional Back     alignment and domain information
>PRK04837 ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>PRK10590 ATP-dependent RNA helicase RhlE; Provisional Back     alignment and domain information
>PRK11634 ATP-dependent RNA helicase DeaD; Provisional Back     alignment and domain information
>PRK02362 ski2-like helicase; Provisional Back     alignment and domain information
>PLN00206 DEAD-box ATP-dependent RNA helicase; Provisional Back     alignment and domain information
>KOG0343 consensus RNA Helicase [RNA processing and modification] Back     alignment and domain information
>PRK04537 ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>PRK11192 ATP-dependent RNA helicase SrmB; Provisional Back     alignment and domain information
>KOG0345 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>KOG0342 consensus ATP-dependent RNA helicase pitchoune [RNA processing and modification] Back     alignment and domain information
>KOG0339 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>KOG0340 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>PRK01297 ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>KOG0328 consensus Predicted ATP-dependent RNA helicase FAL1, involved in rRNA maturation, DEAD-box superfamily [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK00254 ski2-like helicase; Provisional Back     alignment and domain information
>PTZ00424 helicase 45; Provisional Back     alignment and domain information
>KOG0348 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>KOG0341 consensus DEAD-box protein abstrakt [RNA processing and modification] Back     alignment and domain information
>TIGR03817 DECH_helic helicase/secretion neighborhood putative DEAH-box helicase Back     alignment and domain information
>KOG0326 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>KOG0347 consensus RNA helicase [RNA processing and modification] Back     alignment and domain information
>TIGR00614 recQ_fam ATP-dependent DNA helicase, RecQ family Back     alignment and domain information
>COG1202 Superfamily II helicase, archaea-specific [General function prediction only] Back     alignment and domain information
>PRK13767 ATP-dependent helicase; Provisional Back     alignment and domain information
>PLN03137 ATP-dependent DNA helicase; Q4-like; Provisional Back     alignment and domain information
>KOG0332 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>KOG0334 consensus RNA helicase [RNA processing and modification] Back     alignment and domain information
>PRK11057 ATP-dependent DNA helicase RecQ; Provisional Back     alignment and domain information
>KOG0350 consensus DEAD-box ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>KOG0346 consensus RNA helicase [RNA processing and modification] Back     alignment and domain information
>COG1204 Superfamily II helicase [General function prediction only] Back     alignment and domain information
>KOG0344 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>TIGR01389 recQ ATP-dependent DNA helicase RecQ Back     alignment and domain information
>COG1201 Lhr Lhr-like helicases [General function prediction only] Back     alignment and domain information
>TIGR00580 mfd transcription-repair coupling factor (mfd) Back     alignment and domain information
>PRK09751 putative ATP-dependent helicase Lhr; Provisional Back     alignment and domain information
>TIGR02621 cas3_GSU0051 CRISPR-associated helicase Cas3, Anaes-subtype Back     alignment and domain information
>COG1111 MPH1 ERCC4-like helicases [DNA replication, recombination, and repair] Back     alignment and domain information
>KOG0327 consensus Translation initiation factor 4F, helicase subunit (eIF-4A) and related helicases [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK10917 ATP-dependent DNA helicase RecG; Provisional Back     alignment and domain information
>PRK10689 transcription-repair coupling factor; Provisional Back     alignment and domain information
>KOG4284 consensus DEAD box protein [Transcription] Back     alignment and domain information
>TIGR00643 recG ATP-dependent DNA helicase RecG Back     alignment and domain information
>KOG0354 consensus DEAD-box like helicase [General function prediction only] Back     alignment and domain information
>KOG0337 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>TIGR01587 cas3_core CRISPR-associated helicase Cas3 Back     alignment and domain information
>KOG0921 consensus Dosage compensation complex, subunit MLE [Transcription] Back     alignment and domain information
>PHA02558 uvsW UvsW helicase; Provisional Back     alignment and domain information
>TIGR03158 cas3_cyano CRISPR-associated helicase, Cyano-type Back     alignment and domain information
>PRK09401 reverse gyrase; Reviewed Back     alignment and domain information
>PRK13766 Hef nuclease; Provisional Back     alignment and domain information
>KOG0952 consensus DNA/RNA helicase MER3/SLH1, DEAD-box superfamily [RNA processing and modification] Back     alignment and domain information
>COG0514 RecQ Superfamily II DNA helicase [DNA replication, recombination, and repair] Back     alignment and domain information
>COG1205 Distinct helicase family with a unique C-terminal domain including a metal-binding cysteine cluster [General function prediction only] Back     alignment and domain information
>PRK14701 reverse gyrase; Provisional Back     alignment and domain information
>TIGR01054 rgy reverse gyrase Back     alignment and domain information
>TIGR03714 secA2 accessory Sec system translocase SecA2 Back     alignment and domain information
>PRK12898 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>KOG0947 consensus Cytoplasmic exosomal RNA helicase SKI2, DEAD-box superfamily [RNA processing and modification] Back     alignment and domain information
>PRK09200 preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>KOG0948 consensus Nuclear exosomal RNA helicase MTR4, DEAD-box superfamily [RNA processing and modification] Back     alignment and domain information
>KOG0951 consensus RNA helicase BRR2, DEAD-box superfamily [RNA processing and modification] Back     alignment and domain information
>TIGR00603 rad25 DNA repair helicase rad25 Back     alignment and domain information
>COG4581 Superfamily II RNA helicase [DNA replication, recombination, and repair] Back     alignment and domain information
>KOG0349 consensus Putative DEAD-box RNA helicase DDX1 [RNA processing and modification] Back     alignment and domain information
>KOG0352 consensus ATP-dependent DNA helicase [Replication, recombination and repair] Back     alignment and domain information
>TIGR00963 secA preprotein translocase, SecA subunit Back     alignment and domain information
>PRK09694 helicase Cas3; Provisional Back     alignment and domain information
>PRK05580 primosome assembly protein PriA; Validated Back     alignment and domain information
>PRK11448 hsdR type I restriction enzyme EcoKI subunit R; Provisional Back     alignment and domain information
>COG1061 SSL2 DNA or RNA helicases of superfamily II [Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>KOG0351 consensus ATP-dependent DNA helicase [Replication, recombination and repair] Back     alignment and domain information
>KOG0329 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>COG1200 RecG RecG-like helicase [DNA replication, recombination, and repair / Transcription] Back     alignment and domain information
>KOG0950 consensus DNA polymerase theta/eta, DEAD-box superfamily [General function prediction only] Back     alignment and domain information
>TIGR00595 priA primosomal protein N' Back     alignment and domain information
>COG4098 comFA Superfamily II DNA/RNA helicase required for DNA uptake (late competence protein) [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK04914 ATP-dependent helicase HepA; Validated Back     alignment and domain information
>COG1197 Mfd Transcription-repair coupling factor (superfamily II helicase) [DNA replication, recombination, and repair / Transcription] Back     alignment and domain information
>KOG0353 consensus ATP-dependent DNA helicase [General function prediction only] Back     alignment and domain information
>PRK13104 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>cd00268 DEADc DEAD-box helicases Back     alignment and domain information
>PRK12906 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>PF00270 DEAD: DEAD/DEAH box helicase; InterPro: IPR011545 Members of this family include the DEAD and DEAH box helicases Back     alignment and domain information
>PRK12904 preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>COG1203 CRISPR-associated helicase Cas3 [Defense mechanisms] Back     alignment and domain information
>PRK13107 preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>COG4096 HsdR Type I site-specific restriction-modification system, R (restriction) subunit and related helicases [Defense mechanisms] Back     alignment and domain information
>KOG0949 consensus Predicted helicase, DEAD-box superfamily [General function prediction only] Back     alignment and domain information
>PF07717 OB_NTP_bind: Oligonucleotide/oligosaccharide-binding (OB)-fold; InterPro: IPR011709 This domain is found towards the C terminus of the DEAD-box helicases (IPR011545 from INTERPRO) Back     alignment and domain information
>PRK12899 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>PF04408 HA2: Helicase associated domain (HA2); InterPro: IPR007502 This presumed domain is about 90 amino acid residues in length Back     alignment and domain information
>TIGR00348 hsdR type I site-specific deoxyribonuclease, HsdR family Back     alignment and domain information
>PLN03142 Probable chromatin-remodeling complex ATPase chain; Provisional Back     alignment and domain information
>smart00847 HA2 Helicase associated domain (HA2) Add an annotation Back     alignment and domain information
>TIGR01407 dinG_rel DnaQ family exonuclease/DinG family helicase, putative Back     alignment and domain information
>COG1110 Reverse gyrase [DNA replication, recombination, and repair] Back     alignment and domain information
>smart00487 DEXDc DEAD-like helicases superfamily Back     alignment and domain information
>KOG0953 consensus Mitochondrial RNA helicase SUV3, DEAD-box superfamily [RNA processing and modification] Back     alignment and domain information
>PRK12900 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>cd00046 DEXDc DEAD-like helicases superfamily Back     alignment and domain information
>TIGR00631 uvrb excinuclease ABC, B subunit Back     alignment and domain information
>cd00079 HELICc Helicase superfamily c-terminal domain; associated with DEXDc-, DEAD-, and DEAH-box proteins, yeast initiation factor 4A, Ski2p, and Hepatitis C virus NS3 helicases; this domain is found in a wide variety of helicases and helicase related proteins; may not be an autonomously folding unit, but an integral part of the helicase; 4 helicase superfamilies at present according to the organization of their signature motifs; all helicases share the ability to unwind nucleic acid duplexes with a distinct directional polarity; they utilize the free energy from nucleoside triphosphate hydrolysis to fuel their translocation along DNA, unwinding the duplex in the process Back     alignment and domain information
>PF07652 Flavi_DEAD: Flavivirus DEAD domain ; InterPro: IPR011492 This is the Flavivirus DEAD domain Back     alignment and domain information
>KOG4150 consensus Predicted ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>TIGR02562 cas3_yersinia CRISPR-associated helicase Cas3 Back     alignment and domain information
>PRK05298 excinuclease ABC subunit B; Provisional Back     alignment and domain information
>PF00271 Helicase_C: Helicase conserved C-terminal domain; InterPro: IPR001650 The domain, which defines this group of proteins is found in a wide variety of helicases and helicase related proteins Back     alignment and domain information
>PRK12326 preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>COG1198 PriA Primosomal protein N' (replication factor Y) - superfamily II helicase [DNA replication, recombination, and repair] Back     alignment and domain information
>PF04851 ResIII: Type III restriction enzyme, res subunit; InterPro: IPR006935 This entry represents a domain found in the N terminus of several proteins, including helicases, the R subunit (HsdR) of type I restriction endonucleases (3 Back     alignment and domain information
>PRK07246 bifunctional ATP-dependent DNA helicase/DNA polymerase III subunit epsilon; Validated Back     alignment and domain information
>PRK13103 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>KOG1123 consensus RNA polymerase II transcription initiation/nucleotide excision repair factor TFIIH, 3'-5' helicase subunit SSL2 [Transcription; Replication, recombination and repair] Back     alignment and domain information
>COG0556 UvrB Helicase subunit of the DNA excision repair complex [DNA replication, recombination, and repair] Back     alignment and domain information
>smart00490 HELICc helicase superfamily c-terminal domain Back     alignment and domain information
>KOG0951 consensus RNA helicase BRR2, DEAD-box superfamily [RNA processing and modification] Back     alignment and domain information
>KOG0385 consensus Chromatin remodeling complex WSTF-ISWI, small subunit [Transcription] Back     alignment and domain information
>PRK08074 bifunctional ATP-dependent DNA helicase/DNA polymerase III subunit epsilon; Validated Back     alignment and domain information
>PRK12903 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>CHL00122 secA preprotein translocase subunit SecA; Validated Back     alignment and domain information
>PF02399 Herpes_ori_bp: Origin of replication binding protein; InterPro: IPR003450 This entry represents replication origin binding protein Back     alignment and domain information
>KOG0384 consensus Chromodomain-helicase DNA-binding protein [Transcription] Back     alignment and domain information
>PRK12902 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>KOG0390 consensus DNA repair protein, SNF2 family [Replication, recombination and repair] Back     alignment and domain information
>COG4889 Predicted helicase [General function prediction only] Back     alignment and domain information
>PRK11747 dinG ATP-dependent DNA helicase DinG; Provisional Back     alignment and domain information
>TIGR00604 rad3 DNA repair helicase (rad3) Back     alignment and domain information
>KOG0387 consensus Transcription-coupled repair protein CSB/RAD26 (contains SNF2 family DNA-dependent ATPase domain) [Transcription; Replication, recombination and repair] Back     alignment and domain information
>TIGR03117 cas_csf4 CRISPR-associated DEAD/DEAH-box helicase Csf4 Back     alignment and domain information
>COG1199 DinG Rad3-related DNA helicases [Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>PRK14873 primosome assembly protein PriA; Provisional Back     alignment and domain information
>PF06862 DUF1253: Protein of unknown function (DUF1253); InterPro: IPR010678 This family is defined by a C-terminal region of approximately 500 residues, Digestive organ expansion factor (DEF) is thought to Regulate the p53 pathway to control the expansion growth of digestive organs and is required for the expansion growth of intestine, liver and exocrine pancreas, but not endocrine pancreas [, ] Back     alignment and domain information
>PRK12901 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>PF00176 SNF2_N: SNF2 family N-terminal domain; InterPro: IPR000330 This domain is found in proteins involved in a variety of processes including transcription regulation (e Back     alignment and domain information
>KOG0392 consensus SNF2 family DNA-dependent ATPase domain-containing protein [Transcription] Back     alignment and domain information
>KOG1000 consensus Chromatin remodeling protein HARP/SMARCAL1, DEAD-box superfamily [Chromatin structure and dynamics] Back     alignment and domain information
>KOG2340 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF13245 AAA_19: Part of AAA domain Back     alignment and domain information
>PF13604 AAA_30: AAA domain; PDB: 1W36_G 3K70_G 3UPU_B 3GPL_A 3E1S_A 3GP8_A Back     alignment and domain information
>COG0610 Type I site-specific restriction-modification system, R (restriction) subunit and related helicases [Defense mechanisms] Back     alignment and domain information
>PF13401 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S_B Back     alignment and domain information
>TIGR00596 rad1 DNA repair protein (rad1) Back     alignment and domain information
>KOG0389 consensus SNF2 family DNA-dependent ATPase [Chromatin structure and dynamics] Back     alignment and domain information
>TIGR01447 recD exodeoxyribonuclease V, alpha subunit Back     alignment and domain information
>PF00448 SRP54: SRP54-type protein, GTPase domain; InterPro: IPR000897 The signal recognition particle (SRP) is a multimeric protein, which along with its conjugate receptor (SR), is involved in targeting secretory proteins to the rough endoplasmic reticulum (RER) membrane in eukaryotes, or to the plasma membrane in prokaryotes [, ] Back     alignment and domain information
>PRK12723 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>COG0653 SecA Preprotein translocase subunit SecA (ATPase, RNA helicase) [Intracellular trafficking and secretion] Back     alignment and domain information
>KOG0952 consensus DNA/RNA helicase MER3/SLH1, DEAD-box superfamily [RNA processing and modification] Back     alignment and domain information
>PRK10875 recD exonuclease V subunit alpha; Provisional Back     alignment and domain information
>PF02562 PhoH: PhoH-like protein; InterPro: IPR003714 PhoH is a cytoplasmic protein and predicted ATPase that is induced by phosphate starvation and belongings to the phosphate regulon (pho) in Escherichia coli [] Back     alignment and domain information
>KOG1803 consensus DNA helicase [Replication, recombination and repair] Back     alignment and domain information
>PF07517 SecA_DEAD: SecA DEAD-like domain; InterPro: IPR011115 SecA protein binds to the plasma membrane where it interacts with proOmpA to support translocation of proOmpA through the membrane Back     alignment and domain information
>PRK13889 conjugal transfer relaxase TraA; Provisional Back     alignment and domain information
>PRK14722 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>smart00488 DEXDc2 DEAD-like helicases superfamily Back     alignment and domain information
>smart00489 DEXDc3 DEAD-like helicases superfamily Back     alignment and domain information
>PF09848 DUF2075: Uncharacterized conserved protein (DUF2075); InterPro: IPR018647 This domain, found in putative ATP/GTP binding proteins, has no known function Back     alignment and domain information
>PRK10536 hypothetical protein; Provisional Back     alignment and domain information
>COG1419 FlhF Flagellar GTP-binding protein [Cell motility and secretion] Back     alignment and domain information
>PRK11889 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>KOG0386 consensus Chromatin remodeling complex SWI/SNF, component SWI2 and related ATPases (DNA/RNA helicase superfamily) [Chromatin structure and dynamics; Transcription] Back     alignment and domain information
>PRK05703 flhF flagellar biosynthesis regulator FlhF; Validated Back     alignment and domain information
>PRK15483 type III restriction-modification system StyLTI enzyme res; Provisional Back     alignment and domain information
>TIGR01448 recD_rel helicase, putative, RecD/TraA family Back     alignment and domain information
>COG0553 HepA Superfamily II DNA/RNA helicases, SNF2 family [Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>PF12340 DUF3638: Protein of unknown function (DUF3638); InterPro: IPR022099 This domain family is found in eukaryotes, and is approximately 230 amino acids in length Back     alignment and domain information
>PF05729 NACHT: NACHT domain Back     alignment and domain information
>PRK12726 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>cd00009 AAA The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold Back     alignment and domain information
>PF13086 AAA_11: AAA domain; PDB: 2XZL_A 2XZO_A 2WJY_A 2WJV_A 2XZP_A 2GK6_A 2GK7_A 2GJK_A Back     alignment and domain information
>PRK06526 transposase; Provisional Back     alignment and domain information
>TIGR02768 TraA_Ti Ti-type conjugative transfer relaxase TraA Back     alignment and domain information
>PF00580 UvrD-helicase: UvrD/REP helicase N-terminal domain; InterPro: IPR000212 Members of this family are helicases that catalyse ATP dependent unwinding of double stranded DNA to single stranded DNA Back     alignment and domain information
>cd06007 R3H_DEXH_helicase R3H domain of a group of proteins which also contain a DEXH-box helicase domain, and may function as ATP-dependent DNA or RNA helicases Back     alignment and domain information
>PF05970 PIF1: PIF1-like helicase; InterPro: IPR010285 This entry represents PIF1 helicase and related proteins Back     alignment and domain information
>PF13872 AAA_34: P-loop containing NTP hydrolase pore-1 Back     alignment and domain information
>PRK12724 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PRK12727 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PF13307 Helicase_C_2: Helicase C-terminal domain; PDB: 4A15_A 2VSF_A 3CRV_A 3CRW_1 2VL7_A Back     alignment and domain information
>PRK13826 Dtr system oriT relaxase; Provisional Back     alignment and domain information
>PRK14723 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>cd02640 R3H_NRF R3H domain of the NF-kappaB-repression factor (NRF) Back     alignment and domain information
>PRK08181 transposase; Validated Back     alignment and domain information
>PRK14974 cell division protein FtsY; Provisional Back     alignment and domain information
>PRK04296 thymidine kinase; Provisional Back     alignment and domain information
>PHA03333 putative ATPase subunit of terminase; Provisional Back     alignment and domain information
>TIGR00376 DNA helicase, putative Back     alignment and domain information
>PRK14721 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>KOG1802 consensus RNA helicase nonsense mRNA reducing factor (pNORF1) [RNA processing and modification] Back     alignment and domain information
>PRK06731 flhF flagellar biosynthesis regulator FlhF; Validated Back     alignment and domain information
>KOG4439 consensus RNA polymerase II transcription termination factor TTF2/lodestar, DEAD-box superfamily [Transcription; Replication, recombination and repair] Back     alignment and domain information
>PRK06835 DNA replication protein DnaC; Validated Back     alignment and domain information
>PRK07952 DNA replication protein DnaC; Validated Back     alignment and domain information
>PRK07003 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>TIGR03499 FlhF flagellar biosynthetic protein FlhF Back     alignment and domain information
>PF01695 IstB_IS21: IstB-like ATP binding protein; InterPro: IPR002611 Proteins in this entry contain an ATP/GTP binding P-loop motif Back     alignment and domain information
>PRK14949 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>KOG1002 consensus Nucleotide excision repair protein RAD16 [Replication, recombination and repair] Back     alignment and domain information
>PF05127 Helicase_RecD: Helicase; InterPro: IPR007807 This domain is about 350 amino acid residues long and appears to have a P-loop motif, suggesting this is an ATPase Back     alignment and domain information
>PF13173 AAA_14: AAA domain Back     alignment and domain information
>PRK06995 flhF flagellar biosynthesis regulator FlhF; Validated Back     alignment and domain information
>PRK09112 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>KOG0391 consensus SNF2 family DNA-dependent ATPase [General function prediction only] Back     alignment and domain information
>smart00382 AAA ATPases associated with a variety of cellular activities Back     alignment and domain information
>PRK07764 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>cd02641 R3H_Smubp-2_like R3H domain of Smubp-2_like proteins Back     alignment and domain information
>COG3587 Restriction endonuclease [Defense mechanisms] Back     alignment and domain information
>PRK07994 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK06893 DNA replication initiation factor; Validated Back     alignment and domain information
>PRK05642 DNA replication initiation factor; Validated Back     alignment and domain information
>PRK12323 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK08727 hypothetical protein; Validated Back     alignment and domain information
>PF03354 Terminase_1: Phage Terminase ; InterPro: IPR005021 This entry is represented by Lactococcus phage bIL285, Orf41 (terminase) Back     alignment and domain information
>PHA02533 17 large terminase protein; Provisional Back     alignment and domain information
>PRK14961 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK10416 signal recognition particle-docking protein FtsY; Provisional Back     alignment and domain information
>PF05621 TniB: Bacterial TniB protein; InterPro: IPR008868 This family consists of several bacterial TniB NTP-binding proteins Back     alignment and domain information
>TIGR03015 pepcterm_ATPase putative secretion ATPase, PEP-CTERM locus subfamily Back     alignment and domain information
>PRK14956 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK08903 DnaA regulatory inactivator Hda; Validated Back     alignment and domain information
>PTZ00112 origin recognition complex 1 protein; Provisional Back     alignment and domain information
>PRK14952 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK09183 transposase/IS protein; Provisional Back     alignment and domain information
>PRK08116 hypothetical protein; Validated Back     alignment and domain information
>PRK14958 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>TIGR03420 DnaA_homol_Hda DnaA regulatory inactivator Hda Back     alignment and domain information
>PTZ00146 fibrillarin; Provisional Back     alignment and domain information
>PRK14964 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK09111 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>KOG0989 consensus Replication factor C, subunit RFC4 [Replication, recombination and repair] Back     alignment and domain information
>PRK14951 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK08691 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK08084 DNA replication initiation factor; Provisional Back     alignment and domain information
>PF13177 DNA_pol3_delta2: DNA polymerase III, delta subunit; PDB: 1NJF_B 3GLG_G 1XXH_I 1NJG_A 3GLF_B 3GLI_G 1IQP_E 2GNO_A 1SXJ_E 1A5T_A Back     alignment and domain information
>PRK07471 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK11773 uvrD DNA-dependent helicase II; Provisional Back     alignment and domain information
>TIGR02760 TraI_TIGR conjugative transfer relaxase protein TraI Back     alignment and domain information
>PRK14957 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK05707 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK00771 signal recognition particle protein Srp54; Provisional Back     alignment and domain information
>PRK00149 dnaA chromosomal replication initiation protein; Reviewed Back     alignment and domain information
>COG3421 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>TIGR00064 ftsY signal recognition particle-docking protein FtsY Back     alignment and domain information
>PRK12377 putative replication protein; Provisional Back     alignment and domain information
>PRK11331 5-methylcytosine-specific restriction enzyme subunit McrB; Provisional Back     alignment and domain information
>TIGR01425 SRP54_euk signal recognition particle protein SRP54 Back     alignment and domain information
>PRK14960 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>COG1474 CDC6 Cdc6-related protein, AAA superfamily ATPase [DNA replication, recombination, and repair / Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PHA03368 DNA packaging terminase subunit 1; Provisional Back     alignment and domain information
>TIGR01075 uvrD DNA helicase II Back     alignment and domain information
>PRK12402 replication factor C small subunit 2; Reviewed Back     alignment and domain information
>PRK06921 hypothetical protein; Provisional Back     alignment and domain information
>PRK10867 signal recognition particle protein; Provisional Back     alignment and domain information
>TIGR02782 TrbB_P P-type conjugative transfer ATPase TrbB Back     alignment and domain information
>PRK14969 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>TIGR02785 addA_Gpos recombination helicase AddA, Firmicutes type Back     alignment and domain information
>PRK11054 helD DNA helicase IV; Provisional Back     alignment and domain information
>TIGR02881 spore_V_K stage V sporulation protein K Back     alignment and domain information
>TIGR01074 rep ATP-dependent DNA helicase Rep Back     alignment and domain information
>PRK00411 cdc6 cell division control protein 6; Reviewed Back     alignment and domain information
>PRK13833 conjugal transfer protein TrbB; Provisional Back     alignment and domain information
>TIGR00959 ffh signal recognition particle protein Back     alignment and domain information
>TIGR00362 DnaA chromosomal replication initiator protein DnaA Back     alignment and domain information
>PTZ00146 fibrillarin; Provisional Back     alignment and domain information
>PRK14086 dnaA chromosomal replication initiation protein; Provisional Back     alignment and domain information
>PRK14959 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>TIGR00678 holB DNA polymerase III, delta' subunit Back     alignment and domain information
>cd01120 RecA-like_NTPases RecA-like NTPases Back     alignment and domain information
>PRK14962 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK08769 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK14965 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14087 dnaA chromosomal replication initiation protein; Provisional Back     alignment and domain information
>PRK06645 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK10919 ATP-dependent DNA helicase Rep; Provisional Back     alignment and domain information
>COG1444 Predicted P-loop ATPase fused to an acetyltransferase [General function prediction only] Back     alignment and domain information
>PRK14712 conjugal transfer nickase/helicase TraI; Provisional Back     alignment and domain information
>TIGR02928 orc1/cdc6 family replication initiation protein Back     alignment and domain information
>PRK14963 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK08939 primosomal protein DnaI; Reviewed Back     alignment and domain information
>PRK07940 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK14088 dnaA chromosomal replication initiation protein; Provisional Back     alignment and domain information
>COG2804 PulE Type II secretory pathway, ATPase PulE/Tfp pilus assembly pathway, ATPase PilB [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>PF00004 AAA: ATPase family associated with various cellular activities (AAA); InterPro: IPR003959 AAA ATPases (ATPases Associated with diverse cellular Activities) form a large protein family and play a number of roles in the cell including cell-cycle regulation, protein proteolysis and disaggregation, organelle biogenesis and intracellular transport Back     alignment and domain information
>PHA02544 44 clamp loader, small subunit; Provisional Back     alignment and domain information
>COG1435 Tdk Thymidine kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK12422 chromosomal replication initiation protein; Provisional Back     alignment and domain information
>TIGR01547 phage_term_2 phage terminase, large subunit, PBSX family Back     alignment and domain information
>PRK13894 conjugal transfer ATPase TrbB; Provisional Back     alignment and domain information
>cd01124 KaiC KaiC is a circadian clock protein primarily found in cyanobacteria KaiC is a RecA-like ATPase, having both Walker A and Walker B motifs Back     alignment and domain information
>COG3973 Superfamily I DNA and RNA helicases [General function prediction only] Back     alignment and domain information
>PF00437 T2SE: Type II/IV secretion system protein; InterPro: IPR001482 A number of bacterial proteins, some of which are involved in a general secretion pathway (GSP) for the export of proteins (also called the type II pathway) belong to this group [, ] Back     alignment and domain information
>PRK13709 conjugal transfer nickase/helicase TraI; Provisional Back     alignment and domain information
>PRK13851 type IV secretion system protein VirB11; Provisional Back     alignment and domain information
>KOG1805 consensus DNA replication helicase [Replication, recombination and repair] Back     alignment and domain information
>TIGR02760 TraI_TIGR conjugative transfer relaxase protein TraI Back     alignment and domain information
>PRK14955 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK06964 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>cd03115 SRP The signal recognition particle (SRP) mediates the transport to or across the plasma membrane in bacteria and the endoplasmic reticulum in eukaryotes Back     alignment and domain information
>PRK14950 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>COG0470 HolB ATPase involved in DNA replication [DNA replication, recombination, and repair] Back     alignment and domain information
>COG1702 PhoH Phosphate starvation-inducible protein PhoH, predicted ATPase [Signal transduction mechanisms] Back     alignment and domain information
>PRK05563 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PF05496 RuvB_N: Holliday junction DNA helicase ruvB N-terminus; InterPro: IPR008824 The RuvB protein makes up part of the RuvABC revolvasome which catalyses the resolution of Holliday junctions that arise during genetic recombination and DNA repair Back     alignment and domain information
>PRK13900 type IV secretion system ATPase VirB11; Provisional Back     alignment and domain information
>TIGR02880 cbbX_cfxQ probable Rubsico expression protein CbbX Back     alignment and domain information
>PRK05896 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PF00308 Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013317 This entry represents the central domain of bacterial DnaA proteins [, , ] that play an important role in initiating and regulating chromosomal replication Back     alignment and domain information
>KOG0388 consensus SNF2 family DNA-dependent ATPase [Replication, recombination and repair] Back     alignment and domain information
>PRK08451 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK07133 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>COG4962 CpaF Flp pilus assembly protein, ATPase CpaF [Intracellular trafficking and secretion] Back     alignment and domain information
>KOG0391 consensus SNF2 family DNA-dependent ATPase [General function prediction only] Back     alignment and domain information
>cd02639 R3H_RRM R3H domain of mainly fungal proteins which are associated with a RNA recognition motif (RRM) domain Back     alignment and domain information
>PLN03025 replication factor C subunit; Provisional Back     alignment and domain information
>PRK14948 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PHA00729 NTP-binding motif containing protein Back     alignment and domain information
>KOG1132 consensus Helicase of the DEAD superfamily [Replication, recombination and repair] Back     alignment and domain information
>TIGR03345 VI_ClpV1 type VI secretion ATPase, ClpV1 family Back     alignment and domain information
>PRK06871 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PTZ00293 thymidine kinase; Provisional Back     alignment and domain information
>cd02646 R3H_G-patch R3H domain of a group of fungal and plant proteins with unknown function, who also contain a G-patch domain Back     alignment and domain information
>COG4626 Phage terminase-like protein, large subunit [General function prediction only] Back     alignment and domain information
>PRK09087 hypothetical protein; Validated Back     alignment and domain information
>TIGR01073 pcrA ATP-dependent DNA helicase PcrA Back     alignment and domain information
>COG2256 MGS1 ATPase related to the helicase subunit of the Holliday junction resolvase [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK14970 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>TIGR02397 dnaX_nterm DNA polymerase III, subunit gamma and tau Back     alignment and domain information
>COG1484 DnaC DNA replication protein [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK06620 hypothetical protein; Validated Back     alignment and domain information
>PRK00440 rfc replication factor C small subunit; Reviewed Back     alignment and domain information
>CHL00181 cbbX CbbX; Provisional Back     alignment and domain information
>PRK14953 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK07399 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK11823 DNA repair protein RadA; Provisional Back     alignment and domain information
>PF01637 Arch_ATPase: Archaeal ATPase; InterPro: IPR011579 This domain has been found in a number of bacterial and archaeal proteins, all of which contain a conserved P-loop motif that is involved in binding ATP Back     alignment and domain information
>PRK13342 recombination factor protein RarA; Reviewed Back     alignment and domain information
>KOG2373 consensus Predicted mitochondrial DNA helicase twinkle [Replication, recombination and repair] Back     alignment and domain information
>PRK06067 flagellar accessory protein FlaH; Validated Back     alignment and domain information
>PRK04195 replication factor C large subunit; Provisional Back     alignment and domain information
>PF14617 CMS1: U3-containing 90S pre-ribosomal complex subunit Back     alignment and domain information
>PRK14954 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PF05876 Terminase_GpA: Phage terminase large subunit (GpA); InterPro: IPR008866 This entry is represented by Bacteriophage lambda, GpA Back     alignment and domain information
>PRK08533 flagellar accessory protein FlaH; Reviewed Back     alignment and domain information
>PRK08058 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK06090 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PF13555 AAA_29: P-loop containing region of AAA domain Back     alignment and domain information
>TIGR00767 rho transcription termination factor Rho Back     alignment and domain information
>PF01443 Viral_helicase1: Viral (Superfamily 1) RNA helicase; InterPro: IPR000606 This entry includes RNA and DNA helicases Back     alignment and domain information
>COG3267 ExeA Type II secretory pathway, component ExeA (predicted ATPase) [Intracellular trafficking and secretion] Back     alignment and domain information
>PRK08699 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK10865 protein disaggregation chaperone; Provisional Back     alignment and domain information
>PF00931 NB-ARC: NB-ARC domain; InterPro: IPR002182 This is the NB-ARC domain, a novel signalling motif found in bacteria and eukaryotes, shared by plant resistance gene products and regulators of cell death in animals [] Back     alignment and domain information
>cd01130 VirB11-like_ATPase Type IV secretory pathway component VirB11, and related ATPases Back     alignment and domain information
>cd01122 GP4d_helicase GP4d_helicase is a homohexameric 5'-3' helicases Back     alignment and domain information
>cd01393 recA_like RecA is a bacterial enzyme which has roles in homologous recombination, DNA repair, and the induction of the SOS response Back     alignment and domain information
>PRK06647 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>TIGR02524 dot_icm_DotB Dot/Icm secretion system ATPase DotB Back     alignment and domain information
>PRK05564 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>cd03247 ABCC_cytochrome_bd The CYD subfamily implicated in cytochrome bd biogenesis Back     alignment and domain information
>PRK07993 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK14971 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>TIGR02788 VirB11 P-type DNA transfer ATPase VirB11 Back     alignment and domain information
>KOG2028 consensus ATPase related to the helicase subunit of the Holliday junction resolvase [Replication, recombination and repair] Back     alignment and domain information
>cd01121 Sms Sms (bacterial radA) DNA repair protein Back     alignment and domain information
>TIGR02688 conserved hypothetical protein TIGR02688 Back     alignment and domain information
>PF03237 Terminase_6: Terminase-like family; InterPro: IPR004921 The terminase is a component of the molecular motor that translocates genomic DNA into empty capsids during DNA packaging [] Back     alignment and domain information
>COG2805 PilT Tfp pilus assembly protein, pilus retraction ATPase PilT [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>cd03221 ABCF_EF-3 ABCF_EF-3 Elongation factor 3 (EF-3) is a cytosolic protein required by fungal ribosomes for in vitro protein synthesis and for in vivo growth Back     alignment and domain information
>COG0552 FtsY Signal recognition particle GTPase [Intracellular trafficking and secretion] Back     alignment and domain information
>TIGR03877 thermo_KaiC_1 KaiC domain protein, Ph0284 family Back     alignment and domain information
>KOG2004 consensus Mitochondrial ATP-dependent protease PIM1/LON [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd00544 CobU Adenosylcobinamide kinase / adenosylcobinamide phosphate guanyltransferase (CobU) Back     alignment and domain information
>PF12846 AAA_10: AAA-like domain Back     alignment and domain information
>TIGR02655 circ_KaiC circadian clock protein KaiC Back     alignment and domain information
>cd00267 ABC_ATPase ABC (ATP-binding cassette) transporter nucleotide-binding domain; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules Back     alignment and domain information
>TIGR00631 uvrb excinuclease ABC, B subunit Back     alignment and domain information
>PRK13341 recombination factor protein RarA/unknown domain fusion protein; Reviewed Back     alignment and domain information
>COG1221 PspF Transcriptional regulators containing an AAA-type ATPase domain and a DNA-binding domain [Transcription / Signal transduction mechanisms] Back     alignment and domain information
>COG1110 Reverse gyrase [DNA replication, recombination, and repair] Back     alignment and domain information
>COG1074 RecB ATP-dependent exoDNAse (exonuclease V) beta subunit (contains helicase and exonuclease domains) [DNA replication, recombination, and repair] Back     alignment and domain information
>TIGR00635 ruvB Holliday junction DNA helicase, RuvB subunit Back     alignment and domain information
>COG0630 VirB11 Type IV secretory pathway, VirB11 components, and related ATPases involved in archaeal flagella biosynthesis [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>TIGR02525 plasmid_TraJ plasmid transfer ATPase TraJ Back     alignment and domain information
>TIGR02639 ClpA ATP-dependent Clp protease ATP-binding subunit clpA Back     alignment and domain information
>COG0541 Ffh Signal recognition particle GTPase [Intracellular trafficking and secretion] Back     alignment and domain information
>cd01131 PilT Pilus retraction ATPase PilT Back     alignment and domain information
>cd03228 ABCC_MRP_Like The MRP (Mutidrug Resistance Protein)-like transporters are involved in drug, peptide, and lipid export Back     alignment and domain information
>cd01128 rho_factor Transcription termination factor rho is a bacterial ATP-dependent RNA/DNA helicase Back     alignment and domain information
>COG2255 RuvB Holliday junction resolvasome, helicase subunit [DNA replication, recombination, and repair] Back     alignment and domain information
>KOG0741 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd01129 PulE-GspE PulE/GspE The type II secretory pathway is the main terminal branch of the general secretory pathway (GSP) Back     alignment and domain information
>PF05894 Podovirus_Gp16: Podovirus DNA encapsidation protein (Gp16); InterPro: IPR008784 This family consists of several DNA encapsidation protein (Gp16) sequences from the phi-29-like viruses Back     alignment and domain information
>PHA00149 DNA encapsidation protein Back     alignment and domain information
>TIGR03689 pup_AAA proteasome ATPase Back     alignment and domain information
>KOG2543 consensus Origin recognition complex, subunit 5 [Replication, recombination and repair] Back     alignment and domain information
>PRK04841 transcriptional regulator MalT; Provisional Back     alignment and domain information
>PRK05580 primosome assembly protein PriA; Validated Back     alignment and domain information
>PRK05917 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>TIGR02640 gas_vesic_GvpN gas vesicle protein GvpN Back     alignment and domain information
>KOG2228 consensus Origin recognition complex, subunit 4 [Replication, recombination and repair] Back     alignment and domain information
>cd03222 ABC_RNaseL_inhibitor The ABC ATPase RNase L inhibitor (RLI) is a key enzyme in ribosomal biogenesis, formation of translation preinitiation complexes, and assembly of HIV capsids Back     alignment and domain information
>PRK06305 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK10917 ATP-dependent DNA helicase RecG; Provisional Back     alignment and domain information
>TIGR00602 rad24 checkpoint protein rad24 Back     alignment and domain information
>PRK13764 ATPase; Provisional Back     alignment and domain information
>cd03246 ABCC_Protease_Secretion This family represents the ABC component of the protease secretion system PrtD, a 60-kDa integral membrane protein sharing 37% identity with HlyB, the ABC component of the alpha-hemolysin secretion pathway, in the C-terminal domain Back     alignment and domain information
>PLN02165 adenylate isopentenyltransferase Back     alignment and domain information
>PRK05973 replicative DNA helicase; Provisional Back     alignment and domain information
>cd03238 ABC_UvrA The excision repair protein UvrA; Nucleotide excision repair in eubacteria is a process that repairs DNA damage by the removal of a 12-13-mer oligonucleotide containing the lesion Back     alignment and domain information
>TIGR00595 priA primosomal protein N' Back     alignment and domain information
>COG0542 clpA ATP-binding subunits of Clp protease and DnaK/DnaJ chaperones [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR01420 pilT_fam pilus retraction protein PilT Back     alignment and domain information
>PF13207 AAA_17: AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6_G 2QT1_A 2QSZ_A 2QSY_A 2QT0_A 2QG6_A 2P0E_A Back     alignment and domain information
>PRK00080 ruvB Holliday junction DNA helicase RuvB; Reviewed Back     alignment and domain information
>PRK03992 proteasome-activating nucleotidase; Provisional Back     alignment and domain information
>TIGR03819 heli_sec_ATPase helicase/secretion neighborhood ATPase Back     alignment and domain information
>TIGR02639 ClpA ATP-dependent Clp protease ATP-binding subunit clpA Back     alignment and domain information
>COG1126 GlnQ ABC-type polar amino acid transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>PRK05986 cob(I)alamin adenolsyltransferase/cobinamide ATP-dependent adenolsyltransferase; Validated Back     alignment and domain information
>COG0466 Lon ATP-dependent Lon protease, bacterial type [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG2812 DnaX DNA polymerase III, gamma/tau subunits [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK10787 DNA-binding ATP-dependent protease La; Provisional Back     alignment and domain information
>TIGR03346 chaperone_ClpB ATP-dependent chaperone ClpB Back     alignment and domain information
>PRK11034 clpA ATP-dependent Clp protease ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR03117 cas_csf4 CRISPR-associated DEAD/DEAH-box helicase Csf4 Back     alignment and domain information
>COG0513 SrmB Superfamily II DNA and RNA helicases [DNA replication, recombination, and repair / Transcription / Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>TIGR01243 CDC48 AAA family ATPase, CDC48 subfamily Back     alignment and domain information
>PRK10436 hypothetical protein; Provisional Back     alignment and domain information
>PRK11034 clpA ATP-dependent Clp protease ATP-binding subunit; Provisional Back     alignment and domain information
>PRK09376 rho transcription termination factor Rho; Provisional Back     alignment and domain information
>TIGR00708 cobA cob(I)alamin adenosyltransferase Back     alignment and domain information
>KOG1596 consensus Fibrillarin and related nucleolar RNA-binding proteins [RNA processing and modification] Back     alignment and domain information
>KOG1015 consensus Transcription regulator XNP/ATRX, DEAD-box superfamily [Transcription] Back     alignment and domain information
>cd03229 ABC_Class3 This class is comprised of all BPD (Binding Protein Dependent) systems that are largely represented in archaea and eubacteria and are primarily involved in scavenging solutes from the environment Back     alignment and domain information
>PF06745 KaiC: KaiC; InterPro: IPR014774 This entry represents a domain within bacterial and archaeal proteins, most of which are hypothetical Back     alignment and domain information
>COG0593 DnaA ATPase involved in DNA replication initiation [DNA replication, recombination, and repair] Back     alignment and domain information
>COG2109 BtuR ATP:corrinoid adenosyltransferase [Coenzyme metabolism] Back     alignment and domain information
>PF13671 AAA_33: AAA domain; PDB: 1LTQ_A 2IA5_K 1RC8_A 1LY1_A 1RRC_A 1RPZ_A 3ZVM_A 1YJ5_A 3ZVL_A 3U7E_B Back     alignment and domain information
>PRK14873 primosome assembly protein PriA; Provisional Back     alignment and domain information
>TIGR01243 CDC48 AAA family ATPase, CDC48 subfamily Back     alignment and domain information
>TIGR03878 thermo_KaiC_2 KaiC domain protein, AF_0795 family Back     alignment and domain information
>cd03216 ABC_Carb_Monos_I This family represents the domain I of the carbohydrate uptake proteins that transport only monosaccharides (Monos) Back     alignment and domain information
>cd03282 ABC_MSH4_euk MutS4 homolog in eukaryotes Back     alignment and domain information
>KOG2036 consensus Predicted P-loop ATPase fused to an acetyltransferase [General function prediction only] Back     alignment and domain information
>cd00984 DnaB_C DnaB helicase C terminal domain Back     alignment and domain information
>COG3598 RepA RecA-family ATPase [DNA replication, recombination, and repair] Back     alignment and domain information
>CHL00095 clpC Clp protease ATP binding subunit Back     alignment and domain information
>CHL00176 ftsH cell division protein; Validated Back     alignment and domain information
>PF13481 AAA_25: AAA domain; PDB: 1G8Y_J 1OLO_A 1NLF_C Back     alignment and domain information
>KOG0701 consensus dsRNA-specific nuclease Dicer and related ribonucleases [RNA processing and modification] Back     alignment and domain information
>TIGR02533 type_II_gspE general secretory pathway protein E Back     alignment and domain information
>cd03227 ABC_Class2 ABC-type Class 2 contains systems involved in cellular processes other than transport Back     alignment and domain information
>TIGR03263 guanyl_kin guanylate kinase Back     alignment and domain information
>COG1618 Predicted nucleotide kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>cd01127 TrwB Bacterial conjugation protein TrwB, ATP binding domain Back     alignment and domain information
>TIGR02538 type_IV_pilB type IV-A pilus assembly ATPase PilB Back     alignment and domain information
>PF12775 AAA_7: P-loop containing dynein motor region D3; PDB: 4AKI_A 4AI6_B 4AKH_A 4AKG_A 3QMZ_A 3VKH_A 3VKG_A Back     alignment and domain information
>COG2909 MalT ATP-dependent transcriptional regulator [Transcription] Back     alignment and domain information
>KOG0738 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0347 consensus RNA helicase [RNA processing and modification] Back     alignment and domain information
>cd01394 radB RadB Back     alignment and domain information
>TIGR00763 lon ATP-dependent protease La Back     alignment and domain information
>PF13238 AAA_18: AAA domain; PDB: 3IIK_A 3IIJ_A 3IIL_A 1RKB_A 3IIM_A 2AXP_A 3KB2_A 1KHT_A 1NKS_A 3H86_C Back     alignment and domain information
>cd03239 ABC_SMC_head The structural maintenance of chromosomes (SMC) proteins are essential for successful chromosome transmission during replication and segregation of the genome in all organisms Back     alignment and domain information
>TIGR02784 addA_alphas double-strand break repair helicase AddA, alphaproteobacterial type Back     alignment and domain information
>cd03276 ABC_SMC6_euk Eukaryotic SMC6 proteins; SMC proteins are large (approximately 110 to 170 kDa), and each is arranged into five recognizable domains Back     alignment and domain information
>KOG1970 consensus Checkpoint RAD17-RFC complex, RAD17/RAD24 component [Cell cycle control, cell division, chromosome partitioning; Replication, recombination and repair] Back     alignment and domain information
>cd03281 ABC_MSH5_euk MutS5 homolog in eukaryotes Back     alignment and domain information
>cd03213 ABCG_EPDR ABCG transporters are involved in eye pigment (EP) precursor transport, regulation of lipid-trafficking mechanisms, and pleiotropic drug resistance (DR) Back     alignment and domain information
>KOG1969 consensus DNA replication checkpoint protein CHL12/CTF18 [Cell cycle control, cell division, chromosome partitioning; Replication, recombination and repair] Back     alignment and domain information
>cd00561 CobA_CobO_BtuR ATP:corrinoid adenosyltransferase BtuR/CobO/CobP Back     alignment and domain information
>PF01580 FtsK_SpoIIIE: FtsK/SpoIIIE family; InterPro: IPR002543 The FtsK/SpoIIIE domain is found extensively in a wide variety of proteins from prokaryotes and plasmids [] some of which contain up to three copies Back     alignment and domain information
>PRK14530 adenylate kinase; Provisional Back     alignment and domain information
>COG1219 ClpX ATP-dependent protease Clp, ATPase subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR02237 recomb_radB DNA repair and recombination protein RadB Back     alignment and domain information
>TIGR00643 recG ATP-dependent DNA helicase RecG Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query1044
3kx2_B767 Crystal Structure Of Prp43p In Complex With Adp Len 2e-85
2xau_A773 Crystal Structure Of The Prp43p Deah-Box Rna Helica 2e-85
3llm_A235 Crystal Structure Analysis Of A Rna Helicase Length 2e-35
3i4u_A270 Crystal Structure Analysis Of A Helicase Associated 2e-20
>pdb|3KX2|B Chain B, Crystal Structure Of Prp43p In Complex With Adp Length = 767 Back     alignment and structure 
Iteration: 1

 Score =  314 bits (805), Expect = 2e-85,   Method: Compositional matrix adjust.
 Identities = 223/702 (31%), Positives = 334/702 (47%), Gaps = 84/702 (11%)
Query: 274 MLSFREKLPAFKMKAEFLKAVAENQVLVVSGETGCGKTTQLPQFILEEELSSLRGADCNI 333
           +L  R +LP    + EFLK    NQ++V  GETG GKTTQ+PQF+L +E+  L   +  +
Sbjct: 86  ILKIRRELPVHAQRDEFLKLYQNNQIMVFVGETGSGKTTQIPQFVLFDEMPHLE--NTQV 143
Query: 334 ICTQPXXXXXXXXXXXXXXERGENLGETVGYQIRLESKRSAQTRLLFCTTGVLLRQLVED 393
            CTQP              E    LGE VGY IR E+K S +T L + T G+LLR+ +ED
Sbjct: 144 ACTQPRRVAAMSVAQRVAEEMDVKLGEEVGYSIRFENKTSNKTILKYMTDGMLLREAMED 203
Query: 394 PDLSCVSHLLVDEIHERGMNEDFXXXXXXXXXXXXXXXXXXXMSATINADLFSKYFGNAP 453
            DLS  S +++DE HER +  D                    MSAT++A+ F +YF +AP
Sbjct: 204 HDLSRYSCIILDEAHERTLATDILMGLLKQVVKRRPDLKIIIMSATLDAEKFQRYFNDAP 263
Query: 454 TVHIPGLTFPVTDLFLEDVLEKTRYKMNSKLDSFQGNXXXXXXQDSKKDHLTALFEDVDI 513
            + +PG T+PV +L+     ++        LDS           +   D L  L  + +I
Sbjct: 264 LLAVPGRTYPV-ELYYTPEFQR------DYLDSAIRTVLQIHATEEAGDILLFLTGEDEI 316
Query: 514 DSNYKNYRASTRASLEAWSAEQIDLGLVESTIEYICRHEGDGAILVFLTGWNDISKLLDQ 573
           +       A  + SLE                + + R EG G + V+             
Sbjct: 317 ED------AVRKISLEG---------------DQLVREEGCGPLSVY------------- 342
Query: 574 IKVNKFLGDPNKFLVLPLHGSMPTINQREIFDRPPPNK-----RKIVLATNIAESSITID 628
                           PL+GS+P   Q+ IF+  P +      RK+V++TNIAE+S+TID
Sbjct: 343 ----------------PLYGSLPPHQQQRIFEPAPESHNGRPGRKVVISTNIAETSLTID 386
Query: 629 DVVYVVDCGKAKETSYDALNKLACLLPSWISKASAHQRRGRAGRVQPGVCYKLYP-RIIH 687
            +VYVVD G +K+  Y+   ++  LL S ISKASA QR GRAGR +PG C++LY      
Sbjct: 387 GIVYVVDPGFSKQKVYNPRIRVESLLVSPISKASAQQRAGRAGRTRPGKCFRLYTEEAFQ 446
Query: 688 DAMLPYQLPEILRTPLQELCLHIKSLQLGTVGSFLSKALQPPDPLAVQNAIELLKTIGAL 747
             ++    PEILR+ L    L +K L +  +  F    + PP P  +  A+E L  +  L
Sbjct: 447 KELIEQSYPEILRSNLSSTVLELKKLGIDDLVHF--DFMDPPAPETMMRALEELNYLACL 504
Query: 748 DDMENLTPLGRHLCTLPVDPNIGKMLLMGAIFQCLNPALTIAAALAHRNPFVLPVNMQKE 807
           DD  NLTPLGR     P+DP +  ML+    FQC    LTI A L+  N F+ P   +K 
Sbjct: 505 DDEGNLTPLGRLASQFPLDPMLAVMLIGSFEFQCSQEILTIVAMLSVPNVFIRPTKDKKR 564
Query: 808 VDEAKRSFAGDSCSDHIALLKAFDGYK-DAKRNRRERDFCWENFLSPITLQMMEDMRSQF 866
            D+AK  FA     DHI LL  +  +K D         +C +++L+  +L   +++RSQ 
Sbjct: 565 ADDAKNIFAHPD-GDHITLLNVYHAFKSDEAYEYGIHKWCRDHYLNYRSLSAADNIRSQL 623
Query: 867 LDLLSDIGF---VDKSKGPSAYNRYSHDLEMVCAILCAGLYPNVVQCKRKGKRAVFYTKE 923
             L++           + P  ++        +   L +G +  V + KR G +     K+
Sbjct: 624 ERLMNRYNLELNTTDYESPKYFDN-------IRKALASGFFMQVAK-KRSGAKGYITVKD 675
Query: 924 VGQVALHPSSVNANQNNFPLPYMVYSEMVKTNNINVYDSTNI 965
              V +HPS+V  +       +++Y+E V T+   +   T++
Sbjct: 676 NQDVLIHPSTVLGHDAE----WVIYNEFVLTSKNYIRTVTSV 713
>pdb|2XAU|A Chain A, Crystal Structure Of The Prp43p Deah-Box Rna Helicase In Complex With Adp Length = 773 Back     alignment and structure
>pdb|3LLM|A Chain A, Crystal Structure Analysis Of A Rna Helicase Length = 235 Back     alignment and structure
>pdb|3I4U|A Chain A, Crystal Structure Analysis Of A Helicase Associated Domain Length = 270 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

No hit with probability above 80.00

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 1044
d1yksa2299 c.37.1.14 (A:325-623) YFV helicase domain {Yellow 2e-42
d1a1va1136 c.37.1.14 (A:190-325) HCV helicase domain {Human h 2e-24
d2bmfa2305 c.37.1.14 (A:178-482) Dengue virus helicase {Dengu 6e-22
d2bmfa2305 c.37.1.14 (A:178-482) Dengue virus helicase {Dengu 4e-18
d1yksa1140 c.37.1.14 (A:185-324) YFV helicase domain {Yellow 2e-12
d1wp9a2286 c.37.1.19 (A:201-486) putative ATP-dependent RNA h 2e-04
d2p6ra3202 c.37.1.19 (A:1-202) Hel308 helicase {Archaeoglobus 0.001
d1a1va2299 c.37.1.14 (A:326-624) HCV helicase domain {Human h 0.001
d1hv8a1208 c.37.1.19 (A:3-210) Putative DEAD box RNA helicase 0.002
>d1yksa2 c.37.1.14 (A:325-623) YFV helicase domain {Yellow fever virus [TaxId: 11089]} Length = 299 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: RNA helicase
domain: YFV helicase domain
species: Yellow fever virus [TaxId: 11089]

 Score =  155 bits (392), Expect = 2e-42
 Identities = 53/310 (17%), Positives = 87/310 (28%), Gaps = 31/310 (10%)

Query: 533 AEQIDLGLVESTIEYICRHEGDGAILVFLTGWNDISKLLDQIKVNKFLGDPNKFLVLPLH 592
              I      +  ++I   +       FL      + +   ++            V+ L+
Sbjct: 17  QTDIPSEPWNTGHDWILADKRP--TAWFLPSIRAANVMAASLR-------KAGKSVVVLN 67

Query: 593 GSMPTINQREIFDRPPPNKRKIVLATNIAESSITIDDVVYVVDCGKA-KETSYDALNKLA 651
                     I       K   +LAT+IAE    +  V  V+DC  A K    D   K+A
Sbjct: 68  RKTFEREYPTIKQ----KKPDFILATDIAEMGANL-CVERVLDCRTAFKPVLVDEGRKVA 122

Query: 652 CLLPSWISKASAHQRRGRAGRVQPGVCYKLYPRIIHDAMLPYQLPEILRTPLQELCLHIK 711
              P  IS +SA QRRGR GR         Y     +         +       L  +++
Sbjct: 123 IKGPLRISASSAAQRRGRIGRNPNR-DGDSY--YYSEPTSENNAHHVCWLEASMLLDNME 179

Query: 712 SLQLGTVGSFLSKA---LQPPDPLAVQNAIELLKTIGALDDMENLTPLGRHLCTLPVDPN 768
            ++ G V                       +       + + +    L   +    +  N
Sbjct: 180 -VRGGMVAPLYGVEGTKTPVSPGEMRLRDDQRKVFRELVRNCDLPVWLSWQVAKAGLKTN 238

Query: 769 IGKMLLMGAIFQCLNPALTIAAALAHRNPFVLPVNMQKEVDEAKRSFAGDSCSDHIALLK 828
             K    G           I            P   +K +    R       SD  A L 
Sbjct: 239 DRKWCFEGP------EEHEILNDSGETVKCRAPGGAKKPL--RPRWCDERVSSDQSA-LS 289

Query: 829 AFDGYKDAKR 838
            F  + + +R
Sbjct: 290 EFIKFAEGRR 299
>d1a1va1 c.37.1.14 (A:190-325) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} Length = 136 Back     information, alignment and structure
>d2bmfa2 c.37.1.14 (A:178-482) Dengue virus helicase {Dengue virus type 2 [TaxId: 11060]} Length = 305 Back     information, alignment and structure
>d2bmfa2 c.37.1.14 (A:178-482) Dengue virus helicase {Dengue virus type 2 [TaxId: 11060]} Length = 305 Back     information, alignment and structure
>d1yksa1 c.37.1.14 (A:185-324) YFV helicase domain {Yellow fever virus [TaxId: 11089]} Length = 140 Back     information, alignment and structure
>d1wp9a2 c.37.1.19 (A:201-486) putative ATP-dependent RNA helicase PF2015 {Pyrococcus furiosus [TaxId: 2261]} Length = 286 Back     information, alignment and structure
>d2p6ra3 c.37.1.19 (A:1-202) Hel308 helicase {Archaeoglobus fulgidus [TaxId: 2234]} Length = 202 Back     information, alignment and structure
>d1a1va2 c.37.1.14 (A:326-624) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} Length = 299 Back     information, alignment and structure
>d1hv8a1 c.37.1.19 (A:3-210) Putative DEAD box RNA helicase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Length = 208 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query1044
d2bhua3420 Glycosyltrehalose trehalohydrolase, central domain 100.0
d1ejda_419 UDP-N-acetylglucosamine enolpyruvyl transferase (E 100.0
d2df7a1419 Birnavirus VP2 {Infectious bursal disease virus [T 100.0
d1om4a_418 Nitric oxide (NO) synthase oxygenase domain {Rat ( 100.0
d2gp4a2418 6-phosphogluconate dehydratase EDD {Shewanella one 100.0
d1f61a_418 Isocitrate lyase {Mycobacterium tuberculosis [TaxI 100.0
d2r5ea1418 Kynurenine--oxoglutarate transaminase I {Yellowfev 100.0
d1w7la_418 Kynurenine--oxoglutarate transaminase I {Human (Ho 100.0
d1pv7a_417 Lactose permease {Escherichia coli [TaxId: 562]} 100.0
d3bona1417 Botulinum neurotoxin {Clostridium botulinum, serot 100.0
d1q7ea_417 Hypothetical protein YfdW {Escherichia coli [TaxId 100.0
d1w6ga1417 Copper amine oxidase, domain 3 {Arthrobacter globi 100.0
d1ltka_417 Phosphoglycerate kinase {Malaria parasite (Plasmod 100.0
d2csga1417 Hypothetical protein YbiU {Salmonella typhimurium 100.0
d1gff1_417 Microvirus capsid proteins {Bacteriophage G4 [TaxI 100.0
d1vema2417 Bacterial beta-amylase {Bacillus cereus [TaxId: 13 100.0
d1q2oa_416 Nitric oxide (NO) synthase oxygenase domain {Cow ( 100.0
d1dfoa_416 Serine hydroxymethyltransferase {Escherichia coli 100.0
d1d8wa_416 L-rhamnose isomerase {Escherichia coli [TaxId: 562 100.0
d1igwa_416 Isocitrate lyase {Escherichia coli [TaxId: 562]} 100.0
d2vnud4416 Exosome complex exonuclease RRP44 {Saccharomyces c 100.0
d1pb1a_416 Isocitrate dehydrogenase, ICDH {Escherichia coli [ 100.0
d1dnva_415 Densovirus capsid protein {Galleria mellonella den 100.0
d1so2a_415 cGMP-inhibited 3',5'-cyclic phosphodiesterase B, p 100.0
d16pka_415 Phosphoglycerate kinase {Trypanosoma brucei [TaxId 100.0
d2ieaa2415 Pyruvate dehydrogenase E1 component, PP module {Es 100.0
d1qpga_415 Phosphoglycerate kinase {Baker's yeast (Saccharomy 100.0
d2qeec1415 Uncharacterized protein BH0493 {Bacillus haloduran 100.0
d1s5ja2415 Family B DNA polymerase {Sulfolobus solfataricus [ 100.0
d1kbia1414 Flavocytochrome b2, C-terminal domain {Baker's yea 100.0
d2b8na1414 Putative glycerate kinase (hypothetical protein TM 100.0
d1o20a_414 Gamma-glutamyl phosphate reductase {Thermotoga mar 100.0
d1t0la_414 NADP-dependent isocitrate dehydrogenase {Human (Ho 100.0
d1vh4a_413 Stabilizer of iron transporter SufD {Escherichia c 100.0
d1t5la1413 Nucleotide excision repair enzyme UvrB {Bacillus c 100.0
d1hdia_413 Phosphoglycerate kinase {Pig (Sus scrofa) [TaxId: 100.0
d2qgma1413 Succinoglycan biosynthesis protein BC3205 {Bacillu 100.0
d1lwda_413 NADP-dependent isocitrate dehydrogenase {Pig (Sus 100.0
d1zjca1413 Aminopeptidase S, AMPS {Staphylococcus aureus [Tax 100.0
d1ulva1413 Glucodextranase, domain A {Arthrobacter globiformi 100.0
d1a0tp_413 Sucrose-specific porin {Enterobacterium (Salmonell 100.0
d1ocka_412 Malonamidase E2 {Bradyrhizobium japonicum [TaxId: 100.0
d1yzya1412 Hypothetical protein HI1011 {Haemophilus influenza 100.0
d1yaaa_412 Aspartate aminotransferase, AAT {Baker's yeast (Sa 100.0
d1rxxa_412 Arginine deiminase {Pseudomonas aeruginosa [TaxId: 100.0
d1ajsa_412 Aspartate aminotransferase, AAT {Pig (Sus scrofa), 100.0
d1bw0a_412 Tyrosine aminotransferase (TAT) {Trypanosoma cruzi 100.0
d1ufaa2412 Hypothetical protein TT1467, N-terminal domain {Th 100.0
d2afaa1411 Putative NAG isomerase YihS {Salmonella typhimuriu 100.0
d1t3ca_411 Botulinum neurotoxin {Clostridium botulinum, serot 100.0
d1ux5a_411 Bni1 {Baker's yeast (Saccharomyces cerevisiae) [Ta 100.0
d1izoa_411 Cytochrome p450 152a1 (Bs-beta) {Bacillus subtilis 100.0
d2ccaa1410 Catalase-peroxidase KatG {Mycobacterium tuberculos 100.0
d1p1ja1410 Myo-inositol 1-phosphate synthase {Baker's yeast ( 100.0
d1kfsa2410 DNA polymerase I (Klenow fragment) {Escherichia co 100.0
d1uuqa_410 Exomannosidase {Cellvibrio mixtus [TaxId: 39650]} 100.0
d1s5ja1410 Exonuclease domain of family B DNA polymerases {Su 100.0
d2cmza1409 Spike glycoprotein {Vesicular stomatitis indiana v 100.0
d1tv5a1409 Dihydroorotate dehydrogenase {Plasmodium falciparu 100.0
d2g0da1409 Nisin biosynthesis protein NisC {Lactococcus lacti 100.0
d1qtma2409 DNA polymerase I (Klenow fragment) {Thermus aquati 100.0
d1b25a1409 Formaldehyde ferredoxin oxidoreductase {Archaeon P 100.0
d1s9ra_409 Arginine deiminase {Mycoplasma arginini [TaxId: 20 100.0
g1wht.1409 Serine carboxypeptidase II {Wheat (Triticum vulgar 100.0
d1dkla_409 Phytase (myo-inositol-hexakisphosphate-3-phosphohy 100.0
d1wzaa2409 Bacterial alpha-amylase {Halothermothrix orenii [T 100.0
d1r76a_408 Polygalacturonic acid lyase (pectate lyase) {Azosp 100.0
d1c4oa1408 Nucleotide excision repair enzyme UvrB {Thermus th 100.0
d1f1oa_408 Adenylosuccinate lyase {Bacillus subtilis [TaxId: 100.0
d1n11a_408 Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} 100.0
d2hhva2408 DNA polymerase I (Klenow fragment) {Bacillus stear 100.0
d1t3ia_408 Probable cysteine desulfurase SufS {Synechocystis 100.0
d1h4pa_408 Exo-beta-(1,3)-glucanase {Baker's yeast (Saccharom 100.0
d1qs0a_407 2-oxoisovalerate dehydrogenase (E1B), PP module {P 100.0
d1eu8a_407 D-maltodextrin-binding protein, MBP {Archaeon Ther 100.0
d1qhoa4407 Cyclodextrin glycosyltransferase {Bacillus stearot 100.0
d1itka1406 Catalase-peroxidase KatG {Archaeon Haloarcula mari 100.0
d1mwva1406 Catalase-peroxidase KatG {Burkholderia pseudomalle 100.0
d1u2za_406 Catalytic, N-terminal domain of histone methyltran 100.0
d1ub2a1406 Catalase-peroxidase KatG {Synechococcus sp. pcc 79 100.0
d1ei6a_406 Phosphonoacetate hydrolase {Pseudomonas fluorescen 100.0
d2ayia1406 Aminopeptidase T {Thermus thermophilus [TaxId: 274 100.0
d3bmva4406 Cyclodextrin glycosyltransferase {Thermoanaerobact 100.0
d1kl1a_405 Serine hydroxymethyltransferase {Bacillus stearoth 100.0
d2nwwa1405 Proton glutamate symport protein {Pyrococcus horik 100.0
d1h6za3405 Pyruvate phosphate dikinase, N-terminal domain {Tr 100.0
d1jf9a_405 NifS-like protein/selenocysteine lyase {Escherichi 100.0
d1lnsa3405 X-Prolyl dipeptidyl aminopeptidase PepX, middle do 100.0
d1z7da1404 Ornithine aminotransferase {Plasmodium yoelii yoel 100.0
d1uyra2404 Acetyl-coenzyme A carboxylase {Baker's yeast (Sacc 100.0
d1qz9a_404 Kynureninase {Pseudomonas fluorescens [TaxId: 294] 100.0
d1re9a_404 Cytochrome P450-CAM {Pseudomonas putida [TaxId: 30 100.0
d2byla1404 Ornithine aminotransferase {Human (Homo sapiens) [ 100.0
d2b5dx2404 Alpha-amylase AmyC {Thermotoga maritima [TaxId: 23 100.0
d1h12a_404 Endo-1,4-beta-xylanase {Pseudoalteromonas haloplan 100.0
d1hx0a2403 Animal alpha-amylase {Pig (Sus scrofa) [TaxId: 982 100.0
d1ueda_403 p450 monoxygenase OxyC {Amycolatopsis orientalis [ 100.0
d1xksa_403 Nuclear pore complex protein Nup133 {Human (Homo s 100.0
d1wsta1403 Multiple substrate aminotransferase, MSAT {Thermoc 100.0
d1gwia_403 Cyp154c1 monooxygenase {Streptomyces coelicolor [T 100.0
d3b55a1403 Succinoglycan biosynthesis protein BC3120 {Bacillu 100.0
d2g5da1402 Membrane-bound lytic murein transglycosylase A, ML 100.0
d1xk7a1402 Crotonobetainyl-CoA:carnitine CoA-transferase, Cai 100.0
d1z8oa1402 Cytochrome P450-ERYF {Saccharopolyspora erythraea 100.0
d1dofa_402 Adenylosuccinate lyase {Archaeon Pyrobaculum aerop 100.0
d1fp3a_402 N-acyl-D-glucosamine 2-epimerase {Pig (Sus scrofa) 100.0
g1w2w.1402 Putative methylthioribose-1-phosphate isomerase Yp 100.0
d1p9ra_401 Extracellular secretion NTPase EpsE {Vibrio choler 100.0
d1iira_401 UDP-glucosyltransferase GtfB {Amycolatopsis orient 100.0
d1rrva_401 TDP-vancosaminyltransferase GftD {Amycolatopsis or 100.0
d1fc4a_401 2-amino-3-ketobutyrate CoA ligase {Escherichia col 100.0
d1q5da_401 Cytochrome P450epok {Sorangium cellulosum [TaxId: 100.0
d2h6fb1401 Protein farnesyltransferase, beta-subunit {Human ( 100.0
d1a12a_401 Regulator of chromosome condensation RCC1 {Human ( 100.0
d7aata_401 Aspartate aminotransferase, AAT {Chicken (Gallus g 100.0
d1jdpa_401 Hormone binding domain of the atrial natriuretic p 100.0
d2r7da2401 Ribonuclease II family protein DR0020 {Deinococcus 100.0
d1odoa_401 Cyp154a1 monooxygenase {Streptomyces coelicolor [T 100.0
d1tq4a_400 Interferon-inducible GTPase {Mouse (Mus musculus) 100.0
d1ru4a_400 Pectate transeliminase {Erwinia chrysanthemi [TaxI 100.0
d3ovwa_400 Cellobiohydrolase I (cellulase, Endoglucanase I, C 100.0
d1inpa_400 Inositol polyphosphate 1-phosphatase {Cow (Bos tau 100.0
d2olua2400 Penicillin-binding protein 2, PBP2 {Staphylococcus 100.0
d1eh9a3400 Glycosyltrehalose trehalohydrolase, central domain 100.0
d1oyaa_399 Old yellow enzyme (OYE) {Lager yeast (Saccharomyce 100.0
d1jfba_399 Cytochrome P450-NOR, nitric reductase {Fungus (Fus 100.0
d1s1fa_399 Cyp158a2 {Streptomyces coelicolor [TaxId: 1902]} 100.0
d1bn8a_399 Pectate lyase {Bacillus subtilis [TaxId: 1423]} 100.0
d2ah2a2399 Trypanosoma sialidase {Parasitic flagellate protoz 100.0
d1ojja_399 Cellobiohydrolase I (cellulase, Endoglucanase I, C 100.0
d1vpea_398 Phosphoglycerate kinase {Thermotoga maritima [TaxI 100.0
d1qgna_398 Cystathionine gamma-synthase, CGS {Common tobacco 100.0
d1vlja_398 NADH-dependent butanol dehydrogenase A (TM0820) {T 100.0
d1y4ia1397 Methionine gamma-lyase, MGL {Citrobacter freundii 100.0
d1q1la_397 Chorismate synthase, AroC {Aquifex aeolicus [TaxId 100.0
d1vkoa1397 Myo-inositol 1-phosphate synthase {Caenorhabditis 100.0
d3tata_397 Aromatic aminoacid aminotransferase, AroAT {Escher 100.0
d1vjva_397 Ubiquitin carboxyl-terminal hydrolase 6 {Baker's y 100.0
d1lf6a1397 Bacterial glucoamylase, C-terminal domain {Thermoa 100.0
d2bwna1396 5-aminolevulinate synthase {Rhodobacter capsulatus 100.0
d1m7xa3396 1,4-alpha-glucan branching enzyme, central domain 100.0
d2q7wa1396 Aspartate aminotransferase, AAT {Escherichia coli 100.0
d1io1a_395 Phase 1 flagellin {Salmonella typhimurium [TaxId: 100.0
g1f8v.1395 Alphanodavirus capsid protein {Pariacoto virus [Ta 100.0
d2bfda1395 Branched-chain alpha-keto acid dehydrogenase, PP m 100.0
d2py6a1395 Methyltransferase FkbM {Methylobacillus flagellatu 100.0
d1nw1a_395 Choline kinase {Caenorhabditis elegans [TaxId: 623 100.0
d1aora1395 Aldehyde ferredoxin oxidoreductase {Archaeon Pyroc 100.0
d1xi9a_395 Putative alanine aminotransferase {Pyrococcus furi 100.0
d1w36b2395 Exodeoxyribonuclease V beta chain (RecB), N-termin 100.0
d1n40a_395 Cyp121 monooxygenase (P450 Mt2) {Mycobacterium tub 100.0
d1e5ea_394 Methionine gamma-lyase, MGL {Trichomonas vaginalis 100.0
d1phpa_394 Phosphoglycerate kinase {Bacillus stearothermophil 100.0
d1u1ha1394 5-methyltetrahydropteroyltriglutamate--homocystein 100.0
d1qo7a_394 Bacterial epoxide hydrolase {Aspergillus niger [Ta 100.0
d2ay1a_394 Aromatic aminoacid aminotransferase, AroAT {Paraco 100.0
d1c7na_394 Cystalysin {Treponema denticola [TaxId: 158]} 100.0
d1lfka_394 p450 monoxygenase OxyB {Amycolatopsis orientalis [ 100.0
d2pb1a1394 Exo-beta-(1,3)-glucanase {Yeast (Candida albicans) 100.0
d1atia2394 Glycyl-tRNA synthetase (GlyRS) {Thermus thermophil 100.0
d2d3na2394 Bacterial alpha-amylase {Bacillus sp. 707 [TaxId: 100.0
d1q8ia2394 Family B DNA polymerase {Escherichia coli [TaxId: 100.0
d1ldja2394 Cullin homolog 1, Cul-1 {Human (Homo sapiens) [Tax 100.0
d1n8pa_393 Cystathionine gamma-lyase (CYS3) {Baker's yeast (S 100.0
d1xlma_393 D-xylose isomerase {Arthrobacter, strain b3728 [Ta 100.0
d1kwga2393 A4 beta-galactosidase {Thermus thermophilus [TaxId 100.0
d1sq9a_393 Antiviral protein Ski8 (Ski8p) {Baker's yeast (Sac 100.0
d1g8ma2393 AICAR transformylase domain of bifunctional purine 100.0
d1i24a_393 Sulfolipid biosynthesis protein SQD1 {Thale cress 100.0
d1e43a2393 Bacterial alpha-amylase {Chimera (Bacillus amyloli 100.0
d1hvxa2393 Bacterial alpha-amylase {Bacillus stearothermophil 100.0
d1gc0a_392 Methionine gamma-lyase, MGL {Pseudomonas putida [T 100.0
d2d0ta1392 Indoleamine 2,3-dioxygenase {Human (Homo sapiens) 100.0
d1xima_392 D-xylose isomerase {Actinoplanes missouriensis [Ta 100.0
d2pula1392 Methylthioribose kinase MtnK {Bacillus subtilis [T 100.0
d1yvua2392 Argonaute homologue Aq_1447 {Aquifex aeolicus [Tax 100.0
d1cl1a_391 Cystathionine beta-lyase, CBL {Escherichia coli [T 100.0
d1pn3a_391 TDP-epi-vancosaminyltransferase GtfA {Amycolatopsi 100.0
d1nt4a_391 Glucose-1-phosphatase {Escherichia coli [TaxId: 56 100.0
d1gpea1391 Glucose oxidase {Penicillium amagasakiense [TaxId: 100.0
d1p3wa_391 Cysteine desulfurase IscS {Escherichia coli [TaxId 100.0
d1lwha2391 4-alpha-glucanotransferase {Thermotoga maritima [T 100.0
d4ubpc2390 alpha-subunit of urease, catalytic domain {Bacillu 100.0
d1v6sa_390 Phosphoglycerate kinase {Thermus thermophilus [Tax 100.0
d1nsca_390 Influenza neuraminidase {Influenza B virus, differ 100.0
d1qopb_390 Tryptophan synthase, beta-subunit {Salmonella typh 100.0
d1oj7a_390 Hypothetical oxidoreductase yqhD {Escherichia coli 100.0
d1ud2a2390 Bacterial alpha-amylase {Bacillus sp., ksm-k38 [Ta 100.0
d1jiha2389 DNA polymerase eta {Baker's yeast (Saccharomyces c 100.0
d1sg6a_389 Dehydroquinate synthase, DHQS {Aspergillus nidulan 100.0
d2gb3a1389 AAT homologue TM1698 {Thermotoga maritima [TaxId: 100.0
d1e9yb2389 alpha-subunit of urease, catalytic domain {Helicob 100.0
d2o3ia1389 Hypothetical protein CV3147 {Chromobacterium viola 100.0
d1f8ea_388 Influenza neuraminidase {Influenza A virus, differ 100.0
d1u7la_388 Vacuolar ATP synthase subunit C {Baker's yeast (Sa 100.0
d1w3ba_388 O-GlcNAc transferase p110 subunit, OGT {Human (Hom 100.0
d1qxoa_388 Chorismate synthase, AroC {Streptococcus pneumonia 100.0
d2ch1a1388 3-hydroxykynurenine transaminase {Malaria mosquito 100.0
d1eepa_388 Inosine monophosphate dehydrogenase (IMPDH) {Lyme 100.0
d2dcfa1388 6-aminohexanoate-dimer hydrolase NylC {Flavobacter 100.0
d2py5a2388 phi29 DNA polymerase {Bacteriophage phi-29 [TaxId: 100.0
d1q8ia1388 Exonuclease domain of family B DNA polymerases {Es 100.0
d1h0ca_388 Alanine-glyoxylate aminotransferase {Human (Homo s 100.0
d1gdea_388 Aromatic aminoacid aminotransferase, AroAT {Archae 100.0
d1erja_388 Tup1, C-terminal domain {Baker's yeast (Saccharomy 100.0
d1j32a_388 Aspartate aminotransferase, AAT {Phormidium lapide 100.0
d1ku0a_388 Lipase L1 {Bacillus stearothermophilus [TaxId: 142 100.0
d1x38a1388 Beta-D-glucan exohydrolase, N-terminal domain {Bar 100.0
d1zeea1387 Hypothetical protein SO4414 {Shewanella oneidensis 100.0
d2aepa1387 Influenza neuraminidase {Influenza A virus, differ 100.0
d1qvra2387 ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 100.0
d1bxba_387 D-xylose isomerase {Thermus aquaticus, subsp. Ther 100.0
d1zsqa2387 Myotubularin-related protein 2, C-terminal domain 100.0
d1vefa1387 Acetylornithine/acetyl-lysine aminotransferase Arg 100.0
d2qp8a1387 beta-secretase (memapsin) {Human (Homo sapiens) [T 100.0
d1k3ia3387 Galactose oxidase, central domain {Fungi (Fusarium 100.0
d1ur4a_387 Beta-1,4-galactanase {Bacillus licheniformis [TaxI 100.0
d2ex0a1387 Alpha-2,3/2,6-sialyltransferase/sialidase {Pasteur 100.0
d1v8za1386 Tryptophan synthase, beta-subunit {Archaeon Pyroco 100.0
d1r6ta2386 Tryptophanyl-tRNA synthetase (TrpRS) {Human (Homo 100.0
d1muwa_386 D-xylose isomerase {Streptomyces olivochromogenes 100.0
d3c10a1386 Histone deacetylase 7, HDAC7 {Human (Homo sapiens) 100.0
d1v5da_386 Chitosanase {Bacillus sp., strain k17 [TaxId: 1409 100.0
d1rrma_385 Lactaldehyde reductase FucO {Escherichia coli [Tax 100.0
d1xmxa_385 Hypothetical protein VC1899 {Vibrio cholerae [TaxI 100.0
d1uhga_385 Ovalbumin {Hen (Gallus gallus) [TaxId: 9031]} 100.0
d1ir6a_385 Exonuclease RecJ {Thermus thermophilus [TaxId: 274 100.0
d1ejxc2385 alpha-subunit of urease, catalytic domain {Klebsie 100.0
d1cf3a1385 Glucose oxidase {Aspergillus niger [TaxId: 5061]} 100.0
d1n97a_385 Cyp175a1 {Thermus thermophilus [TaxId: 274]} 100.0
d2c5wb1385 Penicillin-binding protein 1a, transpeptidase doma 100.0
d2ix0a4385 Exoribonuclease 2, RNB {Escherichia coli [TaxId: 5 100.0
d2b9va2385 Alpha-amino acid ester hydrolase {Acetobacter past 100.0
d1cs1a_384 Cystathionine gamma-synthase, CGS {Escherichia col 100.0
d3c0na2384 (Pro)aerolysin, pore-forming lobe {Aeromonas hydro 100.0
d1mtyb_384 Methane monooxygenase hydrolase beta subunit {Meth 100.0
d1b9ha_384 3-amino-5-hydroxybenzoic acid synthase (AHBA synth 100.0
d1hn0a1384 Chondroitin ABC lyase I {Proteus vulgaris [TaxId: 100.0
d2fvka2384 Dihydropyrimidine amidohydrolase Pyd2 {Yeast (Sacc 100.0
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 100.0
d1bs0a_383 PLP-dependent acyl-CoA synthase (8-amino-7-oxonano 100.0
d1vz6a_383 Glutamate N-acetyltransferase 2 (ornithine acetylt 100.0
d1mhyb_383 Methane monooxygenase hydrolase beta subunit {Meth 100.0
d1u7ga_383 Ammonium transporter AmtB {Escherichia coli [TaxId 100.0
d1bo1a_383 Phosphatidylinositol phosphate kinase IIbeta, PIPK 100.0
d2v5za1383 Monoamine oxidase B {Human (Homo sapiens) [TaxId: 100.0
d1imva_383 Pigment epithelium-derived factor, PEDF {Human (Ho 100.0
d2ayna1383 Ubiquitin carboxyl-terminal hydrolase 14 {Human (H 100.0
d1gy8a_383 Uridine diphosphogalactose-4-epimerase (UDP-galact 100.0
d1ea9c3382 Maltogenic amylase, central domain {Bacillus sp., 100.0
d1u08a_382 Putative methionine aminotransferase YdbL {Escheri 100.0
d1wkva1382 O-acetylserine sulfhydrylase (Cysteine synthase) { 100.0
d1b5pa_382 Aspartate aminotransferase, AAT {Thermus thermophi 100.0
d2bkwa1382 Alanine-glyoxylate aminotransferase {Baker's yeast 100.0
d1t1ua1382 Choline O-acetyltransferase {Rat (Rattus norvegicu 100.0
d1xl7a1382 Peroxisomal carnitine O-octanoyltransferase, COT { 100.0
d1wzla3382 Maltogenic amylase, central domain {Thermoactinomy 100.0
d1j0ha3382 Neopullulanase, central domain {Bacillus stearothe 100.0
d3bvua3381 Golgi alpha-mannosidase II {Fruit fly (Drosophila 100.0
d1by7a_381 Plasminogen activator inhibitor-2 {Human (Homo sap 100.0
d1odza_381 Mannanase A, ManA {Pseudomonas cellulosa (Cellvibr 100.0
d2bo4a1381 Mannosylglycerate synthase, MGS {Rhodothermus mari 100.0
d1elua_381 Cystine C-S lyase C-des {Synechocystis sp. [TaxId: 100.0
d1xipa_381 Nucleoporin NUP159 {Baker's yeast (Saccharomyces c 100.0
d2guya2381 Fungal alpha-amylases {Aspergillus oryzae, Taka-am 100.0
d1mpxa2381 Alpha-amino acid ester hydrolase {Xanthomonas citr 100.0
d2aaaa2381 Fungal alpha-amylases {Aspergillus niger, acid amy 100.0
d1t6ex_381 Xylanase inhibitor TAXI-I {Wheat (Triticum aestivu 100.0
d1ibja_380 Cystathionine beta-lyase, CBL {Thale cress (Arabid 100.0
d1vbga3380 Pyruvate phosphate dikinase, N-terminal domain {Ma 100.0
d1q45a_380 12-oxophytodienoate reductase (OPR, OYE homolog) { 100.0
d2gmha1380 Electron transfer flavoprotein-ubiquinone oxidored 100.0
d1qyia_380 Hypothetical protein MW1667 (SA1546) {Staphylococc 100.0
d1edga_380 Endoglucanase CelA {Clostridium cellulolyticum [Ta 100.0
d1elja_380 D-maltodextrin-binding protein, MBP {Archaeon Pyro 100.0
d1lj5a_379 Plasminogen activator inhibitor-1 {Human (Homo sap 100.0
d2f5va1379 Pyranose 2-oxidase {White-rot fungus (Peniophora s 100.0
d3sila_379 Salmonella sialidase {Salmonella typhimurium, stra 100.0
d1jr1a1378 Inosine monophosphate dehydrogenase (IMPDH) {Chine 100.0
d2icya2378 UDP-glucose pyrophosphorylase 2 (UDPGP 2) {Thale c 100.0
d1xqga_378 Maspin {Human (Homo sapiens) [TaxId: 9606]} 100.0
d1jaea2378 Animal alpha-amylase {Yellow mealworm (Tenebrio mo 100.0
d1a59a_377 Citrate synthase {Antarctic bacterium DS2-3R [TaxI 100.0
d1vjoa_377 Alanine-glyoxylate aminotransferase {Cyanobacteria 100.0
d1o6ca_377 UDP-N-acetylglucosamine 2-epimerase {Bacillus subt 100.0
d2d5ja1377 Unsaturated glucuronyl hydrolase {Bacillus sp. GL1 100.0
d1k8qa_377 Gastric lipase {Dog (Canis familiaris) [TaxId: 961 100.0
d1ci9a_377 Esterase EstB {Burkholderia gladioli [TaxId: 28095 100.0
d2i71a1377 Hypothetical protein SSO1389 {Sulfolobus solfatari 100.0
d1jmma_377 V-region of surface antigen I/II (SA I/II, PAC) {S 100.0
d1nm8a1377 Carnitine acetyltransferase {Human (Homo sapiens) 100.0
d1mdoa_376 Aminotransferase ArnB {Salmonella typhimurium [Tax 100.0
d2vata1376 Acetyl-CoA:deacetylcephalosporin C acetyltransfera 100.0
d1f6da_376 UDP-N-acetylglucosamine 2-epimerase {Escherichia c 100.0
d1k9oi_376 Alaserpin (serpin 1) {Tobacco hornworm (Manduca se 100.0
d2v3qa1376 PstS-like phosphate-binding protein {Human (Homo s 100.0
d1eg5a_376 NifS-like protein/selenocysteine lyase {Thermotoga 100.0
d1wu4a1376 Xylanase Y {Bacillus halodurans [TaxId: 86665]} 100.0
d1bhea_376 Polygalacturonase {Erwinia carotovora, subsp. caro 100.0
d2fug41375 NADH-quinone oxidoreductase chain 4, Nqo4 {Thermus 100.0
d2dula1375 N(2),N(2)-dimethylguanosine tRNA methyltransferase 100.0
d1o4sa_375 Aspartate aminotransferase, AAT {Thermotoga mariti 100.0
d1ih7a1375 Exonuclease domain of family B DNA polymerases {Ba 100.0
g1hle.1375 Elastase inhibitor {Horse (Equus caballus) [TaxId: 100.0
d1kbla3375 Pyruvate phosphate dikinase, N-terminal domain {Cl 100.0
d1txka2374 Glucans biosynthesis protein G (MdoG, OpgG), N-ter 100.0
d1ioma_374 Citrate synthase {Thermus thermophilus [TaxId: 274 100.0
d1gwja_374 Morphinone reductase {Pseudomonas putida [TaxId: 3 100.0
d2a0ua1374 Initiation factor 2b {Leishmania major [TaxId: 566 100.0
d1nd7a_374 WW domain-containing protein 1, WWP1 {Human (Homo 100.0
d1o69a_374 Aminotransferase homolog WlaK (PglE, Cj1121c) {Cam 100.0
d1rp4a_374 Endoplasmic oxidoreductin 1, Ero1p {Baker's yeast 100.0
d2bvca2374 Glutamine synthetase, C-terminal domain {Mycobacte 100.0
d1so7a_374 Sialidase 2 (Neu2) {Human (Homo sapiens) [TaxId: 9 100.0
d1kfwa1374 Psychrophilic chitinase B {Arthrobacter sp., tad20 100.0
d1seza1373 Protoporphyrinogen oxidase {Tobacco (Nicotiana tab 100.0
d1v4va_373 UDP-N-acetylglucosamine 2-epimerase {Thermus therm 100.0
d2madh_373 Methylamine dehydrogenase, H-chain {Gram negative 100.0
d1ogmx2373 Dextranase, catalytic domain {Penicillium miniolut 100.0
d1miqa_373 Plasmepsin (a hemoglobin-degrading enzyme) {Plasmo 100.0
d1qo0a_373 Amide receptor/negative regulator of the amidase o 100.0
d1m0wa2373 Eukaryotic glutathione synthetase ATP-binding doma 100.0
d1r5ya_372 Queosine tRNA-guanine transglycosylase {Zymomonas 100.0
d1c3pa_372 HDAC homologue {Aquifex aeolicus [TaxId: 63363]} 100.0
d1noya_372 Exonuclease domain of family B DNA polymerases {Ba 100.0
d1qlpa_372 Antitrypsin, alpha-1 {Human (Homo sapiens) [TaxId: 100.0
d1j58a_372 Oxalate decarboxylase OxdC (YvrK) {Bacillus subtil 100.0
d1vkpa_372 Agmatine iminohydrolase {Thale-cress (Arabidopsis 100.0
d1teda_372 Polyketide synthase PKS18 {Mycobacterium tuberculo 100.0
g1htr.1372 Pepsin(ogen) {Human (Homo sapiens), progastricsin 100.0
d1mkfa_371 Viral chemokine binding protein m3 {Murid herpesvi 100.0
d1r53a_371 Chorismate synthase, AroC {Baker's yeast (Saccharo 100.0
d1n7oa1371 Hyaluronate lyase {Streptococcus pneumoniae [TaxId 100.0
d1aj8a_371 Citrate synthase {Archaeon Pyrococcus furiosus [Ta 100.0
d1to6a_371 Glycerate kinase GlxK {Neisseria meningitidis, (se 100.0
d1c8ba_371 Germination protease {Bacillus megaterium [TaxId: 100.0
d1f1sa1371 Hyaluronate lyase {Streptococcus agalactiae [TaxId 100.0
d1eg1a_371 Cellobiohydrolase I (cellulase, Endoglucanase I, C 100.0
d1r85a_371 Xylanase {Bacillus stearothermophilus, Xt6 [TaxId: 100.0
d1k8kc_371 Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taur 100.0
d2fnua1371 Spore coat polysaccharide biosynthesis protein C { 100.0
d2dexx3370 Peptidylarginine deiminase Pad4, catalytic C-termi 100.0
d2gx8a1370 Nif3-related protein BC4286 {Bacillus cereus [TaxI 100.0
d2iw1a1370 Lipopolysaccharide core biosynthesis protein RfaG 100.0
d2hgsa4370 Eukaryotic glutathione synthetase ATP-binding doma 100.0
d2iida1370 L-aminoacid oxidase {Malayan pit viper (Calloselas 100.0
d3psga_370 Pepsin(ogen) {Pig (Sus scrofa) [TaxId: 9823]} 100.0
d1iq0a2370 Arginyl-tRNA synthetase (ArgRS) {Thermus thermophi 100.0
d3coxa1370 Cholesterol oxidase of GMC family {Brevibacterium 100.0
d1rh9a1370 Beta-mannanase {Tomato (Lycopersicon esculentum) [ 100.0
d1itua_369 Renal dipeptidase {Human (Homo sapiens) [TaxId: 96 100.0
d1rwha1369 Chondroitinase AC {Arthrobacter aurescens [TaxId: 100.0
d2heka1369 Hypothetical protein aq_1910 {Aquifex aeolicus [Ta 100.0
d2ewoa1369 Agmatine iminohydrolase {Streptococcus mutans [Tax 100.0
g1ii8.1369 Rad50 {Archaeon Pyrococcus furiosus [TaxId: 2261]} 100.0
g1as4.1369 Antichymotrypsin, alpha-1 {Human (Homo sapiens) [T 100.0
d1ga6a_369 Serine-carboxyl proteinase, SCP {Pseudomonas sp., 100.0
d1laxa_369 D-maltodextrin-binding protein, MBP {Escherichia c 100.0
d1e7ua4369 Phoshoinositide 3-kinase (PI3K), catalytic domain 100.0
d2cu0a1368 Inosine monophosphate dehydrogenase (IMPDH) {Pyroc 100.0
d1r8ga_368 Carboxylate-amine ligase YbdK {Escherichia coli [T 100.0
d2ncda_368 Kinesin motor Ncd (non-claret disjunctional) {Frui 100.0
d1mdah_368 Methylamine dehydrogenase, H-chain {Paracoccus den 100.0
d1f52a2368 Glutamine synthetase, C-terminal domain {Salmonell 100.0
d1v2da_368 Glutamine aminotransferase {Thermus thermophilus [ 100.0
d1pyya4368 Penicillin-binding protein 2x (pbp-2x), transpepti 100.0
d1o7xa_367 Citrate synthase {Archaeon Sulfolobus solfataricus 100.0
d1d3ga_367 Dihydroorotate dehydrogenase {Human (Homo sapiens) 100.0
d1b65a_367 L-aminopeptidase D-Ala-esterase/amidase DmpA {Ochr 100.0
d1iuqa_367 Glycerol-3-phosphate (1)-acyltransferase {Cushaw s 100.0
d1ue8a_367 Cyp119 {Archaeon Sulfolobus tokodaii [TaxId: 11195 100.0
d1ursa_367 D-maltodextrin-binding protein, MBP {Alicyclobacil 100.0
d1n4wa1367 Cholesterol oxidase of GMC family {Streptomyces sp 100.0
d1qw9a2367 Alpha-L-arabinofuranosidase, catalytic domain {Bac 100.0
d1hz4a_366 Transcription factor MalT domain III {Escherichia 100.0
d1moqa_366 "Isomerase domain" of glucosamine 6-phosphate synt 100.0
d1io7a_366 Cyp119 {Archaeon Sulfolobus solfataricus [TaxId: 2 100.0
d1h6za1366 Pyruvate phosphate dikinase, C-terminal domain {Tr 100.0
d2bvya2366 Mannanase A, ManA {Cellulomonas fimi [TaxId: 1708] 100.0
d1jq5a_366 Glycerol dehydrogenase {Bacillus stearothermophilu 100.0
d1u5ua_366 Allene oxide synthase-lipoxygenase protein, N-term 100.0
d2aeua1366 Hypothetical protein MJ0158 {Archaeon Methanococcu 100.0
d1fn9a_365 Outer capsid protein sigma 3 {Reovirus [TaxId: 108 100.0
d1um0a_365 Chorismate synthase, AroC {Helicobacter pylori [Ta 100.0
d2pnwa1365 Membrane-bound lytic murein transglycosylase A, ML 100.0
d1zkda1365 Hypothetical protein RPA4359 {Rhodopseudomonas pal 100.0
d1u1ha2365 5-methyltetrahydropteroyltriglutamate--homocystein 100.0
d1w85a_365 Pyruvate dehydrogenase E1-alpha, PdhA {Bacillus st 100.0
d3c8ya1365 Fe-only hydrogenase, catalytic domain {Clostridium 100.0
d1zfja1365 Inosine monophosphate dehydrogenase (IMPDH) {Strep 100.0
d1jofa_365 3-carboxy-cis,cis-mucoante lactonizing enzyme {Neu 100.0
d2jera1364 Agmatine iminohydrolase {Enterococcus faecalis [Ta 100.0
d1sdma_364 Kinesin heavy chain-like protein {Potato (Solanum 100.0
d1t64a_364 Histone deacetylase 8, HDAC8 {Human (Homo sapiens) 100.0
d1icpa_364 12-oxophytodienoate reductase (OPR, OYE homolog) { 100.0
d1um8a_364 ClpX {Helicobacter pylori [TaxId: 210]} 100.0
d1kbla1364 Pyruvate phosphate dikinase, C-terminal domain {Cl 100.0
d1omwa3364 G-protein coupled receptor kinase 2 {Cow (Bos taur 100.0
d1kq3a_364 Glycerol dehydrogenase {Thermotoga maritima [TaxId 100.0
d1oc7a_364 Cellobiohydrolase II (Cel6) {Humicola insolens, Ce 100.0
d1us3a2364 Xylanase 10c {Cellvibrio japonicus [TaxId: 155077] 100.0
d2e7ja1364 Selenocysteinyl-tRNA synthase (SepSecS) {Archaeogl 100.0
d1w0pa3364 Vibrio cholerae sialidase {Vibrio cholerae [TaxId: 100.0
d1m7va_363 Nitric oxide (NO) synthase oxygenase domain {Bacil 100.0
d1zaia1363 Fructose-1,6-bisphosphate aldolase {Rabbit (Orycto 100.0
d1khba1363 Cytosolic phosphoenolpyruvate carboxykinase (GTP-h 100.0
d1zq1a2363 Glutamyl-tRNA(Gln) amidotransferase subunit D, Gat 100.0
d2c5aa1363 GDP-mannose-3', 5'-epimerase {Thale cress (Arabido 100.0
d1onha_363 AMPC beta-Lactamase, class C {Enterobacter cloacae 100.0
d1vyra_363 Pentaerythritol tetranirate reductase {Enterobacte 100.0
d1nc5a_363 Hypothetical protein YteR {Bacillus subtilis [TaxI 100.0
d1cnza_363 3-isopropylmalate dehydrogenase, IPMDH {Salmonella 100.0
d1kwfa_363 CelA cellulase {Clostridium thermocellum [TaxId: 1 100.0
d2a1ha1363 Branched-chain aminoacid aminotransferase {Human ( 100.0
d1umga_362 ST0318 {Archaeon Sulfolobus tokodaii [TaxId: 11195 100.0
d1gqea_362 Polypeptide chain release factor 2 (RF2) {Escheric 100.0
d1umda_362 Branched-chain alpha-keto acid dehydrogenase, PP m 100.0
d3thia_362 Thiaminase I {Paenibacillus thiaminolyticus [TaxId 100.0
d2pl5a1362 Homoserine O-acetyltransferase {Leptospira interro 100.0
d1pvna1362 Inosine monophosphate dehydrogenase (IMPDH) {Tritr 100.0
d1v8ka_362 Kinesin {Mouse (Mus musculus), kif2c [TaxId: 10090 100.0
d1svma_362 Papillomavirus large T antigen helicase domain {Si 100.0
d2drwa1362 D-Amino acid amidase DaaA {Ochrobactrum anthropi [ 100.0
d1vlca_362 3-isopropylmalate dehydrogenase, IPMDH {Thermotoga 100.0
d1nqka_362 Alkanesulfonate monooxygenase SsuD {Escherichia co 100.0
d2gjxa1362 beta-hexosaminidase A {Human (Homo sapiens) [TaxId 100.0
d1q8ya_362 Sky1p {Baker's yeast (Saccharomyces cerevisiae) [T 100.0
d1qjwa_362 Cellobiohydrolase II (Cel6) {Trichoderma reesei, C 100.0
d2ozla1361 E1-beta subunit of pyruvate dehydrogenase (PP modu 100.0
d2c0ra1361 Phosphoserine aminotransferase, PSAT {Bacillus cir 100.0
d1dhsa_361 Deoxyhypusine synthase, DHS {Human (Homo sapiens) 100.0
d1x1ia1361 Xanthan lyase {Bacillus sp. gl1 [TaxId: 84635]} 100.0
d1m32a_361 2-aminoethylphosphonate transaminase {Salmonella t 100.0
d1lt7a_361 Betaine-homocysteine S-methyltransferase {Human (H 100.0
d1d2fa_361 Modulator in mal gene expression, MalY {Escherichi 100.0
d1rqga2361 Methionyl-tRNA synthetase (MetRS) {Pyrococcus abys 100.0
d1kewa_361 dTDP-glucose 4,6-dehydratase (RmlB) {Streptococcus 100.0
d1mxga2361 Bacterial alpha-amylase {Archaeon Pyrococcus woese 100.0
d1pe9a_361 Pectate lyase {Erwinia chrysanthemi, type A [TaxId 100.0
d1sq1a_360 Chorismate synthase, AroC {Campylobacter jejuni [T 100.0
d1qo5a_360 Fructose-1,6-bisphosphate aldolase {Human (Homo sa 100.0
d1bjna_360 Phosphoserine aminotransferase, PSAT {Escherichia 100.0
d1jdwa_360 L-arginine: glycine amidinotransferase {Human (Hom 100.0
d1w23a_360 Phosphoserine aminotransferase, PSAT {Bacillus alc 100.0
d1xfia_360 Hypothetical protein At2g17340 {Thale cress (Arabi 100.0
d1pn0a1360 Phenol hydroxylase {Soil-living yeast (Trichosporo 100.0
d1oxwa_360 Patatin {Heartleaf nightshade (Solanum cardiophyll 100.0
d1kdga1360 Flavoprotein domain of flavocytochrome cellobiose 100.0
d2jbwa1360 2,6-dihydropseudooxynicotine hydrolase {Arthrobact 100.0
d1k32a3360 Tricorn protease domain 2 {Archaeon Thermoplasma a 100.0
d4bcla_359 Bacteriochlorophyll A protein {Prosthecochloris ae 100.0
d1goxa_359 Glycolate oxidase {Spinach (Spinacia oleracea) [Ta 100.0
d1x74a1359 2-methylacyl-CoA racemase Mcr {Mycobacterium tuber 100.0
d1m6ex_359 Salicylic acid carboxyl methyltransferase (SAMT) { 100.0
d1w36d1359 Exodeoxyribonuclease V alpha chain (RecD) {Escheri 100.0
d1yvra1359 60-kda SS-aARo ribonucleoprotein {African clawed f 100.0
d2hrca1359 Ferrochelatase {Human (Homo sapiens) [TaxId: 9606] 100.0
d1qcxa_359 Pectin lyase {Aspergillus niger, type B [TaxId: 50 100.0
d1idka_359 Pectin lyase {Aspergillus niger, type A [TaxId: 50 100.0
d1o2da_359 Alcohol dehydrogenase TM0920 {Thermotoga maritima 100.0
d1m7ja3358 N-acyl-D-aminoacid amidohydrolase, catalytic domai 100.0
d2hdsa1358 AMPC beta-Lactamase, class C {Escherichia coli, ce 100.0
g1lq8.1358 Protein C inhibitor {Human (Homo sapiens) [TaxId: 100.0
d1jkma_358 Carboxylesterase {Bacillus subtilis, brefeldin A e 100.0
d1ecea_358 Endocellulase E1 {Acidothermus cellulolyticus [Tax 100.0
d1dosa_358 Fructose-bisphosphate aldolase (FBP aldolase) {Esc 100.0
d1uwva2358 rRNA (Uracil-5-)-methyltransferase RumA, catalytic 100.0
d1edqa2358 Chitinase A, catalytic domain {Serratia marcescens 100.0
d2qapa1357 Fructose-1,6-bisphosphate aldolase {Trypanosome (L 100.0
d1taza_357 Catalytic domain of cyclic nucleotide phosphodiest 100.0
d2b61a1357 Homoserine O-acetyltransferase {Haemophilus influe 100.0
d1a05a_357 3-isopropylmalate dehydrogenase, IPMDH {Thiobacill 100.0
d1t1ga_357 Serine-carboxyl proteinase, SCP {Bacillus novosp. 100.0
d2amxa1357 Adenosine deaminase (ADA) {Plasmodium yoelii [TaxI 100.0
d1yyda1357 Fungal peroxidase (ligninase) {Basidomycetos fungu 100.0
d1gcya2357 G4-amylase (1,4-alpha-D-glucan maltotetrahydrolase 100.0
d1mppa_357 Pepsin {Mucor pusillus [TaxId: 4840]} 100.0
d1g01a_357 Alkaline cellulase K catalytic domain {Bacillus sp 100.0
d1db3a_357 GDP-mannose 4,6-dehydratase {Escherichia coli [Tax 100.0
d16vpa_356 Conserved core of transcriptional regulatory prote 100.0
d1r3sa_356 Uroporphyrinogen decarboxylase, UROD {Human (Homo 100.0
d1w8oa3356 Micromonospora sialidase, N-terminal domain {Micro 100.0
d1rkxa_356 CDP-glucose-4,6-dehydratase {Yersinia pseudotuberc 100.0
d1lbqa_356 Ferrochelatase {Baker's yeast (Saccharomyces cerev 100.0
d1v53a1356 3-isopropylmalate dehydrogenase, IPMDH {Bacillus c 100.0
d1l0wa3356 Aspartyl-tRNA synthetase (AspRS) {Thermus thermoph 100.0
d1jnra2356 Adenylylsulfate reductase A subunit {Archaeon Arch 100.0
d2ebsa2356 Oligoxyloglucan reducing end-specific cellobiohydr 100.0
d1goia2356 Chitinase B, catalytic domain {Serratia marcescens 100.0
d1jaka1356 beta-N-acetylhexosaminidase {Streptomyces plicatus 100.0
d1vbga1356 Pyruvate phosphate dikinase, C-terminal domain {Ma 100.0
d3bu7a1355 Gentisate 1,2-dioxygenase {Silicibacter pomeroyi [ 100.0
d1fuia2355 L-fucose isomerase, N-terminal and second domains 100.0
d1luca_355 Bacterial luciferase alpha chain, LuxA {Vibrio har 100.0
d2bbkh_355 Methylamine dehydrogenase, H-chain {Paracoccus den 100.0
d2b1pa1355 c-jun N-terminal kinase (jnk3s) {Human (Homo sapie 100.0
d1jbqa_355 Cystathionine beta-synthase {Human (Homo sapiens) 100.0
g1mtp.1355 Thermopin {Thermobifida fusca [TaxId: 2021]} 100.0
d1nexb2355 Cdc4 propeller domain {Baker's yeast (Saccharomyce 100.0
d1iq8a1355 Archaeosine tRNA-guanine transglycosylase, N-termi 100.0
>d2bhua3 c.1.8.1 (A:111-530) Glycosyltrehalose trehalohydrolase, central domain {Deinococcus radiodurans [TaxId: 1299]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: TIM beta/alpha-barrel
superfamily: (Trans)glycosidases
family: Amylase, catalytic domain
domain: Glycosyltrehalose trehalohydrolase, central domain
species: Deinococcus radiodurans [TaxId: 1299]

Probab=100.00  E-value=0  Score=31718.02  Aligned_cols=1  Identities=0%  Similarity=-0.692  Sum_probs=0.0

Q ss_pred             C-------------------------------------------------------------------------------
Q ss_conf             9-------------------------------------------------------------------------------
Q 001615           76 G-------------------------------------------------------------------------------   76 (1044)
Q Consensus        76 g-------------------------------------------------------------------------------   76 (1044)
                      -                                                                               
T Consensus         1 ~~~w~~~~~~~~~~~~~viYe~~~~~f~~~Gd~~g~~~~ldyl~~LGv~~i~L~Pv~~~~~~~~~GY~~~d~~~vdp~~G   80 (420)
T d2bhua3           1 TFDWTDADWHGIKLADCVFYEVHVGTFTPEGTYRAAAEKLPYLKELGVTAIQVMPLAAFDGQRGWGYDGAAFYAPYAPYG   80 (420)
T ss_dssp             SSCCCCTTCCCCCGGGCCEEEECHHHHSSSCSHHHHHHTHHHHHHHTCCEEEECCCEECSSSCCCSTTCCEEEEECGGGC
T ss_pred             CCCCCCCCCCCCCCCCCEEEEEEHHHCCCCCCHHHHHHHHHHHHHCCCCEEEECCCCCCCCCCCCCCCCCCCCCCCCCCC
T ss_conf             96899989798884224899996002188999999998679999769998995998768888998888566888685659


Q ss_pred             --------------------------------------------------------------------------------
Q ss_conf             --------------------------------------------------------------------------------
Q 001615           77 --------------------------------------------------------------------------------   76 (1044)
Q Consensus        77 --------------------------------------------------------------------------------   76 (1044)
                                                                                                      
T Consensus        81 ~~~d~~~lv~~aH~~gi~VilD~V~NH~~~~~~~~~~~~~~~~~~~~~~~~~~dlN~~np~v~~~~~~~~~~Wl~~~GVD  160 (420)
T d2bhua3          81 RPEDLMALVDAAHRLGLGVFLDVVYNHFGPSGNYLSSYAPSYFTDRFSSAWGMGLDYAEPHMRRYVTGNARMWLRDYHFD  160 (420)
T ss_dssp             CHHHHHHHHHHHHHTTCEEEEEECCSCCCSSSCCHHHHCGGGEEEEEECSSSEEECTTSHHHHHHHHHHHHHHHHHHCCS
T ss_pred             CHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHEEEECCCCC
T ss_conf             99999999999974054534465535667777633334443334554322345545368699999988764032014653


Q ss_pred             --------------------------------------------------------------------------------
Q ss_conf             --------------------------------------------------------------------------------
Q 001615           77 --------------------------------------------------------------------------------   76 (1044)
Q Consensus        77 --------------------------------------------------------------------------------   76 (1044)
                                                                                                      
T Consensus       161 GfR~D~~~~l~~~~~~~~~~~~~~~~~~~~p~~~~i~E~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  240 (420)
T d2bhua3         161 GLRLDATPYMTDDSETHILTELAQEIHELGGTHLLLAEDHRNLPDLVTVNHLDGIWTDDFHHETRVTLTGEQEGYYAGYR  240 (420)
T ss_dssp             EEEETTGGGCCCCSSSCHHHHHHHHHHTTCSCCEEEEECSSCCTHHHHTTCCSEEECTHHHHHHHHHHHCCCSGGGGGCC
T ss_pred             EEEEEEEEEECCCCCCCCHHHHHHHHHHHCCCCEEEECCCCCCHHHHCCCCCCCCCCCCCCHHHHHCCCCCCCCCCCCCC
T ss_conf             78873333202122310079998888764687425620357753121001125422323210444301334445312330


Q ss_pred             --------------------------------------------------------------------------------
Q ss_conf             --------------------------------------------------------------------------------
Q 001615           77 --------------------------------------------------------------------------------   76 (1044)
Q Consensus        77 --------------------------------------------------------------------------------   76 (1044)
                                                                                                      
T Consensus       241 ~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~v~~~~nHD~~~~~~~~~r~~~~~~~~~~~~k~a~~~ll  320 (420)
T d2bhua3         241 GGAEALAYTIRRGWRYEGQFWAVKGEEHERGHPSDALEAPNFVYCIQNHDQIGNRPLGERLHQSDGVTLHEYRGAAALLL  320 (420)
T ss_dssp             CSHHHHHHHHHHSSSCEEEEECCTTCCEEEECCCTTCCGGGEEEESCCHHHHHTSTTCCCGGGSTTCCHHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHCCCCCCCHHHHHCHHHHHCCCCCCCCHHHEEEEECCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHH
T ss_conf             26678999985144446520443153554126433455213034321566323553112356643565999999999998


Q ss_pred             --------------------------------------------------------------------------------
Q ss_conf             --------------------------------------------------------------------------------
Q 001615           77 --------------------------------------------------------------------------------   76 (1044)
Q Consensus        77 --------------------------------------------------------------------------------   76 (1044)
                                                                                                      
T Consensus       321 t~pG~P~iy~GdEig~~~~~~~~~d~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~w~~~~~~~~~~~  400 (420)
T d2bhua3         321 TLPMTPLLFQGQEWAASTPFQFFSDHAGELGQAVSEGRKKEFGGFSGFSGEDVPDPQAEQTFLNSKLNWAEREGGEHART  400 (420)
T ss_dssp             HSSSEEEEETTGGGTCSSCCCCCCCCCHHHHHHHHHHHHHHC---------CCCCTTSHHHHHTTSCCSGGGGSHHHHHH
T ss_pred             HCCCCCEEECCHHHCCCCCCCCCCCCCCHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHCCCCCHHH
T ss_conf             48998798577511789986323456402203544466311367776665557886555544456678788623476899


Q ss_pred             -------------------C
Q ss_conf             -------------------9
Q 001615           77 -------------------G   77 (1044)
Q Consensus        77 -------------------~   77 (1044)
                                         +
T Consensus       401 ~~~yr~Li~lRk~~p~l~~~  420 (420)
T d2bhua3         401 LRLYRDLLRLRREDPVLHNR  420 (420)
T ss_dssp             HHHHHHHHHHHHHCTTTTCC
T ss_pred             HHHHHHHHHHHHCCHHHHCC
T ss_conf             99999999999568987575
>d1ejda_ d.68.2.2 (A:) UDP-N-acetylglucosamine enolpyruvyl transferase (EPT, MurA, MurZ) {Enterobacter cloacae [TaxId: 550]} Back     information, alignment and structure
>d2df7a1 b.121.4.9 (A:11-429) Birnavirus VP2 {Infectious bursal disease virus [TaxId: 10995]} Back     information, alignment and structure
>d1om4a_ d.174.1.1 (A:) Nitric oxide (NO) synthase oxygenase domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2gp4a2 d.334.1.1 (A:1-418) 6-phosphogluconate dehydratase EDD {Shewanella oneidensis [TaxId: 70863]} Back     information, alignment and structure
>d1f61a_ c.1.12.7 (A:) Isocitrate lyase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2r5ea1 c.67.1.1 (A:12-429) Kynurenine--oxoglutarate transaminase I {Yellowfever mosquito (Aedes aegypti) [TaxId: 7159]} Back     information, alignment and structure
>d1w7la_ c.67.1.1 (A:) Kynurenine--oxoglutarate transaminase I {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pv7a_ f.38.1.2 (A:) Lactose permease {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d3bona1 d.92.1.7 (A:3-419) Botulinum neurotoxin {Clostridium botulinum, serotype A [TaxId: 1491]} Back     information, alignment and structure
>d1q7ea_ c.123.1.1 (A:) Hypothetical protein YfdW {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1w6ga1 b.30.2.1 (A:212-628) Copper amine oxidase, domain 3 {Arthrobacter globiformis [TaxId: 1665]} Back     information, alignment and structure
>d1ltka_ c.86.1.1 (A:) Phosphoglycerate kinase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d2csga1 b.82.2.12 (A:3-419) Hypothetical protein YbiU {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1gff1_ b.121.5.1 (1:) Microvirus capsid proteins {Bacteriophage G4 [TaxId: 10843]} Back     information, alignment and structure
>d1vema2 c.1.8.1 (A:1-417) Bacterial beta-amylase {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d1q2oa_ d.174.1.1 (A:) Nitric oxide (NO) synthase oxygenase domain {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1dfoa_ c.67.1.4 (A:) Serine hydroxymethyltransferase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1d8wa_ c.1.15.2 (A:) L-rhamnose isomerase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1igwa_ c.1.12.7 (A:) Isocitrate lyase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2vnud4 b.40.4.16 (D:495-910) Exosome complex exonuclease RRP44 {Saccharomyces cerevisiae [TaxId: 4932]} Back     information, alignment and structure
>d1pb1a_ c.77.1.1 (A:) Isocitrate dehydrogenase, ICDH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1dnva_ b.121.5.3 (A:) Densovirus capsid protein {Galleria mellonella densovirus [TaxId: 37138]} Back     information, alignment and structure
>d1so2a_ a.211.1.2 (A:) cGMP-inhibited 3',5'-cyclic phosphodiesterase B, pde3b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d16pka_ c.86.1.1 (A:) Phosphoglycerate kinase {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d2ieaa2 c.36.1.10 (A:56-470) Pyruvate dehydrogenase E1 component, PP module {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1qpga_ c.86.1.1 (A:) Phosphoglycerate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2qeec1 c.1.9.8 (C:2-416) Uncharacterized protein BH0493 {Bacillus halodurans [TaxId: 86665]} Back     information, alignment and structure
>d1s5ja2 e.8.1.1 (A:450-864) Family B DNA polymerase {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1kbia1 c.1.4.1 (A:98-511) Flavocytochrome b2, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2b8na1 c.118.1.1 (A:4-417) Putative glycerate kinase (hypothetical protein TM1585) {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1o20a_ c.82.1.1 (A:) Gamma-glutamyl phosphate reductase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1t0la_ c.77.1.1 (A:) NADP-dependent isocitrate dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vh4a_ b.80.6.1 (A:) Stabilizer of iron transporter SufD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1t5la1 c.37.1.19 (A:2-414) Nucleotide excision repair enzyme UvrB {Bacillus caldotenax [TaxId: 1395]} Back     information, alignment and structure
>d1hdia_ c.86.1.1 (A:) Phosphoglycerate kinase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d2qgma1 c.150.1.3 (A:33-445) Succinoglycan biosynthesis protein BC3205 {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d1lwda_ c.77.1.1 (A:) NADP-dependent isocitrate dehydrogenase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1zjca1 e.60.1.1 (A:3-415) Aminopeptidase S, AMPS {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1ulva1 a.102.1.5 (A:274-686) Glucodextranase, domain A {Arthrobacter globiformis [TaxId: 1665]} Back     information, alignment and structure
>d1a0tp_ f.4.3.2 (P:) Sucrose-specific porin {Enterobacterium (Salmonella typhimurium) [TaxId: 90371]} Back     information, alignment and structure
>d1ocka_ c.117.1.1 (A:) Malonamidase E2 {Bradyrhizobium japonicum [TaxId: 375]} Back     information, alignment and structure
>d1yzya1 c.146.1.1 (A:1-412) Hypothetical protein HI1011 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1yaaa_ c.67.1.1 (A:) Aspartate aminotransferase, AAT {Baker's yeast (Saccharomyces cerevisiae), cytosolic form [TaxId: 4932]} Back     information, alignment and structure
>d1rxxa_ d.126.1.4 (A:) Arginine deiminase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1ajsa_ c.67.1.1 (A:) Aspartate aminotransferase, AAT {Pig (Sus scrofa), cytosolic form [TaxId: 9823]} Back     information, alignment and structure
>d1bw0a_ c.67.1.1 (A:) Tyrosine aminotransferase (TAT) {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d1ufaa2 c.6.2.4 (A:1-412) Hypothetical protein TT1467, N-terminal domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2afaa1 a.102.1.3 (A:4-415) Putative NAG isomerase YihS {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1t3ca_ d.92.1.7 (A:) Botulinum neurotoxin {Clostridium botulinum, serotype E [TaxId: 1491]} Back     information, alignment and structure
>d1ux5a_ a.207.1.1 (A:) Bni1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1izoa_ a.104.1.1 (A:) Cytochrome p450 152a1 (Bs-beta) {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2ccaa1 a.93.1.3 (A:26-435) Catalase-peroxidase KatG {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1p1ja1 c.2.1.3 (A:9-322,A:438-533) Myo-inositol 1-phosphate synthase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1kfsa2 e.8.1.1 (A:519-928) DNA polymerase I (Klenow fragment) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1uuqa_ c.1.8.3 (A:) Exomannosidase {Cellvibrio mixtus [TaxId: 39650]} Back     information, alignment and structure
>d1s5ja1 c.55.3.5 (A:40-449) Exonuclease domain of family B DNA polymerases {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d2cmza1 e.76.1.2 (A:1-409) Spike glycoprotein {Vesicular stomatitis indiana virus [TaxId: 11277]} Back     information, alignment and structure
>d1tv5a1 c.1.4.1 (A:158-566) Dihydroorotate dehydrogenase {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d2g0da1 a.102.6.1 (A:7-415) Nisin biosynthesis protein NisC {Lactococcus lactis [TaxId: 1358]} Back     information, alignment and structure
>d1qtma2 e.8.1.1 (A:423-831) DNA polymerase I (Klenow fragment) {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1b25a1 a.110.1.1 (A:211-619) Formaldehyde ferredoxin oxidoreductase {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1s9ra_ d.126.1.4 (A:) Arginine deiminase {Mycoplasma arginini [TaxId: 2094]} Back     information, alignment and structure
>d1dkla_ c.60.1.2 (A:) Phytase (myo-inositol-hexakisphosphate-3-phosphohydrolase) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1wzaa2 c.1.8.1 (A:28-436) Bacterial alpha-amylase {Halothermothrix orenii [TaxId: 31909]} Back     information, alignment and structure
>d1r76a_ a.102.5.1 (A:) Polygalacturonic acid lyase (pectate lyase) {Azospirillum irakense [TaxId: 34011]} Back     information, alignment and structure
>d1c4oa1 c.37.1.19 (A:2-409) Nucleotide excision repair enzyme UvrB {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1f1oa_ a.127.1.1 (A:) Adenylosuccinate lyase {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2hhva2 e.8.1.1 (A:469-876) DNA polymerase I (Klenow fragment) {Bacillus stearothermophilus, newly identified strain as yet unnamed [TaxId: 1422]} Back     information, alignment and structure
>d1t3ia_ c.67.1.3 (A:) Probable cysteine desulfurase SufS {Synechocystis sp. PCC 6803 [TaxId: 1148]} Back     information, alignment and structure
>d1h4pa_ c.1.8.3 (A:) Exo-beta-(1,3)-glucanase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1qs0a_ c.36.1.11 (A:) 2-oxoisovalerate dehydrogenase (E1B), PP module {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1eu8a_ c.94.1.1 (A:) D-maltodextrin-binding protein, MBP {Archaeon Thermococcus litoralis [TaxId: 2265]} Back     information, alignment and structure
>d1qhoa4 c.1.8.1 (A:1-407) Cyclodextrin glycosyltransferase {Bacillus stearothermophilus, maltogenic alpha-amylase [TaxId: 1422]} Back     information, alignment and structure
>d1itka1 a.93.1.3 (A:18-423) Catalase-peroxidase KatG {Archaeon Haloarcula marismortui [TaxId: 2238]} Back     information, alignment and structure
>d1mwva1 a.93.1.3 (A:35-440) Catalase-peroxidase KatG {Burkholderia pseudomallei [TaxId: 28450]} Back     information, alignment and structure
>d1u2za_ c.66.1.31 (A:) Catalytic, N-terminal domain of histone methyltransferase Dot1l {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ub2a1 a.93.1.3 (A:21-426) Catalase-peroxidase KatG {Synechococcus sp. pcc 7942 [TaxId: 1140]} Back     information, alignment and structure
>d1ei6a_ c.76.1.4 (A:) Phosphonoacetate hydrolase {Pseudomonas fluorescens [TaxId: 294]} Back     information, alignment and structure
>d2ayia1 e.60.1.1 (A:3-408) Aminopeptidase T {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d3bmva4 c.1.8.1 (A:1-406) Cyclodextrin glycosyltransferase {Thermoanaerobacterium [TaxId: 28895]} Back     information, alignment and structure
>d1kl1a_ c.67.1.4 (A:) Serine hydroxymethyltransferase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d2nwwa1 f.49.1.1 (A:12-416) Proton glutamate symport protein {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1h6za3 d.142.1.5 (A:1-405) Pyruvate phosphate dikinase, N-terminal domain {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1jf9a_ c.67.1.3 (A:) NifS-like protein/selenocysteine lyase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1lnsa3 c.69.1.21 (A:146-550) X-Prolyl dipeptidyl aminopeptidase PepX, middle domain {Lactococcus lactis [TaxId: 1358]} Back     information, alignment and structure
>d1z7da1 c.67.1.4 (A:7-410) Ornithine aminotransferase {Plasmodium yoelii yoelii [TaxId: 73239]} Back     information, alignment and structure
>d1uyra2 c.14.1.4 (A:1815-2218) Acetyl-coenzyme A carboxylase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1qz9a_ c.67.1.3 (A:) Kynureninase {Pseudomonas fluorescens [TaxId: 294]} Back     information, alignment and structure
>d1re9a_ a.104.1.1 (A:) Cytochrome P450-CAM {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d2byla1 c.67.1.4 (A:36-439) Ornithine aminotransferase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2b5dx2 c.6.2.4 (X:1-404) Alpha-amylase AmyC {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1h12a_ a.102.1.2 (A:) Endo-1,4-beta-xylanase {Pseudoalteromonas haloplanktis [TaxId: 228]} Back     information, alignment and structure
>d1hx0a2 c.1.8.1 (A:1-403) Animal alpha-amylase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1ueda_ a.104.1.1 (A:) p450 monoxygenase OxyC {Amycolatopsis orientalis [TaxId: 31958]} Back     information, alignment and structure
>d1xksa_ b.69.14.1 (A:) Nuclear pore complex protein Nup133 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wsta1 c.67.1.1 (A:13-415) Multiple substrate aminotransferase, MSAT {Thermococcus profundus [TaxId: 49899]} Back     information, alignment and structure
>d1gwia_ a.104.1.1 (A:) Cyp154c1 monooxygenase {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
>d3b55a1 c.150.1.3 (A:40-442) Succinoglycan biosynthesis protein BC3120 {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d2g5da1 b.52.1.4 (A:40-441) Membrane-bound lytic murein transglycosylase A, MLTA {Neisseria gonorrhoeae [TaxId: 485]} Back     information, alignment and structure
>d1xk7a1 c.123.1.1 (A:4-405) Crotonobetainyl-CoA:carnitine CoA-transferase, CaiB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1z8oa1 a.104.1.1 (A:3-404) Cytochrome P450-ERYF {Saccharopolyspora erythraea [TaxId: 1836]} Back     information, alignment and structure
>d1dofa_ a.127.1.1 (A:) Adenylosuccinate lyase {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d1fp3a_ a.102.1.3 (A:) N-acyl-D-glucosamine 2-epimerase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1p9ra_ c.37.1.11 (A:) Extracellular secretion NTPase EpsE {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1iira_ c.87.1.5 (A:) UDP-glucosyltransferase GtfB {Amycolatopsis orientalis [TaxId: 31958]} Back     information, alignment and structure
>d1rrva_ c.87.1.5 (A:) TDP-vancosaminyltransferase GftD {Amycolatopsis orientalis [TaxId: 31958]} Back     information, alignment and structure
>d1fc4a_ c.67.1.4 (A:) 2-amino-3-ketobutyrate CoA ligase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1q5da_ a.104.1.1 (A:) Cytochrome P450epok {Sorangium cellulosum [TaxId: 56]} Back     information, alignment and structure
>d2h6fb1 a.102.4.3 (B:521-921) Protein farnesyltransferase, beta-subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a12a_ b.69.5.1 (A:) Regulator of chromosome condensation RCC1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d7aata_ c.67.1.1 (A:) Aspartate aminotransferase, AAT {Chicken (Gallus gallus), mitochondria [TaxId: 9031]} Back     information, alignment and structure
>d1jdpa_ c.93.1.1 (A:) Hormone binding domain of the atrial natriuretic peptide receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2r7da2 b.40.4.16 (A:3-403) Ribonuclease II family protein DR0020 {Deinococcus radiodurans [TaxId: 1299]} Back     information, alignment and structure
>d1odoa_ a.104.1.1 (A:) Cyp154a1 monooxygenase {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
>d1tq4a_ c.37.1.8 (A:) Interferon-inducible GTPase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ru4a_ b.80.1.9 (A:) Pectate transeliminase {Erwinia chrysanthemi [TaxId: 556]} Back     information, alignment and structure
>d3ovwa_ b.29.1.10 (A:) Cellobiohydrolase I (cellulase, Endoglucanase I, CBH1) {Fusarium oxysporum [TaxId: 5507]} Back     information, alignment and structure
>d1inpa_ e.7.1.1 (A:) Inositol polyphosphate 1-phosphatase {Cow (Bos taurus), brain [TaxId: 9913]} Back     information, alignment and structure
>d2olua2 e.3.1.1 (A:293-692) Penicillin-binding protein 2, PBP2 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1eh9a3 c.1.8.1 (A:91-490) Glycosyltrehalose trehalohydrolase, central domain {Archaeon Sulfolobus solfataricus, km1 [TaxId: 2287]} Back     information, alignment and structure
>d1oyaa_ c.1.4.1 (A:) Old yellow enzyme (OYE) {Lager yeast (Saccharomyces pastorianus) [TaxId: 27292]} Back     information, alignment and structure
>d1jfba_ a.104.1.1 (A:) Cytochrome P450-NOR, nitric reductase {Fungus (Fusarium oxysporum) [TaxId: 5507]} Back     information, alignment and structure
>d1s1fa_ a.104.1.1 (A:) Cyp158a2 {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
>d1bn8a_ b.80.1.1 (A:) Pectate lyase {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2ah2a2 b.68.1.1 (A:1-399) Trypanosoma sialidase {Parasitic flagellate protozoan (Trypanosoma cruzi) [TaxId: 5693]} Back     information, alignment and structure
>d1vpea_ c.86.1.1 (A:) Phosphoglycerate kinase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1qgna_ c.67.1.3 (A:) Cystathionine gamma-synthase, CGS {Common tobacco (Nicotiana tabacum) [TaxId: 4097]} Back     information, alignment and structure
>d1vlja_ e.22.1.2 (A:) NADH-dependent butanol dehydrogenase A (TM0820) {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1y4ia1 c.67.1.3 (A:2-398) Methionine gamma-lyase, MGL {Citrobacter freundii [TaxId: 546]} Back     information, alignment and structure
>d1q1la_ d.258.1.1 (A:) Chorismate synthase, AroC {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1vkoa1 c.2.1.3 (A:11-314,A:429-521) Myo-inositol 1-phosphate synthase {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d3tata_ c.67.1.1 (A:) Aromatic aminoacid aminotransferase, AroAT {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1vjva_ d.3.1.9 (A:) Ubiquitin carboxyl-terminal hydrolase 6 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1lf6a1 a.102.1.5 (A:288-684) Bacterial glucoamylase, C-terminal domain {Thermoanaerobacterium thermosaccharolyticum [TaxId: 1517]} Back     information, alignment and structure
>d2bwna1 c.67.1.4 (A:2-397) 5-aminolevulinate synthase {Rhodobacter capsulatus [TaxId: 1061]} Back     information, alignment and structure
>d1m7xa3 c.1.8.1 (A:227-622) 1,4-alpha-glucan branching enzyme, central domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2q7wa1 c.67.1.1 (A:1-396) Aspartate aminotransferase, AAT {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1io1a_ e.32.1.1 (A:) Phase 1 flagellin {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d2bfda1 c.36.1.11 (A:6-400) Branched-chain alpha-keto acid dehydrogenase, PP module {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2py6a1 c.66.1.56 (A:14-408) Methyltransferase FkbM {Methylobacillus flagellatus [TaxId: 405]} Back     information, alignment and structure
>d1nw1a_ d.144.1.8 (A:) Choline kinase {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1aora1 a.110.1.1 (A:211-605) Aldehyde ferredoxin oxidoreductase {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1xi9a_ c.67.1.1 (A:) Putative alanine aminotransferase {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1w36b2 c.37.1.19 (B:486-880) Exodeoxyribonuclease V beta chain (RecB), N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1n40a_ a.104.1.1 (A:) Cyp121 monooxygenase (P450 Mt2) {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1e5ea_ c.67.1.3 (A:) Methionine gamma-lyase, MGL {Trichomonas vaginalis, MGL1 [TaxId: 5722]} Back     information, alignment and structure
>d1phpa_ c.86.1.1 (A:) Phosphoglycerate kinase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1u1ha1 c.1.22.2 (A:2-395) 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase MetE {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1qo7a_ c.69.1.11 (A:) Bacterial epoxide hydrolase {Aspergillus niger [TaxId: 5061]} Back     information, alignment and structure
>d2ay1a_ c.67.1.1 (A:) Aromatic aminoacid aminotransferase, AroAT {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1c7na_ c.67.1.3 (A:) Cystalysin {Treponema denticola [TaxId: 158]} Back     information, alignment and structure
>d1lfka_ a.104.1.1 (A:) p450 monoxygenase OxyB {Amycolatopsis orientalis [TaxId: 31958]} Back     information, alignment and structure
>d2pb1a1 c.1.8.3 (A:7-400) Exo-beta-(1,3)-glucanase {Yeast (Candida albicans) [TaxId: 5476]} Back     information, alignment and structure
>d1atia2 d.104.1.1 (A:1-394) Glycyl-tRNA synthetase (GlyRS) {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2d3na2 c.1.8.1 (A:5-398) Bacterial alpha-amylase {Bacillus sp. 707 [TaxId: 1416]} Back     information, alignment and structure
>d1q8ia2 e.8.1.1 (A:390-783) Family B DNA polymerase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ldja2 a.118.17.1 (A:17-410) Cullin homolog 1, Cul-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1n8pa_ c.67.1.3 (A:) Cystathionine gamma-lyase (CYS3) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1xlma_ c.1.15.3 (A:) D-xylose isomerase {Arthrobacter, strain b3728 [TaxId: 1663]} Back     information, alignment and structure
>d1kwga2 c.1.8.1 (A:1-393) A4 beta-galactosidase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1sq9a_ b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1g8ma2 c.97.1.4 (A:201-593) AICAR transformylase domain of bifunctional purine biosynthesis enzyme ATIC {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1i24a_ c.2.1.2 (A:) Sulfolipid biosynthesis protein SQD1 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1e43a2 c.1.8.1 (A:1-393) Bacterial alpha-amylase {Chimera (Bacillus amyloliquefaciens) and (Bacillus licheniformis) [TaxId: 1390]} Back     information, alignment and structure
>d1hvxa2 c.1.8.1 (A:1-393) Bacterial alpha-amylase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1gc0a_ c.67.1.3 (A:) Methionine gamma-lyase, MGL {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d2d0ta1 a.266.1.2 (A:12-403) Indoleamine 2,3-dioxygenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xima_ c.1.15.3 (A:) D-xylose isomerase {Actinoplanes missouriensis [TaxId: 1866]} Back     information, alignment and structure
>d2pula1 d.144.1.6 (A:5-396) Methylthioribose kinase MtnK {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1yvua2 c.55.3.10 (A:315-706) Argonaute homologue Aq_1447 {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1cl1a_ c.67.1.3 (A:) Cystathionine beta-lyase, CBL {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1pn3a_ c.87.1.5 (A:) TDP-epi-vancosaminyltransferase GtfA {Amycolatopsis orientalis [TaxId: 31958]} Back     information, alignment and structure
>d1nt4a_ c.60.1.2 (A:) Glucose-1-phosphatase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1gpea1 c.3.1.2 (A:1-328,A:525-587) Glucose oxidase {Penicillium amagasakiense [TaxId: 63559]} Back     information, alignment and structure
>d1p3wa_ c.67.1.3 (A:) Cysteine desulfurase IscS {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1lwha2 c.1.8.1 (A:1-391) 4-alpha-glucanotransferase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d4ubpc2 c.1.9.2 (C:132-434,C:484-570) alpha-subunit of urease, catalytic domain {Bacillus pasteurii [TaxId: 1474]} Back     information, alignment and structure
>d1v6sa_ c.86.1.1 (A:) Phosphoglycerate kinase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1nsca_ b.68.1.1 (A:) Influenza neuraminidase {Influenza B virus, different strains [TaxId: 11520]} Back     information, alignment and structure
>d1qopb_ c.79.1.1 (B:) Tryptophan synthase, beta-subunit {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1oj7a_ e.22.1.2 (A:) Hypothetical oxidoreductase yqhD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ud2a2 c.1.8.1 (A:1-390) Bacterial alpha-amylase {Bacillus sp., ksm-k38 [TaxId: 1409]} Back     information, alignment and structure
>d1jiha2 e.8.1.7 (A:1-389) DNA polymerase eta {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1sg6a_ e.22.1.1 (A:) Dehydroquinate synthase, DHQS {Aspergillus nidulans [TaxId: 162425]} Back     information, alignment and structure
>d2gb3a1 c.67.1.1 (A:4-392) AAT homologue TM1698 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1e9yb2 c.1.9.2 (B:132-431,B:481-569) alpha-subunit of urease, catalytic domain {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d2o3ia1 e.73.1.1 (A:2-390) Hypothetical protein CV3147 {Chromobacterium violaceum [TaxId: 536]} Back     information, alignment and structure
>d1f8ea_ b.68.1.1 (A:) Influenza neuraminidase {Influenza A virus, different strains [TaxId: 11320]} Back     information, alignment and structure
>d1u7la_ e.57.1.1 (A:) Vacuolar ATP synthase subunit C {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qxoa_ d.258.1.1 (A:) Chorismate synthase, AroC {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d2ch1a1 c.67.1.3 (A:2-389) 3-hydroxykynurenine transaminase {Malaria mosquito (Anopheles gambiae) [TaxId: 7165]} Back     information, alignment and structure
>d1eepa_ c.1.5.1 (A:) Inosine monophosphate dehydrogenase (IMPDH) {Lyme disease spirochete (Borrelia burgdorferi) [TaxId: 139]} Back     information, alignment and structure
>d2dcfa1 e.3.1.1 (A:5-392) 6-aminohexanoate-dimer hydrolase NylC {Flavobacterium sp. [TaxId: 239]} Back     information, alignment and structure
>d2py5a2 e.8.1.1 (A:188-575) phi29 DNA polymerase {Bacteriophage phi-29 [TaxId: 10756]} Back     information, alignment and structure
>d1q8ia1 c.55.3.5 (A:2-389) Exonuclease domain of family B DNA polymerases {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1h0ca_ c.67.1.3 (A:) Alanine-glyoxylate aminotransferase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gdea_ c.67.1.1 (A:) Aromatic aminoacid aminotransferase, AroAT {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1j32a_ c.67.1.1 (A:) Aspartate aminotransferase, AAT {Phormidium lapideum [TaxId: 32060]} Back     information, alignment and structure
>d1ku0a_ c.69.1.18 (A:) Lipase L1 {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1x38a1 c.1.8.7 (A:1-388) Beta-D-glucan exohydrolase, N-terminal domain {Barley (Hordeum vulgare) [TaxId: 4513]} Back     information, alignment and structure
>d1zeea1 a.266.1.2 (A:6-392) Hypothetical protein SO4414 {Shewanella oneidensis [TaxId: 70863]} Back     information, alignment and structure
>d2aepa1 b.68.1.1 (A:83-469) Influenza neuraminidase {Influenza A virus, different strains [TaxId: 11320]} Back     information, alignment and structure
>d1qvra2 c.37.1.20 (A:149-535) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1bxba_ c.1.15.3 (A:) D-xylose isomerase {Thermus aquaticus, subsp. Thermophilus [TaxId: 271]} Back     information, alignment and structure
>d1zsqa2 c.45.1.3 (A:199-585) Myotubularin-related protein 2, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vefa1 c.67.1.4 (A:9-395) Acetylornithine/acetyl-lysine aminotransferase ArgD {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2qp8a1 b.50.1.2 (A:60-446) beta-secretase (memapsin) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k3ia3 b.69.1.1 (A:151-537) Galactose oxidase, central domain {Fungi (Fusarium sp.) [TaxId: 29916]} Back     information, alignment and structure
>d1ur4a_ c.1.8.3 (A:) Beta-1,4-galactanase {Bacillus licheniformis [TaxId: 1402]} Back     information, alignment and structure
>d2ex0a1 c.87.1.9 (A:26-412) Alpha-2,3/2,6-sialyltransferase/sialidase {Pasteurella multocida [TaxId: 747]} Back     information, alignment and structure
>d1v8za1 c.79.1.1 (A:1-386) Tryptophan synthase, beta-subunit {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1r6ta2 c.26.1.1 (A:82-467) Tryptophanyl-tRNA synthetase (TrpRS) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1muwa_ c.1.15.3 (A:) D-xylose isomerase {Streptomyces olivochromogenes [TaxId: 1963]} Back     information, alignment and structure
>d3c10a1 c.42.1.2 (A:515-900) Histone deacetylase 7, HDAC7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v5da_ a.102.1.2 (A:) Chitosanase {Bacillus sp., strain k17 [TaxId: 1409]} Back     information, alignment and structure
>d1rrma_ e.22.1.2 (A:) Lactaldehyde reductase FucO {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xmxa_ c.52.1.26 (A:) Hypothetical protein VC1899 {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1uhga_ e.1.1.1 (A:) Ovalbumin {Hen (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1ir6a_ c.107.1.2 (A:) Exonuclease RecJ {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1ejxc2 c.1.9.2 (C:1130-1422,C:1476-1567) alpha-subunit of urease, catalytic domain {Klebsiella aerogenes [TaxId: 28451]} Back     information, alignment and structure
>d1cf3a1 c.3.1.2 (A:3-324,A:521-583) Glucose oxidase {Aspergillus niger [TaxId: 5061]} Back     information, alignment and structure
>d1n97a_ a.104.1.1 (A:) Cyp175a1 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2c5wb1 e.3.1.1 (B:266-650) Penicillin-binding protein 1a, transpeptidase domain {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d2ix0a4 b.40.4.16 (A:173-557) Exoribonuclease 2, RNB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2b9va2 c.69.1.21 (A:50-434) Alpha-amino acid ester hydrolase {Acetobacter pasteurianus [TaxId: 438]} Back     information, alignment and structure
>d1cs1a_ c.67.1.3 (A:) Cystathionine gamma-synthase, CGS {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d3c0na2 f.8.1.1 (A:85-468) (Pro)aerolysin, pore-forming lobe {Aeromonas hydrophila [TaxId: 644]} Back     information, alignment and structure
>d1mtyb_ a.25.1.2 (B:) Methane monooxygenase hydrolase beta subunit {Methylococcus capsulatus [TaxId: 414]} Back     information, alignment and structure
>d1b9ha_ c.67.1.4 (A:) 3-amino-5-hydroxybenzoic acid synthase (AHBA synthase) {Amycolatopsis mediterranei [TaxId: 33910]} Back     information, alignment and structure
>d1hn0a1 a.102.3.2 (A:235-618) Chondroitin ABC lyase I {Proteus vulgaris [TaxId: 585]} Back     information, alignment and structure
>d2fvka2 c.1.9.6 (A:57-440) Dihydropyrimidine amidohydrolase Pyd2 {Yeast (Saccharomyces kluyveri) [TaxId: 4934]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1bs0a_ c.67.1.4 (A:) PLP-dependent acyl-CoA synthase (8-amino-7-oxonanoate synthase, AONS) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1vz6a_ d.154.1.2 (A:) Glutamate N-acetyltransferase 2 (ornithine acetyltransferase) {Streptomyces clavuligerus [TaxId: 1901]} Back     information, alignment and structure
>d1mhyb_ a.25.1.2 (B:) Methane monooxygenase hydrolase beta subunit {Methylosinus trichosporium [TaxId: 426]} Back     information, alignment and structure
>d1u7ga_ f.44.1.1 (A:) Ammonium transporter AmtB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1bo1a_ d.143.1.2 (A:) Phosphatidylinositol phosphate kinase IIbeta, PIPK IIbeta {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2v5za1 c.3.1.2 (A:6-289,A:402-500) Monoamine oxidase B {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1imva_ e.1.1.1 (A:) Pigment epithelium-derived factor, PEDF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ayna1 d.3.1.9 (A:100-482) Ubiquitin carboxyl-terminal hydrolase 14 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gy8a_ c.2.1.2 (A:) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1ea9c3 c.1.8.1 (C:122-503) Maltogenic amylase, central domain {Bacillus sp., cyclomaltodextrinase [TaxId: 1409]} Back     information, alignment and structure
>d1u08a_ c.67.1.1 (A:) Putative methionine aminotransferase YdbL {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1wkva1 c.79.1.1 (A:2-383) O-acetylserine sulfhydrylase (Cysteine synthase) {Archaeon Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1b5pa_ c.67.1.1 (A:) Aspartate aminotransferase, AAT {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2bkwa1 c.67.1.3 (A:3-384) Alanine-glyoxylate aminotransferase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1t1ua1 c.43.1.3 (A:20-401) Choline O-acetyltransferase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1xl7a1 c.43.1.3 (A:11-392) Peroxisomal carnitine O-octanoyltransferase, COT {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wzla3 c.1.8.1 (A:121-502) Maltogenic amylase, central domain {Thermoactinomyces vulgaris, TVAII [TaxId: 2026]} Back     information, alignment and structure
>d1j0ha3 c.1.8.1 (A:124-505) Neopullulanase, central domain {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d3bvua3 c.6.2.1 (A:31-411) Golgi alpha-mannosidase II {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1by7a_ e.1.1.1 (A:) Plasminogen activator inhibitor-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1odza_ c.1.8.3 (A:) Mannanase A, ManA {Pseudomonas cellulosa (Cellvibrio japonicus) [TaxId: 155077]} Back     information, alignment and structure
>d2bo4a1 c.68.1.18 (A:2-382) Mannosylglycerate synthase, MGS {Rhodothermus marinus [TaxId: 29549]} Back     information, alignment and structure
>d1elua_ c.67.1.3 (A:) Cystine C-S lyase C-des {Synechocystis sp. [TaxId: 1143]} Back     information, alignment and structure
>d1xipa_ b.69.14.1 (A:) Nucleoporin NUP159 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2guya2 c.1.8.1 (A:1-381) Fungal alpha-amylases {Aspergillus oryzae, Taka-amylase [TaxId: 5062]} Back     information, alignment and structure
>d1mpxa2 c.69.1.21 (A:24-404) Alpha-amino acid ester hydrolase {Xanthomonas citri [TaxId: 346]} Back     information, alignment and structure
>d2aaaa2 c.1.8.1 (A:1-381) Fungal alpha-amylases {Aspergillus niger, acid amylase [TaxId: 5061]} Back     information, alignment and structure
>d1t6ex_ b.50.1.2 (X:) Xylanase inhibitor TAXI-I {Wheat (Triticum aestivum) [TaxId: 4565]} Back     information, alignment and structure
>d1ibja_ c.67.1.3 (A:) Cystathionine beta-lyase, CBL {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1vbga3 d.142.1.5 (A:3-382) Pyruvate phosphate dikinase, N-terminal domain {Maize (Zea mays) [TaxId: 4577]} Back     information, alignment and structure
>d1q45a_ c.1.4.1 (A:) 12-oxophytodienoate reductase (OPR, OYE homolog) {Thale cress (Arabidopsis thaliana), OPR3 [TaxId: 3702]} Back     information, alignment and structure
>d2gmha1 c.3.1.2 (A:4-236,A:336-482) Electron transfer flavoprotein-ubiquinone oxidoreductase, EFT-QO {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1qyia_ c.108.1.13 (A:) Hypothetical protein MW1667 (SA1546) {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1edga_ c.1.8.3 (A:) Endoglucanase CelA {Clostridium cellulolyticum [TaxId: 1521]} Back     information, alignment and structure
>d1elja_ c.94.1.1 (A:) D-maltodextrin-binding protein, MBP {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1lj5a_ e.1.1.1 (A:) Plasminogen activator inhibitor-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2f5va1 c.3.1.2 (A:43-354,A:553-619) Pyranose 2-oxidase {White-rot fungus (Peniophora sp. SG) [TaxId: 204723]} Back     information, alignment and structure
>d3sila_ b.68.1.1 (A:) Salmonella sialidase {Salmonella typhimurium, strain lt2 [TaxId: 90371]} Back     information, alignment and structure
>d1jr1a1 c.1.5.1 (A:17-112,A:233-514) Inosine monophosphate dehydrogenase (IMPDH) {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d1xqga_ e.1.1.1 (A:) Maspin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jaea2 c.1.8.1 (A:1-378) Animal alpha-amylase {Yellow mealworm (Tenebrio molitor), larva [TaxId: 7067]} Back     information, alignment and structure
>d1a59a_ a.103.1.1 (A:) Citrate synthase {Antarctic bacterium DS2-3R [TaxId: 56673]} Back     information, alignment and structure
>d1vjoa_ c.67.1.3 (A:) Alanine-glyoxylate aminotransferase {Cyanobacteria (Nostoc sp. pcc 7120) [TaxId: 103690]} Back     information, alignment and structure
>d1o6ca_ c.87.1.3 (A:) UDP-N-acetylglucosamine 2-epimerase {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2d5ja1 a.102.1.7 (A:1-377) Unsaturated glucuronyl hydrolase {Bacillus sp. GL1 [TaxId: 84635]} Back     information, alignment and structure
>d1k8qa_ c.69.1.6 (A:) Gastric lipase {Dog (Canis familiaris) [TaxId: 9615]} Back     information, alignment and structure
>d1ci9a_ e.3.1.1 (A:) Esterase EstB {Burkholderia gladioli [TaxId: 28095]} Back     information, alignment and structure
>d2i71a1 e.72.1.1 (A:1-377) Hypothetical protein SSO1389 {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1jmma_ b.30.6.1 (A:) V-region of surface antigen I/II (SA I/II, PAC) {Streptococcus mutans [TaxId: 1309]} Back     information, alignment and structure
>d1nm8a1 c.43.1.3 (A:9-385) Carnitine acetyltransferase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mdoa_ c.67.1.4 (A:) Aminotransferase ArnB {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d2vata1 c.69.1.40 (A:7-382) Acetyl-CoA:deacetylcephalosporin C acetyltransferase CefG {Acremonium chrysogenum [TaxId: 5044]} Back     information, alignment and structure
>d1f6da_ c.87.1.3 (A:) UDP-N-acetylglucosamine 2-epimerase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1k9oi_ e.1.1.1 (I:) Alaserpin (serpin 1) {Tobacco hornworm (Manduca sexta) [TaxId: 7130]} Back     information, alignment and structure
>d2v3qa1 c.94.1.1 (A:1-376) PstS-like phosphate-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1eg5a_ c.67.1.3 (A:) NifS-like protein/selenocysteine lyase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1wu4a1 a.102.1.2 (A:6-381) Xylanase Y {Bacillus halodurans [TaxId: 86665]} Back     information, alignment and structure
>d1bhea_ b.80.1.3 (A:) Polygalacturonase {Erwinia carotovora, subsp. carotovora [TaxId: 554]} Back     information, alignment and structure
>d2fug41 e.18.1.2 (4:35-409) NADH-quinone oxidoreductase chain 4, Nqo4 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2dula1 c.66.1.58 (A:3-377) N(2),N(2)-dimethylguanosine tRNA methyltransferase Trm1 {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1o4sa_ c.67.1.1 (A:) Aspartate aminotransferase, AAT {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1ih7a1 c.55.3.5 (A:1-375) Exonuclease domain of family B DNA polymerases {Bacteriophage RB69 [TaxId: 12353]} Back     information, alignment and structure
>d1kbla3 d.142.1.5 (A:2-376) Pyruvate phosphate dikinase, N-terminal domain {Clostridium symbiosum [TaxId: 1512]} Back     information, alignment and structure
>d1txka2 b.30.5.9 (A:23-396) Glucans biosynthesis protein G (MdoG, OpgG), N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ioma_ a.103.1.1 (A:) Citrate synthase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1gwja_ c.1.4.1 (A:) Morphinone reductase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d2a0ua1 c.124.1.5 (A:10-383) Initiation factor 2b {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d1nd7a_ d.148.1.1 (A:) WW domain-containing protein 1, WWP1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1o69a_ c.67.1.4 (A:) Aminotransferase homolog WlaK (PglE, Cj1121c) {Campylobacter jejuni [TaxId: 197]} Back     information, alignment and structure
>d1rp4a_ a.227.1.1 (A:) Endoplasmic oxidoreductin 1, Ero1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2bvca2 d.128.1.1 (A:105-478) Glutamine synthetase, C-terminal domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1so7a_ b.68.1.1 (A:) Sialidase 2 (Neu2) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kfwa1 c.1.8.5 (A:10-327,A:389-444) Psychrophilic chitinase B {Arthrobacter sp., tad20 [TaxId: 1667]} Back     information, alignment and structure
>d1seza1 c.3.1.2 (A:13-329,A:442-497) Protoporphyrinogen oxidase {Tobacco (Nicotiana tabacum) [TaxId: 4097]} Back     information, alignment and structure
>d1v4va_ c.87.1.3 (A:) UDP-N-acetylglucosamine 2-epimerase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2madh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Gram negative methylotrophic bacteria (Thiobacillus versutus) [TaxId: 34007]} Back     information, alignment and structure
>d1ogmx2 b.80.1.10 (X:202-574) Dextranase, catalytic domain {Penicillium minioluteum [TaxId: 28574]} Back     information, alignment and structure
>d1miqa_ b.50.1.2 (A:) Plasmepsin (a hemoglobin-degrading enzyme) {Plasmodium vivax [TaxId: 5855]} Back     information, alignment and structure
>d1qo0a_ c.93.1.1 (A:) Amide receptor/negative regulator of the amidase operon (AmiC) {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1m0wa2 d.142.1.6 (A:6-210,A:324-491) Eukaryotic glutathione synthetase ATP-binding domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1r5ya_ c.1.20.1 (A:) Queosine tRNA-guanine transglycosylase {Zymomonas mobilis [TaxId: 542]} Back     information, alignment and structure
>d1c3pa_ c.42.1.2 (A:) HDAC homologue {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1noya_ c.55.3.5 (A:) Exonuclease domain of family B DNA polymerases {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d1qlpa_ e.1.1.1 (A:) Antitrypsin, alpha-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1j58a_ b.82.1.2 (A:) Oxalate decarboxylase OxdC (YvrK) {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1vkpa_ d.126.1.6 (A:) Agmatine iminohydrolase {Thale-cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1teda_ c.95.1.2 (A:) Polyketide synthase PKS18 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1mkfa_ b.116.1.1 (A:) Viral chemokine binding protein m3 {Murid herpesvirus 4, MuHV-4 [TaxId: 33708]} Back     information, alignment and structure
>d1r53a_ d.258.1.1 (A:) Chorismate synthase, AroC {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1n7oa1 a.102.3.2 (A:170-540) Hyaluronate lyase {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d1aj8a_ a.103.1.1 (A:) Citrate synthase {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1to6a_ c.141.1.1 (A:) Glycerate kinase GlxK {Neisseria meningitidis, (serogroup A) [TaxId: 487]} Back     information, alignment and structure
>d1c8ba_ c.56.1.2 (A:) Germination protease {Bacillus megaterium [TaxId: 1404]} Back     information, alignment and structure
>d1f1sa1 a.102.3.2 (A:249-619) Hyaluronate lyase {Streptococcus agalactiae [TaxId: 1311]} Back     information, alignment and structure
>d1eg1a_ b.29.1.10 (A:) Cellobiohydrolase I (cellulase, Endoglucanase I, CBH1) {Trichoderma reesei, Endoglucanase I [TaxId: 51453]} Back     information, alignment and structure
>d1r85a_ c.1.8.3 (A:) Xylanase {Bacillus stearothermophilus, Xt6 [TaxId: 1422]} Back     information, alignment and structure
>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2fnua1 c.67.1.4 (A:2-372) Spore coat polysaccharide biosynthesis protein C {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d2dexx3 d.126.1.5 (X:294-663) Peptidylarginine deiminase Pad4, catalytic C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2gx8a1 c.135.1.1 (A:4-373) Nif3-related protein BC4286 {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d2iw1a1 c.87.1.8 (A:2-371) Lipopolysaccharide core biosynthesis protein RfaG {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2hgsa4 d.142.1.6 (A:3-201,A:304-474) Eukaryotic glutathione synthetase ATP-binding domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2iida1 c.3.1.2 (A:4-319,A:433-486) L-aminoacid oxidase {Malayan pit viper (Calloselasma rhodostoma) [TaxId: 8717]} Back     information, alignment and structure
>d3psga_ b.50.1.2 (A:) Pepsin(ogen) {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1iq0a2 c.26.1.1 (A:97-466) Arginyl-tRNA synthetase (ArgRS) {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d3coxa1 c.3.1.2 (A:5-318,A:451-506) Cholesterol oxidase of GMC family {Brevibacterium sterolicum [TaxId: 1702]} Back     information, alignment and structure
>d1rh9a1 c.1.8.3 (A:30-399) Beta-mannanase {Tomato (Lycopersicon esculentum) [TaxId: 4081]} Back     information, alignment and structure
>d1itua_ c.1.9.7 (A:) Renal dipeptidase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rwha1 a.102.3.2 (A:4-372) Chondroitinase AC {Arthrobacter aurescens [TaxId: 43663]} Back     information, alignment and structure
>d2heka1 a.211.1.1 (A:1-369) Hypothetical protein aq_1910 {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d2ewoa1 d.126.1.6 (A:2-370) Agmatine iminohydrolase {Streptococcus mutans [TaxId: 1309]} Back     information, alignment and structure
>d1ga6a_ c.41.1.2 (A:) Serine-carboxyl proteinase, SCP {Pseudomonas sp., sedolisin [TaxId: 306]} Back     information, alignment and structure
>d1laxa_ c.94.1.1 (A:) D-maltodextrin-binding protein, MBP {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2cu0a1 c.1.5.1 (A:3-96,A:207-480) Inosine monophosphate dehydrogenase (IMPDH) {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1r8ga_ d.128.1.3 (A:) Carboxylate-amine ligase YbdK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2ncda_ c.37.1.9 (A:) Kinesin motor Ncd (non-claret disjunctional) {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1mdah_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1f52a2 d.128.1.1 (A:101-468) Glutamine synthetase, C-terminal domain {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1v2da_ c.67.1.1 (A:) Glutamine aminotransferase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1pyya4 e.3.1.1 (A:264-631) Penicillin-binding protein 2x (pbp-2x), transpeptidase domain {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d1o7xa_ a.103.1.1 (A:) Citrate synthase {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1d3ga_ c.1.4.1 (A:) Dihydroorotate dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1b65a_ d.154.1.1 (A:) L-aminopeptidase D-Ala-esterase/amidase DmpA {Ochrobactrum anthropi [TaxId: 529]} Back     information, alignment and structure
>d1iuqa_ c.112.1.1 (A:) Glycerol-3-phosphate (1)-acyltransferase {Cushaw squash (Cucurbita moschata) [TaxId: 3662]} Back     information, alignment and structure
>d1ue8a_ a.104.1.1 (A:) Cyp119 {Archaeon Sulfolobus tokodaii [TaxId: 111955]} Back     information, alignment and structure
>d1ursa_ c.94.1.1 (A:) D-maltodextrin-binding protein, MBP {Alicyclobacillus acidocaldarius [TaxId: 405212]} Back     information, alignment and structure
>d1n4wa1 c.3.1.2 (A:9-318,A:451-507) Cholesterol oxidase of GMC family {Streptomyces sp. [TaxId: 1931]} Back     information, alignment and structure
>d1qw9a2 c.1.8.3 (A:18-384) Alpha-L-arabinofuranosidase, catalytic domain {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1moqa_ c.80.1.1 (A:) "Isomerase domain" of glucosamine 6-phosphate synthase (GLMS) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1io7a_ a.104.1.1 (A:) Cyp119 {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1h6za1 c.1.12.2 (A:538-903) Pyruvate phosphate dikinase, C-terminal domain {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d2bvya2 c.1.8.3 (A:5-370) Mannanase A, ManA {Cellulomonas fimi [TaxId: 1708]} Back     information, alignment and structure
>d1jq5a_ e.22.1.2 (A:) Glycerol dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1u5ua_ e.5.1.2 (A:) Allene oxide synthase-lipoxygenase protein, N-terminal domain {Black sea rod (Plexaura homomalla) [TaxId: 47982]} Back     information, alignment and structure
>d2aeua1 c.67.1.8 (A:9-374) Hypothetical protein MJ0158 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1fn9a_ d.196.1.1 (A:) Outer capsid protein sigma 3 {Reovirus [TaxId: 10891]} Back     information, alignment and structure
>d1um0a_ d.258.1.1 (A:) Chorismate synthase, AroC {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d2pnwa1 b.52.1.4 (A:5-369) Membrane-bound lytic murein transglycosylase A, MLTA {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1zkda1 c.66.1.52 (A:2-366) Hypothetical protein RPA4359 {Rhodopseudomonas palustris [TaxId: 1076]} Back     information, alignment and structure
>d1u1ha2 c.1.22.2 (A:396-760) 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase MetE {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1w85a_ c.36.1.11 (A:) Pyruvate dehydrogenase E1-alpha, PdhA {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d3c8ya1 c.96.1.1 (A:210-574) Fe-only hydrogenase, catalytic domain {Clostridium pasteurianum [TaxId: 1501]} Back     information, alignment and structure
>d1zfja1 c.1.5.1 (A:2-94,A:221-492) Inosine monophosphate dehydrogenase (IMPDH) {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1jofa_ b.69.10.1 (A:) 3-carboxy-cis,cis-mucoante lactonizing enzyme {Neurospora crassa [TaxId: 5141]} Back     information, alignment and structure
>d2jera1 d.126.1.6 (A:2-365) Agmatine iminohydrolase {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1sdma_ c.37.1.9 (A:) Kinesin heavy chain-like protein {Potato (Solanum tuberosum) [TaxId: 4113]} Back     information, alignment and structure
>d1t64a_ c.42.1.2 (A:) Histone deacetylase 8, HDAC8 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1icpa_ c.1.4.1 (A:) 12-oxophytodienoate reductase (OPR, OYE homolog) {Tomato (Lycopersicon esculentum), OPR1 [TaxId: 4081]} Back     information, alignment and structure
>d1um8a_ c.37.1.20 (A:) ClpX {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1kbla1 c.1.12.2 (A:510-873) Pyruvate phosphate dikinase, C-terminal domain {Clostridium symbiosum [TaxId: 1512]} Back     information, alignment and structure
>d1omwa3 d.144.1.7 (A:186-549) G-protein coupled receptor kinase 2 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1kq3a_ e.22.1.2 (A:) Glycerol dehydrogenase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1oc7a_ c.6.1.1 (A:) Cellobiohydrolase II (Cel6) {Humicola insolens, Cel6a [TaxId: 34413]} Back     information, alignment and structure
>d1us3a2 c.1.8.3 (A:243-606) Xylanase 10c {Cellvibrio japonicus [TaxId: 155077]} Back     information, alignment and structure
>d2e7ja1 c.67.1.9 (A:8-371) Selenocysteinyl-tRNA synthase (SepSecS) {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1w0pa3 b.68.1.1 (A:217-346,A:544-777) Vibrio cholerae sialidase {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1m7va_ d.174.1.1 (A:) Nitric oxide (NO) synthase oxygenase domain {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1zaia1 c.1.10.1 (A:1-363) Fructose-1,6-bisphosphate aldolase {Rabbit (Oryctolagus cuniculus), muscle isozyme [TaxId: 9986]} Back     information, alignment and structure
>d1khba1 c.91.1.1 (A:260-622) Cytosolic phosphoenolpyruvate carboxykinase (GTP-hydrolyzing) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zq1a2 c.88.1.1 (A:76-438) Glutamyl-tRNA(Gln) amidotransferase subunit D, GatD {Pyrococcus abyssi [TaxId: 29292]} Back     information, alignment and structure
>d2c5aa1 c.2.1.2 (A:13-375) GDP-mannose-3', 5'-epimerase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1onha_ e.3.1.1 (A:) AMPC beta-Lactamase, class C {Enterobacter cloacae, P99, cephalosporinase [TaxId: 550]} Back     information, alignment and structure
>d1vyra_ c.1.4.1 (A:) Pentaerythritol tetranirate reductase {Enterobacter cloacae [TaxId: 550]} Back     information, alignment and structure
>d1nc5a_ a.102.1.6 (A:) Hypothetical protein YteR {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1cnza_ c.77.1.1 (A:) 3-isopropylmalate dehydrogenase, IPMDH {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1kwfa_ a.102.1.2 (A:) CelA cellulase {Clostridium thermocellum [TaxId: 1515]} Back     information, alignment and structure
>d2a1ha1 e.17.1.1 (A:3-365) Branched-chain aminoacid aminotransferase {Human (Homo sapiens), mitochondrial [TaxId: 9606]} Back     information, alignment and structure
>d1umga_ d.280.1.1 (A:) ST0318 {Archaeon Sulfolobus tokodaii [TaxId: 111955]} Back     information, alignment and structure
>d1gqea_ e.38.1.1 (A:) Polypeptide chain release factor 2 (RF2) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1umda_ c.36.1.11 (A:) Branched-chain alpha-keto acid dehydrogenase, PP module {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d3thia_ c.94.1.1 (A:) Thiaminase I {Paenibacillus thiaminolyticus [TaxId: 49283]} Back     information, alignment and structure
>d2pl5a1 c.69.1.40 (A:5-366) Homoserine O-acetyltransferase {Leptospira interrogans [TaxId: 173]} Back     information, alignment and structure
>d1pvna1 c.1.5.1 (A:2-99,A:231-494) Inosine monophosphate dehydrogenase (IMPDH) {Tritrichomonas foetus [TaxId: 5724]} Back     information, alignment and structure
>d1v8ka_ c.37.1.9 (A:) Kinesin {Mouse (Mus musculus), kif2c [TaxId: 10090]} Back     information, alignment and structure
>d1svma_ c.37.1.20 (A:) Papillomavirus large T antigen helicase domain {Simian virus 40 [TaxId: 10633]} Back     information, alignment and structure
>d2drwa1 e.3.1.1 (A:2-363) D-Amino acid amidase DaaA {Ochrobactrum anthropi [TaxId: 529]} Back     information, alignment and structure
>d1vlca_ c.77.1.1 (A:) 3-isopropylmalate dehydrogenase, IPMDH {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1nqka_ c.1.16.4 (A:) Alkanesulfonate monooxygenase SsuD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2gjxa1 c.1.8.6 (A:167-528) beta-hexosaminidase A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1q8ya_ d.144.1.7 (A:) Sky1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1qjwa_ c.6.1.1 (A:) Cellobiohydrolase II (Cel6) {Trichoderma reesei, Cel6a [TaxId: 51453]} Back     information, alignment and structure
>d2ozla1 c.36.1.11 (A:1-361) E1-beta subunit of pyruvate dehydrogenase (PP module) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2c0ra1 c.67.1.4 (A:2-362) Phosphoserine aminotransferase, PSAT {Bacillus circulans, subsp. alkalophilus [TaxId: 1397]} Back     information, alignment and structure
>d1dhsa_ c.31.1.1 (A:) Deoxyhypusine synthase, DHS {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x1ia1 a.102.3.2 (A:26-386) Xanthan lyase {Bacillus sp. gl1 [TaxId: 84635]} Back     information, alignment and structure
>d1m32a_ c.67.1.3 (A:) 2-aminoethylphosphonate transaminase {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1lt7a_ c.1.26.1 (A:) Betaine-homocysteine S-methyltransferase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1d2fa_ c.67.1.3 (A:) Modulator in mal gene expression, MalY {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1rqga2 c.26.1.1 (A:1-138,A:174-396) Methionyl-tRNA synthetase (MetRS) {Pyrococcus abyssi [TaxId: 29292]} Back     information, alignment and structure
>d1kewa_ c.2.1.2 (A:) dTDP-glucose 4,6-dehydratase (RmlB) {Streptococcus suis, serotype 2 [TaxId: 1307]} Back     information, alignment and structure
>d1mxga2 c.1.8.1 (A:1-361) Bacterial alpha-amylase {Archaeon Pyrococcus woesei [TaxId: 2262]} Back     information, alignment and structure
>d1pe9a_ b.80.1.1 (A:) Pectate lyase {Erwinia chrysanthemi, type A [TaxId: 556]} Back     information, alignment and structure
>d1sq1a_ d.258.1.1 (A:) Chorismate synthase, AroC {Campylobacter jejuni [TaxId: 197]} Back     information, alignment and structure
>d1qo5a_ c.1.10.1 (A:) Fructose-1,6-bisphosphate aldolase {Human (Homo sapiens), liver isozyme [TaxId: 9606]} Back     information, alignment and structure
>d1bjna_ c.67.1.4 (A:) Phosphoserine aminotransferase, PSAT {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1jdwa_ d.126.1.2 (A:) L-arginine: glycine amidinotransferase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w23a_ c.67.1.4 (A:) Phosphoserine aminotransferase, PSAT {Bacillus alcalophilus [TaxId: 1445]} Back     information, alignment and structure
>d1xfia_ e.50.1.1 (A:) Hypothetical protein At2g17340 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1pn0a1 c.3.1.2 (A:1-240,A:342-461) Phenol hydroxylase {Soil-living yeast (Trichosporon cutaneum) [TaxId: 5554]} Back     information, alignment and structure
>d1oxwa_ c.19.1.3 (A:) Patatin {Heartleaf nightshade (Solanum cardiophyllum) [TaxId: 160510]} Back     information, alignment and structure
>d1kdga1 c.3.1.2 (A:215-512,A:694-755) Flavoprotein domain of flavocytochrome cellobiose dehydrogenase (CDH), FAD-binding domain {Fungus (Phanerochaete chrysosporium) [TaxId: 5306]} Back     information, alignment and structure
>d2jbwa1 c.69.1.41 (A:8-367) 2,6-dihydropseudooxynicotine hydrolase {Arthrobacter nicotinovorans [TaxId: 29320]} Back     information, alignment and structure
>d1k32a3 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d4bcla_ b.75.1.1 (A:) Bacteriochlorophyll A protein {Prosthecochloris aestuarii, strain 2k [TaxId: 1102]} Back     information, alignment and structure
>d1goxa_ c.1.4.1 (A:) Glycolate oxidase {Spinach (Spinacia oleracea) [TaxId: 3562]} Back     information, alignment and structure
>d1x74a1 c.123.1.1 (A:2-360) 2-methylacyl-CoA racemase Mcr {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1m6ex_ c.66.1.35 (X:) Salicylic acid carboxyl methyltransferase (SAMT) {Clarkia breweri [TaxId: 36903]} Back     information, alignment and structure
>d1w36d1 c.37.1.19 (D:2-360) Exodeoxyribonuclease V alpha chain (RecD) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1yvra1 a.118.25.1 (A:5-363) 60-kda SS-aARo ribonucleoprotein {African clawed frog (Xenopus laevis) [TaxId: 8355]} Back     information, alignment and structure
>d2hrca1 c.92.1.1 (A:65-423) Ferrochelatase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qcxa_ b.80.1.2 (A:) Pectin lyase {Aspergillus niger, type B [TaxId: 5061]} Back     information, alignment and structure
>d1idka_ b.80.1.2 (A:) Pectin lyase {Aspergillus niger, type A [TaxId: 5061]} Back     information, alignment and structure
>d1o2da_ e.22.1.2 (A:) Alcohol dehydrogenase TM0920 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1m7ja3 c.1.9.11 (A:62-419) N-acyl-D-aminoacid amidohydrolase, catalytic domain {Alcaligenes faecalis [TaxId: 511]} Back     information, alignment and structure
>d2hdsa1 e.3.1.1 (A:4-361) AMPC beta-Lactamase, class C {Escherichia coli, cephalosporinase [TaxId: 562]} Back     information, alignment and structure
>d1jkma_ c.69.1.2 (A:) Carboxylesterase {Bacillus subtilis, brefeldin A esterase [TaxId: 1423]} Back     information, alignment and structure
>d1ecea_ c.1.8.3 (A:) Endocellulase E1 {Acidothermus cellulolyticus [TaxId: 28049]} Back     information, alignment and structure
>d1dosa_ c.1.10.2 (A:) Fructose-bisphosphate aldolase (FBP aldolase) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1uwva2 c.66.1.40 (A:75-432) rRNA (Uracil-5-)-methyltransferase RumA, catalytic domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1edqa2 c.1.8.5 (A:133-443,A:517-563) Chitinase A, catalytic domain {Serratia marcescens [TaxId: 615]} Back     information, alignment and structure
>d2qapa1 c.1.10.1 (A:1-357) Fructose-1,6-bisphosphate aldolase {Trypanosome (Leishmania mexicana) [TaxId: 5665]} Back     information, alignment and structure
>d1taza_ a.211.1.2 (A:) Catalytic domain of cyclic nucleotide phosphodiesterase 1b, PDE1B {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2b61a1 c.69.1.40 (A:2-358) Homoserine O-acetyltransferase {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1a05a_ c.77.1.1 (A:) 3-isopropylmalate dehydrogenase, IPMDH {Thiobacillus ferrooxidans [TaxId: 920]} Back     information, alignment and structure
>d1t1ga_ c.41.1.2 (A:) Serine-carboxyl proteinase, SCP {Bacillus novosp. MN-32, kumamolisin [TaxId: 198803]} Back     information, alignment and structure
>d2amxa1 c.1.9.1 (A:20-376) Adenosine deaminase (ADA) {Plasmodium yoelii [TaxId: 5861]} Back     information, alignment and structure
>d1yyda1 a.93.1.1 (A:1-357) Fungal peroxidase (ligninase) {Basidomycetos fungus (Phanerochaete chrysosporium) [TaxId: 5306]} Back     information, alignment and structure
>d1gcya2 c.1.8.1 (A:1-357) G4-amylase (1,4-alpha-D-glucan maltotetrahydrolase) {Pseudomonas stutzeri [TaxId: 316]} Back     information, alignment and structure
>d1mppa_ b.50.1.2 (A:) Pepsin {Mucor pusillus [TaxId: 4840]} Back     information, alignment and structure
>d1g01a_ c.1.8.3 (A:) Alkaline cellulase K catalytic domain {Bacillus sp. [TaxId: 1409]} Back     information, alignment and structure
>d1db3a_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d16vpa_ d.180.1.1 (A:) Conserved core of transcriptional regulatory protein vp16 {Herpes simplex virus type 1 [TaxId: 10298]} Back     information, alignment and structure
>d1r3sa_ c.1.22.1 (A:) Uroporphyrinogen decarboxylase, UROD {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w8oa3 b.68.1.1 (A:47-402) Micromonospora sialidase, N-terminal domain {Micromonospora viridifaciens [TaxId: 1881]} Back     information, alignment and structure
>d1rkxa_ c.2.1.2 (A:) CDP-glucose-4,6-dehydratase {Yersinia pseudotuberculosis [TaxId: 633]} Back     information, alignment and structure
>d1lbqa_ c.92.1.1 (A:) Ferrochelatase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1v53a1 c.77.1.1 (A:1-356) 3-isopropylmalate dehydrogenase, IPMDH {Bacillus coagulans [TaxId: 1398]} Back     information, alignment and structure
>d1l0wa3 d.104.1.1 (A:105-294,A:415-580) Aspartyl-tRNA synthetase (AspRS) {Thermus thermophilus, AspRS-1 [TaxId: 274]} Back     information, alignment and structure
>d1jnra2 c.3.1.4 (A:2-256,A:402-502) Adenylylsulfate reductase A subunit {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2ebsa2 b.69.13.1 (A:431-786) Oligoxyloglucan reducing end-specific cellobiohydrolase {Yeast (Geotrichum sp. M128) [TaxId: 203496]} Back     information, alignment and structure
>d1goia2 c.1.8.5 (A:3-291,A:380-446) Chitinase B, catalytic domain {Serratia marcescens [TaxId: 615]} Back     information, alignment and structure
>d1jaka1 c.1.8.6 (A:151-506) beta-N-acetylhexosaminidase {Streptomyces plicatus [TaxId: 1922]} Back     information, alignment and structure
>d1vbga1 c.1.12.2 (A:521-876) Pyruvate phosphate dikinase, C-terminal domain {Maize (Zea mays) [TaxId: 4577]} Back     information, alignment and structure
>d3bu7a1 b.82.1.23 (A:19-373) Gentisate 1,2-dioxygenase {Silicibacter pomeroyi [TaxId: 89184]} Back     information, alignment and structure
>d1fuia2 c.85.1.1 (A:1-355) L-fucose isomerase, N-terminal and second domains {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1luca_ c.1.16.1 (A:) Bacterial luciferase alpha chain, LuxA {Vibrio harveyi [TaxId: 669]} Back     information, alignment and structure
>d2bbkh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d2b1pa1 d.144.1.7 (A:46-400) c-jun N-terminal kinase (jnk3s) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jbqa_ c.79.1.1 (A:) Cystathionine beta-synthase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1iq8a1 c.1.20.1 (A:6-360) Archaeosine tRNA-guanine transglycosylase, N-terminal domain {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure