Citrus Sinensis ID: 001628

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820-------830-------840-------850-------860-------870-------880-------890-------900-------910-------920-------930-------940-------950-------960-------970-------980-------990------1000------1010------1020------1030------1040--
MFVKTLVEKASMKKPGGSSDGLKSSDVDPRLVFHYGFPSGCNKFAYDPLQKILAAATKDGRIKLYGRHNNTQALLESSEAVSTKFLQFLENQGILLNVTSTNLIEVWDIDKKRLSHVHVCKEEITSFTIMQHSNYMLLGDTAGKISVLKLDQESSQIVKMKYIIPLSASHGNEVSGDPAVINILPQPTAESKRILIIFRDGLISLWDIRESKSIFSMGGNVLQSVYHETKQVTSACWACPIGSKVAVGYSNGEILIWGVPSILNLKTEECGTQITPICKLNLGYKLDKIPISSLKWVYADGKASRLYIMGASDFVSMNLLQIVLLNEQTESRTTKLALPLSEPCIDMEIISSSSDPNKPKQDSFLLLGKSGHFYAFDDCQIERYLLQYQSRSPPSAPKEVMLKMPFLDSSITAMKLITGNSFILSSADEDYSLLAKSVPPLLDFETKLKDGSQSHSKVKNLFITGHSDGAINFWDVSCPLFLLILSLKQQSEKDFSLSGIPLTALYYDGTSRVLVSGDQSGMVRIFKLKYEPHAIENSFLSFTGSKKGNSHIIHSVKVMKINGSIISLNMNRNSQHLAVGSDQGYVYLLDTEGPTVLYQKHIASDISSGIVSLQFETCSLQGFEKNFLVIATKDSSVLVLDSDNGNMLSTNLIHPKKPSRALFMQILNGQDGLARGANLSNVAGMNKGSPKENAVPKQWFVLLCSEKAACAYSLSHAVQGVKKVLYKKKFHSSSCCWASTFYSGSDVGLMLLFTSGKFEIRSLPELSLLKETSIRGFVYLTPKPNSLSNTLMCSSWDGELIMVNGNQEAFFISALRQRDFFRFLDSACQVYSYDPTLLQEGVVSASIVQTEKKKGIFGSVLKGNKTKQAPDVEREETWEIIEELATIFSTANFQCDSENTVNLDLEEDEDLLNIDDIDLDGIREKPKEQSMLAVMNKQILSSKLQAFKGKWKQMKGKNEKNNMKEEQQDEKTGAVDQIKKKYGFSHSGEPSVAKMAESKLHENSKKLQGINLKTTEMQDTARSFSSMAKEVLRIAEHDKKSS
cHHHHHHHHccccccccccccccccccccEEEEEEccccccEEEEEcccccEEEEEEccccEEEEcccccEEEEEEccccccEEEEEEEccccEEEEEEccccEEEEEcccccEEEEEEEcccEEEEEEcccccEEEEEcccccEEEEEEcccccEEEEEEEEcccccccccccccccccEEEEEccccccccEEEEEcccEEEEEEccccccEEEcccccccEEEEccccEEEEEEEcccccEEEEEEccccEEEEEccccccccccccccccccccccccccccccccccEEEEEEEcccccEEEEEccccccccccEEEEEEcccccccEEEcccccccccEEEEEccccccccccccccEEEEcccccEEEEEcccccEEEEcccccccccccccccccccccccccEEEEEEcccccccccccccccccccccccccccccccccccccccccccEEEEEEcccEEEEEccccccEEEEEEEccccccccccccccEEEEEEEccccEEEEEcccccEEEEEEccccccccccEEccccccccccccEEEEEEEEccccEEEEEEEccccEEEEEEcccEEEEEEccccEEEEEEEccccccccEEEEEEEEccccccccEEEEEEEcccEEEEEEcccccEEEEEEcccccccccEEEEEEccccccccccccccccccccccccccccccccEEEEEEcccEEEEEcccEEcccEEEEEEEcccccccEEEEEEEEcccEEEEEEEEEcEEEEEEccccccccEEEccccccccccccccccccEEEcccccEEEEEccEEEEEEEEEEEcccEEcccccccccccccccccccEEEccccccccccEEEEEEEccccccccccccccHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHcHHHHHHcccccccccccccccccccccccccccHHHHHHHcccccccccHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccc
cHHHHHccccccccccHHHHHccHHHccHHHHHHccccccccEEcccHHHEEEEEEcccccEEEEEccccEEEEEEccccccEEEEEEEccccEEEEEEcccEEEEEEEcccccEEEEccccEEEEEEEcccccEEEEEcccccEEEEEEcccccEEEEccEEEEcccccccccccccccEEEEccccccccEEEEEEcccEEEEEEcccccEEEEcccccccccccccccEEEEEEEcccccEEEEEEccccEEEEEccccccccccccccccccccccccccccccccEEEEEEEEccccccEEEEEEcccccccccEEEEEEEEEccccEEEEEEEccccEEEEEEEccccccccccccEEEEEEccccEEEEEccHccccccccccccccccccccccccccccccEEEEEccccccHHHHHHHHHHHHHHccccccccccccccccccccccccEEEEEccccccEEEEccccccHHHHEEcccccEEcccccccEEEEEEEcccccEEEEEEcccEEEEEEEccccccccccEEEEEccccccccccccEEEEEccccEEEEEEccccEEEcccccccEEEEEEcccccEEEEEEccccccccEEEEEEccccccccccEEEEEEccccEEEEEccccccEEccccccccccccccEEEEEccccccccccccccccccccccccccccccccEEEEEccccEEEEEcHHHHHccccEHEEccccccccEccccccccccEEEEEEEEccEEEEEEcccHHHHHHcccccccccccccccccccEEEEccccEEEEEccccEEEEEEEEccccccccccccccEEccccHHHHHHHcccccccHHHHccccHHHEcccccccccccccccHHHHHHHHHHHHcccccccccccccccccccHHHHHcccccccccccccccccccccccccccccHHHHHccccccccccccccccccccccccccccHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHcccc
MFVKTLVEKasmkkpggssdglkssdvdprlvfhygfpsgcnkfayDPLQKILAAATKDgriklygrhnntqalLESSEAVSTKFLQFLENQGILLNVTSTNLIEVWDIDKKRLSHVHVCKEEITsftimqhsnymllgdTAGKISVLKLDQESSQIVKMKYIiplsashgnevsgdpavinilpqptaesKRILIIFRDGLISLWDIRESKSIFSMGGNVLQSVYHETKQvtsacwacpigskvavgysngeiliwgvpsilnlkteecgtqitpicklnlgykldkipisslkwvyadgkasrlYIMGASDFVSMNLLQIVLLNeqtesrttklalplsepcidmeiissssdpnkpkqdsflllgksghfyafddCQIERYLLqyqsrsppsapkevmlkmpfldssITAMKLITGNSFILSSADEDYSLlaksvpplldfetklkdgsqshsKVKNLFITghsdgainfwdvSCPLFLLILSLKQQsekdfslsgipltalyydgtsrvlvsgdqsgmvRIFKlkyephaiensflsftgskkgnshiIHSVKVMKINGSIISLnmnrnsqhlavgsdqgyvYLLDTEGPTVLYQKHIASDISSGIVSLQFETCSLQGFEKNFLVIAtkdssvlvldsdngnmlstnlihpkkpsRALFMQILNGqdglarganlsnvagmnkgspkenavpKQWFVLLCSEKAACAYSLSHAVQGVKKVLYKkkfhsssccwastfysgsdVGLMLLFTSgkfeirslpelsllketsirgfvyltpkpnslsntlmcsswdgelIMVNGNQEAFFISALRQRDFFRFLDSAcqvysydptllqegVVSASIVqtekkkgifgsvlkgnktkqapdverEETWEIIEELATIFStanfqcdsentvnldleededllniddidldgirekpkEQSMLAVMNKQILSSKLQAFKGKWkqmkgkneknnmkeeqqdektGAVDQIkkkygfshsgepsVAKMAESKLHENSKKLQGINLKTTEMQDTARSFSSMAKEVLRIAEHDKKSS
mfvktlvekasmkkpggssdglkssDVDPRLVFHYGFPSGCNKFAYDPLQKILAAATKDGRIKLYGRHNNTQALLESSEAVSTKFLQFLENQGILLNVTSTNLIEVWDIDKKRLSHVHVCKEEITsftimqhsNYMLLGDTAGKISVLKLDQESSQIVKMKYIIPLSASHGNEVSGDPAVINILPQPTAESKRILIIFRDGLISLWDIRESKSIFSMGGNVLQSVYHETKQVTSACWACPIGSKVAVGYSNGEILIWGVPSILNLKTEECGTQITPICKLNLGYKLDKIPISSLKWVYADGKASRLYIMGASDFVSMNLLQIVLLNEQTESRTTKLALPLSEPCIDMEIissssdpnkPKQDSFLLLGKSGHFYAFDDCQIERYLLQYQSRSPPSAPKEVMLKMPFLDSSITAMKLITGNSFILSSADEDYSLLAKSVPPLLDFETKLKDGSQSHSKVKNLFITGHSDGAINFWDVSCPLFLLILSLKQQSEKDFSLSGIPLTALYYDGTSRVLVSGDQSGMVRIFKLKYEPHAIENSFLsftgskkgnSHIIHSVKVMKINGSIISLNMNRNSQHLAVGSDQGYVYLLDTEGPTVLYQKHIASDISSGIVSLQFETCSLQGFEKNFLVIATKDSSVLVLDSDNGNMLSTNLIHPKKPSRALFMQILNGQDGLARGANLSNVAGMNKGSPKENAVPKQWFVLLCSEKAACAYSLSHAVQGVKKVLYKKKFHSSSCCWASTFYSGSDVGLMLLFTSGKFEIRSLPELSLLKETSIRGFVyltpkpnslsNTLMCSSWDGELIMVNGNQEAFFISALRQRDFFRFLDSACQVYSYDPTLLQEGVVSASivqtekkkgifgsvlkgnktkqapdverEETWEIIEELATIFSTANFQCDSENTVNLDLEEDEDLLNIDDIDLDGIREKPKEQSMLAVMNKQILSSKLQAFKGKWkqmkgkneknnmkeeqqdektgaVDQIKKkygfshsgepSVAKMAESKlhenskklqginlkttemqdtARSFSSMAKEVLRIAEHDKKSS
MFVKTLVEKASMKKPGGSSDGLKSSDVDPRLVFHYGFPSGCNKFAYDPLQKILAAATKDGRIKLYGRHNNTQALLESSEAVSTKFLQFLENQGILLNVTSTNLIEVWDIDKKRLSHVHVCKEEITSFTIMQHSNYMLLGDTAGKISVLKLDQESSQIVKMKYIIPLSASHGNEVSGDPAVINILPQPTAESKRILIIFRDGLISLWDIRESKSIFSMGGNVLQSVYHETKQVTSACWACPIGSKVAVGYSNGEILIWGVPSILNLKTEECGTQITPICKLNLGYKLDKIPISSLKWVYADGKASRLYIMGASDFVSMNLLQIVLLNEQTESRTTKLALPLSEPCIDMEIISSSSDPNKPKQDSFLLLGKSGHFYAFDDCQIERYLLQYQSRSPPSAPKEVMLKMPFLDSSITAMKLITGNSFILSSADEDYSLLAKSVPPLLDFETKLKDGSQSHSKVKNLFITGHSDGAINFWDVSCPLFLLILSLKQQSEKDFSLSGIPLTALYYDGTSRVLVSGDQSGMVRIFKLKYEPHAIENSFLSFTGSKKGNSHIIHSVKVMKINGSIISLNMNRNSQHLAVGSDQGYVYLLDTEGPTVLYQKHIASDISSGIVSLQFETCSLQGFEKNFLVIATKDSSVLVLDSDNGNMLSTNLIHPKKPSRALFMQILNGQDGLARGANLSNVAGMNKGSPKENAVPKQWFVLLCSEKAACAYSLSHAVQGVKKVLYKKKFHSSSCCWASTFYSGSDVGLMLLFTSGKFEIRSLPELSLLKETSIRGFVYLTPKPNSLSNTLMCSSWDGELIMVNGNQEAFFISALRQRDFFRFLDSACQVYSYDPTLLQEGVVSASIVQTEKKKGIFGSVLKGNKTKQAPDVereetweiieeLATIFSTANFQCDSENTVnldleededllniddidldGIREKPKEQSMLAVMNKQILSSKLQAFKGKWkqmkgkneknnmkeeqqdekTGAVDQIKKKYGFSHSGEPSVAKMAESKLHENSKKLQGINLKTTEMQDTARSFSSMAKEVLRIAEHDKKSS
*****************************RLVFHYGFPSGCNKFAYDPLQKILAAATKDGRIKLYGRHNNTQALLESSEAVSTKFLQFLENQGILLNVTSTNLIEVWDIDKKRLSHVHVCKEEITSFTIMQHSNYMLLGDTAGKISVLKLDQESSQIVKMKYIIPLSASHGNEVSGDPAVINILPQPTAESKRILIIFRDGLISLWDIRESKSIFSMGGNVLQSVYHETKQVTSACWACPIGSKVAVGYSNGEILIWGVPSILNLKTEECGTQITPICKLNLGYKLDKIPISSLKWVYADGKASRLYIMGASDFVSMNLLQIVLLNEQT****TKLALPLSEPCID*****************FLLLGKSGHFYAFDDCQIERYLLQY************MLKMPFLDSSITAMKLITGNSFILSSADEDYSLLAKSVPPLLDFE************VKNLFITGHSDGAINFWDVSCPLFLLILSLKQQSEKDFSLSGIPLTALYYDGTSRVLVSGDQSGMVRIFKLKYEPHAIENSFLSFTGSKKGNSHIIHSVKVMKINGSIISLNMNRNSQHLAVGSDQGYVYLLDTEGPTVLYQKHIASDISSGIVSLQFETCSLQGFEKNFLVIATKDSSVLVLDSDNGNMLSTNLIH*****RALFMQILNGQDGL*********************VPKQWFVLLCSEKAACAYSLSHAVQGVKKVLYKKKFHSSSCCWASTFYSGSDVGLMLLFTSGKFEIRSLPELSLLKETSIRGFVYLTPKPNSLSNTLMCSSWDGELIMVNGNQEAFFISALRQRDFFRFLDSACQVYSYDPTLLQEGVVSASIVQTEKKKGIFGSVLK************EETWEIIEELATIFSTANFQCDSENTVNLDLEEDEDLLNIDDIDLDG*************************************************************************************************************************
**************************VDPRLVFHYGFPSGCNKFAYDPLQKILAAATKDGRIKLYGRHNNTQALLESSEAVSTKFLQFLENQGILLNVTSTNLIEVWDIDKKRLSHVHVCKEEITSFTIMQHSNYMLLGDTAGKISVLKLDQESSQIVKMKYIIPLSASHGNEVSGDPAVINILPQPTAESKRILIIFRDGLISLWDIRESKSIFSMGGNVLQSVYHETKQVTSACWACPIGSKVAVGYSNGEILIWGVPSIL************PICKLNLGYKLDKIPISSLKWVYADGKASRLYIMGASDFVSMNLLQIVLLNEQTESRTTKLALPLSEPCIDMEIISSSSDPNKPKQDSFLLLGKSGHFYAFDDCQIERYLLQYQSRSPPSAPKEVMLKMPFLDSSITAMKLITGNSFILSSADEDYSLLAKSVPPLLDFETKLKDGSQSHSKVKNLFITGHSDGAINFWDVSCPLFLLILSLKQQSEKDFSLSGIPLTALYYDGTSRVLVSGDQSGMVRIFKLKYEPHAIE***********G*SHIIHSVKVMKINGSIISLNMNRNSQHLAVGSDQGYVYLLDTEGPTVLYQKHIASDISSGIVSLQFET****GFEKNFLVIATKDSSVLVLDSDNGNMLSTNLI**K**SRALFMQ*********************************WFVLLCSEKAACAYSLSHAVQGVKKVLYKKKFHSSSCCWASTFYSGSDVGLMLLFTSGKFEIRSLPELSLLKETSIRGFV******************DGELIMVNGNQEAFFISALRQRDFFRFLDSACQVYSYDPTLLQ*********************L******************IIEELATIFSTAN******************LLNIDDIDL***************************************************************************************************************************
MFVKTLVEKA*************SSDVDPRLVFHYGFPSGCNKFAYDPLQKILAAATKDGRIKLYGRHNNTQALLESSEAVSTKFLQFLENQGILLNVTSTNLIEVWDIDKKRLSHVHVCKEEITSFTIMQHSNYMLLGDTAGKISVLKLDQESSQIVKMKYIIPLSASHGNEVSGDPAVINILPQPTAESKRILIIFRDGLISLWDIRESKSIFSMGGNVLQSVYHETKQVTSACWACPIGSKVAVGYSNGEILIWGVPSILNLKTEECGTQITPICKLNLGYKLDKIPISSLKWVYADGKASRLYIMGASDFVSMNLLQIVLLNEQTESRTTKLALPLSEPCIDMEIISSSSDPNKPKQDSFLLLGKSGHFYAFDDCQIERYLLQYQSRSPPSAPKEVMLKMPFLDSSITAMKLITGNSFILSSADEDYSLLAKSVPPLLDFETKLKDGSQSHSKVKNLFITGHSDGAINFWDVSCPLFLLILSLKQQSEKDFSLSGIPLTALYYDGTSRVLVSGDQSGMVRIFKLKYEPHAIENSFLSFTGSKKGNSHIIHSVKVMKINGSIISLNMNRNSQHLAVGSDQGYVYLLDTEGPTVLYQKHIASDISSGIVSLQFETCSLQGFEKNFLVIATKDSSVLVLDSDNGNMLSTNLIHPKKPSRALFMQILNGQDGLARGANLSNVAGMNKGSPKENAVPKQWFVLLCSEKAACAYSLSHAVQGVKKVLYKKKFHSSSCCWASTFYSGSDVGLMLLFTSGKFEIRSLPELSLLKETSIRGFVYLTPKPNSLSNTLMCSSWDGELIMVNGNQEAFFISALRQRDFFRFLDSACQVYSYDPTLLQEGVVSASIVQTEKKKGIFGSVLKGN*********REETWEIIEELATIFSTANFQCDSENTVNLDLEEDEDLLNIDDIDLDGIREKPKEQSMLAVMNKQILSSKLQAFKG*************************VDQIKKKYGFSHSGEPSVAKMAESKLHENSKKLQGINLKTTEMQDTARSFSSMAKEVLRIAEHDKKSS
***************GGSSDGLKSSDVDPRLVFHYGFPSGCNKFAYDPLQKILAAATKDGRIKLYGRHNNTQALLESSEAVSTKFLQFLENQGILLNVTSTNLIEVWDIDKKRLSHVHVCKEEITSFTIMQHSNYMLLGDTAGKISVLKLDQESSQIVKMKYIIPLSASHGNEVSGDPAVINILPQPTAESKRILIIFRDGLISLWDIRESKSIFSMGGNVLQSVYHETKQVTSACWACPIGSKVAVGYSNGEILIWGVPSILNLKTEECGTQITPICKLNLGYKLDKIPISSLKWVYADGKASRLYIMGASDFVSMNLLQIVLLNEQTESRTTKLALPLSEPCIDMEIISSSSDPNKPKQDSFLLLGKSGHFYAFDDCQIERYLLQYQSRSPPSAPKEVMLKMPFLDSSITAMKLITGNSFILSSADEDYSLLAKSVPPLLDFETKLKDGSQSHSKVKNLFITGHSDGAINFWDVSCPLFLLILSLKQQSEKDFSLSGIPLTALYYDGTSRVLVSGDQSGMVRIFKLKYEPHAIENSFLSFTGSKKGNSHIIHSVKVMKINGSIISLNMNRNSQHLAVGSDQGYVYLLDTEGPTVLYQKHIASDISSGIVSLQFETCSLQGFEKNFLVIATKDSSVLVLDSDNGNMLSTNLIHPKKPSRALFMQILNGQ************************VPKQWFVLLCSEKAACAYSLSHAVQGVKKVLYKKKFHSSSCCWASTFYSGSDVGLMLLFTSGKFEIRSLPELSLLKETSIRGFVYLTPKPNSLSNTLMCSSWDGELIMVNGNQEAFFISALRQRDFFRFLDSACQVYSYDPTLLQEGVVSASIVQTEKKKGIFGSVLKGNKTK*A****R*E*WEI*E*LATIFSTANFQCD*******DLEEDEDLLNIDDIDLD****************************************************GAVDQIKKKYGFSHSGEPSVAKMAESKLHENSKKLQGINLKTTEMQDTARSFSSMAKEVLRIAE******
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MFVKTLVEKASMKKPGGSSDGLKSSDVDPRLVFHYGFPSGCNKFAYDPLQKILAAATKDGRIKLYGRHNNTQALLESSEAVSTKFLQFLENQGILLNVTSTNLIEVWDIDKKRLSHVHVCKEEITSFTIMQHSNYMLLGDTAGKISVLKLDQESSQIVKMKYIIPLSASHGNEVSGDPAVINILPQPTAESKRILIIFRDGLISLWDIRESKSIFSMGGNVLQSVYHETKQVTSACWACPIGSKVAVGYSNGEILIWGVPSILNLKTEECGTQITPICKLNLGYKLDKIPISSLKWVYADGKASRLYIMGASDFVSMNLLQIVLLNEQTESRTTKLALPLSEPCIDMEIISSSSDPNKPKQDSFLLLGKSGHFYAFDDCQIERYLLQYQSRSPPSAPKEVMLKMPFLDSSITAMKLITGNSFILSSADEDYSLLAKSVPPLLDFETKLKDGSQSHSKVKNLFITGHSDGAINFWDVSCPLFLLILSLKQQSEKDFSLSGIPLTALYYDGTSRVLVSGDQSGMVRIFKLKYEPHAIENSFLSFTGSKKGNSHIIHSVKVMKINGSIISLNMNRNSQHLAVGSDQGYVYLLDTEGPTVLYQKHIASDISSGIVSLQFETCSLQGFEKNFLVIATKDSSVLVLDSDNGNMLSTNLIHPKKPSRALFMQILNGQDGLARGANLSNVAGMNKGSPKENAVPKQWFVLLCSEKAACAYSLSHAVQGVKKVLYKKKFHSSSCCWASTFYSGSDVGLMLLFTSGKFEIRSLPELSLLKETSIRGFVYLTPKPNSLSNTLMCSSWDGELIMVNGNQEAFFISALRQRDFFRFLDSACQVYSYDPTLLQEGVVSASIVQTEKKKGIFGSVLKGNKTKQAPDVEREETWEIIEELATIFSTANFQCDSENTVNLDLEEDEDLLNIDDIDLDGIREKPKEQSMLAVMNKQILSSKLQAFKGKWKQMKGKNEKNNMKEEQQDEKTGAVDQIKKKYGFSHSGEPSVAKMAESKLHENSKKLQGINLKTTEMQDTARSFSSMAKEVLRIAEHDKKSS
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query1042 2.2.26 [Sep-21-2011]
Q9WU70 1152 Syntaxin-binding protein yes no 0.201 0.182 0.269 8e-17
Q5T5C0 1151 Syntaxin-binding protein yes no 0.201 0.182 0.269 9e-17
Q8K400 1152 Syntaxin-binding protein yes no 0.201 0.182 0.264 1e-16
Q5DQR4 1185 Syntaxin-binding protein no no 0.220 0.194 0.246 3e-13
Q9Y2K9 1186 Syntaxin-binding protein no no 0.202 0.177 0.246 1e-12
Q5SQE21159 Syntaxin-binding protein no no 0.198 0.178 0.234 1e-10
Q3TJ911027 Lethal(2) giant larvae pr no no 0.371 0.376 0.207 1e-06
Q08470 1166 Protein lethal(2) giant l no no 0.166 0.148 0.23 2e-05
Q7SZE31020 Lethal(2) giant larvae pr no no 0.197 0.201 0.224 2e-05
P08111 1161 Lethal(2) giant larvae pr no no 0.172 0.155 0.237 7e-05
>sp|Q9WU70|STXB5_RAT Syntaxin-binding protein 5 OS=Rattus norvegicus GN=Stxbp5 PE=1 SV=1 Back     alignment and function desciption
 Score = 90.1 bits (222), Expect = 8e-17,   Method: Compositional matrix adjust.
 Identities = 63/234 (26%), Positives = 113/234 (48%), Gaps = 24/234 (10%)

Query: 34  HYGFPSGCNKFAYDPLQKILAAATKDGRIKLYGRHNNTQALLESSEAVSTKFLQFLENQG 93
            +GFP   +  A+DP+QKILA  T+ G ++L+GR    +   +     +   LQFL N+G
Sbjct: 54  RHGFPYQPSALAFDPVQKILAVGTQTGALRLFGR-PGVECYCQHDSGAAVIQLQFLINEG 112

Query: 94  ILLNVTSTNLIEVWDIDKKRLSHVH---VCKEEITSFTIMQHSNYMLLGDTAGKISVLKL 150
            L++  + + + +W++ +KR + +H    C+E +T   +   S ++ +G   G I ++ +
Sbjct: 113 ALVSALADDTLHLWNLRQKRPAVLHSLKFCRERVTFCHLPFQSKWLYVGTERGNIHIVNV 172

Query: 151 DQ--ESSQIVKMKYIIPLSA-SHGNEVSGDPAVINILPQPTAESKRILIIFRDGLISLWD 207
           +    S  ++     I LS+ SH         V++I   P  E K +LI F  G + LWD
Sbjct: 173 ESFTLSGYVIMWNKAIELSSKSHPG------PVVHISDNPMDEGK-LLIGFESGTVVLWD 225

Query: 208 IRESKSIFSMGGNVLQSVYHETKQVTSACWACPIGSKVAVGYSNGEILIWGVPS 261
           ++  K+ +          Y   + + S  W    G +    +S+G + IW V S
Sbjct: 226 LKSKKADYR---------YTYDEAIHSVAWHHE-GKQFICSHSDGTLTIWNVRS 269
Inhibits translocation of GLUT4 from intracellular vesicles to the plasma membrane (By similarity). Plays a regulatory role in calcium-dependent exocytosis and neurotransmitter release. Inhibits membrane fusion between transport vesicles and the plasma membrane. May modulate the assembly of trans-SNARE complexes between transport vesicles and the plasma membrane. Competes with STXBP1 for STX1 binding.
Rattus norvegicus (taxid: 10116)
>sp|Q5T5C0|STXB5_HUMAN Syntaxin-binding protein 5 OS=Homo sapiens GN=STXBP5 PE=1 SV=1 Back     alignment and function description
>sp|Q8K400|STXB5_MOUSE Syntaxin-binding protein 5 OS=Mus musculus GN=Stxbp5 PE=1 SV=3 Back     alignment and function description
>sp|Q5DQR4|STB5L_MOUSE Syntaxin-binding protein 5-like OS=Mus musculus GN=Stxbp5l PE=1 SV=1 Back     alignment and function description
>sp|Q9Y2K9|STB5L_HUMAN Syntaxin-binding protein 5-like OS=Homo sapiens GN=STXBP5L PE=2 SV=2 Back     alignment and function description
>sp|Q5SQE2|STB5L_DANRE Syntaxin-binding protein 5-like OS=Danio rerio GN=stxbp5l PE=3 SV=1 Back     alignment and function description
>sp|Q3TJ91|L2GL2_MOUSE Lethal(2) giant larvae protein homolog 2 OS=Mus musculus GN=Llgl2 PE=2 SV=2 Back     alignment and function description
>sp|Q08470|L2GL_DROPS Protein lethal(2) giant larvae OS=Drosophila pseudoobscura pseudoobscura GN=l(2)gl PE=1 SV=3 Back     alignment and function description
>sp|Q7SZE3|L2GL2_DANRE Lethal(2) giant larvae protein homolog 2 OS=Danio rerio GN=llgl2 PE=1 SV=1 Back     alignment and function description
>sp|P08111|L2GL_DROME Lethal(2) giant larvae protein OS=Drosophila melanogaster GN=l(2)gl PE=1 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query1042
2254314231053 PREDICTED: uncharacterized protein LOC10 0.995 0.984 0.651 0.0
2960886521054 unnamed protein product [Vitis vinifera] 0.983 0.972 0.638 0.0
3565610561055 PREDICTED: uncharacterized protein LOC10 0.997 0.984 0.619 0.0
3565296751061 PREDICTED: uncharacterized protein LOC10 0.997 0.979 0.609 0.0
4494569491052 PREDICTED: uncharacterized protein LOC10 0.984 0.975 0.601 0.0
4494951151053 PREDICTED: uncharacterized protein LOC10 0.984 0.974 0.600 0.0
3574841591124 Syntaxin-binding protein [Medicago trunc 0.974 0.903 0.554 0.0
356538385961 PREDICTED: uncharacterized protein LOC10 0.904 0.981 0.580 0.0
1453535941049 transducin/WD40 domain-containing protei 0.973 0.966 0.538 0.0
3341871941050 transducin/WD40 domain-containing protei 0.973 0.965 0.539 0.0
>gi|225431423|ref|XP_002280019.1| PREDICTED: uncharacterized protein LOC100262676 [Vitis vinifera] Back     alignment and taxonomy information
 Score = 1310 bits (3389), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 689/1058 (65%), Positives = 830/1058 (78%), Gaps = 21/1058 (1%)

Query: 1    MFVKTLVEKASMKKPGGSSDGLKSSDVDPRLVFHYGFPSGCNKFAYDPLQKILAAATKDG 60
            MFVK LVEKAS KKPGGS DGLKS DVDPRLVFHYG P G   FAYD +QKILA AT+DG
Sbjct: 1    MFVKKLVEKAS-KKPGGSLDGLKSQDVDPRLVFHYGIPGGSILFAYDSIQKILAIATRDG 59

Query: 61   RIKLYGRHNNTQALLESSEAVSTKFLQFLENQGILLNVTSTNLIEVWDIDKKRLSHVHVC 120
            RIKL+G+ +NTQALLES+E V +KFLQF+ENQGILLNVT+ N IEVWDIDKK LSHVHV 
Sbjct: 60   RIKLFGK-DNTQALLESNETVPSKFLQFIENQGILLNVTAENHIEVWDIDKKLLSHVHVF 118

Query: 121  KEEITSFTIMQHSNYMLLGDTAGKISVLKLDQESSQIVKMKYIIPLSASHGN--EVSGDP 178
            KEEITSF +MQ S +M LGD++G ISVLKL+QE   +V+MKY IP +ASHGN  EV+G  
Sbjct: 119  KEEITSFMVMQRSFFMYLGDSSGNISVLKLEQEPCHMVQMKYTIPSTASHGNPTEVAGGT 178

Query: 179  AVINILPQPTAESKRILIIFRDGLISLWDIRESKSIFSMGGNVLQSVYHETKQVTSACWA 238
            AV++ILPQPTAESKR+LIIFRDGLI LWDIRESK IF  G N+LQ + H+TK VTSACWA
Sbjct: 179  AVMHILPQPTAESKRVLIIFRDGLIVLWDIRESKVIFKTGVNMLQPLSHDTKTVTSACWA 238

Query: 239  CPIGSKVAVGYSNGEILIWGVPSILNLKTEECG------TQITPICKLNLGYKLDKIPIS 292
            CP G KV VGYSNG++ IW V  I +             +Q  PI KLNLGYKL+KIPI+
Sbjct: 239  CPFGGKVVVGYSNGDVFIWNVLHIPDPSNGAAADKDLYSSQSAPIYKLNLGYKLEKIPIA 298

Query: 293  SLKWVYADGKASRLYIMGASDFVSMNLLQIVLLNEQTESRTTKLALPLSEPCIDMEIISS 352
            SLKW YADGKA+RLY+MG SD  S NLLQ++LLNEQTESRT KL + L EPC+DM I+SS
Sbjct: 299  SLKWAYADGKATRLYVMGGSDIQSTNLLQVILLNEQTESRTIKLGIHLPEPCVDMVIVSS 358

Query: 353  SSDPNKPKQDSFLLLGKSGHFYAFDDCQIERYLLQYQSRSPPSAPKEVMLKMPFLDSSIT 412
            SS+ +K KQDSFLLLGKSG  YA+DD  IE+YLLQ QSRS PS PKE+M+K+PF DSSIT
Sbjct: 359  SSEQSKHKQDSFLLLGKSGCMYAYDDYVIEKYLLQCQSRSSPSLPKEIMVKLPFSDSSIT 418

Query: 413  AMKLITGNSFILSSADEDYSLLAKSVPPLLDFETKLKDGSQSHS-------KVKNLFITG 465
              K IT N   L+S+DEDY  LAKS+PP L  E K KD ++ +S       K+KNL+ITG
Sbjct: 419  IAKFITENPNFLNSSDEDYVSLAKSIPPFLPSEAKPKDETRLNSTNFGGFAKIKNLYITG 478

Query: 466  HSDGAINFWDVSCPLFLLILSLKQQSEKDFSLSGIPLTALYYDGTSRVLVSGDQSGMVRI 525
            HS+GAI FWD+SCP  L ILSLKQQSE D SLSGI LTALY+DG SR L+SGDQ+GMVRI
Sbjct: 479  HSNGAIYFWDLSCPFLLPILSLKQQSEDDLSLSGIALTALYFDGHSRYLISGDQNGMVRI 538

Query: 526  FKLKYEPHAIENSFLSFTGS-KKGNSHIIHSVKVMKINGSIISLNMNRNSQHLAVGSDQG 584
            FK K E +A   SF+   GS KKG++HII SVK++K+NGS++S++++R S+HLA+GSDQG
Sbjct: 539  FKFKTEAYATATSFMPLQGSTKKGSNHIIQSVKLIKVNGSVLSIDISRGSRHLAIGSDQG 598

Query: 585  YVYLLDTEGPTVLYQKHIASDISSGIVSLQFETCSLQGFEKNFLVIATKDSSVLVLDSDN 644
            YV L+D E P++LYQK I S++S+G++S+ FETC L GFEKN L +ATKDSS+L LDSD 
Sbjct: 599  YVSLIDMESPSLLYQKLIESELSTGVISVWFETCILHGFEKNILAVATKDSSILALDSDT 658

Query: 645  GNMLSTNLIHPKKPSRALFMQILNGQDGLARGANLSNVAGMNKGSPKENAVPKQWFVLLC 704
            GN LST++IHPKKPS+ALFMQIL+G D   + +  S    +NKG+  E++  KQ  +LLC
Sbjct: 659  GNTLSTSMIHPKKPSKALFMQILDGHDAFGKRSYTSENLDLNKGNYIEDS--KQLSLLLC 716

Query: 705  SEKAACAYSLSHAVQGVKKVLYKKKFHSSSCCWASTFYSGSDVGLMLLFTSGKFEIRSLP 764
            SEKAA  YSL+H +QG+KKV YKKKF+SS CCWASTFY+ SD GL+L+FT+GK EIRSLP
Sbjct: 717  SEKAAYVYSLTHVIQGIKKVHYKKKFNSSCCCWASTFYTPSDAGLVLIFTNGKIEIRSLP 776

Query: 765  ELSLLKETSIRGFVYLTPKPNSLSNTLMCSSWDGELIMVNGNQEAFFISALRQRDFFRFL 824
            ELSLLKETSI+G  + T K NSLSN+ +CSS DGE+I+VNG+QE F +S+L Q + +R L
Sbjct: 777  ELSLLKETSIKGLAFSTSKSNSLSNSSVCSSRDGEIIVVNGDQEMFALSSLLQNEIYRPL 836

Query: 825  DSACQVYSYDPTLLQEGVVSASIVQTEKKKGIFGSVLKGNKTKQAPDVEREETWEIIEEL 884
            DSA QVY  D  + QEG++S  +V  EKKKGIF SV+KG+KTK  PD+E E+  E IEEL
Sbjct: 837  DSARQVYRKDLVVSQEGLISGPLVHKEKKKGIFSSVIKGSKTKHVPDMEAEDAKESIEEL 896

Query: 885  ATIFSTANFQCDSENTVNLDLEEDEDLLNIDDIDLDGIREKPKEQSMLAVMNKQILSSKL 944
            ++IFS ANF   +    NLD++E+E  L+IDDIDL+   EKPK Q+M+A +NKQ L+SK 
Sbjct: 897  SSIFSVANFPLYAGKGDNLDMDEEEVELDIDDIDLEDPGEKPKGQNMMAALNKQKLTSKF 956

Query: 945  QAFKGKWKQMKGKNEKNNMKEEQQDEKTGAVDQIKKKYGFSHSGEPSVAKMAESKLHENS 1004
            QA KGK K +K KNEK++ KEE QDEK GAVDQIKKKYGF  SGE SV KMAESKL+EN 
Sbjct: 957  QALKGKLKHVKLKNEKSSTKEEPQDEKAGAVDQIKKKYGFPISGESSVIKMAESKLNENL 1016

Query: 1005 KKLQGINLKTTEMQDTARSFSSMAKEVLRIAEHDKKSS 1042
            KKLQGIN+KTTEMQDTA+SFS MAK+VLR AE DK+SS
Sbjct: 1017 KKLQGINIKTTEMQDTAKSFSFMAKQVLR-AEQDKQSS 1053

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|296088652|emb|CBI37643.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|356561056|ref|XP_003548801.1| PREDICTED: uncharacterized protein LOC100811900 [Glycine max] Back     alignment and taxonomy information
>gi|356529675|ref|XP_003533414.1| PREDICTED: uncharacterized protein LOC100793138 [Glycine max] Back     alignment and taxonomy information
>gi|449456949|ref|XP_004146211.1| PREDICTED: uncharacterized protein LOC101213055 [Cucumis sativus] Back     alignment and taxonomy information
>gi|449495115|ref|XP_004159738.1| PREDICTED: uncharacterized protein LOC101230863 [Cucumis sativus] Back     alignment and taxonomy information
>gi|357484159|ref|XP_003612366.1| Syntaxin-binding protein [Medicago truncatula] gi|355513701|gb|AES95324.1| Syntaxin-binding protein [Medicago truncatula] Back     alignment and taxonomy information
>gi|356538385|ref|XP_003537684.1| PREDICTED: uncharacterized protein LOC100782049 [Glycine max] Back     alignment and taxonomy information
>gi|145353594|ref|NP_195281.2| transducin/WD40 domain-containing protein [Arabidopsis thaliana] gi|110737638|dbj|BAF00759.1| hypothetical protein [Arabidopsis thaliana] gi|332661130|gb|AEE86530.1| transducin/WD40 domain-containing protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|334187194|ref|NP_001190926.1| transducin/WD40 domain-containing protein [Arabidopsis thaliana] gi|332661131|gb|AEE86531.1| transducin/WD40 domain-containing protein [Arabidopsis thaliana] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query1042
TAIR|locus:21696721124 AT5G05570 "AT5G05570" [Arabido 0.212 0.196 0.341 1e-65
UNIPROTKB|E1BNK4 1152 STXBP5 "Uncharacterized protei 0.200 0.181 0.278 5.3e-20
UNIPROTKB|F1S7R81115 STXBP5 "Uncharacterized protei 0.200 0.187 0.283 1.4e-19
RGD|708517 1152 Stxbp5 "syntaxin binding prote 0.200 0.181 0.278 1.7e-19
UNIPROTKB|Q5T5C0 1151 STXBP5 "Syntaxin-binding prote 0.200 0.181 0.278 2.2e-19
MGI|MGI:1926058 1152 Stxbp5 "syntaxin binding prote 0.201 0.182 0.271 2.8e-19
UNIPROTKB|E2R4G21116 STXBP5 "Uncharacterized protei 0.200 0.187 0.278 9.3e-19
UNIPROTKB|E2R4F7 1152 STXBP5 "Uncharacterized protei 0.200 0.181 0.278 1.1e-18
UNIPROTKB|E1C3U0 1153 STXBP5 "Uncharacterized protei 0.240 0.217 0.279 1e-17
ZFIN|ZDB-GENE-041001-1611129 stxbp5a "syntaxin binding prot 0.201 0.186 0.267 1.4e-17
TAIR|locus:2169672 AT5G05570 "AT5G05570" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 355 (130.0 bits), Expect = 1.0e-65, Sum P(4) = 1.0e-65
 Identities = 79/231 (34%), Positives = 133/231 (57%)

Query:     1 MFVKTLVEKAS--MKKPGGSSD---G-LKSSDVDPRLVFHYGFPSGCNKFAYDPLQKILA 54
             MFV+  ++K+S     P   +    G L + D+DP ++ H G PS  +  A+DP+Q +LA
Sbjct:     1 MFVRKFLQKSSGGQNPPPPIAPPPRGCLMAEDLDPHIITHSGIPSTASLLAFDPIQCLLA 60

Query:    55 AATKDGRIKLYGRHNNTQALLESSEAVSTKFLQFLENQGILLNVTSTNLIEVWDIDKKRL 114
               T DGRIK+ G  +N +A+L S + +  K L+F++NQG L+++++ N I+VWD+D ++ 
Sbjct:    61 VGTLDGRIKVIGG-DNIEAILASPKQLPFKNLEFMQNQGFLVSISNENEIQVWDLDLRQP 119

Query:   115 SHVHVCKEEITSFTIMQHSNYMLLGDTAGKISVLKLDQESSQIVKMKYIIP---LSASHG 171
             +     +  IT+F I+  + YM +GD  G +SVL    +  +++++ Y +P   LS + G
Sbjct:   120 ASSLKWESNITAFAILHGTGYMYVGDEYGMVSVLNYSADEGKLLQLPYYVPTDALSEAAG 179

Query:   172 NEVSGDPAVINILPQPTAESKRILIIFRDGLISLWDIRESKSIFSMGGNVL 222
                  D  V+ +L QP ++  R+LI F +GL+ LWD  E   +   G   L
Sbjct:   180 LSSPIDYPVVGLLSQPCSKGTRLLIAFSNGLLFLWDASEDHVVLVRGNKDL 230
GO:0000166 "nucleotide binding" evidence=ISS
GO:0003676 "nucleic acid binding" evidence=IEA
GO:0005634 "nucleus" evidence=ISM
GO:0008168 "methyltransferase activity" evidence=IEA
GO:0016021 "integral to membrane" evidence=IEA
GO:0016192 "vesicle-mediated transport" evidence=IEA
GO:0032259 "methylation" evidence=IEA
GO:0005886 "plasma membrane" evidence=IDA
UNIPROTKB|E1BNK4 STXBP5 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|F1S7R8 STXBP5 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
RGD|708517 Stxbp5 "syntaxin binding protein 5 (tomosyn)" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|Q5T5C0 STXBP5 "Syntaxin-binding protein 5" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
MGI|MGI:1926058 Stxbp5 "syntaxin binding protein 5 (tomosyn)" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|E2R4G2 STXBP5 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|E2R4F7 STXBP5 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|E1C3U0 STXBP5 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-041001-161 stxbp5a "syntaxin binding protein 5a (tomosyn)" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query1042
cd00200289 cd00200, WD40, WD40 domain, found in a number of e 3e-07
COG2319466 COG2319, COG2319, FOG: WD40 repeat [General functi 4e-04
pfam08596393 pfam08596, Lgl_C, Lethal giant larvae(Lgl) like, C 7e-04
>gnl|CDD|238121 cd00200, WD40, WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and bottom surface of the propeller are proposed to coordinate interactions with other proteins and/or small ligands; 7 copies of the repeat are present in this alignment Back     alignment and domain information 
 Score = 53.1 bits (128), Expect = 3e-07
 Identities = 44/243 (18%), Positives = 80/243 (32%), Gaps = 32/243 (13%)

Query: 34  HYGFPSGCNKFAYDPLQKILAAATKDGRIKLYGRHNNTQALLESSEAVSTKFLQFLENQG 93
             G   G    A+ P  K+LA  + DG IK++                  + +    +  
Sbjct: 5   LKGHTGGVTCVAFSPDGKLLATGSGDGTIKVWDLETGELLRTLKGHTGPVRDVAASADGT 64

Query: 94  ILLNVTSTNLIEVWDIDKKRLSHVHVC-KEEITSFTIMQHSNYMLLGDTAGKISVLKLDQ 152
            L + +S   I +WD++              ++S         +        I V  ++ 
Sbjct: 65  YLASGSSDKTIRLWDLETGECVRTLTGHTSYVSSVAFSPDGRILSSSSRDKTIKVWDVET 124

Query: 153 ESSQIVKMKYIIPLSASHGNEVSGDPAVINILPQPTAESKRILIIFRDGLISLWDIRESK 212
                 K    +     H +       V ++   P      +    +DG I LWD+R  K
Sbjct: 125 G-----KCLTTLR---GHTD------WVNSVAFSPD--GTFVASSSQDGTIKLWDLRTGK 168

Query: 213 SIFSMGGNVLQSVYHETKQVTSACWACPIGSKVAVGYSNGEILIWGVPSILNLKTEECGT 272
            +         ++   T +V S  +  P G K+    S+G I +W      +L T +C  
Sbjct: 169 CV--------ATLTGHTGEVNSVAF-SPDGEKLLSSSSDGTIKLW------DLSTGKCLG 213

Query: 273 QIT 275
            + 
Sbjct: 214 TLR 216

Length = 289
>gnl|CDD|225201 COG2319, COG2319, FOG: WD40 repeat [General function prediction only] Back     alignment and domain information
>gnl|CDD|219923 pfam08596, Lgl_C, Lethal giant larvae(Lgl) like, C-terminal Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 1042
KOG0319775 consensus WD40-repeat-containing subunit of the 18 100.0
KOG0318603 consensus WD40 repeat stress protein/actin interac 100.0
KOG0271480 consensus Notchless-like WD40 repeat-containing pr 100.0
KOG0291893 consensus WD40-repeat-containing subunit of the 18 100.0
KOG0271480 consensus Notchless-like WD40 repeat-containing pr 100.0
KOG0318603 consensus WD40 repeat stress protein/actin interac 100.0
KOG0319775 consensus WD40-repeat-containing subunit of the 18 100.0
KOG0291893 consensus WD40-repeat-containing subunit of the 18 100.0
KOG0306888 consensus WD40-repeat-containing subunit of the 18 100.0
KOG0306888 consensus WD40-repeat-containing subunit of the 18 100.0
KOG0272459 consensus U4/U6 small nuclear ribonucleoprotein Pr 100.0
KOG0272459 consensus U4/U6 small nuclear ribonucleoprotein Pr 100.0
KOG0273524 consensus Beta-transducin family (WD-40 repeat) pr 100.0
KOG0276794 consensus Vesicle coat complex COPI, beta' subunit 100.0
KOG0286343 consensus G-protein beta subunit [General function 100.0
KOG0286343 consensus G-protein beta subunit [General function 100.0
KOG0315311 consensus G-protein beta subunit-like protein (con 100.0
KOG1408 1080 consensus WD40 repeat protein [Function unknown] 100.0
KOG0279315 consensus G protein beta subunit-like protein [Sig 99.98
KOG0279315 consensus G protein beta subunit-like protein [Sig 99.98
KOG0296399 consensus Angio-associated migratory cell protein 99.97
KOG0292 1202 consensus Vesicle coat complex COPI, alpha subunit 99.97
KOG0315311 consensus G-protein beta subunit-like protein (con 99.97
KOG0296399 consensus Angio-associated migratory cell protein 99.97
KOG0273524 consensus Beta-transducin family (WD-40 repeat) pr 99.97
KOG2106626 consensus Uncharacterized conserved protein, conta 99.97
KOG1539910 consensus WD repeat protein [General function pred 99.97
KOG0276794 consensus Vesicle coat complex COPI, beta' subunit 99.97
KOG14081080 consensus WD40 repeat protein [Function unknown] 99.97
KOG1539910 consensus WD repeat protein [General function pred 99.97
KOG0284464 consensus Polyadenylation factor I complex, subuni 99.97
KOG0645312 consensus WD40 repeat protein [General function pr 99.97
KOG2048691 consensus WD40 repeat protein [General function pr 99.97
KOG0263707 consensus Transcription initiation factor TFIID, s 99.97
KOG0292 1202 consensus Vesicle coat complex COPI, alpha subunit 99.97
KOG0645312 consensus WD40 repeat protein [General function pr 99.97
KOG0263707 consensus Transcription initiation factor TFIID, s 99.97
KOG0284464 consensus Polyadenylation factor I complex, subuni 99.97
KOG0285460 consensus Pleiotropic regulator 1 [RNA processing 99.96
KOG1063764 consensus RNA polymerase II elongator complex, sub 99.96
PLN00181793 protein SPA1-RELATED; Provisional 99.96
KOG1983993 consensus Tomosyn and related SNARE-interacting pr 99.96
KOG0285460 consensus Pleiotropic regulator 1 [RNA processing 99.96
KOG0295406 consensus WD40 repeat-containing protein [Function 99.96
KOG0265338 consensus U5 snRNP-specific protein-like factor an 99.95
KOG0293519 consensus WD40 repeat-containing protein [Function 99.95
PLN00181793 protein SPA1-RELATED; Provisional 99.95
cd00200289 WD40 WD40 domain, found in a number of eukaryotic 99.95
KOG0266456 consensus WD40 repeat-containing protein [General 99.95
KOG0265338 consensus U5 snRNP-specific protein-like factor an 99.95
KOG0295406 consensus WD40 repeat-containing protein [Function 99.95
cd00200289 WD40 WD40 domain, found in a number of eukaryotic 99.95
KOG0293519 consensus WD40 repeat-containing protein [Function 99.95
KOG0282503 consensus mRNA splicing factor [Function unknown] 99.94
KOG0266456 consensus WD40 repeat-containing protein [General 99.94
KOG0282503 consensus mRNA splicing factor [Function unknown] 99.94
KOG0281499 consensus Beta-TrCP (transducin repeats containing 99.94
KOG2106626 consensus Uncharacterized conserved protein, conta 99.94
KOG0281499 consensus Beta-TrCP (transducin repeats containing 99.93
KOG0316307 consensus Conserved WD40 repeat-containing protein 99.93
KOG0313423 consensus Microtubule binding protein YTM1 (contai 99.93
KOG0772641 consensus Uncharacterized conserved protein, conta 99.93
KOG2048691 consensus WD40 repeat protein [General function pr 99.93
PF08596395 Lgl_C: Lethal giant larvae(Lgl) like, C-terminal; 99.93
KOG0316307 consensus Conserved WD40 repeat-containing protein 99.92
KOG0275508 consensus Conserved WD40 repeat-containing protein 99.92
KOG1063764 consensus RNA polymerase II elongator complex, sub 99.92
KOG0288459 consensus WD40 repeat protein TipD [General functi 99.92
KOG0643327 consensus Translation initiation factor 3, subunit 99.92
KOG0640430 consensus mRNA cleavage stimulating factor complex 99.92
KOG0313423 consensus Microtubule binding protein YTM1 (contai 99.92
KOG0277311 consensus Peroxisomal targeting signal type 2 rece 99.92
KOG0278334 consensus Serine/threonine kinase receptor-associa 99.92
KOG1407313 consensus WD40 repeat protein [Function unknown] 99.92
KOG0278334 consensus Serine/threonine kinase receptor-associa 99.92
KOG0275508 consensus Conserved WD40 repeat-containing protein 99.91
KOG0310487 consensus Conserved WD40 repeat-containing protein 99.91
KOG0643327 consensus Translation initiation factor 3, subunit 99.91
KOG0310487 consensus Conserved WD40 repeat-containing protein 99.91
KOG0772641 consensus Uncharacterized conserved protein, conta 99.9
KOG0283712 consensus WD40 repeat-containing protein [Function 99.9
KOG0277311 consensus Peroxisomal targeting signal type 2 rece 99.9
KOG0299479 consensus U3 snoRNP-associated protein (contains W 99.9
KOG0305484 consensus Anaphase promoting complex, Cdc20, Cdh1, 99.9
KOG0640430 consensus mRNA cleavage stimulating factor complex 99.9
KOG0288459 consensus WD40 repeat protein TipD [General functi 99.9
KOG0289506 consensus mRNA splicing factor [General function p 99.89
KOG0641350 consensus WD40 repeat protein [General function pr 99.89
KOG0647347 consensus mRNA export protein (contains WD40 repea 99.89
KOG0268433 consensus Sof1-like rRNA processing protein (conta 99.89
KOG0299479 consensus U3 snoRNP-associated protein (contains W 99.89
KOG0973942 consensus Histone transcription regulator HIRA, WD 99.89
KOG0283712 consensus WD40 repeat-containing protein [Function 99.89
KOG0646476 consensus WD40 repeat protein [General function pr 99.89
PTZ00421493 coronin; Provisional 99.88
KOG2055514 consensus WD40 repeat protein [General function pr 99.88
KOG2096420 consensus WD40 repeat protein [General function pr 99.88
KOG0305484 consensus Anaphase promoting complex, Cdc20, Cdh1, 99.88
KOG0973 942 consensus Histone transcription regulator HIRA, WD 99.88
KOG14451012 consensus Tumor-specific antigen (contains WD repe 99.88
KOG0300481 consensus WD40 repeat-containing protein [Function 99.88
KOG0289506 consensus mRNA splicing factor [General function p 99.88
KOG0301745 consensus Phospholipase A2-activating protein (con 99.88
KOG1036323 consensus Mitotic spindle checkpoint protein BUB3, 99.88
KOG0647347 consensus mRNA export protein (contains WD40 repea 99.87
KOG0308735 consensus Conserved WD40 repeat-containing protein 99.87
KOG0268433 consensus Sof1-like rRNA processing protein (conta 99.87
KOG0641350 consensus WD40 repeat protein [General function pr 99.87
PTZ00421493 coronin; Provisional 99.87
KOG2055514 consensus WD40 repeat protein [General function pr 99.87
KOG0274537 consensus Cdc4 and related F-box and WD-40 protein 99.87
PTZ00420568 coronin; Provisional 99.87
KOG2096420 consensus WD40 repeat protein [General function pr 99.87
KOG0274537 consensus Cdc4 and related F-box and WD-40 protein 99.86
KOG0294362 consensus WD40 repeat-containing protein [Function 99.86
KOG1446311 consensus Histone H3 (Lys4) methyltransferase comp 99.86
KOG1446311 consensus Histone H3 (Lys4) methyltransferase comp 99.86
KOG0301745 consensus Phospholipase A2-activating protein (con 99.86
PTZ00420568 coronin; Provisional 99.86
KOG1036323 consensus Mitotic spindle checkpoint protein BUB3, 99.86
KOG0300481 consensus WD40 repeat-containing protein [Function 99.86
KOG1332299 consensus Vesicle coat complex COPII, subunit SEC1 99.86
KOG1407313 consensus WD40 repeat protein [Function unknown] 99.86
KOG0294362 consensus WD40 repeat-containing protein [Function 99.86
KOG0308735 consensus Conserved WD40 repeat-containing protein 99.85
KOG1332299 consensus Vesicle coat complex COPII, subunit SEC1 99.85
KOG0639705 consensus Transducin-like enhancer of split protei 99.84
KOG1274933 consensus WD40 repeat protein [General function pr 99.84
KOG14451012 consensus Tumor-specific antigen (contains WD repe 99.83
KOG0264422 consensus Nucleosome remodeling factor, subunit CA 99.83
KOG0269839 consensus WD40 repeat-containing protein [Function 99.83
KOG4283397 consensus Transcription-coupled repair protein CSA 99.83
KOG0264422 consensus Nucleosome remodeling factor, subunit CA 99.82
KOG0321720 consensus WD40 repeat-containing protein L2DTL [Fu 99.82
KOG0269839 consensus WD40 repeat-containing protein [Function 99.81
KOG2445361 consensus Nuclear pore complex component (sc Seh1) 99.81
KOG0639705 consensus Transducin-like enhancer of split protei 99.81
TIGR03866300 PQQ_ABC_repeats PQQ-dependent catabolism-associate 99.81
KOG1274933 consensus WD40 repeat protein [General function pr 99.81
KOG0321720 consensus WD40 repeat-containing protein L2DTL [Fu 99.81
KOG0646476 consensus WD40 repeat protein [General function pr 99.8
KOG1963792 consensus WD40 repeat protein [General function pr 99.8
KOG2445361 consensus Nuclear pore complex component (sc Seh1) 99.79
KOG1538 1081 consensus Uncharacterized conserved protein WDR10, 99.79
KOG4328498 consensus WD40 protein [Function unknown] 99.79
TIGR03866300 PQQ_ABC_repeats PQQ-dependent catabolism-associate 99.78
KOG4328498 consensus WD40 protein [Function unknown] 99.78
KOG4283397 consensus Transcription-coupled repair protein CSA 99.78
KOG1034385 consensus Transcriptional repressor EED/ESC/FIE, r 99.77
KOG0650733 consensus WD40 repeat nucleolar protein Bop1, invo 99.77
KOG1273405 consensus WD40 repeat protein [General function pr 99.77
KOG1273405 consensus WD40 repeat protein [General function pr 99.77
COG2319466 FOG: WD40 repeat [General function prediction only 99.75
KOG0270463 consensus WD40 repeat-containing protein [Function 99.75
KOG2919406 consensus Guanine nucleotide-binding protein [Gene 99.75
KOG1963792 consensus WD40 repeat protein [General function pr 99.74
KOG0650733 consensus WD40 repeat nucleolar protein Bop1, invo 99.74
KOG0270463 consensus WD40 repeat-containing protein [Function 99.73
KOG0267 825 consensus Microtubule severing protein katanin p80 99.72
KOG1538 1081 consensus Uncharacterized conserved protein WDR10, 99.72
KOG0302440 consensus Ribosome Assembly protein [General funct 99.71
KOG0302440 consensus Ribosome Assembly protein [General funct 99.71
KOG1009434 consensus Chromatin assembly complex 1 subunit B/C 99.68
KOG15171387 consensus Guanine nucleotide binding protein MIP1 99.68
KOG4378673 consensus Nuclear protein COP1 [Signal transductio 99.68
KOG03071049 consensus Vesicle coat complex COPII, subunit SEC3 99.68
KOG1034385 consensus Transcriptional repressor EED/ESC/FIE, r 99.68
KOG0267825 consensus Microtubule severing protein katanin p80 99.67
KOG1188376 consensus WD40 repeat protein [General function pr 99.66
KOG4378673 consensus Nuclear protein COP1 [Signal transductio 99.65
KOG12401431 consensus Protein kinase containing WD40 repeats [ 99.65
KOG0322323 consensus G-protein beta subunit-like protein GNB1 99.64
KOG1587555 consensus Cytoplasmic dynein intermediate chain [C 99.64
KOG4227609 consensus WD40 repeat protein [General function pr 99.64
KOG03071049 consensus Vesicle coat complex COPII, subunit SEC3 99.63
KOG0322323 consensus G-protein beta subunit-like protein GNB1 99.63
KOG15171387 consensus Guanine nucleotide binding protein MIP1 99.62
KOG0642577 consensus Cell-cycle nuclear protein, contains WD- 99.62
KOG1587555 consensus Cytoplasmic dynein intermediate chain [C 99.62
COG2319466 FOG: WD40 repeat [General function prediction only 99.61
KOG1524737 consensus WD40 repeat-containing protein CHE-2 [Ge 99.6
KOG0290364 consensus Conserved WD40 repeat-containing protein 99.58
KOG19121062 consensus WD40 repeat protein [General function pr 99.57
KOG4227609 consensus WD40 repeat protein [General function pr 99.57
KOG1007370 consensus WD repeat protein TSSC1, WD repeat super 99.57
KOG1009434 consensus Chromatin assembly complex 1 subunit B/C 99.56
PRK11028330 6-phosphogluconolactonase; Provisional 99.56
KOG2919406 consensus Guanine nucleotide-binding protein [Gene 99.55
KOG1188376 consensus WD40 repeat protein [General function pr 99.55
KOG0642577 consensus Cell-cycle nuclear protein, contains WD- 99.55
KOG0290364 consensus Conserved WD40 repeat-containing protein 99.54
KOG1524737 consensus WD40 repeat-containing protein CHE-2 [Ge 99.53
KOG4497447 consensus Uncharacterized conserved protein WDR8, 99.53
KOG4497447 consensus Uncharacterized conserved protein WDR8, 99.53
KOG06441113 consensus Uncharacterized conserved protein, conta 99.52
KOG1523361 consensus Actin-related protein Arp2/3 complex, su 99.51
KOG0649325 consensus WD40 repeat protein [General function pr 99.51
KOG1007370 consensus WD repeat protein TSSC1, WD repeat super 99.51
PRK11028330 6-phosphogluconolactonase; Provisional 99.51
KOG2394636 consensus WD40 protein DMR-N9 [General function pr 99.48
KOG0771398 consensus Prolactin regulatory element-binding pro 99.48
KOG0974967 consensus WD-repeat protein WDR6, WD repeat superf 99.47
KOG2110391 consensus Uncharacterized conserved protein, conta 99.45
KOG0303472 consensus Actin-binding protein Coronin, contains 99.45
KOG12401431 consensus Protein kinase containing WD40 repeats [ 99.44
KOG0771398 consensus Prolactin regulatory element-binding pro 99.44
KOG0303472 consensus Actin-binding protein Coronin, contains 99.42
KOG1334559 consensus WD40 repeat protein [General function pr 99.42
PF04762928 IKI3: IKI3 family; InterPro: IPR006849 Members of 99.41
KOG2111346 consensus Uncharacterized conserved protein, conta 99.4
KOG0649325 consensus WD40 repeat protein [General function pr 99.39
KOG2139445 consensus WD40 repeat protein [General function pr 99.37
KOG2139445 consensus WD40 repeat protein [General function pr 99.35
PRK01742429 tolB translocation protein TolB; Provisional 99.35
KOG1310758 consensus WD40 repeat protein [General function pr 99.34
KOG2041 1189 consensus WD40 repeat protein [General function pr 99.32
PF02239369 Cytochrom_D1: Cytochrome D1 heme domain; PDB: 1NNO 99.31
KOG2321703 consensus WD40 repeat protein [General function pr 99.29
PRK01742429 tolB translocation protein TolB; Provisional 99.29
PF02239369 Cytochrom_D1: Cytochrome D1 heme domain; PDB: 1NNO 99.29
KOG1523361 consensus Actin-related protein Arp2/3 complex, su 99.28
KOG06441113 consensus Uncharacterized conserved protein, conta 99.27
KOG19121062 consensus WD40 repeat protein [General function pr 99.27
KOG1334559 consensus WD40 repeat protein [General function pr 99.25
KOG2394636 consensus WD40 protein DMR-N9 [General function pr 99.24
PRK03629429 tolB translocation protein TolB; Provisional 99.24
PF04762928 IKI3: IKI3 family; InterPro: IPR006849 Members of 99.23
KOG1310758 consensus WD40 repeat protein [General function pr 99.22
KOG3881412 consensus Uncharacterized conserved protein [Funct 99.22
KOG1272545 consensus WD40-repeat-containing subunit of the 18 99.21
KOG1272545 consensus WD40-repeat-containing subunit of the 18 99.2
COG5354561 Uncharacterized protein, contains Trp-Asp (WD) rep 99.18
PF08662194 eIF2A: Eukaryotic translation initiation factor eI 99.17
KOG2110391 consensus Uncharacterized conserved protein, conta 99.16
KOG2041 1189 consensus WD40 repeat protein [General function pr 99.15
PRK03629429 tolB translocation protein TolB; Provisional 99.15
PRK05137435 tolB translocation protein TolB; Provisional 99.14
KOG3617 1416 consensus WD40 and TPR repeat-containing protein [ 99.13
PF08662194 eIF2A: Eukaryotic translation initiation factor eI 99.13
KOG2315566 consensus Predicted translation initiation factor 99.13
PRK04922433 tolB translocation protein TolB; Provisional 99.1
PRK05137435 tolB translocation protein TolB; Provisional 99.09
KOG1409404 consensus Uncharacterized conserved protein, conta 99.09
PRK04922433 tolB translocation protein TolB; Provisional 99.06
COG4946668 Uncharacterized protein related to the periplasmic 99.06
PF10282345 Lactonase: Lactonase, 7-bladed beta-propeller; Int 99.05
PRK02889427 tolB translocation protein TolB; Provisional 99.05
PF10282345 Lactonase: Lactonase, 7-bladed beta-propeller; Int 99.04
KOG2315566 consensus Predicted translation initiation factor 99.02
KOG1409404 consensus Uncharacterized conserved protein, conta 99.01
PRK02889427 tolB translocation protein TolB; Provisional 99.01
KOG2314698 consensus Translation initiation factor 3, subunit 99.0
KOG2111346 consensus Uncharacterized conserved protein, conta 98.99
TIGR02658352 TTQ_MADH_Hv methylamine dehydrogenase heavy chain. 98.95
COG4946668 Uncharacterized protein related to the periplasmic 98.95
KOG3881412 consensus Uncharacterized conserved protein [Funct 98.93
KOG1354433 consensus Serine/threonine protein phosphatase 2A, 98.93
KOG3617 1416 consensus WD40 and TPR repeat-containing protein [ 98.92
KOG2321703 consensus WD40 repeat protein [General function pr 98.91
TIGR02800417 propeller_TolB tol-pal system beta propeller repea 98.9
KOG4547541 consensus WD40 repeat-containing protein [General 98.89
PRK00178430 tolB translocation protein TolB; Provisional 98.83
PRK00178430 tolB translocation protein TolB; Provisional 98.82
TIGR02800417 propeller_TolB tol-pal system beta propeller repea 98.81
PRK04792448 tolB translocation protein TolB; Provisional 98.81
PRK04792448 tolB translocation protein TolB; Provisional 98.79
COG2706346 3-carboxymuconate cyclase [Carbohydrate transport 98.75
KOG1354433 consensus Serine/threonine protein phosphatase 2A, 98.74
KOG0974 967 consensus WD-repeat protein WDR6, WD repeat superf 98.74
KOG4547541 consensus WD40 repeat-containing protein [General 98.72
KOG10642439 consensus RAVE (regulator of V-ATPase assembly) co 98.68
KOG3914390 consensus WD repeat protein WDR4 [Function unknown 98.68
TIGR02658352 TTQ_MADH_Hv methylamine dehydrogenase heavy chain. 98.67
KOG10642439 consensus RAVE (regulator of V-ATPase assembly) co 98.65
TIGR03300377 assembly_YfgL outer membrane assembly lipoprotein 98.64
PLN029191057 haloacid dehalogenase-like hydrolase family protei 98.62
PRK01029428 tolB translocation protein TolB; Provisional 98.62
TIGR03300377 assembly_YfgL outer membrane assembly lipoprotein 98.61
KOG03091081 consensus Conserved WD40 repeat-containing protein 98.61
COG5354561 Uncharacterized protein, contains Trp-Asp (WD) rep 98.6
KOG3914390 consensus WD repeat protein WDR4 [Function unknown 98.59
KOG4532344 consensus WD40-like repeat containing protein [Gen 98.58
PF15492282 Nbas_N: Neuroblastoma-amplified sequence, N termin 98.56
COG2706346 3-carboxymuconate cyclase [Carbohydrate transport 98.54
PLN029191057 haloacid dehalogenase-like hydrolase family protei 98.54
KOG4532344 consensus WD40-like repeat containing protein [Gen 98.52
KOG41901034 consensus Uncharacterized conserved protein [Funct 98.49
KOG0280339 consensus Uncharacterized conserved protein [Amino 98.48
KOG4714319 consensus Nucleoporin [Nuclear structure] 98.48
KOG2314698 consensus Translation initiation factor 3, subunit 98.44
PF15492282 Nbas_N: Neuroblastoma-amplified sequence, N termin 98.41
KOG4714319 consensus Nucleoporin [Nuclear structure] 98.38
PRK01029428 tolB translocation protein TolB; Provisional 98.38
KOG0882558 consensus Cyclophilin-related peptidyl-prolyl cis- 98.37
KOG2114933 consensus Vacuolar assembly/sorting protein PEP5/V 98.34
PRK04043419 tolB translocation protein TolB; Provisional 98.31
COG5170460 CDC55 Serine/threonine protein phosphatase 2A, reg 98.3
KOG0280339 consensus Uncharacterized conserved protein [Amino 98.28
KOG2695425 consensus WD40 repeat protein [General function pr 98.2
KOG2066846 consensus Vacuolar assembly/sorting protein VPS41 98.15
KOG03091081 consensus Conserved WD40 repeat-containing protein 98.14
KOG41901034 consensus Uncharacterized conserved protein [Funct 98.13
KOG18971096 consensus Damage-specific DNA binding complex, sub 98.11
PRK11138394 outer membrane biogenesis protein BamB; Provisiona 98.11
KOG2695425 consensus WD40 repeat protein [General function pr 98.09
PRK11138394 outer membrane biogenesis protein BamB; Provisiona 98.08
KOG1920 1265 consensus IkappaB kinase complex, IKAP component [ 98.07
COG5170460 CDC55 Serine/threonine protein phosphatase 2A, reg 98.07
PF08450246 SGL: SMP-30/Gluconolaconase/LRE-like region; Inter 98.04
KOG3621 726 consensus WD40 repeat-containing protein [General 98.03
PF11768545 DUF3312: Protein of unknown function (DUF3312); In 97.97
KOG1920 1265 consensus IkappaB kinase complex, IKAP component [ 97.95
PRK04043419 tolB translocation protein TolB; Provisional 97.93
PF0040039 WD40: WD domain, G-beta repeat; InterPro: IPR01978 97.93
PF11768545 DUF3312: Protein of unknown function (DUF3312); In 97.91
PF06977248 SdiA-regulated: SdiA-regulated; InterPro: IPR00972 97.9
KOG2114 933 consensus Vacuolar assembly/sorting protein PEP5/V 97.88
KOG2066 846 consensus Vacuolar assembly/sorting protein VPS41 97.86
PF0040039 WD40: WD domain, G-beta repeat; InterPro: IPR01978 97.84
PF08450246 SGL: SMP-30/Gluconolaconase/LRE-like region; Inter 97.83
KOG1645463 consensus RING-finger-containing E3 ubiquitin liga 97.82
KOG3621726 consensus WD40 repeat-containing protein [General 97.75
KOG0860116 consensus Synaptobrevin/VAMP-like protein [Intrace 97.69
KOG4649354 consensus PQQ (pyrrolo-quinoline quinone) repeat p 97.69
KOG12751118 consensus PAB-dependent poly(A) ribonuclease, subu 97.69
KOG0882558 consensus Cyclophilin-related peptidyl-prolyl cis- 97.66
PF04841410 Vps16_N: Vps16, N-terminal region; InterPro: IPR00 97.65
PF13360238 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 97.6
KOG1645463 consensus RING-finger-containing E3 ubiquitin liga 97.56
PF13360238 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 97.55
PF0095789 Synaptobrevin: Synaptobrevin; InterPro: IPR001388 97.54
KOG18321516 consensus HIV-1 Vpr-binding protein [Cell cycle co 97.53
PF03178321 CPSF_A: CPSF A subunit region; InterPro: IPR004871 97.52
PF07433305 DUF1513: Protein of unknown function (DUF1513); In 97.48
KOG1008783 consensus Uncharacterized conserved protein, conta 97.47
KOG4649354 consensus PQQ (pyrrolo-quinoline quinone) repeat p 97.46
PF07433305 DUF1513: Protein of unknown function (DUF1513); In 97.46
PF08596395 Lgl_C: Lethal giant larvae(Lgl) like, C-terminal; 97.45
PF06433342 Me-amine-dh_H: Methylamine dehydrogenase heavy cha 97.42
PF08366105 LLGL: LLGL2; InterPro: IPR013577 This domain is fo 97.31
PF04841410 Vps16_N: Vps16, N-terminal region; InterPro: IPR00 97.26
KOG4640 665 consensus Anaphase-promoting complex (APC), subuni 97.23
PF00780275 CNH: CNH domain; InterPro: IPR001180 Based on sequ 97.11
PF1289447 Apc4_WD40: Anaphase-promoting complex subunit 4 WD 97.09
COG3204316 Uncharacterized protein conserved in bacteria [Fun 97.06
PF14783111 BBS2_Mid: Ciliary BBSome complex subunit 2, middle 97.02
KOG2079 1206 consensus Vacuolar assembly/sorting protein VPS8 [ 96.99
PRK02888635 nitrous-oxide reductase; Validated 96.97
cd00216488 PQQ_DH Dehydrogenases with pyrrolo-quinoline quino 96.84
PF14655415 RAB3GAP2_N: Rab3 GTPase-activating protein regulat 96.83
PF14783111 BBS2_Mid: Ciliary BBSome complex subunit 2, middle 96.82
KOG4640665 consensus Anaphase-promoting complex (APC), subuni 96.76
PF14727418 PHTB1_N: PTHB1 N-terminus 96.66
PF00930353 DPPIV_N: Dipeptidyl peptidase IV (DPP IV) N-termin 96.65
KOG18971096 consensus Damage-specific DNA binding complex, sub 96.52
PF04053443 Coatomer_WDAD: Coatomer WD associated region ; Int 96.49
KOG2079 1206 consensus Vacuolar assembly/sorting protein VPS8 [ 96.46
PF08553794 VID27: VID27 cytoplasmic protein; InterPro: IPR013 96.43
cd00216488 PQQ_DH Dehydrogenases with pyrrolo-quinoline quino 96.41
PF06977248 SdiA-regulated: SdiA-regulated; InterPro: IPR00972 96.31
PF00780275 CNH: CNH domain; InterPro: IPR001180 Based on sequ 96.26
PF05096264 Glu_cyclase_2: Glutamine cyclotransferase; InterPr 96.24
KOG1275 1118 consensus PAB-dependent poly(A) ribonuclease, subu 96.22
PRK13616591 lipoprotein LpqB; Provisional 96.17
TIGR03075527 PQQ_enz_alc_DH PQQ-dependent dehydrogenase, methan 96.12
KOG1008783 consensus Uncharacterized conserved protein, conta 96.09
PF03178321 CPSF_A: CPSF A subunit region; InterPro: IPR004871 96.07
KOG18321516 consensus HIV-1 Vpr-binding protein [Cell cycle co 96.05
PRK02888635 nitrous-oxide reductase; Validated 96.02
COG0823425 TolB Periplasmic component of the Tol biopolymer t 96.01
PF06433342 Me-amine-dh_H: Methylamine dehydrogenase heavy cha 96.01
smart0032040 WD40 WD40 repeats. Note that these repeats are per 95.96
KOG2444238 consensus WD40 repeat protein [General function pr 95.8
PF1289447 Apc4_WD40: Anaphase-promoting complex subunit 4 WD 95.76
PF10168717 Nup88: Nuclear pore component; InterPro: IPR019321 95.7
smart0032040 WD40 WD40 repeats. Note that these repeats are per 95.57
COG3391381 Uncharacterized conserved protein [Function unknow 95.51
PF14727418 PHTB1_N: PTHB1 N-terminus 95.47
COG3490366 Uncharacterized protein conserved in bacteria [Fun 95.34
PF10647253 Gmad1: Lipoprotein LpqB beta-propeller domain; Int 95.32
KOG3630 1405 consensus Nuclear pore complex, Nup214/CAN compone 95.27
PF04053443 Coatomer_WDAD: Coatomer WD associated region ; Int 95.23
PF08553794 VID27: VID27 cytoplasmic protein; InterPro: IPR013 95.12
COG3204316 Uncharacterized protein conserved in bacteria [Fun 94.96
KOG2444238 consensus WD40 repeat protein [General function pr 94.95
KOG2395644 consensus Protein involved in vacuole import and d 94.94
KOG3630 1405 consensus Nuclear pore complex, Nup214/CAN compone 94.69
COG0823425 TolB Periplasmic component of the Tol biopolymer t 94.64
COG3386307 Gluconolactonase [Carbohydrate transport and metab 94.59
PRK13616591 lipoprotein LpqB; Provisional 94.58
COG3391381 Uncharacterized conserved protein [Function unknow 94.42
PF14870302 PSII_BNR: Photosynthesis system II assembly factor 94.13
KOG0859217 consensus Synaptobrevin/VAMP-like protein [Intrace 94.05
TIGR03075527 PQQ_enz_alc_DH PQQ-dependent dehydrogenase, methan 93.85
PF14781136 BBS2_N: Ciliary BBSome complex subunit 2, N-termin 93.42
COG3490366 Uncharacterized protein conserved in bacteria [Fun 93.33
KOG4499310 consensus Ca2+-binding protein Regucalcin/SMP30 [I 92.99
PF02897414 Peptidase_S9_N: Prolyl oligopeptidase, N-terminal 92.98
PF10647253 Gmad1: Lipoprotein LpqB beta-propeller domain; Int 92.96
PF12234 631 Rav1p_C: RAVE protein 1 C terminal; InterPro: IPR0 92.38
PF10395 670 Utp8: Utp8 family; InterPro: IPR018843 Utp8 is an 92.15
COG3386307 Gluconolactonase [Carbohydrate transport and metab 92.05
PF14761215 HPS3_N: Hermansky-Pudlak syndrome 3 91.99
PF10168717 Nup88: Nuclear pore component; InterPro: IPR019321 91.75
PF00930353 DPPIV_N: Dipeptidyl peptidase IV (DPP IV) N-termin 91.44
PF08728717 CRT10: CRT10; InterPro: IPR014839 CRT10 is a trans 91.4
PRK13684334 Ycf48-like protein; Provisional 90.85
KOG2395644 consensus Protein involved in vacuole import and d 90.53
PF15390671 DUF4613: Domain of unknown function (DUF4613) 90.4
KOG2280 829 consensus Vacuolar assembly/sorting protein VPS16 90.32
PF14761215 HPS3_N: Hermansky-Pudlak syndrome 3 90.08
PF08728717 CRT10: CRT10; InterPro: IPR014839 CRT10 is a trans 90.07
TIGR02604367 Piru_Ver_Nterm putative membrane-bound dehydrogena 89.76
PF14781136 BBS2_N: Ciliary BBSome complex subunit 2, N-termin 89.7
PF14655415 RAB3GAP2_N: Rab3 GTPase-activating protein regulat 89.66
KOG2280829 consensus Vacuolar assembly/sorting protein VPS16 89.54
PF14583386 Pectate_lyase22: Oligogalacturonate lyase; PDB: 3C 89.54
PF05694461 SBP56: 56kDa selenium binding protein (SBP56); Int 89.42
PLN00033398 photosystem II stability/assembly factor; Provisio 89.32
PRK13684334 Ycf48-like protein; Provisional 89.16
KOG1900 1311 consensus Nuclear pore complex, Nup155 component ( 89.1
PF14870302 PSII_BNR: Photosynthesis system II assembly factor 89.01
KOG1983993 consensus Tomosyn and related SNARE-interacting pr 88.99
PF07569219 Hira: TUP1-like enhancer of split; InterPro: IPR01 88.66
KOG1916 1283 consensus Nuclear protein, contains WD40 repeats [ 88.41
TIGR03118336 PEPCTERM_chp_1 conserved hypothetical protein TIGR 88.03
PF1031343 DUF2415: Uncharacterised protein domain (DUF2415); 87.92
PHA02713557 hypothetical protein; Provisional 87.86
PF1097943 DUF2786: Protein of unknown function (DUF2786); In 87.86
PHA02713557 hypothetical protein; Provisional 87.11
PF07569219 Hira: TUP1-like enhancer of split; InterPro: IPR01 86.66
PF12234631 Rav1p_C: RAVE protein 1 C terminal; InterPro: IPR0 86.23
KOG2377657 consensus Uncharacterized conserved protein [Funct 85.77
PF10214 765 Rrn6: RNA polymerase I-specific transcription-init 85.38
PF11635753 Med16: Mediator complex subunit 16; InterPro: IPR0 85.36
PF15390671 DUF4613: Domain of unknown function (DUF4613) 84.87
PF12657173 TFIIIC_delta: Transcription factor IIIC subunit de 83.22
TIGR03118336 PEPCTERM_chp_1 conserved hypothetical protein TIGR 82.81
KOG3616 1636 consensus Selective LIM binding factor [Transcript 82.74
PF02897414 Peptidase_S9_N: Prolyl oligopeptidase, N-terminal 82.65
PF13449326 Phytase-like: Esterase-like activity of phytase 82.59
KOG4441571 consensus Proteins containing BTB/POZ and Kelch do 80.93
>KOG0319 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification] Back     alignment and domain information 
Probab=100.00  E-value=2e-41  Score=369.29  Aligned_cols=470  Identities=15%  Similarity=0.202  Sum_probs=344.2

Q ss_pred             cCceEEEEEcCCCCEEEEEEcCCeEEEEecC-CCeEEEEecCCCcceEEEEEecCCCEEEEEeCCCCEEEEEcCCCc-ee
Q 001628           38 PSGCNKFAYDPLQKILAAATKDGRIKLYGRH-NNTQALLESSEAVSTKFLQFLENQGILLNVTSTNLIEVWDIDKKR-LS  115 (1042)
Q Consensus        38 ~~~v~~la~sp~~~~LA~gs~dg~I~iw~~~-g~~~~~~~~~~~~~v~~l~fs~~~~~Lvs~s~dg~I~vWd~~~~~-~~  115 (1042)
                      +..+++++.+|++.+|.++.+...+++|..+ |........-+..||.-++|+|.+..|++|+.||.++|||+..+. ..
T Consensus        62 ~d~ita~~l~~d~~~L~~a~rs~llrv~~L~tgk~irswKa~He~Pvi~ma~~~~g~LlAtggaD~~v~VWdi~~~~~th  141 (775)
T KOG0319|consen   62 EDEITALALTPDEEVLVTASRSQLLRVWSLPTGKLIRSWKAIHEAPVITMAFDPTGTLLATGGADGRVKVWDIKNGYCTH  141 (775)
T ss_pred             hhhhheeeecCCccEEEEeeccceEEEEEcccchHhHhHhhccCCCeEEEEEcCCCceEEeccccceEEEEEeeCCEEEE
Confidence            4579999999999999999999999999998 455556666567899999999999999999999999999999988 78


Q ss_pred             eeeecCCCeEEEEEeCCCC--EEEEEeCCCcEEEEEccCCccceeeeeeecccccccCccccCCCCEEEEEEccCCCCCe
Q 001628          116 HVHVCKEEITSFTIMQHSN--YMLLGDTAGKISVLKLDQESSQIVKMKYIIPLSASHGNEVSGDPAVINILPQPTAESKR  193 (1042)
Q Consensus       116 ~~~~h~~~It~v~~sp~~~--~l~sg~~dG~I~vwd~~~~~~~~~~~~~~ip~~~~~~~~~~~~~~V~~v~~~p~~d~~~  193 (1042)
                      .+.+|++.|.++.|.|+-.  .|++|..|++|++||+.....++..             ...|...|++++|.+  |+..
T Consensus       142 ~fkG~gGvVssl~F~~~~~~~lL~sg~~D~~v~vwnl~~~~tcl~~-------------~~~H~S~vtsL~~~~--d~~~  206 (775)
T KOG0319|consen  142 SFKGHGGVVSSLLFHPHWNRWLLASGATDGTVRVWNLNDKRTCLHT-------------MILHKSAVTSLAFSE--DSLE  206 (775)
T ss_pred             EecCCCceEEEEEeCCccchhheeecCCCceEEEEEcccCchHHHH-------------HHhhhhheeeeeecc--CCce
Confidence            8899999999999999874  5899999999999999875421111             234578999999999  8999


Q ss_pred             EEEEECCCeEEEEeccCCeeEEEeCCcccccccccCCceeEEEEEccC-----CCEEEEEecCCeEEEEeCCCccccccc
Q 001628          194 ILIIFRDGLISLWDIRESKSIFSMGGNVLQSVYHETKQVTSACWACPI-----GSKVAVGYSNGEILIWGVPSILNLKTE  268 (1042)
Q Consensus       194 lls~~~dg~I~vWd~~~~~~~~~~~g~~~~~~~~~~~~I~~l~~~~~~-----g~~l~sg~~dG~I~iWd~~~~~~~~~~  268 (1042)
                      +++++.|..|.|||+.+-+....         ......+-++.+. ++     |.++.+++.+|.+++||..++......
T Consensus       207 ~ls~~RDkvi~vwd~~~~~~l~~---------lp~ye~~E~vv~l-~~~~~~~~~~~~TaG~~g~~~~~d~es~~~~~~~  276 (775)
T KOG0319|consen  207 LLSVGRDKVIIVWDLVQYKKLKT---------LPLYESLESVVRL-REELGGKGEYIITAGGSGVVQYWDSESGKCVYKQ  276 (775)
T ss_pred             EEEeccCcEEEEeehhhhhhhhe---------echhhheeeEEEe-chhcCCcceEEEEecCCceEEEEecccchhhhhh
Confidence            99999999999999976554333         1223456666676 56     679999999999999999986322221


Q ss_pred             cCCccccccccccCCCCCCCccceEEEEEEeCCCCeEEEEecccccCCCccEEEEeecccccceeEEEeeCCCCCeeeEE
Q 001628          269 ECGTQITPICKLNLGYKLDKIPISSLKWVYADGKASRLYIMGASDFVSMNLLQIVLLNEQTESRTTKLALPLSEPCIDME  348 (1042)
Q Consensus       269 ~~~~~~~p~~~l~~~~~~~~~pi~~l~~~~~~~~~~~l~~~gg~~~~~~~~~~v~~~~~~~~~~~~~~~~~~~~~~~~~~  348 (1042)
                      ....    ..++           ..+..+   .....++.+....       +++.. +..+.+...........+.||.
T Consensus       277 ~~~~----~~e~-----------~~~~~~---~~~~~~l~vtaeQ-------nl~l~-d~~~l~i~k~ivG~ndEI~Dm~  330 (775)
T KOG0319|consen  277 RQSD----SEEI-----------DHLLAI---ESMSQLLLVTAEQ-------NLFLY-DEDELTIVKQIVGYNDEILDMK  330 (775)
T ss_pred             ccCC----chhh-----------hcceec---cccCceEEEEccc-------eEEEE-EccccEEehhhcCCchhheeee
Confidence            1111    1011           111111   0111111111110       11111 1112223333445566788888


Q ss_pred             EccCCCCCCCCCccEEEEEecCCceEEeecccceeeeccCCCCCCCCCCccceeccCCCCcceeEEEEeecCccccccch
Q 001628          349 IISSSSDPNKPKQDSFLLLGKSGHFYAFDDCQIERYLLQYQSRSPPSAPKEVMLKMPFLDSSITAMKLITGNSFILSSAD  428 (1042)
Q Consensus       349 ~~~~s~~~~~~~~~~l~vl~~~G~l~~~d~~~~e~~~~~~~~~~~~~l~~~~~~~~~~h~~~vt~~~~~~~~~~~~s~~~  428 (1042)
                      ++..       ..+.|+|.++.+.+++|+..+.                  ....+++|...|.++.             
T Consensus       331 ~lG~-------e~~~laVATNs~~lr~y~~~~~------------------~c~ii~GH~e~vlSL~-------------  372 (775)
T KOG0319|consen  331 FLGP-------EESHLAVATNSPELRLYTLPTS------------------YCQIIPGHTEAVLSLD-------------  372 (775)
T ss_pred             ecCC-------ccceEEEEeCCCceEEEecCCC------------------ceEEEeCchhheeeee-------------
Confidence            7732       3456899999999999984432                  2335678888887776             


Q ss_pred             hHHHhhhhcCCCCCCCCcCCCCCCccCCCCccEEEEEeCCCcEEEEeCCCCceeeeeeccccccccCCCCCCCeEEEEEe
Q 001628          429 EDYSLLAKSVPPLLDFETKLKDGSQSHSKVKNLFITGHSDGAINFWDVSCPLFLLILSLKQQSEKDFSLSGIPLTALYYD  508 (1042)
Q Consensus       429 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~tg~~Dg~IriWd~~~~~~~~l~~l~~~~~~~~~~~~~~V~~l~fs  508 (1042)
                                                ....+.+|+||+.|.++++|.++.+....+.      .....+|...|.+++++
T Consensus       373 --------------------------~~~~g~llat~sKD~svilWr~~~~~~~~~~------~a~~~gH~~svgava~~  420 (775)
T KOG0319|consen  373 --------------------------VWSSGDLLATGSKDKSVILWRLNNNCSKSLC------VAQANGHTNSVGAVAGS  420 (775)
T ss_pred             --------------------------ecccCcEEEEecCCceEEEEEecCCcchhhh------hhhhcccccccceeeec
Confidence                                      2234459999999999999988544322111      12227899999999998


Q ss_pred             CCC-CEEEEEeccceEEEEEeccCCcccccceeeecccccCccceeeeEEEeecCCCeEEEEEecCCcEEEEEecCCcEE
Q 001628          509 GTS-RVLVSGDQSGMVRIFKLKYEPHAIENSFLSFTGSKKGNSHIIHSVKVMKINGSIISLNMNRNSQHLAVGSDQGYVY  587 (1042)
Q Consensus       509 p~~-~~Lasg~~dG~V~vw~~~~~~~~~~~~~~~~~~~~~g~~~~~~~~~~~~~~~~V~~l~~spdg~~La~gs~dg~V~  587 (1042)
                      ..+ ..|++++.|+++++|.+...+.... ...        ....   .....|...|.+++++|+.+++|+|+.|.+.+
T Consensus       421 ~~~asffvsvS~D~tlK~W~l~~s~~~~~-~~~--------~~~~---~t~~aHdKdIN~Vaia~ndkLiAT~SqDktaK  488 (775)
T KOG0319|consen  421 KLGASFFVSVSQDCTLKLWDLPKSKETAF-PIV--------LTCR---YTERAHDKDINCVAIAPNDKLIATGSQDKTAK  488 (775)
T ss_pred             ccCccEEEEecCCceEEEecCCCcccccc-cce--------ehhh---HHHHhhcccccceEecCCCceEEeccccccee
Confidence            776 7899999999999999987333210 000        0000   22345779999999999999999999999999


Q ss_pred             EEeccCCeEE--EecccccccCCCeEEEEEEeeecCCCCceEEEEEeCCceEEEEECCCCceeeee
Q 001628          588 LLDTEGPTVL--YQKHIASDISSGIVSLQFETCSLQGFEKNFLVIATKDSSVLVLDSDNGNMLSTN  651 (1042)
Q Consensus       588 vwD~~~~~~~--~~~~~~~~~~~~V~sl~fs~~~~~~~~~~~L~s~s~Dg~V~vwd~~tg~~i~~~  651 (1042)
                      ||++....+.  +.+|     .-.|.++.|+|      ..+.|+|+|.|++|++|.+++..++.++
T Consensus       489 iW~le~~~l~~vLsGH-----~RGvw~V~Fs~------~dq~laT~SgD~TvKIW~is~fSClkT~  543 (775)
T KOG0319|consen  489 IWDLEQLRLLGVLSGH-----TRGVWCVSFSK------NDQLLATCSGDKTVKIWSISTFSCLKTF  543 (775)
T ss_pred             eecccCceEEEEeeCC-----ccceEEEEecc------ccceeEeccCCceEEEEEeccceeeeee
Confidence            9999977775  5555     44999999999      8999999999999999999988877776

>KOG0318 consensus WD40 repeat stress protein/actin interacting protein [Cytoskeleton] Back     alignment and domain information
>KOG0271 consensus Notchless-like WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0291 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification] Back     alignment and domain information
>KOG0271 consensus Notchless-like WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0318 consensus WD40 repeat stress protein/actin interacting protein [Cytoskeleton] Back     alignment and domain information
>KOG0319 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification] Back     alignment and domain information
>KOG0291 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification] Back     alignment and domain information
>KOG0306 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification] Back     alignment and domain information
>KOG0306 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification] Back     alignment and domain information
>KOG0272 consensus U4/U6 small nuclear ribonucleoprotein Prp4 (contains WD40 repeats) [RNA processing and modification] Back     alignment and domain information
>KOG0272 consensus U4/U6 small nuclear ribonucleoprotein Prp4 (contains WD40 repeats) [RNA processing and modification] Back     alignment and domain information
>KOG0273 consensus Beta-transducin family (WD-40 repeat) protein [Chromatin structure and dynamics] Back     alignment and domain information
>KOG0276 consensus Vesicle coat complex COPI, beta' subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0286 consensus G-protein beta subunit [General function prediction only] Back     alignment and domain information
>KOG0286 consensus G-protein beta subunit [General function prediction only] Back     alignment and domain information
>KOG0315 consensus G-protein beta subunit-like protein (contains WD40 repeats) [General function prediction only] Back     alignment and domain information
>KOG1408 consensus WD40 repeat protein [Function unknown] Back     alignment and domain information
>KOG0279 consensus G protein beta subunit-like protein [Signal transduction mechanisms] Back     alignment and domain information
>KOG0279 consensus G protein beta subunit-like protein [Signal transduction mechanisms] Back     alignment and domain information
>KOG0296 consensus Angio-associated migratory cell protein (contains WD40 repeats) [Function unknown] Back     alignment and domain information
>KOG0292 consensus Vesicle coat complex COPI, alpha subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0315 consensus G-protein beta subunit-like protein (contains WD40 repeats) [General function prediction only] Back     alignment and domain information
>KOG0296 consensus Angio-associated migratory cell protein (contains WD40 repeats) [Function unknown] Back     alignment and domain information
>KOG0273 consensus Beta-transducin family (WD-40 repeat) protein [Chromatin structure and dynamics] Back     alignment and domain information
>KOG2106 consensus Uncharacterized conserved protein, contains HELP and WD40 domains [Function unknown] Back     alignment and domain information
>KOG1539 consensus WD repeat protein [General function prediction only] Back     alignment and domain information
>KOG0276 consensus Vesicle coat complex COPI, beta' subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1408 consensus WD40 repeat protein [Function unknown] Back     alignment and domain information
>KOG1539 consensus WD repeat protein [General function prediction only] Back     alignment and domain information
>KOG0284 consensus Polyadenylation factor I complex, subunit PFS2 [RNA processing and modification] Back     alignment and domain information
>KOG0645 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG2048 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0263 consensus Transcription initiation factor TFIID, subunit TAF5 (also component of histone acetyltransferase SAGA) [Transcription] Back     alignment and domain information
>KOG0292 consensus Vesicle coat complex COPI, alpha subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0645 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0263 consensus Transcription initiation factor TFIID, subunit TAF5 (also component of histone acetyltransferase SAGA) [Transcription] Back     alignment and domain information
>KOG0284 consensus Polyadenylation factor I complex, subunit PFS2 [RNA processing and modification] Back     alignment and domain information
>KOG0285 consensus Pleiotropic regulator 1 [RNA processing and modification] Back     alignment and domain information
>KOG1063 consensus RNA polymerase II elongator complex, subunit ELP2, WD repeat superfamily [Chromatin structure and dynamics; Transcription] Back     alignment and domain information
>PLN00181 protein SPA1-RELATED; Provisional Back     alignment and domain information
>KOG1983 consensus Tomosyn and related SNARE-interacting proteins [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0285 consensus Pleiotropic regulator 1 [RNA processing and modification] Back     alignment and domain information
>KOG0295 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0265 consensus U5 snRNP-specific protein-like factor and related proteins [RNA processing and modification] Back     alignment and domain information
>KOG0293 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>PLN00181 protein SPA1-RELATED; Provisional Back     alignment and domain information
>cd00200 WD40 WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and botto Back     alignment and domain information
>KOG0266 consensus WD40 repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG0265 consensus U5 snRNP-specific protein-like factor and related proteins [RNA processing and modification] Back     alignment and domain information
>KOG0295 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>cd00200 WD40 WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and botto Back     alignment and domain information
>KOG0293 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0282 consensus mRNA splicing factor [Function unknown] Back     alignment and domain information
>KOG0266 consensus WD40 repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG0282 consensus mRNA splicing factor [Function unknown] Back     alignment and domain information
>KOG0281 consensus Beta-TrCP (transducin repeats containing)/Slimb proteins [Function unknown] Back     alignment and domain information
>KOG2106 consensus Uncharacterized conserved protein, contains HELP and WD40 domains [Function unknown] Back     alignment and domain information
>KOG0281 consensus Beta-TrCP (transducin repeats containing)/Slimb proteins [Function unknown] Back     alignment and domain information
>KOG0316 consensus Conserved WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0313 consensus Microtubule binding protein YTM1 (contains WD40 repeats) [Cytoskeleton] Back     alignment and domain information
>KOG0772 consensus Uncharacterized conserved protein, contains WD40 repeat [Function unknown] Back     alignment and domain information
>KOG2048 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PF08596 Lgl_C: Lethal giant larvae(Lgl) like, C-terminal; InterPro: IPR013905 The Lethal giant larvae (Lgl) tumour suppressor protein is conserved from yeast to mammals Back     alignment and domain information
>KOG0316 consensus Conserved WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0275 consensus Conserved WD40 repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG1063 consensus RNA polymerase II elongator complex, subunit ELP2, WD repeat superfamily [Chromatin structure and dynamics; Transcription] Back     alignment and domain information
>KOG0288 consensus WD40 repeat protein TipD [General function prediction only] Back     alignment and domain information
>KOG0643 consensus Translation initiation factor 3, subunit i (eIF-3i)/TGF-beta receptor-interacting protein (TRIP-1) [Translation, ribosomal structure and biogenesis; Signal transduction mechanisms] Back     alignment and domain information
>KOG0640 consensus mRNA cleavage stimulating factor complex; subunit 1 [RNA processing and modification] Back     alignment and domain information
>KOG0313 consensus Microtubule binding protein YTM1 (contains WD40 repeats) [Cytoskeleton] Back     alignment and domain information
>KOG0277 consensus Peroxisomal targeting signal type 2 receptor [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0278 consensus Serine/threonine kinase receptor-associated protein [Lipid transport and metabolism] Back     alignment and domain information
>KOG1407 consensus WD40 repeat protein [Function unknown] Back     alignment and domain information
>KOG0278 consensus Serine/threonine kinase receptor-associated protein [Lipid transport and metabolism] Back     alignment and domain information
>KOG0275 consensus Conserved WD40 repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG0310 consensus Conserved WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0643 consensus Translation initiation factor 3, subunit i (eIF-3i)/TGF-beta receptor-interacting protein (TRIP-1) [Translation, ribosomal structure and biogenesis; Signal transduction mechanisms] Back     alignment and domain information
>KOG0310 consensus Conserved WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0772 consensus Uncharacterized conserved protein, contains WD40 repeat [Function unknown] Back     alignment and domain information
>KOG0283 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0277 consensus Peroxisomal targeting signal type 2 receptor [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0299 consensus U3 snoRNP-associated protein (contains WD40 repeats) [RNA processing and modification] Back     alignment and domain information
>KOG0305 consensus Anaphase promoting complex, Cdc20, Cdh1, and Ama1 subunits [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0640 consensus mRNA cleavage stimulating factor complex; subunit 1 [RNA processing and modification] Back     alignment and domain information
>KOG0288 consensus WD40 repeat protein TipD [General function prediction only] Back     alignment and domain information
>KOG0289 consensus mRNA splicing factor [General function prediction only] Back     alignment and domain information
>KOG0641 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0647 consensus mRNA export protein (contains WD40 repeats) [RNA processing and modification] Back     alignment and domain information
>KOG0268 consensus Sof1-like rRNA processing protein (contains WD40 repeats) [RNA processing and modification] Back     alignment and domain information
>KOG0299 consensus U3 snoRNP-associated protein (contains WD40 repeats) [RNA processing and modification] Back     alignment and domain information
>KOG0973 consensus Histone transcription regulator HIRA, WD repeat superfamily [Cell cycle control, cell division, chromosome partitioning; Transcription] Back     alignment and domain information
>KOG0283 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0646 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PTZ00421 coronin; Provisional Back     alignment and domain information
>KOG2055 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG2096 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0305 consensus Anaphase promoting complex, Cdc20, Cdh1, and Ama1 subunits [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0973 consensus Histone transcription regulator HIRA, WD repeat superfamily [Cell cycle control, cell division, chromosome partitioning; Transcription] Back     alignment and domain information
>KOG1445 consensus Tumor-specific antigen (contains WD repeats) [Cytoskeleton] Back     alignment and domain information
>KOG0300 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0289 consensus mRNA splicing factor [General function prediction only] Back     alignment and domain information
>KOG0301 consensus Phospholipase A2-activating protein (contains WD40 repeats) [Lipid transport and metabolism] Back     alignment and domain information
>KOG1036 consensus Mitotic spindle checkpoint protein BUB3, WD repeat superfamily [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0647 consensus mRNA export protein (contains WD40 repeats) [RNA processing and modification] Back     alignment and domain information
>KOG0308 consensus Conserved WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0268 consensus Sof1-like rRNA processing protein (contains WD40 repeats) [RNA processing and modification] Back     alignment and domain information
>KOG0641 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PTZ00421 coronin; Provisional Back     alignment and domain information
>KOG2055 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0274 consensus Cdc4 and related F-box and WD-40 proteins [General function prediction only] Back     alignment and domain information
>PTZ00420 coronin; Provisional Back     alignment and domain information
>KOG2096 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0274 consensus Cdc4 and related F-box and WD-40 proteins [General function prediction only] Back     alignment and domain information
>KOG0294 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG1446 consensus Histone H3 (Lys4) methyltransferase complex and RNA cleavage factor II complex, subunit SWD2 [RNA processing and modification; Chromatin structure and dynamics; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1446 consensus Histone H3 (Lys4) methyltransferase complex and RNA cleavage factor II complex, subunit SWD2 [RNA processing and modification; Chromatin structure and dynamics; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0301 consensus Phospholipase A2-activating protein (contains WD40 repeats) [Lipid transport and metabolism] Back     alignment and domain information
>PTZ00420 coronin; Provisional Back     alignment and domain information
>KOG1036 consensus Mitotic spindle checkpoint protein BUB3, WD repeat superfamily [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0300 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG1332 consensus Vesicle coat complex COPII, subunit SEC13 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1407 consensus WD40 repeat protein [Function unknown] Back     alignment and domain information
>KOG0294 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0308 consensus Conserved WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG1332 consensus Vesicle coat complex COPII, subunit SEC13 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0639 consensus Transducin-like enhancer of split protein (contains WD40 repeats) [Chromatin structure and dynamics] Back     alignment and domain information
>KOG1274 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG1445 consensus Tumor-specific antigen (contains WD repeats) [Cytoskeleton] Back     alignment and domain information
>KOG0264 consensus Nucleosome remodeling factor, subunit CAF1/NURF55/MSI1 [Chromatin structure and dynamics] Back     alignment and domain information
>KOG0269 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG4283 consensus Transcription-coupled repair protein CSA, contains WD40 domain [Transcription; Replication, recombination and repair] Back     alignment and domain information
>KOG0264 consensus Nucleosome remodeling factor, subunit CAF1/NURF55/MSI1 [Chromatin structure and dynamics] Back     alignment and domain information
>KOG0321 consensus WD40 repeat-containing protein L2DTL [Function unknown] Back     alignment and domain information
>KOG0269 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG2445 consensus Nuclear pore complex component (sc Seh1) [Nuclear structure; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0639 consensus Transducin-like enhancer of split protein (contains WD40 repeats) [Chromatin structure and dynamics] Back     alignment and domain information
>TIGR03866 PQQ_ABC_repeats PQQ-dependent catabolism-associated beta-propeller protein Back     alignment and domain information
>KOG1274 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0321 consensus WD40 repeat-containing protein L2DTL [Function unknown] Back     alignment and domain information
>KOG0646 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG1963 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG2445 consensus Nuclear pore complex component (sc Seh1) [Nuclear structure; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1538 consensus Uncharacterized conserved protein WDR10, contains WD40 repeats [General function prediction only] Back     alignment and domain information
>KOG4328 consensus WD40 protein [Function unknown] Back     alignment and domain information
>TIGR03866 PQQ_ABC_repeats PQQ-dependent catabolism-associated beta-propeller protein Back     alignment and domain information
>KOG4328 consensus WD40 protein [Function unknown] Back     alignment and domain information
>KOG4283 consensus Transcription-coupled repair protein CSA, contains WD40 domain [Transcription; Replication, recombination and repair] Back     alignment and domain information
>KOG1034 consensus Transcriptional repressor EED/ESC/FIE, required for transcriptional silencing, WD repeat superfamily [Transcription] Back     alignment and domain information
>KOG0650 consensus WD40 repeat nucleolar protein Bop1, involved in ribosome biogenesis [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG1273 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG1273 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>COG2319 FOG: WD40 repeat [General function prediction only] Back     alignment and domain information
>KOG0270 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG2919 consensus Guanine nucleotide-binding protein [General function prediction only] Back     alignment and domain information
>KOG1963 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0650 consensus WD40 repeat nucleolar protein Bop1, involved in ribosome biogenesis [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG0270 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0267 consensus Microtubule severing protein katanin p80 subunit B (contains WD40 repeats) [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG1538 consensus Uncharacterized conserved protein WDR10, contains WD40 repeats [General function prediction only] Back     alignment and domain information
>KOG0302 consensus Ribosome Assembly protein [General function prediction only] Back     alignment and domain information
>KOG0302 consensus Ribosome Assembly protein [General function prediction only] Back     alignment and domain information
>KOG1009 consensus Chromatin assembly complex 1 subunit B/CAC2 (contains WD40 repeats) [Chromatin structure and dynamics; Replication, recombination and repair] Back     alignment and domain information
>KOG1517 consensus Guanine nucleotide binding protein MIP1 [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG4378 consensus Nuclear protein COP1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0307 consensus Vesicle coat complex COPII, subunit SEC31 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1034 consensus Transcriptional repressor EED/ESC/FIE, required for transcriptional silencing, WD repeat superfamily [Transcription] Back     alignment and domain information
>KOG0267 consensus Microtubule severing protein katanin p80 subunit B (contains WD40 repeats) [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG1188 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG4378 consensus Nuclear protein COP1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG1240 consensus Protein kinase containing WD40 repeats [Signal transduction mechanisms] Back     alignment and domain information
>KOG0322 consensus G-protein beta subunit-like protein GNB1L, contains WD repeats [General function prediction only] Back     alignment and domain information
>KOG1587 consensus Cytoplasmic dynein intermediate chain [Cytoskeleton] Back     alignment and domain information
>KOG4227 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0307 consensus Vesicle coat complex COPII, subunit SEC31 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0322 consensus G-protein beta subunit-like protein GNB1L, contains WD repeats [General function prediction only] Back     alignment and domain information
>KOG1517 consensus Guanine nucleotide binding protein MIP1 [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0642 consensus Cell-cycle nuclear protein, contains WD-40 repeats [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG1587 consensus Cytoplasmic dynein intermediate chain [Cytoskeleton] Back     alignment and domain information
>COG2319 FOG: WD40 repeat [General function prediction only] Back     alignment and domain information
>KOG1524 consensus WD40 repeat-containing protein CHE-2 [General function prediction only] Back     alignment and domain information
>KOG0290 consensus Conserved WD40 repeat-containing protein AN11 [Function unknown] Back     alignment and domain information
>KOG1912 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG4227 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG1007 consensus WD repeat protein TSSC1, WD repeat superfamily [Function unknown] Back     alignment and domain information
>KOG1009 consensus Chromatin assembly complex 1 subunit B/CAC2 (contains WD40 repeats) [Chromatin structure and dynamics; Replication, recombination and repair] Back     alignment and domain information
>PRK11028 6-phosphogluconolactonase; Provisional Back     alignment and domain information
>KOG2919 consensus Guanine nucleotide-binding protein [General function prediction only] Back     alignment and domain information
>KOG1188 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0642 consensus Cell-cycle nuclear protein, contains WD-40 repeats [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0290 consensus Conserved WD40 repeat-containing protein AN11 [Function unknown] Back     alignment and domain information
>KOG1524 consensus WD40 repeat-containing protein CHE-2 [General function prediction only] Back     alignment and domain information
>KOG4497 consensus Uncharacterized conserved protein WDR8, contains WD repeats [General function prediction only] Back     alignment and domain information
>KOG4497 consensus Uncharacterized conserved protein WDR8, contains WD repeats [General function prediction only] Back     alignment and domain information
>KOG0644 consensus Uncharacterized conserved protein, contains WD40 repeat and BROMO domains [General function prediction only] Back     alignment and domain information
>KOG1523 consensus Actin-related protein Arp2/3 complex, subunit ARPC1/p41-ARC [Cytoskeleton] Back     alignment and domain information
>KOG0649 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG1007 consensus WD repeat protein TSSC1, WD repeat superfamily [Function unknown] Back     alignment and domain information
>PRK11028 6-phosphogluconolactonase; Provisional Back     alignment and domain information
>KOG2394 consensus WD40 protein DMR-N9 [General function prediction only] Back     alignment and domain information
>KOG0771 consensus Prolactin regulatory element-binding protein/Protein transport protein SEC12p [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0974 consensus WD-repeat protein WDR6, WD repeat superfamily [General function prediction only] Back     alignment and domain information
>KOG2110 consensus Uncharacterized conserved protein, contains WD40 repeats [Function unknown] Back     alignment and domain information
>KOG0303 consensus Actin-binding protein Coronin, contains WD40 repeats [Cytoskeleton] Back     alignment and domain information
>KOG1240 consensus Protein kinase containing WD40 repeats [Signal transduction mechanisms] Back     alignment and domain information
>KOG0771 consensus Prolactin regulatory element-binding protein/Protein transport protein SEC12p [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0303 consensus Actin-binding protein Coronin, contains WD40 repeats [Cytoskeleton] Back     alignment and domain information
>KOG1334 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PF04762 IKI3: IKI3 family; InterPro: IPR006849 Members of this family are components of the elongator multi-subunit component of a novel RNA polymerase II holoenzyme for transcriptional elongation [] Back     alignment and domain information
>KOG2111 consensus Uncharacterized conserved protein, contains WD40 repeats [Function unknown] Back     alignment and domain information
>KOG0649 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG2139 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG2139 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PRK01742 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG1310 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG2041 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PF02239 Cytochrom_D1: Cytochrome D1 heme domain; PDB: 1NNO_B 1HZU_A 1N15_B 1N50_A 1GJQ_A 1BL9_B 1NIR_B 1N90_B 1HZV_A 1AOQ_A Back     alignment and domain information
>KOG2321 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PRK01742 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PF02239 Cytochrom_D1: Cytochrome D1 heme domain; PDB: 1NNO_B 1HZU_A 1N15_B 1N50_A 1GJQ_A 1BL9_B 1NIR_B 1N90_B 1HZV_A 1AOQ_A Back     alignment and domain information
>KOG1523 consensus Actin-related protein Arp2/3 complex, subunit ARPC1/p41-ARC [Cytoskeleton] Back     alignment and domain information
>KOG0644 consensus Uncharacterized conserved protein, contains WD40 repeat and BROMO domains [General function prediction only] Back     alignment and domain information
>KOG1912 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG1334 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG2394 consensus WD40 protein DMR-N9 [General function prediction only] Back     alignment and domain information
>PRK03629 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PF04762 IKI3: IKI3 family; InterPro: IPR006849 Members of this family are components of the elongator multi-subunit component of a novel RNA polymerase II holoenzyme for transcriptional elongation [] Back     alignment and domain information
>KOG1310 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG3881 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1272 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification] Back     alignment and domain information
>KOG1272 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification] Back     alignment and domain information
>COG5354 Uncharacterized protein, contains Trp-Asp (WD) repeat [General function prediction only] Back     alignment and domain information
>PF08662 eIF2A: Eukaryotic translation initiation factor eIF2A; InterPro: IPR013979 This entry contains beta propellor domains found in eukaryotic translation initiation factors and TolB domain-containing proteins Back     alignment and domain information
>KOG2110 consensus Uncharacterized conserved protein, contains WD40 repeats [Function unknown] Back     alignment and domain information
>KOG2041 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PRK03629 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK05137 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG3617 consensus WD40 and TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF08662 eIF2A: Eukaryotic translation initiation factor eIF2A; InterPro: IPR013979 This entry contains beta propellor domains found in eukaryotic translation initiation factors and TolB domain-containing proteins Back     alignment and domain information
>KOG2315 consensus Predicted translation initiation factor related to eIF-3a [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK04922 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK05137 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG1409 consensus Uncharacterized conserved protein, contains WD40 repeats and FYVE domains [Function unknown] Back     alignment and domain information
>PRK04922 tolB translocation protein TolB; Provisional Back     alignment and domain information
>COG4946 Uncharacterized protein related to the periplasmic component of the Tol biopolymer transport system [Function unknown] Back     alignment and domain information
>PF10282 Lactonase: Lactonase, 7-bladed beta-propeller; InterPro: IPR019405 6-phosphogluconolactonases (6PGL) 3 Back     alignment and domain information
>PRK02889 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PF10282 Lactonase: Lactonase, 7-bladed beta-propeller; InterPro: IPR019405 6-phosphogluconolactonases (6PGL) 3 Back     alignment and domain information
>KOG2315 consensus Predicted translation initiation factor related to eIF-3a [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG1409 consensus Uncharacterized conserved protein, contains WD40 repeats and FYVE domains [Function unknown] Back     alignment and domain information
>PRK02889 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG2314 consensus Translation initiation factor 3, subunit b (eIF-3b) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG2111 consensus Uncharacterized conserved protein, contains WD40 repeats [Function unknown] Back     alignment and domain information
>TIGR02658 TTQ_MADH_Hv methylamine dehydrogenase heavy chain Back     alignment and domain information
>COG4946 Uncharacterized protein related to the periplasmic component of the Tol biopolymer transport system [Function unknown] Back     alignment and domain information
>KOG3881 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1354 consensus Serine/threonine protein phosphatase 2A, regulatory subunit [Signal transduction mechanisms] Back     alignment and domain information
>KOG3617 consensus WD40 and TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG2321 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>TIGR02800 propeller_TolB tol-pal system beta propeller repeat protein TolB Back     alignment and domain information
>KOG4547 consensus WD40 repeat-containing protein [General function prediction only] Back     alignment and domain information
>PRK00178 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK00178 tolB translocation protein TolB; Provisional Back     alignment and domain information
>TIGR02800 propeller_TolB tol-pal system beta propeller repeat protein TolB Back     alignment and domain information
>PRK04792 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK04792 tolB translocation protein TolB; Provisional Back     alignment and domain information
>COG2706 3-carboxymuconate cyclase [Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG1354 consensus Serine/threonine protein phosphatase 2A, regulatory subunit [Signal transduction mechanisms] Back     alignment and domain information
>KOG0974 consensus WD-repeat protein WDR6, WD repeat superfamily [General function prediction only] Back     alignment and domain information
>KOG4547 consensus WD40 repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG1064 consensus RAVE (regulator of V-ATPase assembly) complex subunit RAV1/DMX protein, WD repeat superfamily [General function prediction only] Back     alignment and domain information
>KOG3914 consensus WD repeat protein WDR4 [Function unknown] Back     alignment and domain information
>TIGR02658 TTQ_MADH_Hv methylamine dehydrogenase heavy chain Back     alignment and domain information
>KOG1064 consensus RAVE (regulator of V-ATPase assembly) complex subunit RAV1/DMX protein, WD repeat superfamily [General function prediction only] Back     alignment and domain information
>TIGR03300 assembly_YfgL outer membrane assembly lipoprotein YfgL Back     alignment and domain information
>PLN02919 haloacid dehalogenase-like hydrolase family protein Back     alignment and domain information
>PRK01029 tolB translocation protein TolB; Provisional Back     alignment and domain information
>TIGR03300 assembly_YfgL outer membrane assembly lipoprotein YfgL Back     alignment and domain information
>KOG0309 consensus Conserved WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>COG5354 Uncharacterized protein, contains Trp-Asp (WD) repeat [General function prediction only] Back     alignment and domain information
>KOG3914 consensus WD repeat protein WDR4 [Function unknown] Back     alignment and domain information
>KOG4532 consensus WD40-like repeat containing protein [General function prediction only] Back     alignment and domain information
>PF15492 Nbas_N: Neuroblastoma-amplified sequence, N terminal Back     alignment and domain information
>COG2706 3-carboxymuconate cyclase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PLN02919 haloacid dehalogenase-like hydrolase family protein Back     alignment and domain information
>KOG4532 consensus WD40-like repeat containing protein [General function prediction only] Back     alignment and domain information
>KOG4190 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG0280 consensus Uncharacterized conserved protein [Amino acid transport and metabolism] Back     alignment and domain information
>KOG4714 consensus Nucleoporin [Nuclear structure] Back     alignment and domain information
>KOG2314 consensus Translation initiation factor 3, subunit b (eIF-3b) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PF15492 Nbas_N: Neuroblastoma-amplified sequence, N terminal Back     alignment and domain information
>KOG4714 consensus Nucleoporin [Nuclear structure] Back     alignment and domain information
>PRK01029 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG0882 consensus Cyclophilin-related peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2114 consensus Vacuolar assembly/sorting protein PEP5/VPS11 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PRK04043 tolB translocation protein TolB; Provisional Back     alignment and domain information
>COG5170 CDC55 Serine/threonine protein phosphatase 2A, regulatory subunit [Signal transduction mechanisms] Back     alignment and domain information
>KOG0280 consensus Uncharacterized conserved protein [Amino acid transport and metabolism] Back     alignment and domain information
>KOG2695 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG2066 consensus Vacuolar assembly/sorting protein VPS41 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0309 consensus Conserved WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG4190 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1897 consensus Damage-specific DNA binding complex, subunit DDB1 [Replication, recombination and repair] Back     alignment and domain information
>PRK11138 outer membrane biogenesis protein BamB; Provisional Back     alignment and domain information
>KOG2695 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PRK11138 outer membrane biogenesis protein BamB; Provisional Back     alignment and domain information
>KOG1920 consensus IkappaB kinase complex, IKAP component [Transcription] Back     alignment and domain information
>COG5170 CDC55 Serine/threonine protein phosphatase 2A, regulatory subunit [Signal transduction mechanisms] Back     alignment and domain information
>PF08450 SGL: SMP-30/Gluconolaconase/LRE-like region; InterPro: IPR013658 This family describes a region that is found in proteins expressed by a variety of eukaryotic and prokaryotic species Back     alignment and domain information
>KOG3621 consensus WD40 repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF11768 DUF3312: Protein of unknown function (DUF3312); InterPro: IPR024511 This is a eukaryotic family of uncharacterised proteins that contain WD40 repeats Back     alignment and domain information
>KOG1920 consensus IkappaB kinase complex, IKAP component [Transcription] Back     alignment and domain information
>PRK04043 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PF00400 WD40: WD domain, G-beta repeat; InterPro: IPR019781 WD-40 repeats (also known as WD or beta-transducin repeats) are short ~40 amino acid motifs, often terminating in a Trp-Asp (W-D) dipeptide Back     alignment and domain information
>PF11768 DUF3312: Protein of unknown function (DUF3312); InterPro: IPR024511 This is a eukaryotic family of uncharacterised proteins that contain WD40 repeats Back     alignment and domain information
>PF06977 SdiA-regulated: SdiA-regulated; InterPro: IPR009722 This entry represents a conserved region approximately 100 residues long within a number of hypothetical bacterial proteins that may be regulated by SdiA, a member of the LuxR family of transcriptional regulators [] Back     alignment and domain information
>KOG2114 consensus Vacuolar assembly/sorting protein PEP5/VPS11 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG2066 consensus Vacuolar assembly/sorting protein VPS41 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF00400 WD40: WD domain, G-beta repeat; InterPro: IPR019781 WD-40 repeats (also known as WD or beta-transducin repeats) are short ~40 amino acid motifs, often terminating in a Trp-Asp (W-D) dipeptide Back     alignment and domain information
>PF08450 SGL: SMP-30/Gluconolaconase/LRE-like region; InterPro: IPR013658 This family describes a region that is found in proteins expressed by a variety of eukaryotic and prokaryotic species Back     alignment and domain information
>KOG1645 consensus RING-finger-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3621 consensus WD40 repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG0860 consensus Synaptobrevin/VAMP-like protein [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG4649 consensus PQQ (pyrrolo-quinoline quinone) repeat protein [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>KOG1275 consensus PAB-dependent poly(A) ribonuclease, subunit PAN2 [Replication, recombination and repair] Back     alignment and domain information
>KOG0882 consensus Cyclophilin-related peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF04841 Vps16_N: Vps16, N-terminal region; InterPro: IPR006926 This protein forms part of the Class C vacuolar protein sorting (Vps) complex Back     alignment and domain information
>PF13360 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 3Q54_A 2YH3_A 3PRW_A 3P1L_A 3Q7M_A 3Q7O_A 3Q7N_A Back     alignment and domain information
>KOG1645 consensus RING-finger-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13360 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 3Q54_A 2YH3_A 3PRW_A 3P1L_A 3Q7M_A 3Q7O_A 3Q7N_A Back     alignment and domain information
>PF00957 Synaptobrevin: Synaptobrevin; InterPro: IPR001388 Synaptobrevin is an intrinsic membrane protein of small synaptic vesicles [], specialised secretory organelles of neurons that actively accumulate neurotransmitters and participate in their calcium-dependent release by exocytosis Back     alignment and domain information
>KOG1832 consensus HIV-1 Vpr-binding protein [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PF03178 CPSF_A: CPSF A subunit region; InterPro: IPR004871 This family includes a region that lies towards the C terminus of the cleavage and polyadenylation specificity factor (CPSF) A (160 kDa) subunit Back     alignment and domain information
>PF07433 DUF1513: Protein of unknown function (DUF1513); InterPro: IPR008311 There are currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function Back     alignment and domain information
>KOG1008 consensus Uncharacterized conserved protein, contains WD40 repeats [Function unknown] Back     alignment and domain information
>KOG4649 consensus PQQ (pyrrolo-quinoline quinone) repeat protein [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PF07433 DUF1513: Protein of unknown function (DUF1513); InterPro: IPR008311 There are currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function Back     alignment and domain information
>PF08596 Lgl_C: Lethal giant larvae(Lgl) like, C-terminal; InterPro: IPR013905 The Lethal giant larvae (Lgl) tumour suppressor protein is conserved from yeast to mammals Back     alignment and domain information
>PF06433 Me-amine-dh_H: Methylamine dehydrogenase heavy chain (MADH); InterPro: IPR009451 Methylamine dehydrogenase (1 Back     alignment and domain information
>PF08366 LLGL: LLGL2; InterPro: IPR013577 This domain is found in lethal giant larvae homologue 2 (LLGL2) proteins and syntaxin-binding proteins like tomosyn [] Back     alignment and domain information
>PF04841 Vps16_N: Vps16, N-terminal region; InterPro: IPR006926 This protein forms part of the Class C vacuolar protein sorting (Vps) complex Back     alignment and domain information
>KOG4640 consensus Anaphase-promoting complex (APC), subunit 4 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF00780 CNH: CNH domain; InterPro: IPR001180 Based on sequence similarities a domain of homology has been identified in the following proteins []: Citron and Citron kinase Back     alignment and domain information
>PF12894 Apc4_WD40: Anaphase-promoting complex subunit 4 WD40 domain Back     alignment and domain information
>COG3204 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF14783 BBS2_Mid: Ciliary BBSome complex subunit 2, middle region Back     alignment and domain information
>KOG2079 consensus Vacuolar assembly/sorting protein VPS8 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PRK02888 nitrous-oxide reductase; Validated Back     alignment and domain information
>cd00216 PQQ_DH Dehydrogenases with pyrrolo-quinoline quinone (PQQ) as cofactor, like ethanol, methanol, and membrane bound glucose dehydrogenases Back     alignment and domain information
>PF14655 RAB3GAP2_N: Rab3 GTPase-activating protein regulatory subunit N-terminus Back     alignment and domain information
>PF14783 BBS2_Mid: Ciliary BBSome complex subunit 2, middle region Back     alignment and domain information
>KOG4640 consensus Anaphase-promoting complex (APC), subunit 4 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF14727 PHTB1_N: PTHB1 N-terminus Back     alignment and domain information
>PF00930 DPPIV_N: Dipeptidyl peptidase IV (DPP IV) N-terminal region; InterPro: IPR002469 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>KOG1897 consensus Damage-specific DNA binding complex, subunit DDB1 [Replication, recombination and repair] Back     alignment and domain information
>PF04053 Coatomer_WDAD: Coatomer WD associated region ; InterPro: IPR006692 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>KOG2079 consensus Vacuolar assembly/sorting protein VPS8 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF08553 VID27: VID27 cytoplasmic protein; InterPro: IPR013863 This entry represents fungal and plant proteins and contains many hypothetical proteins Back     alignment and domain information
>cd00216 PQQ_DH Dehydrogenases with pyrrolo-quinoline quinone (PQQ) as cofactor, like ethanol, methanol, and membrane bound glucose dehydrogenases Back     alignment and domain information
>PF06977 SdiA-regulated: SdiA-regulated; InterPro: IPR009722 This entry represents a conserved region approximately 100 residues long within a number of hypothetical bacterial proteins that may be regulated by SdiA, a member of the LuxR family of transcriptional regulators [] Back     alignment and domain information
>PF00780 CNH: CNH domain; InterPro: IPR001180 Based on sequence similarities a domain of homology has been identified in the following proteins []: Citron and Citron kinase Back     alignment and domain information
>PF05096 Glu_cyclase_2: Glutamine cyclotransferase; InterPro: IPR007788 This family of enzymes 2 Back     alignment and domain information
>KOG1275 consensus PAB-dependent poly(A) ribonuclease, subunit PAN2 [Replication, recombination and repair] Back     alignment and domain information
>PRK13616 lipoprotein LpqB; Provisional Back     alignment and domain information
>TIGR03075 PQQ_enz_alc_DH PQQ-dependent dehydrogenase, methanol/ethanol family Back     alignment and domain information
>KOG1008 consensus Uncharacterized conserved protein, contains WD40 repeats [Function unknown] Back     alignment and domain information
>PF03178 CPSF_A: CPSF A subunit region; InterPro: IPR004871 This family includes a region that lies towards the C terminus of the cleavage and polyadenylation specificity factor (CPSF) A (160 kDa) subunit Back     alignment and domain information
>KOG1832 consensus HIV-1 Vpr-binding protein [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PRK02888 nitrous-oxide reductase; Validated Back     alignment and domain information
>COG0823 TolB Periplasmic component of the Tol biopolymer transport system [Intracellular trafficking and secretion] Back     alignment and domain information
>PF06433 Me-amine-dh_H: Methylamine dehydrogenase heavy chain (MADH); InterPro: IPR009451 Methylamine dehydrogenase (1 Back     alignment and domain information
>smart00320 WD40 WD40 repeats Back     alignment and domain information
>KOG2444 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PF12894 Apc4_WD40: Anaphase-promoting complex subunit 4 WD40 domain Back     alignment and domain information
>PF10168 Nup88: Nuclear pore component; InterPro: IPR019321 Nup88 can be divided into two structural domains; the N-terminal two-thirds of the protein have no obvious structural motifs Back     alignment and domain information
>smart00320 WD40 WD40 repeats Back     alignment and domain information
>COG3391 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF14727 PHTB1_N: PTHB1 N-terminus Back     alignment and domain information
>COG3490 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF10647 Gmad1: Lipoprotein LpqB beta-propeller domain; InterPro: IPR018910 The Gmad1 domain is found associated with IPR019606 from INTERPRO, in bacterial spore formation Back     alignment and domain information
>KOG3630 consensus Nuclear pore complex, Nup214/CAN component [Nuclear structure; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF04053 Coatomer_WDAD: Coatomer WD associated region ; InterPro: IPR006692 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>PF08553 VID27: VID27 cytoplasmic protein; InterPro: IPR013863 This entry represents fungal and plant proteins and contains many hypothetical proteins Back     alignment and domain information
>COG3204 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>KOG2444 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG2395 consensus Protein involved in vacuole import and degradation [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG3630 consensus Nuclear pore complex, Nup214/CAN component [Nuclear structure; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>COG0823 TolB Periplasmic component of the Tol biopolymer transport system [Intracellular trafficking and secretion] Back     alignment and domain information
>COG3386 Gluconolactonase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK13616 lipoprotein LpqB; Provisional Back     alignment and domain information
>COG3391 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF14870 PSII_BNR: Photosynthesis system II assembly factor YCF48; PDB: 2XBG_A Back     alignment and domain information
>KOG0859 consensus Synaptobrevin/VAMP-like protein [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>TIGR03075 PQQ_enz_alc_DH PQQ-dependent dehydrogenase, methanol/ethanol family Back     alignment and domain information
>PF14781 BBS2_N: Ciliary BBSome complex subunit 2, N-terminal Back     alignment and domain information
>COG3490 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>KOG4499 consensus Ca2+-binding protein Regucalcin/SMP30 [Inorganic ion transport and metabolism; Signal transduction mechanisms] Back     alignment and domain information
>PF02897 Peptidase_S9_N: Prolyl oligopeptidase, N-terminal beta-propeller domain; InterPro: IPR004106 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>PF10647 Gmad1: Lipoprotein LpqB beta-propeller domain; InterPro: IPR018910 The Gmad1 domain is found associated with IPR019606 from INTERPRO, in bacterial spore formation Back     alignment and domain information
>PF12234 Rav1p_C: RAVE protein 1 C terminal; InterPro: IPR022033 This domain family is found in eukaryotes, and is typically between 621 and 644 amino acids in length Back     alignment and domain information
>PF10395 Utp8: Utp8 family; InterPro: IPR018843 Utp8 is an essential component of the nuclear tRNA export machinery in Saccharomyces cerevisiae (Baker's yeast) Back     alignment and domain information
>COG3386 Gluconolactonase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PF14761 HPS3_N: Hermansky-Pudlak syndrome 3 Back     alignment and domain information
>PF10168 Nup88: Nuclear pore component; InterPro: IPR019321 Nup88 can be divided into two structural domains; the N-terminal two-thirds of the protein have no obvious structural motifs Back     alignment and domain information
>PF00930 DPPIV_N: Dipeptidyl peptidase IV (DPP IV) N-terminal region; InterPro: IPR002469 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>PF08728 CRT10: CRT10; InterPro: IPR014839 CRT10 is a transcriptional regulator of ribonucleotide reductase (RNR) genes [] Back     alignment and domain information
>PRK13684 Ycf48-like protein; Provisional Back     alignment and domain information
>KOG2395 consensus Protein involved in vacuole import and degradation [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF15390 DUF4613: Domain of unknown function (DUF4613) Back     alignment and domain information
>KOG2280 consensus Vacuolar assembly/sorting protein VPS16 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF14761 HPS3_N: Hermansky-Pudlak syndrome 3 Back     alignment and domain information
>PF08728 CRT10: CRT10; InterPro: IPR014839 CRT10 is a transcriptional regulator of ribonucleotide reductase (RNR) genes [] Back     alignment and domain information
>TIGR02604 Piru_Ver_Nterm putative membrane-bound dehydrogenase domain Back     alignment and domain information
>PF14781 BBS2_N: Ciliary BBSome complex subunit 2, N-terminal Back     alignment and domain information
>PF14655 RAB3GAP2_N: Rab3 GTPase-activating protein regulatory subunit N-terminus Back     alignment and domain information
>KOG2280 consensus Vacuolar assembly/sorting protein VPS16 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF14583 Pectate_lyase22: Oligogalacturonate lyase; PDB: 3C5M_C 3PE7_A Back     alignment and domain information
>PF05694 SBP56: 56kDa selenium binding protein (SBP56); InterPro: IPR008826 This family consists of several eukaryotic selenium binding proteins as well as three sequences from archaea Back     alignment and domain information
>PLN00033 photosystem II stability/assembly factor; Provisional Back     alignment and domain information
>PRK13684 Ycf48-like protein; Provisional Back     alignment and domain information
>KOG1900 consensus Nuclear pore complex, Nup155 component (D Nup154, sc Nup157/Nup170) [Nuclear structure; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF14870 PSII_BNR: Photosynthesis system II assembly factor YCF48; PDB: 2XBG_A Back     alignment and domain information
>KOG1983 consensus Tomosyn and related SNARE-interacting proteins [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF07569 Hira: TUP1-like enhancer of split; InterPro: IPR011494 The Hira proteins are found in a range of eukaryotes and are implicated in the assembly of repressive chromatin Back     alignment and domain information
>KOG1916 consensus Nuclear protein, contains WD40 repeats [General function prediction only] Back     alignment and domain information
>TIGR03118 PEPCTERM_chp_1 conserved hypothetical protein TIGR03118 Back     alignment and domain information
>PF10313 DUF2415: Uncharacterised protein domain (DUF2415); InterPro: IPR019417 This entry represents a short (30 residues) domain of unknown function found in a family of fungal proteins Back     alignment and domain information
>PHA02713 hypothetical protein; Provisional Back     alignment and domain information
>PF10979 DUF2786: Protein of unknown function (DUF2786); InterPro: IPR024498 This domain is found in proteins that have no known function Back     alignment and domain information
>PHA02713 hypothetical protein; Provisional Back     alignment and domain information
>PF07569 Hira: TUP1-like enhancer of split; InterPro: IPR011494 The Hira proteins are found in a range of eukaryotes and are implicated in the assembly of repressive chromatin Back     alignment and domain information
>PF12234 Rav1p_C: RAVE protein 1 C terminal; InterPro: IPR022033 This domain family is found in eukaryotes, and is typically between 621 and 644 amino acids in length Back     alignment and domain information
>KOG2377 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF10214 Rrn6: RNA polymerase I-specific transcription-initiation factor; InterPro: IPR019350 RNA polymerase I-specific transcription-initiation factor Rrn6 and Rrn7 represent components of a multisubunit transcription factor essential for the initiation of rDNA transcription by Pol I [] Back     alignment and domain information
>PF11635 Med16: Mediator complex subunit 16; InterPro: IPR021665 Mediator is a large complex of up to 33 proteins that is conserved from plants through fungi to humans - the number and representation of individual subunits varying with species [],[] Back     alignment and domain information
>PF15390 DUF4613: Domain of unknown function (DUF4613) Back     alignment and domain information
>PF12657 TFIIIC_delta: Transcription factor IIIC subunit delta N-term; InterPro: IPR024761 This entry represents a domain found towards the N terminus of the 90 kDa subunit of transcription factor IIIC (also known as subunit 9 in yeast []) Back     alignment and domain information
>TIGR03118 PEPCTERM_chp_1 conserved hypothetical protein TIGR03118 Back     alignment and domain information
>KOG3616 consensus Selective LIM binding factor [Transcription] Back     alignment and domain information
>PF02897 Peptidase_S9_N: Prolyl oligopeptidase, N-terminal beta-propeller domain; InterPro: IPR004106 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>PF13449 Phytase-like: Esterase-like activity of phytase Back     alignment and domain information
>KOG4441 consensus Proteins containing BTB/POZ and Kelch domains, involved in regulatory/signal transduction processes [Signal transduction mechanisms; General function prediction only] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query1042
2oaj_A902 Protein SNI1; WD40 repeat, beta propeller, endocyt 2e-79
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-08
2j04_B524 YDR362CP, TAU91; beta propeller, type 2 promoters, 6e-06
1urq_A63 M-tomosyn isoform; transport protein, tomosyn-snar 2e-05
1yfq_A342 Cell cycle arrest protein BUB3; WD repeat WD40 rep 3e-05
3lrv_A343 PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiqu 6e-05
3lrv_A343 PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiqu 2e-04
3i2n_A357 WD repeat-containing protein 92; WD40 repeats, str 1e-04
2oit_A434 Nucleoporin 214KDA; NH2 terminal domain of NUP214/ 6e-04
3gre_A437 Serine/threonine-protein kinase VPS15; seven-blade 6e-04
>2oaj_A Protein SNI1; WD40 repeat, beta propeller, endocytosis/exocytosis complex; 2.40A {Saccharomyces cerevisiae} Length = 902 Back     alignment and structure
 Score =  277 bits (710), Expect = 2e-79
 Identities = 116/859 (13%), Positives = 288/859 (33%), Gaps = 91/859 (10%)

Query: 23  KSSDVDPRLVFHYGFPSGCNKFAYDPLQKILAAATKDGRIKLYGRHNNTQALLESSEAVS 82
           K+          YG  S     A+D  Q +LA AT  G + +YG+    + +++  +  +
Sbjct: 2   KNKIFSLAETNKYGMSSKPIAAAFDFTQNLLAIATVTGEVHIYGQ-QQVEVVIKLEDRSA 60

Query: 83  TKFLQFLENQGILLNVTSTNLIEVWDIDKKRLSHVHVCKEEITSFTIMQHSNYMLLGDTA 142
            K ++F++    L+ + + + + V  +  +++        +ITS       ++ML+G   
Sbjct: 61  IKEMRFVKG-IYLVVINAKDTVYVLSLYSQKVLTTVFVPGKITSIDTDASLDWMLIGLQN 119

Query: 143 GKISVLKLDQESSQIVKMKYIIPLSASHGNEVSGDP-AVINILPQPTAESKRILIIFRDG 201
           G + V  +D++        + +          +     +++I   P       ++I  + 
Sbjct: 120 GSMIVYDIDRDQLS----SFKLDNLQKSSFFPAARLSPIVSIQWNPRDIGT--VLISYEY 173

Query: 202 LISLWDIRESKSIFSM----------GGNVLQSVYHETKQVTSACWACPIGSKVAVGYSN 251
           +   + + E++   S           G    ++    T +V  + +  P    +   + +
Sbjct: 174 VTLTYSLVENEIKQSFIYELPPFAPGGDFSEKTNEKRTPKVIQSLY-HPNSLHIITIHED 232

Query: 252 GEILIWGVPS--ILNLKTEECGTQITPICKLNLGYKLDKIPISSLKWVYA-DGKASRLYI 308
             ++ W   S  ++  +T        P          +   IS + W+   + + + L I
Sbjct: 233 NSLVFWDANSGHMIMARTVFETEINVPQPDYIRDSSTNAAKISKVYWMCENNPEYTSLLI 292

Query: 309 MGASDFVSMNLLQIVLLNEQTESRTTKLALPLSEPCIDMEIISSSSDPNKPKQDSFLLLG 368
              S     N    ++    T   +      +     + + +     P      + L + 
Sbjct: 293 SHKSISRGDNQSLTMIDLGYTPRYSITSYEGMKNYYANPKQMKIFPLPTNVPIVNILPIP 352

Query: 369 KSGHFYAFDDCQI---------ERYLLQYQSRSPPSAPKEVMLKMPFLDSSITAMKLITG 419
           +   ++A               E   + Y S             + +L    T     + 
Sbjct: 353 RQSPYFAGCHNPGLILLILGNGEIETMLYPSGIFTDKASLFPQNLSWLRPLATTSMAASV 412

Query: 420 NSFILSSADEDYSLLAKSVPPLLDFETKLKDGSQSHSKVKNLFITGHSDGAINFWDVSCP 479
            + +   A         +   LL    + K   +  ++    FITGHS+G++  +D S  
Sbjct: 413 PNKLWLGALSAAQ----NKDYLLKGGVRTKR-QKLPAEYGTAFITGHSNGSVRIYDASHG 467

Query: 480 LFLLILSLKQQSEKDFSLS-GIPLTALYYDGTSRVLVSGDQSGMVRIFKLKYEPHAIENS 538
                 S +    +  + +  + +  + +   +  L    ++G V +FK +        +
Sbjct: 468 DIQDNASFEVNLSRTLNKAKELAVDKISFAAETLELAVSIETGDVVLFKYEVNQFYSVEN 527

Query: 539 FL---------SFTGSKKGNSHIIH---------------SVKVMKINGSIISLNMNRNS 574
                              N  ++                S  V    G   ++N N N 
Sbjct: 528 RPESGDLEMNFRRFSLNNTNGVLVDVRDRAPTGVRQGFMPSTAVHANKGKTSAIN-NSNI 586

Query: 575 QHLAVGSDQGYVYLLDTEGPTVLYQKHIASD---ISSGIVSLQFETCSL--QGFEKNFLV 629
             + +    G + L+D  GP ++Y ++I       S+ +  ++F        G+    +V
Sbjct: 587 GFVGIAYAAGSLMLIDRRGPAIIYMENIREISGAQSACVTCIEFVIMEYGDDGYSSILMV 646

Query: 630 IATKDSSVL---VLDSDNG--NMLSTNLIHPKKPSRALFMQILNGQDGLARGANLSNVAG 684
             T    V+   +L +  G  ++   ++ +         +   + +   +  A +  +  
Sbjct: 647 CGTDMGEVITYKILPASGGKFDVQLMDITNVTSKGPIHKIDAFSKETKSSCLATIPKMQN 706

Query: 685 MNKGSPKENAVPKQWFVLLCSEKAACAYSLSHAVQGVKKVLYKKKFHSSSCCWASTFYSG 744
           ++KG      +     VL+         +L  + +   K  +K    ++   + ST    
Sbjct: 707 LSKG------LCIPGIVLITGFDDIRLITLGKS-KSTHKG-FKYPLAATGLSYISTVEKN 758

Query: 745 SD----VGLMLLFTSGKFEIRSLPELSLLKETSIRGFVYLTPKPNSLSNTLMCSSWDGEL 800
           +D      ++ L  +G   + ++P+        I   +        ++ + +  +  G++
Sbjct: 759 NDRKNLTVIITLEINGHLRVFTIPDFKEQMSEHIPFPIA----AKYITESSVLRN--GDI 812

Query: 801 IMVNGNQEAFFISALRQRD 819
            +     +A   S ++++D
Sbjct: 813 AIRVSEFQASLFSTVKEQD 831
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>2j04_B YDR362CP, TAU91; beta propeller, type 2 promoters, transcription, hypothetica protein, preinitiation complex, yeast RNA polymerase III; 3.2A {Saccharomyces cerevisiae} Length = 524 Back     alignment and structure
>1urq_A M-tomosyn isoform; transport protein, tomosyn-snare complex, exocytosis, four helical bundle, coiled coil; 2.0A {Rattus norvegicus} SCOP: h.1.15.1 Length = 63 Back     alignment and structure
>1yfq_A Cell cycle arrest protein BUB3; WD repeat WD40 repeat beta transducin repeat all beta, signaling protein; 1.10A {Saccharomyces cerevisiae} SCOP: b.69.4.2 PDB: 1u4c_A 2i3s_A 2i3t_A Length = 342 Back     alignment and structure
>3lrv_A PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiquitin ligase, spliceosome, DNA damage, D repair, mRNA processing, nucleus; 2.60A {Saccharomyces cerevisiae} Length = 343 Back     alignment and structure
>3lrv_A PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiquitin ligase, spliceosome, DNA damage, D repair, mRNA processing, nucleus; 2.60A {Saccharomyces cerevisiae} Length = 343 Back     alignment and structure
>3i2n_A WD repeat-containing protein 92; WD40 repeats, structural genomics, structural genomic consortium, SGC, apoptosis, transcription; 1.95A {Homo sapiens} Length = 357 Back     alignment and structure
>2oit_A Nucleoporin 214KDA; NH2 terminal domain of NUP214/CAN, X-RAY crystallography, beta-propeller, structure, mRNA export, NPC assembly, leukemia; HET: MES; 1.65A {Homo sapiens} PDB: 3fmo_A* 3fmp_A* 3fhc_A Length = 434 Back     alignment and structure
>3gre_A Serine/threonine-protein kinase VPS15; seven-bladed propeller, WD repeat, scaffold protein, ATP- binding, endosome, golgi apparatus; 1.80A {Saccharomyces cerevisiae} Length = 437 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

No hit with probability above 80.00

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 1042
d2ovrb2342 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing 1e-04
d1vyhc1317 b.69.4.1 (C:92-408) Platelet-activating factor ace 2e-04
d1vyhc1317 b.69.4.1 (C:92-408) Platelet-activating factor ace 0.002
d1nr0a2299 b.69.4.1 (A:313-611) Actin interacting protein 1 { 2e-04
d1gxra_337 b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Hum 0.001
d1gxra_337 b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Hum 0.001
d1erja_388 b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yea 0.002
d1erja_388 b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yea 0.003
>d2ovrb2 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Length = 342 Back     information, alignment and structure

class: All beta proteins
fold: 7-bladed beta-propeller
superfamily: WD40 repeat-like
family: WD40-repeat
domain: F-box/WD repeat-containing protein 7, FBXW7
species: Human (Homo sapiens) [TaxId: 9606]

 Score = 42.9 bits (99), Expect = 1e-04
 Identities = 30/212 (14%), Positives = 71/212 (33%), Gaps = 26/212 (12%)

Query: 50  QKILAAATKDGRIKLYGRHNNTQALLESSEAVSTKFLQFLENQGILLNVTSTNLIEVWDI 109
            + + +   D  +K++     T   L + +  + +      +   +++ +    I VWD+
Sbjct: 147 GRRVVSGAYDFMVKVWDPETET--CLHTLQGHTNRVYSLQFDGIHVVSGSLDTSIRVWDV 204

Query: 110 DKKRLSHVHVCKEEITSFTIMQHSNYMLLGDTAGKISVLKLDQESSQIVKMKYIIPLSAS 169
           +     H     + +TS  +    N ++ G+    + +  +                SA 
Sbjct: 205 ETGNCIHTLTGHQSLTS-GMELKDNILVSGNADSTVKIWDIKTGQCLQTLQGPNKHQSAV 263

Query: 170 HGNEVSGDPAVINILPQPTAESKRILIIFRDGLISLWDIRESKSIFSMGGNVLQSVYHET 229
              + + +                ++    DG + LWD++  + I ++    L+S     
Sbjct: 264 TCLQFNKN---------------FVITSSDDGTVKLWDLKTGEFIRNL--VTLESGGS-G 305

Query: 230 KQVTSACWACPIGSKVAVGYSNG----EILIW 257
             V             AVG  NG    ++L+ 
Sbjct: 306 GVVWRIRA-SNTKLVCAVGSRNGTEETKLLVL 336
>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Length = 317 Back     information, alignment and structure
>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Length = 317 Back     information, alignment and structure
>d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 299 Back     information, alignment and structure
>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 337 Back     information, alignment and structure
>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 337 Back     information, alignment and structure
>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 388 Back     information, alignment and structure
>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 388 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query1042
d1erja_388 Tup1, C-terminal domain {Baker's yeast (Saccharomy 100.0
d1gxra_337 Groucho/tle1, C-terminal domain {Human (Homo sapie 100.0
d1erja_388 Tup1, C-terminal domain {Baker's yeast (Saccharomy 100.0
d1gxra_337 Groucho/tle1, C-terminal domain {Human (Homo sapie 100.0
d1vyhc1317 Platelet-activating factor acetylhydrolase IB subu 100.0
d1k8kc_371 Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taur 100.0
d1k8kc_371 Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taur 100.0
d1nr0a1311 Actin interacting protein 1 {Nematode (Caenorhabdi 100.0
d1nexb2355 Cdc4 propeller domain {Baker's yeast (Saccharomyce 100.0
d1vyhc1317 Platelet-activating factor acetylhydrolase IB subu 100.0
d1tbga_340 beta1-subunit of the signal-transducing G protein 100.0
d1tbga_340 beta1-subunit of the signal-transducing G protein 100.0
d1nr0a1311 Actin interacting protein 1 {Nematode (Caenorhabdi 100.0
d1nexb2355 Cdc4 propeller domain {Baker's yeast (Saccharomyce 100.0
d1nr0a2299 Actin interacting protein 1 {Nematode (Caenorhabdi 100.0
d1nr0a2299 Actin interacting protein 1 {Nematode (Caenorhabdi 100.0
d2ovrb2342 F-box/WD repeat-containing protein 7, FBXW7 {Human 100.0
d2ovrb2342 F-box/WD repeat-containing protein 7, FBXW7 {Human 100.0
d1pgua1325 Actin interacting protein 1 {Baker's yeast (Saccha 100.0
d1pgua1325 Actin interacting protein 1 {Baker's yeast (Saccha 100.0
d1sq9a_393 Antiviral protein Ski8 (Ski8p) {Baker's yeast (Sac 100.0
d1yfqa_342 Cell cycle arrest protein BUB3 {Baker's yeast (Sac 99.98
d1sq9a_393 Antiviral protein Ski8 (Ski8p) {Baker's yeast (Sac 99.98
d1k32a3360 Tricorn protease domain 2 {Archaeon Thermoplasma a 99.98
d1yfqa_342 Cell cycle arrest protein BUB3 {Baker's yeast (Sac 99.97
d1p22a2293 F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Hom 99.97
d1p22a2293 F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Hom 99.97
d1pgua2287 Actin interacting protein 1 {Baker's yeast (Saccha 99.97
d1pgua2287 Actin interacting protein 1 {Baker's yeast (Saccha 99.97
d1k32a3360 Tricorn protease domain 2 {Archaeon Thermoplasma a 99.96
d1qksa2432 C-terminal (heme d1) domain of cytochrome cd1-nitr 99.96
d1hzua2426 C-terminal (heme d1) domain of cytochrome cd1-nitr 99.96
d1hzua2426 C-terminal (heme d1) domain of cytochrome cd1-nitr 99.94
d1qksa2432 C-terminal (heme d1) domain of cytochrome cd1-nitr 99.93
d1l0qa2301 Surface layer protein {Archaeon Methanosarcina maz 99.91
d1jmxb_346 Quinohemoprotein amine dehydrogenase B chain {Pseu 99.89
d1pbyb_337 Quinohemoprotein amine dehydrogenase B chain {Para 99.89
d1pbyb_337 Quinohemoprotein amine dehydrogenase B chain {Para 99.87
d1jmxb_346 Quinohemoprotein amine dehydrogenase B chain {Pseu 99.87
d1l0qa2301 Surface layer protein {Archaeon Methanosarcina maz 99.86
d1ri6a_333 Putative isomerase YbhE {Escherichia coli [TaxId: 99.86
d2madh_373 Methylamine dehydrogenase, H-chain {Gram negative 99.83
d2madh_373 Methylamine dehydrogenase, H-chain {Gram negative 99.83
d2bbkh_355 Methylamine dehydrogenase, H-chain {Paracoccus den 99.81
d1ri6a_333 Putative isomerase YbhE {Escherichia coli [TaxId: 99.81
d2bbkh_355 Methylamine dehydrogenase, H-chain {Paracoccus den 99.73
d2bgra1470 Dipeptidyl peptidase IV/CD26, N-terminal domain {P 99.71
d2bgra1470 Dipeptidyl peptidase IV/CD26, N-terminal domain {P 99.5
d1mdah_368 Methylamine dehydrogenase, H-chain {Paracoccus den 99.49
d1mdah_368 Methylamine dehydrogenase, H-chain {Paracoccus den 99.45
d1qnia2441 Nitrous oxide reductase, N-terminal domain {Pseudo 99.31
d1jofa_365 3-carboxy-cis,cis-mucoante lactonizing enzyme {Neu 99.24
d2p4oa1302 Hypothetical protein All0351 homologue {Nostoc pun 99.14
d2p4oa1302 Hypothetical protein All0351 homologue {Nostoc pun 98.95
d1qnia2441 Nitrous oxide reductase, N-terminal domain {Pseudo 98.83
d1rwia_260 Serine/threonine-protein kinase PknD {Mycobacteriu 98.7
d1jofa_365 3-carboxy-cis,cis-mucoante lactonizing enzyme {Neu 98.69
d1rwia_260 Serine/threonine-protein kinase PknD {Mycobacteriu 98.65
d2dg1a1319 Lactonase Drp35 {Staphylococcus aureus [TaxId: 128 98.51
d1pjxa_314 Diisopropylfluorophosphatase (phosphotriesterase, 98.47
d1xfda1465 Dipeptidyl aminopeptidase-like protein 6, DPP6, N- 98.34
d2hqsa1269 TolB, C-terminal domain {Escherichia coli [TaxId: 98.21
d1pjxa_314 Diisopropylfluorophosphatase (phosphotriesterase, 98.12
d2hqsa1269 TolB, C-terminal domain {Escherichia coli [TaxId: 98.12
d1q7fa_279 Brain tumor cg10719-pa {Fruit fly (Drosophila mela 98.11
d1xfda1465 Dipeptidyl aminopeptidase-like protein 6, DPP6, N- 98.09
d2dg1a1319 Lactonase Drp35 {Staphylococcus aureus [TaxId: 128 98.09
d1q7fa_279 Brain tumor cg10719-pa {Fruit fly (Drosophila mela 97.76
d2ghsa1295 Regucalcin {Agrobacterium tumefaciens [TaxId: 358] 97.72
d1k32a2281 Tricorn protease N-terminal domain {Archaeon Therm 96.43
d2ghsa1295 Regucalcin {Agrobacterium tumefaciens [TaxId: 358] 96.19
d1k3ia3387 Galactose oxidase, central domain {Fungi (Fusarium 95.47
d1utca2327 Clathrin heavy-chain terminal domain {Rat (Rattus 93.9
d1k32a2281 Tricorn protease N-terminal domain {Archaeon Therm 91.6
d1k3ia3387 Galactose oxidase, central domain {Fungi (Fusarium 90.34
d1npea_263 Nidogen {Mouse (Mus musculus) [TaxId: 10090]} 89.92
d1fwxa2459 Nitrous oxide reductase, N-terminal domain {Paraco 88.75
d1flga_582 Ethanol dehydrogenase {Pseudomonas aeruginosa [Tax 84.07
>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
class: All beta proteins
fold: 7-bladed beta-propeller
superfamily: WD40 repeat-like
family: WD40-repeat
domain: Tup1, C-terminal domain
species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]

Probab=100.00  E-value=3.6e-38  Score=258.97  Aligned_cols=345  Identities=15%  Similarity=0.227  Sum_probs=232.2

Q ss_pred             EEEECCCCEEEEECCCCC-----EEEEEECCCCEEEEEEECCCCEEEEEECCCCEEEEECCCCCCCEEEEEEEC-----C
Q ss_conf             999489979999738996-----556641499748999917998999990798399998068742024422202-----4
Q 001628           96 LNVTSTNLIEVWDIDKKR-----LSHVHVCKEEITSFTIMQHSNYMLLGDTAGKISVLKLDQESSQIVKMKYII-----P  165 (1042)
Q Consensus        96 vs~s~dg~I~vWd~~~~~-----~~~~~~h~~~It~i~~sp~~~~L~sg~~dG~I~vwd~~~~~~~~~~~~~~i-----p  165 (1042)
                      +....++...+|+.....     +.....|.+.|+|++|+|++++|++|+ ||.|++|++.++.. ........     +
T Consensus        32 ~~~~~~~~~~~~~~~~~~~~~~~l~~~~~H~~~V~~l~fs~dg~~lasg~-d~~i~iW~~~~~~~-~~~~~~~~~~~~~~  109 (388)
T d1erja_          32 LKKQTNDYYILYNPALPREIDVELHKSLDHTSVVCCVKFSNDGEYLATGC-NKTTQVYRVSDGSL-VARLSDDSAANKDP  109 (388)
T ss_dssp             SEEECSSCEEEECTTSCCCEEEEEEEEEECSSCCCEEEECTTSSEEEEEC-BSCEEEEETTTCCE-EEEECC--------
T ss_pred             CCCCCCCCEEEECCCCCCCEEEEEEEECCCCCCEEEEEECCCCCEEEEEE-CCEEEEEEECCCCE-EEEECCCCCCCCCC
T ss_conf             24688970898688777620541076079999689999999999999994-99489998136405-76631665443244


Q ss_pred             CCCCCCCCCCCCCCEEEEEECCCCCCCEEEEEECCCEEEEEECCCCEEEEEECCCCCCCCCCCCCCEEEEEEECCCCCEE
Q ss_conf             64445865469987799997457999959999879929999656982689827762101223587555899995699889
Q 001628          166 LSASHGNEVSGDPAVINILPQPTAESKRILIIFRDGLISLWDIRESKSIFSMGGNVLQSVYHETKQVTSACWACPIGSKV  245 (1042)
Q Consensus       166 ~~~~~~~~~~~~~~V~~i~~~p~~d~~~lls~~~dg~I~iWd~~~~~~~~~~~g~~~~~~~~~~~~I~~i~~~~~~g~~l  245 (1042)
                      ..........+...|.+++|+|  ++++|++++.||.|++|+...++.+...        .+|...|.++.|+ +++..+
T Consensus       110 ~~~~~~~~~~~~~~V~~l~~s~--~~~~l~s~~~dg~v~i~~~~~~~~~~~~--------~~h~~~v~~~~~~-~~~~~~  178 (388)
T d1erja_         110 ENLNTSSSPSSDLYIRSVCFSP--DGKFLATGAEDRLIRIWDIENRKIVMIL--------QGHEQDIYSLDYF-PSGDKL  178 (388)
T ss_dssp             ---------CCCCBEEEEEECT--TSSEEEEEETTSCEEEEETTTTEEEEEE--------CCCSSCEEEEEEC-TTSSEE
T ss_pred             CCCCCCCCCCCCCCEEEEEECC--CCCCCEECCCCCCCCCCCCCCCCCCCCC--------CCCCCCCCCCCCC-CCCCCC
T ss_conf             3211101467789889999889--9980121344411112111111111111--------1111111110111-111111


Q ss_pred             EEEECCCEEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCEEEEEEEECCCCEEEEEECCCCCCCCCCEEEEEE
Q ss_conf             99960782999967886543433578634532123678777776504899988079770799936434677750899960
Q 001628          246 AVGYSNGEILIWGVPSILNLKTEECGTQITPICKLNLGYKLDKIPISSLKWVYADGKASRLYIMGASDFVSMNLLQIVLL  325 (1042)
Q Consensus       246 vsg~~dG~I~iWd~~~~~~~~~~~~~~~~~p~~~l~~~~~~~~~pi~~l~~~~~~~~~~~i~~~gg~~~~~~~~~~v~~~  325 (1042)
                      ++++.+|.+++|+.......                             ...                            
T Consensus       179 ~~~~~~~~i~~~d~~~~~~~-----------------------------~~~----------------------------  201 (388)
T d1erja_         179 VSGSGDRTVRIWDLRTGQCS-----------------------------LTL----------------------------  201 (388)
T ss_dssp             EEEETTSEEEEEETTTTEEE-----------------------------EEE----------------------------
T ss_pred             CCCCCCEEEEEEECCCCCCC-----------------------------CCC----------------------------
T ss_conf             12221015654101111110-----------------------------000----------------------------


Q ss_pred             CCCCCCEEEEEEECCCCCEEEEEECCCCCCCCCCCCCEEEEEECCCCEEEEECCCCEEEECCCCCCCCCCCCCCCEECCC
Q ss_conf             45566314887428999734599824899999999518999821881698304210022114899999999831110167
Q 001628          326 NEQTESRTTKLALPLSEPCIDMEIISSSSDPNKPKQDSFLLLGKSGHFYAFDDCQIERYLLQYQSRSPPSAPKEVMLKMP  405 (1042)
Q Consensus       326 ~~~~~~~~~~~~~~~~~~~~~~~~~~~s~~~~~~~~~~l~vl~~~G~i~~~d~~~~e~~~~~~~~~~~~~l~~~~~~~~p  405 (1042)
                                                                         .                            
T Consensus       202 ---------------------------------------------------~----------------------------  202 (388)
T d1erja_         202 ---------------------------------------------------S----------------------------  202 (388)
T ss_dssp             ---------------------------------------------------E----------------------------
T ss_pred             ---------------------------------------------------C----------------------------
T ss_conf             ---------------------------------------------------1----------------------------


Q ss_pred             CCCCCEEEEEEEECCCCCCCCCHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCEEEEEECCCCEEEEECCCCCEEEEE
Q ss_conf             77863129998405852223323678764511999877776778997667887619999807982999949898325552
Q 001628          406 FLDSSITAMKLITGNSFILSSADEDYSLLAKSVPPLLDFETKLKDGSQSHSKVKNLFITGHSDGAINFWDVSCPLFLLIL  485 (1042)
Q Consensus       406 ~h~~~vt~~~~~~~~~~i~s~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~tg~~Dg~IriWd~~~~~~~~l~  485 (1042)
                      .+. ...++.+                                      ...+++++++|+.||.|++|+...+.....+
T Consensus       203 ~~~-~~~~~~~--------------------------------------~~~~~~~l~~~~~d~~i~i~~~~~~~~~~~~  243 (388)
T d1erja_         203 IED-GVTTVAV--------------------------------------SPGDGKYIAAGSLDRAVRVWDSETGFLVERL  243 (388)
T ss_dssp             CSS-CEEEEEE--------------------------------------CSTTCCEEEEEETTSCEEEEETTTCCEEEEE
T ss_pred             CCC-CCCCCCC--------------------------------------CCCCCCEEEEECCCCEEEEEECCCCCCCEEE
T ss_conf             245-4421123--------------------------------------6887875899738981999634557300010


Q ss_pred             ECCCCCCCCCCCCCCCEEEEEEECCCCEEEEEECCCEEEEEEECCCCCCCCCCEEEECCCCCCCCCEEEEEEEEECCCCE
Q ss_conf             01223334677799785899982799899999063219999962688633454466304555764212248974049875
Q 001628          486 SLKQQSEKDFSLSGIPLTALYYDGTSRVLVSGDQSGMVRIFKLKYEPHAIENSFLSFTGSKKGNSHIIHSVKVMKINGSI  565 (1042)
Q Consensus       486 ~l~~~~~~~~~~~~~~Vt~i~fsp~~~~Lasg~~dG~V~iw~~~~~~~~~~~~~~~~~~~~~g~~~~~~~~~~~~~~~~V  565 (1042)
                      ...   .....+|...|++++|+|++.+|++++.||.|++|++...........         ............|...|
T Consensus       244 ~~~---~~~~~~h~~~v~~l~~s~~~~~l~s~~~d~~i~iwd~~~~~~~~~~~~---------~~~~~~~~~~~~~~~~v  311 (388)
T d1erja_         244 DSE---NESGTGHKDSVYSVVFTRDGQSVVSGSLDRSVKLWNLQNANNKSDSKT---------PNSGTCEVTYIGHKDFV  311 (388)
T ss_dssp             C---------CCCSSCEEEEEECTTSSEEEEEETTSEEEEEEC------------------------CEEEEEECCSSCE
T ss_pred             CCC---CCCCCCCCCCEEEEEECCCCCEEEEEECCCCEEEEECCCCCCCCCCCC---------CCCCCEEEECCCCCCEE
T ss_conf             244---333457789878999979999999997899289875157764321013---------44420011012455327


Q ss_pred             EEEEEECCCCEEEEEECCCCEEEEECCCCEEEEECCCCCCCCCCEEEEEEEEEECCCCCCEEEEEEECCCEEEEEECC
Q ss_conf             899980698499999358809999534883999413233358884999999500378885189998378539999779
Q 001628          566 ISLNMNRNSQHLAVGSDQGYVYLLDTEGPTVLYQKHIASDISSGIVSLQFETCSLQGFEKNFLVIATKDSSVLVLDSD  643 (1042)
Q Consensus       566 ~~l~~spdg~~La~gs~dg~V~iwD~~~~~~~~~~~~~~~~~~~V~sl~fs~~~~~~~~~~~L~sgs~Dg~V~vwd~~  643 (1042)
                      ++++|+|++.+|++|+.||.|++||++++..+..   ..+|...|+++++++...-.+++.+|++|+.||+|++|+++
T Consensus       312 ~~~~~s~~~~~l~sg~~dg~i~vwd~~~~~~~~~---l~~H~~~V~~~~~~~~~~~spd~~~l~s~s~Dg~I~iW~~~  386 (388)
T d1erja_         312 LSVATTQNDEYILSGSKDRGVLFWDKKSGNPLLM---LQGHRNSVISVAVANGSSLGPEYNVFATGSGDCKARIWKYK  386 (388)
T ss_dssp             EEEEECGGGCEEEEEETTSEEEEEETTTCCEEEE---EECCSSCEEEEEECSSCTTCTTCEEEEEEETTSEEEEEEEE
T ss_pred             EEEEECCCCCEEEEEECCCEEEEEECCCCCEEEE---EECCCCCEEEEEEECCCCCCCCCCEEEEEECCCEEEEEEEE
T ss_conf             8999889999999996989799999999969999---96889978999984674258999999999189979997621
>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d2ovrb2 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ovrb2 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pgua1 b.69.4.1 (A:2-326) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1pgua1 b.69.4.1 (A:2-326) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1sq9a_ b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1yfqa_ b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1sq9a_ b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1k32a3 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1yfqa_ b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1p22a2 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p22a2 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pgua2 b.69.4.1 (A:327-613) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1pgua2 b.69.4.1 (A:327-613) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1k32a3 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1qksa2 b.70.2.1 (A:136-567) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1hzua2 b.70.2.1 (A:118-543) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1hzua2 b.70.2.1 (A:118-543) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1qksa2 b.70.2.1 (A:136-567) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1l0qa2 b.69.2.3 (A:1-301) Surface layer protein {Archaeon Methanosarcina mazei [TaxId: 2209]} Back     information, alignment and structure
>d1jmxb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1pbyb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1pbyb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1jmxb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1l0qa2 b.69.2.3 (A:1-301) Surface layer protein {Archaeon Methanosarcina mazei [TaxId: 2209]} Back     information, alignment and structure
>d1ri6a_ b.69.11.1 (A:) Putative isomerase YbhE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2madh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Gram negative methylotrophic bacteria (Thiobacillus versutus) [TaxId: 34007]} Back     information, alignment and structure
>d2madh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Gram negative methylotrophic bacteria (Thiobacillus versutus) [TaxId: 34007]} Back     information, alignment and structure
>d2bbkh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1ri6a_ b.69.11.1 (A:) Putative isomerase YbhE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2bbkh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d2bgra1 b.70.3.1 (A:39-508) Dipeptidyl peptidase IV/CD26, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d2bgra1 b.70.3.1 (A:39-508) Dipeptidyl peptidase IV/CD26, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1mdah_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1mdah_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1qnia2 b.69.3.1 (A:10-450) Nitrous oxide reductase, N-terminal domain {Pseudomonas nautica [TaxId: 2743]} Back     information, alignment and structure
>d1jofa_ b.69.10.1 (A:) 3-carboxy-cis,cis-mucoante lactonizing enzyme {Neurospora crassa [TaxId: 5141]} Back     information, alignment and structure
>d2p4oa1 b.68.6.3 (A:4-305) Hypothetical protein All0351 homologue {Nostoc punctiforme [TaxId: 272131]} Back     information, alignment and structure
>d2p4oa1 b.68.6.3 (A:4-305) Hypothetical protein All0351 homologue {Nostoc punctiforme [TaxId: 272131]} Back     information, alignment and structure
>d1qnia2 b.69.3.1 (A:10-450) Nitrous oxide reductase, N-terminal domain {Pseudomonas nautica [TaxId: 2743]} Back     information, alignment and structure
>d1rwia_ b.68.9.1 (A:) Serine/threonine-protein kinase PknD {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1jofa_ b.69.10.1 (A:) 3-carboxy-cis,cis-mucoante lactonizing enzyme {Neurospora crassa [TaxId: 5141]} Back     information, alignment and structure
>d1rwia_ b.68.9.1 (A:) Serine/threonine-protein kinase PknD {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2dg1a1 b.68.6.1 (A:6-324) Lactonase Drp35 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1pjxa_ b.68.6.1 (A:) Diisopropylfluorophosphatase (phosphotriesterase, DFP) {Squid (Loligo vulgaris) [TaxId: 6622]} Back     information, alignment and structure
>d1xfda1 b.70.3.1 (A:127-591) Dipeptidyl aminopeptidase-like protein 6, DPP6, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2hqsa1 b.68.4.1 (A:163-431) TolB, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1pjxa_ b.68.6.1 (A:) Diisopropylfluorophosphatase (phosphotriesterase, DFP) {Squid (Loligo vulgaris) [TaxId: 6622]} Back     information, alignment and structure
>d2hqsa1 b.68.4.1 (A:163-431) TolB, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1q7fa_ b.68.9.1 (A:) Brain tumor cg10719-pa {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1xfda1 b.70.3.1 (A:127-591) Dipeptidyl aminopeptidase-like protein 6, DPP6, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dg1a1 b.68.6.1 (A:6-324) Lactonase Drp35 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1q7fa_ b.68.9.1 (A:) Brain tumor cg10719-pa {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2ghsa1 b.68.6.1 (A:20-314) Regucalcin {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1k32a2 b.68.7.1 (A:39-319) Tricorn protease N-terminal domain {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d2ghsa1 b.68.6.1 (A:20-314) Regucalcin {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1k3ia3 b.69.1.1 (A:151-537) Galactose oxidase, central domain {Fungi (Fusarium sp.) [TaxId: 29916]} Back     information, alignment and structure
>d1utca2 b.69.6.1 (A:4-330) Clathrin heavy-chain terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1k32a2 b.68.7.1 (A:39-319) Tricorn protease N-terminal domain {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1k3ia3 b.69.1.1 (A:151-537) Galactose oxidase, central domain {Fungi (Fusarium sp.) [TaxId: 29916]} Back     information, alignment and structure
>d1npea_ b.68.5.1 (A:) Nidogen {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1fwxa2 b.69.3.1 (A:8-451) Nitrous oxide reductase, N-terminal domain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1flga_ b.70.1.1 (A:) Ethanol dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure