Citrus Sinensis ID: 001842


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820-------830-------840-------850-------860-------870-------880-------890-------900-------910-------920-------930-------940-------950-------960-------970-------980-------990------1000------101
MRSILLLSWLFFMPFLANYFGILVTLVSGQCQSDQQSLLLQMKNSFILSKDSITSTKLSQWSSHHSSDCCDWNGVDCDEAGHVIGLDLSREPIIGGLENATGLFSLQYLRSLNLGFTLFSGIQIPSRLANLTNLTYLNLSQSGFIQDIPIEISSLTRLVTLDLSAEPSGGFSFLEISNLSLFLQNLTELRELHLDNVDLFASGTDWCKALSFLPNLQVLSLSRCELSGPINQYLANLRSLSAIRLPNNYGLSSPVPEFLANFSHLTALDLGDCQLQGKFPEKILQVPTLETLDLSDNPSLQGSLPHFPKNSSLRNLILFGTGFSGTLPNSIGNLENLANVDISSCNFTGPIPTSMANLTRLFHLDFSSNHFSGPIPSLGLSRNLSYLDLSSNDLTGRILFTPWEQLLNIKYVHLNYNSLSGSIPRSLFLLPTLEMLLLSTNQFENQLPEFSNESSSVMNFLDLSGNRLEGPIPISIFFELRNLLTLDLSSNKFSRLKLASSKPRGTPNLNKQSKLSSLDLSDNQISGEIPNWIWEFSANLVFLNLSHNLLESLQEPYFIAGVGLLDLHSNELQGSIPYMSPNTSYMDYSNNNFTTIPADIGNFMSGTIFFSAANNSLTGVIPQSVCNATYFSVLDLSNNSLSGTIPTCLITNSSRTLGVLNLRGNSLNGTLSDRVPGICGLQILDLNGNQLEGMVPKSLANCKMLQVLDLGNNNFSKKFPCWLKNASSLQVLVLRSNNFSGNISCPRNNVSWPLLQIIDLASNKFSGRLSKKWLLTLEKMMNAETKSGSELKHLQYGFMGGYQFYQVTVTVTVKSVEILVRKVSNIFTSIDFSSNNFEGPIPEEMGRFKSLYALNLSQNVLTGSIPSSFGNLEQIESLDLSMNNLSGKIPAPLANLNFLSVLNLSYNNLVGKIPTSTQLQSFSPTSYEGNKGLYGPPLTNDSQTHSPELQASPPSASSDEIDSFFVVMSIGFAVGFGAAVSPLMFSVKVNKWYNDLIYKFIYRRFAV
ccHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHccccccccccccccccccccccccccccccEEEcccccEEEEEcccccccccccccccccccccccEEcccccccccccccccccccccccEEEcccccccccccccccccccccEEEccccccccccccccccHHHHHHccccccEEEcccccccccccccHHHHcccccccEEEcccccccccccccccccccccEEEccccccccccccHHccccccccEEEcccccccccccccccccccccEEEcccccccccccccccccccccEEEcccccccccccccccccccccEEEcccccccccccccccccccccEEEccccccccccccccccccccEEEccccccccccccccccccccccEEEcccccccccccccccccccccEEEcccccccEEcccccccccccccEEEccccEEEEEcccccccccccccEEEcccccccccccccccccccccccccccccEEEcccccccccccHHHHHccccccEEEcccccccccccccccccccEEEccccccccccccccccccEEEcccccccccccccccccccccEEEcccccccccccccccccccccEEEcccccccccccHHHHHcccccccEEEccccccEEEccccccccccccEEEccccccEEcccHHHHccccccEEEcccccccccccHHHHccccccEEEccccccEEEccccccccccccccEEEcccccccccccHHHHHHHHHHHHccccccccccEEEccccccEEEEEEEEEEEEccEEEEHHHHccccEEEEcccccccccccHHHHccccccccccccccccccccccccccccccEEccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEEEEHHHHHHHHHHHHHHHHccccHHHHHHHHcEEEEEEEEc
ccHHHHHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHccccccccccccccccccccccccccEEEEEEccccEEEEEEccccccccccccccHHHcHHHHHHEcccccccccccccHHHcccccccEEEcccccccccccHHHHccccEEEEEccccccccccccccccHHHHHHHHHcccEEEcccccccccccHHHHHHHcccccEEEEcccccccccccccHccccccEEEEEcccccccccccHHHHcccccEEEEEccccccccccHHHccccccEEEEEcccccccccccccccccccEEEEEccccccccccHHHHHHHcccEEEcccccccccccHHHHcccccEEEEccccccccccccccccccccEEEEccccccccccHHHHccccccEEEEcccccccccccHHHccccccEEEEcccccccccccHHHHHHcccccEEEcccccccccccHHHHcccccccEEEEcccccccccccccccccccHHcccccccEEEcccccccccccHHHHHHccHccEEEccccccccccccccccccEEEEcccccccccccccccccEEEEcccccccccccccccccccEEEEEEccccccccccHHHccccccEEEEcccccccccccHHHHHcccccEEEEEcccccccccccccccccccEEEEEcccccccccccHHHHHccccEEEEcccccccccccHHHHcccccEEEEEEcccccccccccccccccccEEEEEEccccccccccHHHHHHHHHHHHHccccccccccccccccccccEEEEEEEEEEcccccHHHHHHcEEEEEEcccccccccccHHHHHHHHHHEEEccccccccccccHHcccccccEEEccccccEEcccHHHHHcccccEEEccccEEEEEccccccHHHccHHHcccccEEEcccccccccccccccccccccccccccHHHEHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHEEEEc
MRSILLLSWLFFMPFLANYFGILVTLVSGQCQSDQQSLLLQMKnsfilskdsitstklsqwsshhssdccdwngvdcdeaghvigldlsrepiigglenatglfSLQYLRSLNLgftlfsgiqipsrlanltnltylnlsqsgfiqdipieisSLTRLVtldlsaepsggfsfLEISNLSLFLQNLTELRELHLDNVDLFASGTDWCKalsflpnlqvlslsrcelsgPINQYLANLRslsairlpnnyglsspvpeflanfshltaldlgdcqlqgkfpekilqvptletldlsdnpslqgslphfpknsslrnLILFgtgfsgtlpnsignlenlanvdisscnftgpiptsmanltrlfhldfssnhfsgpipslglsrnlsyldlssndltgrilftpWEQLLNIKYVHLNYnslsgsiprslfllPTLEMLLLSTNQfenqlpefsnessSVMNFLDlsgnrlegpipiSIFFELRNLltldlssnkfsrlklasskprgtpnlnkqsklssldlsdnqisgeipnWIWEFSANLVFLNLSHNLLeslqepyfiagvglldlhsnelqgsipymspntsymdysnnnfttipadignfmsGTIFFSAannsltgvipqsvcnaTYFSVLDlsnnslsgtiptclitnssrtlgvlnlrgnslngtlsdrvpgicglqildlngnqlegmvpkslancKMLQVldlgnnnfskkfpcwlknASSLQVLVLRSnnfsgniscprnnvswpLLQIIDLASNKFSGRLSKKWLLTLEKMMNAEtksgselkhlqygfmggyqFYQVTVTVTVKSVEILVRKVSNIFtsidfssnnfegpipeeMGRFKSLYALNLsqnvltgsipssfgnleQIESLDLsmnnlsgkipaplanlNFLSVLNLSYNnlvgkiptstqlqsfsptsyegnkglygppltndsqthspelqasppsassdeidSFFVVMSIGFAVGFGAAVSPLMFSVKVNKWYNDLIYKFIYRRFAV
MRSILLLSWLFFMPFLANYFGILVTLVSGQCQSDQQSLLLQMKNSFILSKDSITSTKLSQWSSHHSSDCCDWNGVDCDEAGHVIGLDLSREPIIGGLENATGLFSLQYLRSLNLGFTLFSGIQIPSRLANLTNLTYLNLSQSGFIQDIPIEISSLTRLVTLDLSAEPSGGFSFLEISNLSLFLQNLTELRELHLDNVDLFASGTDWCKALSFLPNLQVLSLSRCELSGPINQYLANLRSLSAIRLPNNYGLSSPVPEFLANFSHLTALDLGDCQLQGKFPEKILQVPTLETLDLSDNPSLQGSLPHFPKNSSLRNLILFGTGFSGTLPNSIGNLENLANVDISSCNFTGPIPTSMANLTRLFHLDFSSNHFSGPIPSLGLSRNLSYLDLSSNDLTGRILFTPWEQLLNIKYVHLNYNSLSGSIPRSLFLLPTLEMLLLSTNQFENQLPEFSNESSSVMNFLDLSGNRLEGPIPISIFFELRNLLTLDLSSNKFSRLKlasskprgtpnlnkqsklsslDLSDNQISGEIPNWIWEFSANLVFLNLSHNLLESLQEPYFIAGVGLLDLHSNELQGSIPYMSPNTSYMDYSNNNFTTIPADIGNFMSGTIFFSAANNSLTGVIPQSVCNATYFSVLDLSNNSLSGTIPTCLITNSSRTLGVLNLRGNSLNGTLSDRVPGICGLQILDLNGNQLEGMVPKSLANCKMLQVLDLGNNNFSKKFPCWLKNASSLQVLVLRSNNFSGNISCPRNNVSWPLLQIIDLASNKFSGRLSKKWLLTLEKMMNAETKSGSELKHLQYGFMGGYQFYQVTVTVTVKSVEILVRKVSniftsidfssnnfEGPIPEEMGRFKSLYALNLSQNVLTGSIPSSFGNLEQIESLDLSMNNLSGKIPAPLANLNFLSVLNLSYNNLVGKIPTSTQLQSFSPTSYEGNKGLYGPPLTNDSQTHSPELQASPPSASSDEIDSFFVVMSIGFAVGFGAAVSPLMFSVKVNKWYNDLIYKFIYRRFAV
MRSILLLSWLFFMPFLANYFGILVTLVsgqcqsdqqslllqMKNSFILSKDSITSTKLSQWSSHHSSDCCDWNGVDCDEAGHVIGLDLSREPIIGGLENATGLFSLQYLRSLNLGFTLFSGIQIPSRlanltnltylnlSQSGFIQDIPIEISSLTRLVTLDLSAEPSGGFSFLEISNLSLFLQNLTELRELHLDNVDLFASGTDWCKALSFLPNLQVLSLSRCELSGPINQYLANLRSLSAIRLPNNYGLSSPVPEFLANFSHLTALDLGDCQLQGKFPEKILQVPTLETLDLSDNPSLQGSLPHFPKNSSLRNLILFGTGFSGTLPNSIGNLENLANVDISSCNFTGPIPTSMANLTRLFHLDFSSNHFSGPIPSLGlsrnlsyldlssndlTGRILFTPWEQLLNIKYVHLNYNSLSGSIPRSlfllptlemlllSTNQFENQLPEFSNESSSVMNFLDLSGNRLEGPIPISIFFELRNLLTLDLSSNKFSRLKLASSKPRGTPNlnkqsklssldlsdnqISGEIPNWIWEFSANLVFLNLSHNLLESLQEPYFIAGVGLLDLHSNELQGSIPYMSPNTSYMDYSNNNFTTIPADIGNFMSGTIFFSAANNSLTGVIPQSVCNATYFSVLDLSNNSLSGTIPTCLITNSSRTLGVLNLRGNSLNGTLSDRVPGICGLQILDLNGNQLEGMVPKSLANCKMLQVLDLGNNNFSKKFPCWLKNASSLQVLVLRSNNFSGNISCPRNNVSWPLLQIIDLASNKFSGRLSKKWLLTLEKMMNAETKSGSELKHLQYGFMGGYQFYQvtvtvtvKSVEILVRKVSNIFTSIDFSSNNFEGPIPEEMGRFKSLYALNLSQNVLTGSIPSSFGNLEQIESLDLSMNNLSGKIPAPLAnlnflsvlnlsynnlvGKIPTSTQLQSFSPTSYEGNKGLYGPPLTNDSQTHSPELQASPPSASSDEIDSFFVVMSIGFAVGFGAAVSPLMFSVKVNKWYNDLIYKFIYRRFAV
***ILLLSWLFFMPFLANYFGILVTLVSGQCQSDQQSLLLQMKNSFILSKDSITSTKLSQWSSHHSSDCCDWNGVDCDEAGHVIGLDLSREPIIGGLENATGLFSLQYLRSLNLGFTLFSGIQIPSRLANLTNLTYLNLSQSGFIQDIPIEISSLTRLVTLDLSAEPSGGFSFLEISNLSLFLQNLTELRELHLDNVDLFASGTDWCKALSFLPNLQVLSLSRCELSGPINQYLANLRSLSAIRLPNNYGLSSPVPEFLANFSHLTALDLGDCQLQGKFPEKILQVPTLETL*******************SLRNLILFGTGFSGTLPNSIGNLENLANVDISSCNFTGPIPTSMANLTRLFHLDFSSNHFSGPIPSLGLSRNLSYLDLSSNDLTGRILFTPWEQLLNIKYVHLNYNSLSGSIPRSLFLLPTLEMLLLSTNQFE************VMNFLDLSGNRLEGPIPISIFFELRNLLTLDLS************************************SGEIPNWIWEFSANLVFLNLSHNLLESLQEPYFIAGVGLLDLHSNELQGSIPYMSPNTSYMDYSNNNFTTIPADIGNFMSGTIFFSAANNSLTGVIPQSVCNATYFSVLDLSNNSLSGTIPTCLITNSSRTLGVLNLRGNSLNGTLSDRVPGICGLQILDLNGNQLEGMVPKSLANCKMLQVLDLGNNNFSKKFPCWLKNASSLQVLVLRSNNFSGNISCPRNNVSWPLLQIIDLASNKFSGRLSKKWLLTLEKMMNA******ELKHLQYGFMGGYQFYQVTVTVTVKSVEILVRKVSNIFTSIDFSSNNFEGPIPEEMGRFKSLYALNLSQNVLTGSIPSSFGNLEQIESLDLSMNNLSGKIPAPLANLNFLSVLNLSYNNLVGKIP**********************************************IDSFFVVMSIGFAVGFGAAVSPLMFSVKVNKWYNDLIYKFIYRRF**
***ILLLSWLFFMPFLANYFGILVTLVSGQCQSDQQSLLLQMKNSFILSKDSITSTKLSQWSSHHSSDCCDWNGVDCDEAGHVIGLDLSREPIIGGLENATGLFSLQYLRSLNLGFTLFSGIQIPSRLANLTNLTYLNLSQSGFIQDIPIEISSLTRLVTLDLSAEPSGGFSFLEISNLSLFLQNLTELRELHLDNVDLFASGTDWCKALSFLPNLQVLSLSRCELSGPINQYLANLRSLSAIRLPNNYGLSSPVPEFLANFSHLTALDLGDCQLQGKFPEKILQVPTLETLDLSDNPSLQGSLPHFPKNSSLRNLILFGTGFSGTLPNSIGNLENLANVDISSCNFTGPIPTSMANLTRLFHLDFSSNHFSGPIPSLGLSRNLSYLDLSSNDLTGRILFTPWEQLLNIKYVHLNYNSLSGSIPRSLFLLPTLEMLLLSTNQFENQLPEFSNESSSVMNFLDLSGNRLEGPIPISIFFELRNLLTLDLSSNKFSRLKLASSKPRGTPNLNKQSKLSSLDLSDNQISGEIPNWIWEFSANLVFLNLSHNLLESLQEPYFIAGVGLLDLHSNELQGSIPYMSPNTSYMDYSNNNFTTIPADIGNFMSGTIFFSAANNSLTGVIPQSVCNATYFSVLDLSNNSLSGTIPTCLITNSSRTLGVLNLRGNSLNGTLSDRVPGICGLQILDLNGNQLEGMVPKSLANCKMLQVLDLGNNNFSKKFPCWLKNASSLQVLVLRSNNFSGNISCPRNNVSWPLLQIIDLASNKFSGRLSKKWLLTLEKMM*********LKHLQYGFMGGYQFYQVTVTVTVKSVEILVRKVSNIFTSIDFSSNNFEGPIPEEMGRFKSLYALNLSQNVLTGSIPSSFGNLEQIESLDLSMNNLSGKIPAPLANLNFLSVLNLSYNNLVGKIPTSTQLQSFSPTSYEGNKGLYGP***************************FFVVMSIGFAVGFGAAVSPLMFSVKVNKWYNDLIYKFIYRRFAV
MRSILLLSWLFFMPFLANYFGILVTLVSGQCQSDQQSLLLQMKNSFILSKDSI***************CCDWNGVDCDEAGHVIGLDLSREPIIGGLENATGLFSLQYLRSLNLGFTLFSGIQIPSRLANLTNLTYLNLSQSGFIQDIPIEISSLTRLVTLDLSAEPSGGFSFLEISNLSLFLQNLTELRELHLDNVDLFASGTDWCKALSFLPNLQVLSLSRCELSGPINQYLANLRSLSAIRLPNNYGLSSPVPEFLANFSHLTALDLGDCQLQGKFPEKILQVPTLETLDLSDNPSLQGSLPHFPKNSSLRNLILFGTGFSGTLPNSIGNLENLANVDISSCNFTGPIPTSMANLTRLFHLDFSSNHFSGPIPSLGLSRNLSYLDLSSNDLTGRILFTPWEQLLNIKYVHLNYNSLSGSIPRSLFLLPTLEMLLLSTNQFENQLPEFSNESSSVMNFLDLSGNRLEGPIPISIFFELRNLLTLDLSSNKFSRLKLASSKPRGTPNLNKQSKLSSLDLSDNQISGEIPNWIWEFSANLVFLNLSHNLLESLQEPYFIAGVGLLDLHSNELQGSIPYMSPNTSYMDYSNNNFTTIPADIGNFMSGTIFFSAANNSLTGVIPQSVCNATYFSVLDLSNNSLSGTIPTCLITNSSRTLGVLNLRGNSLNGTLSDRVPGICGLQILDLNGNQLEGMVPKSLANCKMLQVLDLGNNNFSKKFPCWLKNASSLQVLVLRSNNFSGNISCPRNNVSWPLLQIIDLASNKFSGRLSKKWLLTLEKMMNAETKSGSELKHLQYGFMGGYQFYQVTVTVTVKSVEILVRKVSNIFTSIDFSSNNFEGPIPEEMGRFKSLYALNLSQNVLTGSIPSSFGNLEQIESLDLSMNNLSGKIPAPLANLNFLSVLNLSYNNLVGKIPTSTQLQSFSPTSYEGNKGLYGPPLTND****************SDEIDSFFVVMSIGFAVGFGAAVSPLMFSVKVNKWYNDLIYKFIYRRFAV
*RSILLLSWLFFMPFLANYFGILVTLVSGQCQSDQQSLLLQMKNSFILSKD*ITSTKLSQWSSHHSSDCCDWNGVDCDEAGHVIGLDLSREPIIGGLENATGLFSLQYLRSLNLGFTLFSGIQIPSRLANLTNLTYLNLSQSGFIQDIPIEISSLTRLVTLDLSAEPSGGFSFLEISNLSLFLQNLTELRELHLDNVDLFASGTDWCKALSFLPNLQVLSLSRCELSGPINQYLANLRSLSAIRLPNNYGLSSPVPEFLANFSHLTALDLGDCQLQGKFPEKILQVPTLETLDLSDNPSLQGSLPHFPKNSSLRNLILFGTGFSGTLPNSIGNLENLANVDISSCNFTGPIPTSMANLTRLFHLDFSSNHFSGPIPSLGLSRNLSYLDLSSNDLTGRILFTPWEQLLNIKYVHLNYNSLSGSIPRSLFLLPTLEMLLLSTNQFENQLPEFSNESSSVMNFLDLSGNRLEGPIPISIFFELRNLLTLDLSSNKFSRLKLASSKPRGTPNLNKQSKLSSLDLSDNQISGEIPNWIWEFSANLVFLNLSHNLLESLQEPYFIAGVGLLDLHSNELQGSIPYMSPNTSYMDYSNNNFTTIPADIGNFMSGTIFFSAANNSLTGVIPQSVCNATYFSVLDLSNNSLSGTIPTCLITNSSRTLGVLNLRGNSLNGTLSDRVPGICGLQILDLNGNQLEGMVPKSLANCKMLQVLDLGNNNFSKKFPCWLKNASSLQVLVLRSNNFSGNISCPRNNVSWPLLQIIDLASNKFSGRLSKKWLLTLEKMMNAETKSGSELKHLQYGFMGGYQFYQVTVTVTVKSVEILVRKVSNIFTSIDFSSNNFEGPIPEEMGRFKSLYALNLSQNVLTGSIPSSFGNLEQIESLDLSMNNLSGKIPAPLANLNFLSVLNLSYNNLVGKIPTSTQLQSFSPTSYEGNKGLYGPPLTNDS****************DEIDSFFVVMSIGFAVGFGAAVSPLMFSVKVNKWYNDLIYKFIYRRFAV
iiiiHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiii
iiiiiHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MRSILLLSWLFFMPFLANYFGILVTLVSGQCQSDQQSLLLQMKNSFILSKDSITSTKLSQWSSHHSSDCCDWNGVDCDEAGHVIGLDLSREPIIGGLENATGLFSLQYLRSLNLGFTLFSGIQIPSRLANLTNLTYLNLSQSGFIQDIPIEISSLTRLVTLDLSAEPSGGFSFLEISNLSLFLQNLTELRELHLDNVDLFASGTDWCKALSFLPNLQVLSLSRCELSGPINQYLANLRSLSAIRLPNNYGLSSPVPEFLANFSHLTALDLGDCQLQGKFPEKILQVPTLETLDLSDNPSLQGSLPHFPKNSSLRNLILFGTGFSGTLPNSIGNLENLANVDISSCNFTGPIPTSMANLTRLFHLDFSSNHFSGPIPSLGLSRNLSYLDLSSNDLTGRILFTPWEQLLNIKYVHLNYNSLSGSIPRSLFLLPTLEMLLLSTNQFENQLPEFSNESSSVMNFLDLSGNRLEGPIPISIFFELRNLLTLDLSSNKFSRLKLASSKPRGTPNLNKQSKLSSLDLSDNQISGEIPNWIWEFSANLVFLNLSHNLLESLQEPYFIAGVGLLDLHSNELQGSIPYMSPNTSYMDYSNNNFTTIPADIGNFMSGTIFFSAANNSLTGVIPQSVCNATYFSVLDLSNNSLSGTIPTCLITNSSRTLGVLNLRGNSLNGTLSDRVPGICGLQILDLNGNQLEGMVPKSLANCKMLQVLDLGNNNFSKKFPCWLKNASSLQVLVLRSNNFSGNISCPRNNVSWPLLQIIDLASNKFSGRLSKKWLLTLEKMMNAETKSGSELKHLQYGFMGGYQFYQVTVTVTVKSVEILVRKVSNIFTSIDFSSNNFEGPIPEEMGRFKSLYALNLSQNVLTGSIPSSFGNLEQIESLDLSMNNLSGKIPAPLANLNFLSVLNLSYNNLVGKIPTSTQLQSFSPTSYEGNKGLYGPPLTNDSQTHSPELQASPPSASSDEIDSFFVVMSIGFAVGFGAAVSPLMFSVKVNKWYNDLIYKFIYRRFAV
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query1007 2.2.26 [Sep-21-2011]
Q9C9H7847 Receptor-like protein 12 no no 0.717 0.853 0.334 2e-85
C0LGQ5 1249 LRR receptor-like serine/ no no 0.824 0.664 0.307 2e-78
Q9FL28 1173 LRR receptor-like serine/ no no 0.673 0.578 0.328 2e-67
Q9LYN8 1192 Leucine-rich repeat recep no no 0.694 0.586 0.314 5e-66
Q9FIZ3 1252 LRR receptor-like serine/ no no 0.691 0.555 0.320 1e-62
Q9LVP0 1102 Probable leucine-rich rep no no 0.676 0.617 0.308 2e-58
O49318 1124 Probable leucine-rich rep no no 0.624 0.559 0.308 3e-56
Q9SHI2 1101 Leucine-rich repeat recep no no 0.632 0.578 0.303 8e-56
C0LGS2 1136 Probable LRR receptor-lik no no 0.678 0.601 0.286 4e-54
P93194 1109 Receptor-like protein kin N/A no 0.614 0.558 0.296 4e-49
>sp|Q9C9H7|RLP12_ARATH Receptor-like protein 12 OS=Arabidopsis thaliana GN=RLP12 PE=2 SV=2 Back     alignment and function desciption
 Score =  318 bits (814), Expect = 2e-85,   Method: Compositional matrix adjust.
 Identities = 252/753 (33%), Positives = 375/753 (49%), Gaps = 30/753 (3%)

Query: 259  LANFSHLTALDLGDCQLQGKFPEKILQVPTLETLDLSDNPSLQGSLPHFPKN-SSLRNLI 317
            L    +L  LDL +C L G+ P  +  +  L  ++L  N    G +P    N + LR+LI
Sbjct: 106  LFKLQYLRHLDLTNCNLYGEIPSSLGNLSHLTLVNLYFN-KFVGEIPASIGNLNQLRHLI 164

Query: 318  LFGTGFSGTLPNSIGNLENLANVDISSCNFTGPIPTSMANLTRLFHLDFSSNHFSGPIPS 377
            L     +G +P+S+GNL  L N+++ S    G IP S+ +L +L +L  +SN+  G IPS
Sbjct: 165  LANNVLTGEIPSSLGNLSRLVNLELFSNRLVGKIPDSIGDLKQLRNLSLASNNLIGEIPS 224

Query: 378  -LGLSRNLSYLDLSSNDLTGRILFTPWEQLLNIKYVHLNYNSLSGSIPRSLFLLPTLEML 436
             LG   NL +L L+ N L G +       L+ ++ +    NSLSG+IP S   L  L + 
Sbjct: 225  SLGNLSNLVHLVLTHNQLVGEVP-ASIGNLIELRVMSFENNSLSGNIPISFANLTKLSIF 283

Query: 437  LLSTNQFENQLPEFSNESSSVMNFLDLSGNRLEGPIPISIFFELRNLLTLDLSSNKFSRL 496
            +LS+N F +  P F       + + D+S N   GP P S+   + +L ++ L  N+F+  
Sbjct: 284  VLSSNNFTSTFP-FDMSIFHNLEYFDVSYNSFSGPFPKSLLL-IPSLESIYLQENQFT-- 339

Query: 497  KLASSKPRGTPNLNKQSKLSSLDLSDNQISGEIPNWIWEFSANLVFLNLSHNLLESLQEP 556
                  P    N +  +KL  L L  N++ G IP  I     NL  L++SHN       P
Sbjct: 340  -----GPIEFANTSSSTKLQDLILGRNRLHGPIPESISRL-LNLEELDISHNNFTGAIPP 393

Query: 557  YFIAGVGLL--DLHSNELQGSIPYMSPNTSYMDYSNNNFTTIPADIGNFMSGTIFFSAAN 614
                 V LL  DL  N L+G +P      + M  S+N+F++   +     +        +
Sbjct: 394  TISKLVNLLHLDLSKNNLEGEVPACLWRLNTMVLSHNSFSSF-ENTSQEEALIEELDLNS 452

Query: 615  NSLTGVIPQSVCNATYFSVLDLSNNSLSGTIPTCLITNSSRTLGVLNLRGNSLNGTLSDR 674
            NS  G IP  +C  +    LDLSNN  SG+IP+C I N S ++  LNL  N+ +GTL D 
Sbjct: 453  NSFQGPIPYMICKLSSLGFLDLSNNLFSGSIPSC-IRNFSGSIKELNLGDNNFSGTLPDI 511

Query: 675  VPGICGLQILDLNGNQLEGMVPKSLANCKMLQVLDLGNNNFSKKFPCWLKNASSLQVLVL 734
                  L  LD++ NQLEG  PKSL NCK L+++++ +N     FP WL++  SL VL L
Sbjct: 512  FSKATELVSLDVSHNQLEGKFPKSLINCKALELVNVESNKIKDIFPSWLESLPSLHVLNL 571

Query: 735  RSNNFSGNISCPRNNVSWPLLQIIDLASNKFSGRLSKKWLLTLEKMMNAETKSGSELKHL 794
            RSN F G +     ++ +  L+IID++ N FSG L   +    + M    T    E+   
Sbjct: 572  RSNKFYGPLYHRHASIGFQSLRIIDISHNNFSGTLPPYYFSNWKDM----TTLTEEMDQY 627

Query: 795  QYGFMGGYQFYQVTVTVTVKSVEILVRKVSNIFTSIDFSSNNFEGPIPEEMGRFKSLYAL 854
               F      Y   + +  K V++   ++   F +IDFS N   G IPE +G  K L  L
Sbjct: 628  MTEFWRYADSYYHEMEMVNKGVDMSFERIRRDFRAIDFSGNKINGNIPESLGYLKELRVL 687

Query: 855  NLSQNVLTGSIPSSFGNLEQIESLDLSMNNLSGKIPAPLANLNFLSVLNLSYNNLVGKIP 914
            NLS N  T  IP    NL ++E+LD+S N LSG+IP  LA L+FLS +N S+N L G +P
Sbjct: 688  NLSGNAFTSVIPRFLANLTKLETLDISRNKLSGQIPQDLAALSFLSYMNFSHNLLQGPVP 747

Query: 915  TSTQLQSFSPTSYEGNKGLYG-PPLTNDSQTHSPELQASPPSASSDEIDSFFVVMSIGFA 973
              TQ Q    +S+  N GLYG   +  D+   +P  Q  P   S  E + F  V +   A
Sbjct: 748  RGTQFQRQKCSSFLDNPGLYGLEDICRDTGALNPTSQL-PEDLSEAEENMFNWVAA---A 803

Query: 974  VGFGAAVSPLMFSVKVNKWYNDLIYKFIYRRFA 1006
            + +G  V   +  + +  +Y    +++   +F 
Sbjct: 804  IAYGPGV---LCGLVIGHFYTSHNHEWFTEKFG 833




Involved in the perception of CLV3 and CLV3-like peptides, that act as extracellular signals regulating meristems maintenance.
Arabidopsis thaliana (taxid: 3702)
>sp|C0LGQ5|GSO1_ARATH LRR receptor-like serine/threonine-protein kinase GSO1 OS=Arabidopsis thaliana GN=GSO1 PE=2 SV=1 Back     alignment and function description
>sp|Q9FL28|FLS2_ARATH LRR receptor-like serine/threonine-protein kinase FLS2 OS=Arabidopsis thaliana GN=FLS2 PE=1 SV=1 Back     alignment and function description
>sp|Q9LYN8|EXS_ARATH Leucine-rich repeat receptor protein kinase EXS OS=Arabidopsis thaliana GN=EXS PE=1 SV=1 Back     alignment and function description
>sp|Q9FIZ3|GSO2_ARATH LRR receptor-like serine/threonine-protein kinase GSO2 OS=Arabidopsis thaliana GN=GSO2 PE=2 SV=2 Back     alignment and function description
>sp|Q9LVP0|Y5639_ARATH Probable leucine-rich repeat receptor-like protein kinase At5g63930 OS=Arabidopsis thaliana GN=At5g63930 PE=1 SV=1 Back     alignment and function description
>sp|O49318|Y2317_ARATH Probable leucine-rich repeat receptor-like protein kinase At2g33170 OS=Arabidopsis thaliana GN=At2g33170 PE=2 SV=1 Back     alignment and function description
>sp|Q9SHI2|Y1723_ARATH Leucine-rich repeat receptor-like serine/threonine-protein kinase At1g17230 OS=Arabidopsis thaliana GN=At1g17230 PE=2 SV=2 Back     alignment and function description
>sp|C0LGS2|Y4361_ARATH Probable LRR receptor-like serine/threonine-protein kinase At4g36180 OS=Arabidopsis thaliana GN=At4g36180 PE=1 SV=1 Back     alignment and function description
>sp|P93194|RPK1_IPONI Receptor-like protein kinase OS=Ipomoea nil GN=INRPK1 PE=2 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query1007
2241391841032 predicted protein [Populus trichocarpa] 0.977 0.953 0.526 0.0
3594812981070 PREDICTED: LRR receptor-like serine/thre 0.985 0.927 0.515 0.0
3594813001054 PREDICTED: leucine-rich repeat receptor 0.960 0.917 0.510 0.0
3594813041057 PREDICTED: LRR receptor-like serine/thre 0.960 0.914 0.504 0.0
3594812961075 PREDICTED: receptor-like protein 12-like 0.983 0.920 0.509 0.0
214011438 1128 GbVe [Gossypium barbadense] 0.976 0.871 0.486 0.0
359481293 1197 PREDICTED: leucine-rich repeat receptor 0.969 0.815 0.510 0.0
237899605 1139 verticillium wilt disease resistance pro 0.977 0.863 0.482 0.0
237899607 1139 verticillium wilt disease resistance pro 0.977 0.863 0.481 0.0
237899609 1139 verticillium wilt disease resistance pro 0.977 0.863 0.481 0.0
>gi|224139184|ref|XP_002323001.1| predicted protein [Populus trichocarpa] gi|222867631|gb|EEF04762.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
 Score =  963 bits (2490), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 548/1040 (52%), Positives = 697/1040 (67%), Gaps = 56/1040 (5%)

Query: 8    SWLFFMPFLANYFGILVTLVSGQCQSDQQSLLLQMKNSFILSKDSITSTKLSQWSSHHSS 67
            +WLF +PFL  +FG+ V LVSGQC+ DQQSLLLQ+KN+ +   D   S KL +W+S  + 
Sbjct: 2    TWLFLIPFLTIFFGVNVCLVSGQCRKDQQSLLLQLKNTLVF--DQSVSAKLVKWNS--TP 57

Query: 68   DCCDWNGVDCDE-AGHVIGLDLSREPIIGGLENATGLFSLQYLRSLNLGFTLFSGIQIPS 126
            DCCDW G+ CDE +G VI LDLS E I GGL +++GL+ LQ+L+SLNL F  FS   +P 
Sbjct: 58   DCCDWPGITCDEGSGRVISLDLSSERITGGLGDSSGLYRLQFLQSLNLSFNSFS-TALPV 116

Query: 127  RLANLTNLTYLNLSQSGFIQDIPIEISSLTRLVTLDLSAE--PSGGFSFLEISNLSLFLQ 184
              ANLT+L  LNLS +GF   IP + S LT+LV+LDLSA   P      LE  N +  +Q
Sbjct: 117  GFANLTDLISLNLSNAGFTGQIPNDFSKLTKLVSLDLSALSFPGSPALKLEQPNFATLVQ 176

Query: 185  NLTELRELHLDNVDLFASGTDWCKALSF-LPNLQVLSLSRCELSGPINQYLANLRSLSAI 243
            NLT L EL LD V++ A G DWCKALS  LPNL+VLS+S C LSGP++  LA L+SLS I
Sbjct: 177  NLTHLTELLLDGVNISAHGNDWCKALSSSLPNLKVLSMSNCYLSGPLDASLAKLQSLSII 236

Query: 244  RLPNNYGLSSPVPEFLANFSHLTALDLGDCQLQGKFPEKILQVPTLETLDLSDNPSLQGS 303
            RL  N  LS+PVPEFLAN+S LTAL L  CQL G FP+ I QVPTLE LDL  N  LQGS
Sbjct: 237  RLSGN-NLSTPVPEFLANYSKLTALQLSSCQLNGIFPQAIFQVPTLEILDLQYNKFLQGS 295

Query: 304  LPHFPKNSSLRNLILFGTGFSGTLPNSIGNLENLANVDISSCNFTGPIPTSMANLTRLFH 363
             P F +N SLR L+L  T FSGTLP SIG L+ L+ ++++  NFTGPIP SMANLT+LF+
Sbjct: 296  FPEFHQNLSLRTLLLSNTNFSGTLPQSIGELQKLSRIELAGNNFTGPIPNSMANLTQLFY 355

Query: 364  LDFSSNHFSGPIPSLGLSRNLSYLDLSSNDLTGRILFTPWEQLLNIKYVHLNYNSLSGSI 423
            LD  SN F+G +PS   S+NL+Y+D+S N L G I    WE L ++ YV L YN+ +GSI
Sbjct: 356  LDLLSNKFTGTLPSFRKSKNLTYVDVSHNQLKGEIPSGHWEGLRSLTYVDLGYNAFNGSI 415

Query: 424  PRSLFLLPTLEMLLLSTNQFENQLPEFSNESSSVMNFLDLSGNRLEGPIPISIFF----- 478
            P SLF +P+L+ + LS N+F  Q+PEF N SSS+++ LDLS N+LEGPIP S+F      
Sbjct: 416  PSSLFAIPSLQKIQLSNNRFGGQIPEFPNVSSSLLDTLDLSSNKLEGPIPSSVFGLAKLN 475

Query: 479  -------------------ELRNLLTLDLSSN-----------------KFSRLKLASSK 502
                               +L NL TL LS N                 +  +L+LAS  
Sbjct: 476  VLELSSNMLNDTLQLHWIQKLPNLTTLGLSYNNLTVKSSGGNSNMSSLPQIKKLRLASCD 535

Query: 503  PRGTPNLNKQSKLSSLDLSDNQISGEIPNWIWEFSANLVFLNLSHNLLESLQEPYFIAGV 562
                P+L  QSKL  LDLSDNQI+G +P WI E    L +LNLS NLL  L+ P  + G+
Sbjct: 536  LGMFPDLRNQSKLFHLDLSDNQITGPVPGWISELIL-LQYLNLSRNLLVDLERPLSLPGL 594

Query: 563  GLLDLHSNELQGSIPYMSPNTSYMDYSNNNFTT-IPADIGNFMSGTIFFSAANNSLTGVI 621
             +LDLH N+LQGSIP      +Y+DYS+N F++ IP +IGN+ + T+FFS +NN LTG I
Sbjct: 595  SILDLHHNQLQGSIPVPPSYITYVDYSSNKFSSFIPPNIGNYFNFTLFFSLSNNHLTGEI 654

Query: 622  PQSVCNATYFSVLDLSNNSLSGTIPTCLITNSSRTLGVLNLRGNSLNGTLSDRVPGICGL 681
            PQS+CN  +  VLDLSNNSLSG IP+CLI +  +TL VLNLR N+ +G + D+ P  C L
Sbjct: 655  PQSICNTEWLQVLDLSNNSLSGAIPSCLI-DKIKTLRVLNLRRNNFDGIIPDKFPRSCEL 713

Query: 682  QILDLNGNQLEGMVPKSLANCKMLQVLDLGNNNFSKKFPCWLKNASSLQVLVLRSNNFSG 741
            + LDL+GN L+G VPKSLANC ML+VLDLGNN  +  FPC LK+ SS +VLVLR+N FSG
Sbjct: 714  KTLDLSGNNLQGQVPKSLANCTMLEVLDLGNNQINDSFPCLLKSISSFRVLVLRNNMFSG 773

Query: 742  NISCPRNNVSWPLLQIIDLASNKFSGRLSKKWLLTLEKMMNAETKSGSELKHLQYGFMGG 801
            +I CP+   +WP LQI+DLA N F G LS   L T E MM    +S   +++       G
Sbjct: 774  HIGCPQIEGTWPRLQIVDLAFNHFIGNLSDICLKTWEGMMEGGNRSLDHIRYDPLQLTNG 833

Query: 802  YQFYQVTVTVTVKSVEILVRKVSNIFTSIDFSSNNFEGPIPEEMGRFKSLYALNLSQNVL 861
              +YQ ++TVTVK +E+ + K+  +FTS DFSSNNFEGPIP+ +G+F +LY LNLS NVL
Sbjct: 834  L-YYQDSITVTVKGLELELVKILTVFTSADFSSNNFEGPIPDAIGKFNALYVLNLSHNVL 892

Query: 862  TGSIPSSFGNLEQIESLDLSMNNLSGKIPAPLANLNFLSVLNLSYNNLVGKIPTSTQLQS 921
            TG IPSS GNL Q+ESLDLS N LSG+IPA L +L FLSVLNLSYN LVG+IPT  Q  +
Sbjct: 893  TGQIPSSLGNLSQLESLDLSSNQLSGQIPAQLTSLTFLSVLNLSYNRLVGRIPTGNQFLT 952

Query: 922  FSPTSYEGNKGLYGPPLTNDSQTHSPELQASPPSASSDEIDSFFVVMSIGFAVGFGAAVS 981
            FS  S+EGN+GL GPPL   + +++ E  ++  S    E D  F+V  +GF +G G  V+
Sbjct: 953  FSSDSFEGNQGLCGPPL-KLACSNTNESNSTRGSNQRKEFDWQFIVPGLGFGLGSGIVVA 1011

Query: 982  PLMFSVKVNKWYNDLIYKFI 1001
            PL+FS K+NK Y+D I K +
Sbjct: 1012 PLLFSKKINKCYDDRIDKIL 1031




Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|359481298|ref|XP_003632604.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase GSO2-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|359481300|ref|XP_002269481.2| PREDICTED: leucine-rich repeat receptor protein kinase EXS-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|359481304|ref|XP_002270356.2| PREDICTED: LRR receptor-like serine/threonine-protein kinase FLS2-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|359481296|ref|XP_003632603.1| PREDICTED: receptor-like protein 12-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|214011438|gb|ACJ61469.1| GbVe [Gossypium barbadense] Back     alignment and taxonomy information
>gi|359481293|ref|XP_003632602.1| PREDICTED: leucine-rich repeat receptor protein kinase EXS-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|237899605|gb|ACR33107.1| verticillium wilt disease resistance protein [Solanum lycopersicum] Back     alignment and taxonomy information
>gi|237899607|gb|ACR33108.1| verticillium wilt disease resistance protein [Solanum lycopersicum] gi|237899611|gb|ACR33110.1| verticillium wilt disease resistance protein [Solanum lycopersicum] gi|237899613|gb|ACR33111.1| verticillium wilt disease resistance protein [Solanum lycopersicum] Back     alignment and taxonomy information
>gi|237899609|gb|ACR33109.1| verticillium wilt disease resistance protein [Solanum lycopersicum] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query1007
TAIR|locus:2078102875 RLP33 "receptor like protein 3 0.416 0.478 0.358 8e-90
TAIR|locus:2074633943 RLP35 "AT3G11080" [Arabidopsis 0.417 0.445 0.340 6.3e-88
TAIR|locus:2085537894 RLP34 "AT3G11010" [Arabidopsis 0.414 0.466 0.348 1.1e-87
TAIR|locus:2144392957 RLP53 "receptor like protein 5 0.416 0.437 0.328 2.6e-86
TAIR|locus:22050051019 RLP7 "AT1G47890" [Arabidopsis 0.803 0.793 0.317 6.2e-85
TAIR|locus:2055772983 RLP19 "receptor like protein 1 0.818 0.838 0.300 5.6e-84
TAIR|locus:2046357890 RLP23 "receptor like protein 2 0.730 0.826 0.315 1.2e-79
TAIR|locus:2825384847 RLP12 "AT1G71400" [Arabidopsis 0.712 0.846 0.308 1.8e-78
TAIR|locus:2046600800 RLP26 "receptor like protein 2 0.650 0.818 0.320 7.9e-78
TAIR|locus:2046515864 RLP24 "receptor like protein 2 0.785 0.915 0.311 1e-77
TAIR|locus:2078102 RLP33 "receptor like protein 33" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 645 (232.1 bits), Expect = 8.0e-90, Sum P(2) = 8.0e-90
 Identities = 159/443 (35%), Positives = 235/443 (53%)

Query:   565 LDLHSNELQGSIP-YMSPNTSYMDYSNNNF------TTIPADIGNFMSGTIFFSAANNSL 617
             LD+ +N+++G +P ++     YM  SNNNF      T +   +    S   FF + NN+ 
Sbjct:   433 LDISNNKIKGQVPSWLLLQLEYMHISNNNFIGFERSTKLEKTVVPKPSMKHFFGS-NNNF 491

Query:   618 TGVIPQSVCNATYFSVLDLSNNSLSGTIPTCLITNSSRTLGVLNLRGNSLNGTLSDRVPG 677
             +G IP  +C+     +LDLSNN+ SG IP C +     TL  LNLR N L+G+L   +  
Sbjct:   492 SGKIPSFICSLRSLIILDLSNNNFSGAIPPC-VGKFKSTLSDLNLRRNRLSGSLPKTI-- 548

Query:   678 ICGLQILDLNGNQLEGMVPKSLANCKMLQVLDLGNNNFSKKFPCWLKNASSLQVLVLRSN 737
             I  L+ LD++ N+LEG +P+SL +   L+VL++ +N  +  FP WL +   LQVLVLRSN
Sbjct:   549 IKSLRSLDVSHNELEGKLPRSLIHFSTLEVLNVESNRINDTFPFWLSSLKKLQVLVLRSN 608

Query:   738 NFSGNISCPRNNVSWPLLQIIDLASNKFSGRLSKKWLLTLEKMMNAETKSGSELKHLQYG 797
              F G I   R    +P L+IID++ N F+G L     +    M + E K+         G
Sbjct:   609 AFHGRIHKTR----FPKLRIIDISRNHFNGTLPSDCFVEWTGMHSLE-KNEDRFNEKYMG 663

Query:   798 FMGGYQFYQXXXXXXXKSVEILVRKVSNIFTSIDFSSNNFEGPIPEEMGRFKSLYALNLS 857
                GY  Y        K +E+ + ++  I+T++DFS N FEG IP  +G  K L+ LNLS
Sbjct:   664 --SGY--YHDSMVLMNKGLEMELVRILKIYTALDFSGNKFEGEIPRSIGLLKELHILNLS 719

Query:   858 QNVLTGSIPSSFGNLEQIESLDLSMNNLSGKIPAPLAXXXXXXXXXXXXXXXXGKIPTST 917
              N  TG IPSS GNL ++ESLD+S N LSG+IP  L                 G++P  T
Sbjct:   720 SNGFTGHIPSSMGNLRELESLDVSRNKLSGEIPQELGNLSYLAYMNFSHNQLVGQVPGGT 779

Query:   918 QLQSFSPTSYEGNKGLYGPPLTNDSQTHSPELQASPPSASSDEIDSFFVVMSIGFAVGF- 976
             Q ++ S +S+E N GL G PL      H P       +  S+++ S+ +  +IGF  G  
Sbjct:   780 QFRTQSASSFEENLGLCGRPLEECRVVHEPTPSGESETLESEQVLSW-IAAAIGFTPGIV 838

Query:   977 -GAAVSPLMFSVKVNKWYNDLIY 998
              G  +  ++ S K  +W+  ++Y
Sbjct:   839 LGLTIGHIVLSSKP-RWFFKVLY 860


GO:0005886 "plasma membrane" evidence=ISM
GO:0006952 "defense response" evidence=ISS
GO:0016301 "kinase activity" evidence=ISS
GO:0007165 "signal transduction" evidence=IC
GO:0009507 "chloroplast" evidence=IDA
GO:0000165 "MAPK cascade" evidence=RCA
GO:0006355 "regulation of transcription, DNA-dependent" evidence=RCA
GO:0006457 "protein folding" evidence=RCA
GO:0006612 "protein targeting to membrane" evidence=RCA
GO:0009408 "response to heat" evidence=RCA
GO:0009617 "response to bacterium" evidence=RCA
GO:0009644 "response to high light intensity" evidence=RCA
GO:0009862 "systemic acquired resistance, salicylic acid mediated signaling pathway" evidence=RCA
GO:0009867 "jasmonic acid mediated signaling pathway" evidence=RCA
GO:0010310 "regulation of hydrogen peroxide metabolic process" evidence=RCA
GO:0010363 "regulation of plant-type hypersensitive response" evidence=RCA
GO:0031348 "negative regulation of defense response" evidence=RCA
GO:0034976 "response to endoplasmic reticulum stress" evidence=RCA
GO:0035304 "regulation of protein dephosphorylation" evidence=RCA
GO:0042542 "response to hydrogen peroxide" evidence=RCA
TAIR|locus:2074633 RLP35 "AT3G11080" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2085537 RLP34 "AT3G11010" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2144392 RLP53 "receptor like protein 53" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2205005 RLP7 "AT1G47890" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2055772 RLP19 "receptor like protein 19" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2046357 RLP23 "receptor like protein 23" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2825384 RLP12 "AT1G71400" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2046600 RLP26 "receptor like protein 26" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2046515 RLP24 "receptor like protein 24" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Your Input:
gw1.XVI.3792.1
hypothetical protein (1032 aa)
(Populus trichocarpa)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query1007
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 6e-64
PLN00113968 PLN00113, PLN00113, leucine-rich repeat receptor-l 8e-50
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 5e-33
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 1e-16
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 1e-14
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 7e-10
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 3e-09
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 1e-08
PLN032101153 PLN03210, PLN03210, Resistant to P 1e-08
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 2e-08
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 2e-08
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 1e-07
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 2e-07
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 5e-07
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 9e-07
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 5e-06
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 5e-06
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 1e-05
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 2e-05
cd00116319 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribo 2e-05
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 3e-05
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 5e-05
PLN032101153 PLN03210, PLN03210, Resistant to P 1e-04
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 2e-04
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 3e-04
PRK15370 754 PRK15370, PRK15370, E3 ubiquitin-protein ligase Sl 9e-04
cd00116319 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribo 0.001
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 0.002
cd00116319 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribo 0.002
pfam0826342 pfam08263, LRRNT_2, Leucine rich repeat N-terminal 0.003
cd00116319 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribo 0.004
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
 Score =  233 bits (597), Expect = 6e-64
 Identities = 204/684 (29%), Positives = 307/684 (44%), Gaps = 150/684 (21%)

Query: 261 NFSHLTALDLGDCQLQGKFPEKILQVPTLETLDLSDNPSLQGSLPH--FPKNSSLRNLIL 318
           N S + ++DL    + GK    I ++P ++T++LS+N  L G +P   F  +SSLR L L
Sbjct: 67  NSSRVVSIDLSGKNISGKISSAIFRLPYIQTINLSNN-QLSGPIPDDIFTTSSSLRYLNL 125

Query: 319 FGTGFSGTLPNSIGNLENLANVDISSCNFTGPIPTSMANLTRLFHLDFSSNHFSGPIP-S 377
               F+G++P   G++ NL  +D+S+   +G IP  + + + L  LD   N   G IP S
Sbjct: 126 SNNNFTGSIPR--GSIPNLETLDLSNNMLSGEIPNDIGSFSSLKVLDLGGNVLVGKIPNS 183

Query: 378 LGLSRNLSYLDLSSNDLTGRILFTPWE--QLLNIKYVHLNYNSLSGSIPRSLFLLPTLEM 435
           L    +L +L L+SN L G+I   P E  Q+ ++K+++L YN+LSG IP  +  L +L  
Sbjct: 184 LTNLTSLEFLTLASNQLVGQI---PRELGQMKSLKWIYLGYNNLSGEIPYEIGGLTSL-- 238

Query: 436 LLLSTNQFENQLPEFSNESSSVMNFLDLSGNRLEGPIPISIFFELRNLLTLDLSSNKFSR 495
                                  N LDL  N L GPIP S    L+NL  L L  NK S 
Sbjct: 239 -----------------------NHLDLVYNNLTGPIPSS-LGNLKNLQYLFLYQNKLS- 273

Query: 496 LKLASSKPRGTPNLNKQSKLSSLDLSDNQISGEIPNWIWEFSANLVFLNLSHNLLESLQE 555
                  P    +L    KL SLDLSDN +SGEIP  + +              L++L+ 
Sbjct: 274 ----GPIPPSIFSL---QKLISLDLSDNSLSGEIPELVIQ--------------LQNLE- 311

Query: 556 PYFIAGVGLLDLHSNELQGSIPYMS---PNTSYMDYSNNNFT-TIPADIGNFMSGTIFFS 611
                   +L L SN   G IP      P    +   +N F+  IP ++G   + T+   
Sbjct: 312 --------ILHLFSNNFTGKIPVALTSLPRLQVLQLWSNKFSGEIPKNLGKHNNLTVL-D 362

Query: 612 AANNSLTGVIPQSVCNATYFSVLDLSNNSLSGTIPTCLITNSSRTLGVLNLRGNSLNGTL 671
            + N+LTG IP+ +C++     L L +NSL G IP  L    S                 
Sbjct: 363 LSTNNLTGEIPEGLCSSGNLFKLILFSNSLEGEIPKSLGACRS----------------- 405

Query: 672 SDRVPGICGLQILDLNGNQLEGMVPKSLANCKMLQVLDLGNNNFSKKFPCWLKNASSLQV 731
                    L+ + L  N   G +P       ++  LD+ NNN   +      +  SLQ+
Sbjct: 406 ---------LRRVRLQDNSFSGELPSEFTKLPLVYFLDISNNNLQGRINSRKWDMPSLQM 456

Query: 732 LVLRSNNFSGNISCPRNNVSWPLLQIIDLASNKFSGRLSKKWLLTLEKMMNAETKSGSEL 791
           L L  N F G +  P +  S   L+ +DL+ N+FSG + +K L +L ++M          
Sbjct: 457 LSLARNKFFGGL--PDSFGS-KRLENLDLSRNQFSGAVPRK-LGSLSELMQ--------- 503

Query: 792 KHLQYGFMGGYQFYQVTVTVTVKSVEILVRKVSNIFTSIDFSSNNFEGPIPEEMGRFKSL 851
                                                 +  S N   G IP+E+   K L
Sbjct: 504 --------------------------------------LKLSENKLSGEIPDELSSCKKL 525

Query: 852 YALNLSQNVLTGSIPSSFGNLEQIESLDLSMNNLSGKIPAPLANLNFLSVLNLSYNNLVG 911
            +L+LS N L+G IP+SF  +  +  LDLS N LSG+IP  L N+  L  +N+S+N+L G
Sbjct: 526 VSLDLSHNQLSGQIPASFSEMPVLSQLDLSQNQLSGEIPKNLGNVESLVQVNISHNHLHG 585

Query: 912 KIPTSTQLQSFSPTSYEGNKGLYG 935
            +P++    + + ++  GN  L G
Sbjct: 586 SLPSTGAFLAINASAVAGNIDLCG 609


Length = 968

>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|215633 PLN03210, PLN03210, Resistant to P Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|238064 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|215633 PLN03210, PLN03210, Resistant to P Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|185268 PRK15370, PRK15370, E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>gnl|CDD|238064 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|238064 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>gnl|CDD|219766 pfam08263, LRRNT_2, Leucine rich repeat N-terminal domain Back     alignment and domain information
>gnl|CDD|238064 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 1007
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 100.0
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 100.0
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 100.0
KOG0472565 consensus Leucine-rich repeat protein [Function un 100.0
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 100.0
KOG0472565 consensus Leucine-rich repeat protein [Function un 100.0
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 100.0
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.97
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.96
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.95
KOG4237498 consensus Extracellular matrix protein slit, conta 99.91
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 99.89
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 99.89
KOG4237498 consensus Extracellular matrix protein slit, conta 99.87
PLN03210 1153 Resistant to P. syringae 6; Provisional 99.87
PLN032101153 Resistant to P. syringae 6; Provisional 99.86
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 99.83
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 99.82
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.7
PLN03150623 hypothetical protein; Provisional 99.68
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.68
KOG0617264 consensus Ras suppressor protein (contains leucine 99.61
KOG0617264 consensus Ras suppressor protein (contains leucine 99.6
PLN03150623 hypothetical protein; Provisional 99.41
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 99.19
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 99.17
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 99.12
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 99.09
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 99.07
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 99.04
KOG3207505 consensus Beta-tubulin folding cofactor E [Posttra 98.91
KOG3207505 consensus Beta-tubulin folding cofactor E [Posttra 98.9
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 98.89
KOG1259490 consensus Nischarin, modulator of integrin alpha5 98.84
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 98.84
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 98.83
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 98.8
PF0826343 LRRNT_2: Leucine rich repeat N-terminal domain; In 98.8
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.76
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.74
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 98.74
KOG1259490 consensus Nischarin, modulator of integrin alpha5 98.74
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 98.57
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 98.56
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 98.39
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 98.38
KOG2982418 consensus Uncharacterized conserved protein [Funct 98.25
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 98.23
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 98.16
KOG4341483 consensus F-box protein containing LRR [General fu 98.13
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 98.02
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 97.86
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 97.78
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 97.72
KOG2982418 consensus Uncharacterized conserved protein [Funct 97.68
PRK15386426 type III secretion protein GogB; Provisional 97.64
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 97.64
KOG4341483 consensus F-box protein containing LRR [General fu 97.51
PRK15386426 type III secretion protein GogB; Provisional 97.51
KOG3665699 consensus ZYG-1-like serine/threonine protein kina 97.5
KOG3665699 consensus ZYG-1-like serine/threonine protein kina 97.49
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 97.4
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 97.37
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 97.04
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 96.93
KOG1947482 consensus Leucine rich repeat proteins, some prote 96.75
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 96.65
KOG2123388 consensus Uncharacterized conserved protein [Funct 96.05
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 96.02
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 95.91
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 95.86
KOG2123388 consensus Uncharacterized conserved protein [Funct 95.84
KOG1947482 consensus Leucine rich repeat proteins, some prote 95.64
KOG4308478 consensus LRR-containing protein [Function unknown 92.81
KOG4308478 consensus LRR-containing protein [Function unknown 90.75
KOG0473 326 consensus Leucine-rich repeat protein [Function un 90.32
KOG3864221 consensus Uncharacterized conserved protein [Funct 90.26
PF1350417 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO 89.75
KOG3864221 consensus Uncharacterized conserved protein [Funct 87.05
PF1351624 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RI 86.28
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 85.82
smart0037026 LRR Leucine-rich repeats, outliers. 85.82
smart0037026 LRR Leucine-rich repeats, outliers. 84.91
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 84.91
PF1351624 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RI 82.47
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
Probab=100.00  E-value=6.2e-71  Score=702.45  Aligned_cols=584  Identities=35%  Similarity=0.569  Sum_probs=390.5

Q ss_pred             CHHHHHHHHHhhhcCCCCCCCcCCCCCCCCCCCCCCCCccccceecCCCCCEEEEeCCCCCccccccCCCccccCCCCCe
Q 001842           32 QSDQQSLLLQMKNSFILSKDSITSTKLSQWSSHHSSDCCDWNGVDCDEAGHVIGLDLSREPIIGGLENATGLFSLQYLRS  111 (1007)
Q Consensus        32 ~~~~~~~ll~~k~~~~~~~~~~~~~~l~~W~~~~~~~~c~w~gv~c~~~~~v~~L~L~~~~l~g~~~~~~~l~~l~~L~~  111 (1007)
                      .++|++||++||+++. +|.    +.+++|  ..+.+||.|.||+|+..++|+.|||+++.+.|.+  ++.+..+++|++
T Consensus        27 ~~~~~~~l~~~~~~~~-~~~----~~~~~w--~~~~~~c~w~gv~c~~~~~v~~L~L~~~~i~~~~--~~~~~~l~~L~~   97 (968)
T PLN00113         27 HAEELELLLSFKSSIN-DPL----KYLSNW--NSSADVCLWQGITCNNSSRVVSIDLSGKNISGKI--SSAIFRLPYIQT   97 (968)
T ss_pred             CHHHHHHHHHHHHhCC-CCc----ccCCCC--CCCCCCCcCcceecCCCCcEEEEEecCCCccccC--ChHHhCCCCCCE
Confidence            4589999999999995 454    568899  5678999999999997789999999999999877  678888888999


Q ss_pred             eeCCCCCCCCCCCCcccc-CCCCCCEEeCCCCCCCccCCccccCCCCCCEEeCCCCCCCCCccccccchHHhhccCCCCc
Q 001842          112 LNLGFTLFSGIQIPSRLA-NLTNLTYLNLSQSGFIQDIPIEISSLTRLVTLDLSAEPSGGFSFLEISNLSLFLQNLTELR  190 (1007)
Q Consensus       112 L~Ls~n~~~~~~lp~~l~-~l~~L~~L~Ls~n~~~~~lp~~l~~l~~L~~L~Ls~n~~~~l~~~~~~~~~~~l~~l~~L~  190 (1007)
                      |+|++|.+.+. +|..+. .+++|++|+|++|.+.+.+|.  +.+++|++|++++|                        
T Consensus        98 L~Ls~n~~~~~-ip~~~~~~l~~L~~L~Ls~n~l~~~~p~--~~l~~L~~L~Ls~n------------------------  150 (968)
T PLN00113         98 INLSNNQLSGP-IPDDIFTTSSSLRYLNLSNNNFTGSIPR--GSIPNLETLDLSNN------------------------  150 (968)
T ss_pred             EECCCCccCCc-CChHHhccCCCCCEEECcCCccccccCc--cccCCCCEEECcCC------------------------
Confidence            99988888775 776654 888888888888887777663  33445555555443                        


Q ss_pred             eeecCCccccCccchhhHhhCCCCCCcEEEccCcCCCCcchhhhcCCCCCCEEECCCCCCCCCCchhhhcCCCCCCEEec
Q 001842          191 ELHLDNVDLFASGTDWCKALSFLPNLQVLSLSRCELSGPINQYLANLRSLSAIRLPNNYGLSSPVPEFLANFSHLTALDL  270 (1007)
Q Consensus       191 ~L~L~~~~~~~~~~~~~~~l~~l~~L~~L~L~~n~l~~~~~~~l~~l~~L~~L~L~~n~~~~~~~~~~l~~l~~L~~L~L  270 (1007)
                                                        .+++.+|..++.+++|++|++++| .+.+.+|..++++++|++|++
T Consensus       151 ----------------------------------~~~~~~p~~~~~l~~L~~L~L~~n-~l~~~~p~~~~~l~~L~~L~L  195 (968)
T PLN00113        151 ----------------------------------MLSGEIPNDIGSFSSLKVLDLGGN-VLVGKIPNSLTNLTSLEFLTL  195 (968)
T ss_pred             ----------------------------------cccccCChHHhcCCCCCEEECccC-cccccCChhhhhCcCCCeeec
Confidence                                              344444445555555555555555 455555555555666666666


Q ss_pred             cCCcCCcccchhccCCCCCCEEeCCCCCCCCCCCCCCCCCCCCcEEEecCCCCcccccccccCCCCCCEEEccCCcCCCC
Q 001842          271 GDCQLQGKFPEKILQVPTLETLDLSDNPSLQGSLPHFPKNSSLRNLILFGTGFSGTLPNSIGNLENLANVDISSCNFTGP  350 (1007)
Q Consensus       271 s~n~l~~~~p~~l~~l~~L~~L~Ls~n~~~~~~~~~~~~l~~L~~L~L~~n~l~~~~~~~l~~l~~L~~L~Ls~n~l~~~  350 (1007)
                      ++|.+.+.+|..++++++|++|++++|                        .+.+.+|..++++++|++|++++|.+.+.
T Consensus       196 ~~n~l~~~~p~~l~~l~~L~~L~L~~n------------------------~l~~~~p~~l~~l~~L~~L~L~~n~l~~~  251 (968)
T PLN00113        196 ASNQLVGQIPRELGQMKSLKWIYLGYN------------------------NLSGEIPYEIGGLTSLNHLDLVYNNLTGP  251 (968)
T ss_pred             cCCCCcCcCChHHcCcCCccEEECcCC------------------------ccCCcCChhHhcCCCCCEEECcCceeccc
Confidence            666655555555555555555554443                        23344555555666666666666666655


Q ss_pred             CcccccCCCCCcEEEeccCcccCCCCCccCCCCCCEEEcccCCCCCccCCcccccCCCcCEEEccCCcCCCccCccccCC
Q 001842          351 IPTSMANLTRLFHLDFSSNHFSGPIPSLGLSRNLSYLDLSSNDLTGRILFTPWEQLLNIKYVHLNYNSLSGSIPRSLFLL  430 (1007)
Q Consensus       351 ~p~~l~~l~~L~~L~L~~n~l~~~~~~~~~~~~L~~L~L~~n~l~~~i~~~~~~~l~~L~~L~L~~n~l~~~~~~~l~~l  430 (1007)
                      +|..++++++|++|++++|.+.+.+|                       .. +..+++|++|++++|.+.+.+|..+.++
T Consensus       252 ~p~~l~~l~~L~~L~L~~n~l~~~~p-----------------------~~-l~~l~~L~~L~Ls~n~l~~~~p~~~~~l  307 (968)
T PLN00113        252 IPSSLGNLKNLQYLFLYQNKLSGPIP-----------------------PS-IFSLQKLISLDLSDNSLSGEIPELVIQL  307 (968)
T ss_pred             cChhHhCCCCCCEEECcCCeeeccCc-----------------------hh-HhhccCcCEEECcCCeeccCCChhHcCC
Confidence            66666666655555555555443332                       22 4445555555555555555566666655


Q ss_pred             CcccccccCCCcccccCccccccCcCCccEEEccCCCCCCCCChhhhccCCCCcEEECCCCccccccccCCCCCCCCCCC
Q 001842          431 PTLEMLLLSTNQFENQLPEFSNESSSVMNFLDLSGNRLEGPIPISIFFELRNLLTLDLSSNKFSRLKLASSKPRGTPNLN  510 (1007)
Q Consensus       431 ~~L~~L~L~~n~l~~~~~~~~~~~~~~L~~L~ls~n~l~~~i~~~~f~~l~~L~~L~L~~n~l~~l~~~~~~~~~~p~l~  510 (1007)
                      ++|+.|++++|.+.+                         .+|..+ ..+                              
T Consensus       308 ~~L~~L~l~~n~~~~-------------------------~~~~~~-~~l------------------------------  331 (968)
T PLN00113        308 QNLEILHLFSNNFTG-------------------------KIPVAL-TSL------------------------------  331 (968)
T ss_pred             CCCcEEECCCCccCC-------------------------cCChhH-hcC------------------------------
Confidence            656655555555443                         222221 222                              


Q ss_pred             CCCCccEEEcCCCccccchhhhHhhccccceEEeccCCcccCCCcccccccCCeEecccccccccCCCCCCCCCeEEecC
Q 001842          511 KQSKLSSLDLSDNQISGEIPNWIWEFSANLVFLNLSHNLLESLQEPYFIAGVGLLDLHSNELQGSIPYMSPNTSYMDYSN  590 (1007)
Q Consensus       511 ~l~~L~~L~Ls~n~l~~~ip~~~~~~~~~L~~L~Ls~N~l~~l~~~~~~~~L~~L~l~~N~l~~~~~~~~~~L~~L~ls~  590 (1007)
                        ++|+.|++++|.+++.+|..+..                                                       
T Consensus       332 --~~L~~L~L~~n~l~~~~p~~l~~-------------------------------------------------------  354 (968)
T PLN00113        332 --PRLQVLQLWSNKFSGEIPKNLGK-------------------------------------------------------  354 (968)
T ss_pred             --CCCCEEECcCCCCcCcCChHHhC-------------------------------------------------------
Confidence              33444444444444344332211                                                       


Q ss_pred             CcCcCCCccccccCCCceEEEcccCcccccCCccccCCCCCCEEEccCCcccccCCcchhhcCcCccceEEccCCcCccc
Q 001842          591 NNFTTIPADIGNFMSGTIFFSAANNSLTGVIPQSVCNATYFSVLDLSNNSLSGTIPTCLITNSSRTLGVLNLRGNSLNGT  670 (1007)
Q Consensus       591 n~l~~i~~~~~~~~~~L~~L~l~~n~l~~~~p~~~~~~~~L~~L~Ls~N~l~~~~p~~~~~~~~~~L~~L~Ls~N~l~~~  670 (1007)
                                   +++|+.|++++|++++.+|..++.+++|+.|++++|++.+.                          
T Consensus       355 -------------~~~L~~L~Ls~n~l~~~~p~~~~~~~~L~~L~l~~n~l~~~--------------------------  395 (968)
T PLN00113        355 -------------HNNLTVLDLSTNNLTGEIPEGLCSSGNLFKLILFSNSLEGE--------------------------  395 (968)
T ss_pred             -------------CCCCcEEECCCCeeEeeCChhHhCcCCCCEEECcCCEeccc--------------------------
Confidence                         11222233333333333333444444455555555555444                          


Q ss_pred             cCCCcCCCCCccEEeccCCcccccccccccCCCCCcEEeCCCCcCCccchhhhhcCCCCcEEECCCccCccccCCCCCCC
Q 001842          671 LSDRVPGICGLQILDLNGNQLEGMVPKSLANCKMLQVLDLGNNNFSKKFPCWLKNASSLQVLVLRSNNFSGNISCPRNNV  750 (1007)
Q Consensus       671 ~~~~~~~l~~L~~L~L~~N~l~~~~p~~l~~l~~L~~L~Ls~N~l~~~~p~~l~~l~~L~~L~L~~N~l~~~~~~~~~~~  750 (1007)
                      +|..+..+++|+.|++++|++++.+|..|..++.|+.|++++|++++.+|..+..+++|+.|++++|++.+.+  |..+ 
T Consensus       396 ~p~~~~~~~~L~~L~L~~n~l~~~~p~~~~~l~~L~~L~Ls~N~l~~~~~~~~~~l~~L~~L~L~~n~~~~~~--p~~~-  472 (968)
T PLN00113        396 IPKSLGACRSLRRVRLQDNSFSGELPSEFTKLPLVYFLDISNNNLQGRINSRKWDMPSLQMLSLARNKFFGGL--PDSF-  472 (968)
T ss_pred             CCHHHhCCCCCCEEECcCCEeeeECChhHhcCCCCCEEECcCCcccCccChhhccCCCCcEEECcCceeeeec--Cccc-
Confidence            4444555555555556666665555656666666666666666666666666666666666666666666554  4332 


Q ss_pred             CCCCCcEEECCCCcCcccCchHHHHhHHHhhhhccccccccccccccccCcceeeeeEEEEEecceeeeeeccccceEEE
Q 001842          751 SWPLLQIIDLASNKFSGRLSKKWLLTLEKMMNAETKSGSELKHLQYGFMGGYQFYQVTVTVTVKSVEILVRKVSNIFTSI  830 (1007)
Q Consensus       751 ~l~~L~~L~Ls~N~l~g~~p~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~l  830 (1007)
                      ..++|+.||+++|+++|.+|..+.                                                .+..|+.|
T Consensus       473 ~~~~L~~L~ls~n~l~~~~~~~~~------------------------------------------------~l~~L~~L  504 (968)
T PLN00113        473 GSKRLENLDLSRNQFSGAVPRKLG------------------------------------------------SLSELMQL  504 (968)
T ss_pred             ccccceEEECcCCccCCccChhhh------------------------------------------------hhhccCEE
Confidence            346777888888888777774321                                                24457788


Q ss_pred             EcccccccCCCcccccCCCCCCEEeCCCCcccccCCcCccCCCCCCEEeCCCccccccCCccCcCCCCCCeEEccCCccc
Q 001842          831 DFSSNNFEGPIPEEMGRFKSLYALNLSQNVLTGSIPSSFGNLEQIESLDLSMNNLSGKIPAPLANLNFLSVLNLSYNNLV  910 (1007)
Q Consensus       831 dLs~N~l~g~ip~~~~~l~~L~~L~Ls~N~l~g~ip~~~~~l~~L~~LdLs~N~l~g~ip~~l~~l~~L~~l~ls~N~L~  910 (1007)
                      ||++|+++|.+|+.++++++|++|+|++|.++|.+|..|+++++|+.|||++|+++|.+|..++++++|+++++++|+++
T Consensus       505 ~Ls~N~l~~~~p~~~~~l~~L~~L~Ls~N~l~~~~p~~~~~l~~L~~L~Ls~N~l~~~~p~~l~~l~~L~~l~ls~N~l~  584 (968)
T PLN00113        505 KLSENKLSGEIPDELSSCKKLVSLDLSHNQLSGQIPASFSEMPVLSQLDLSQNQLSGEIPKNLGNVESLVQVNISHNHLH  584 (968)
T ss_pred             ECcCCcceeeCChHHcCccCCCEEECCCCcccccCChhHhCcccCCEEECCCCcccccCChhHhcCcccCEEeccCCcce
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             ccCCCCCCCCccCCCcccCCCCCCCCC
Q 001842          911 GKIPTSTQLQSFSPTSYEGNKGLYGPP  937 (1007)
Q Consensus       911 g~iP~~~~~~~~~~~~~~gn~~lcg~~  937 (1007)
                      |.||..++|.++.+.+|.||+++||.+
T Consensus       585 ~~~p~~~~~~~~~~~~~~~n~~lc~~~  611 (968)
T PLN00113        585 GSLPSTGAFLAINASAVAGNIDLCGGD  611 (968)
T ss_pred             eeCCCcchhcccChhhhcCCccccCCc
Confidence            999999999999999999999999864



>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>PF08263 LRRNT_2: Leucine rich repeat N-terminal domain; InterPro: IPR013210 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>KOG4308 consensus LRR-containing protein [Function unknown] Back     alignment and domain information
>KOG4308 consensus LRR-containing protein [Function unknown] Back     alignment and domain information
>KOG0473 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF13516 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RIZ_A 3RGX_A 1DFJ_I 2BNH_A 3VQ1_A 3VQ2_A 2Z64_A 2OMX_A Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>PF13516 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RIZ_A 3RGX_A 1DFJ_I 2BNH_A 3VQ1_A 3VQ2_A 2Z64_A 2OMX_A Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query1007
3riz_A772 Crystal Structure Of The Plant Steroid Receptor Bri 2e-29
3rgx_A768 Structural Insight Into Brassinosteroid Perception 2e-29
1ogq_A313 The Crystal Structure Of Pgip (Polygalacturonase In 8e-10
1ogq_A313 The Crystal Structure Of Pgip (Polygalacturonase In 4e-07
1ogq_A313 The Crystal Structure Of Pgip (Polygalacturonase In 1e-04
4fcg_A328 Structure Of The Leucine-Rich Repeat Domain Of The 3e-04
3ul8_A279 Crystal Structure Of The Tv3 Mutant V134l Length = 7e-04
2z63_A570 Crystal Structure Of The Tv8 Hybrid Of Human Tlr4 A 8e-04
3ula_A279 Crystal Structure Of The Tv3 Mutant F63w-Md-2-Erito 8e-04
4g8a_A635 Crystal Structure Of Human Tlr4 Polymorphic Variant 9e-04
3ul7_A278 Crystal Structure Of The Tv3 Mutant F63w Length = 2 9e-04
2z62_A276 Crystal Structure Of The Tv3 Hybrid Of Human Tlr4 A 9e-04
>pdb|3RIZ|A Chain A, Crystal Structure Of The Plant Steroid Receptor Bri1 Ectodomain Length = 772 Back     alignment and structure

Iteration: 1

Score = 128 bits (322), Expect = 2e-29, Method: Compositional matrix adjust. Identities = 197/758 (25%), Positives = 301/758 (39%), Gaps = 136/758 (17%) Query: 221 LSRCELSGPINQYLANLRSLSAIRLPNNYGLSSPVPEF--LANFSHLTALDLGDCQLQGK 278 LS ++G ++ + + SL+++ L N LS PV L + S L L++ L Sbjct: 81 LSNSHINGSVSGFKCS-ASLTSLDLSRN-SLSGPVTTLTSLGSCSGLKFLNVSSNTLD-- 136 Query: 279 FPEKI---LQVPTLETLDLSDNPSLQGSLPHFPKNSSLRNLILFGTGFSGTLPNSIGNLE 335 FP K+ L++ +LE LDLS N S+ G+ N++ + L + G L+ Sbjct: 137 FPGKVSGGLKLNSLEVLDLSAN-SISGA-----------NVVGW------VLSDGCGELK 178 Query: 336 NLANVDISSCNFTGPIPTSMANLTRLFHLDFSSNHFSGPIPSLGXXXXXXXXXXXXXXXT 395 +LA IS +G + S L LD SSN+FS IP LG Sbjct: 179 HLA---ISGNKISGDVDVSRC--VNLEFLDVSSNNFSTGIPFLGDCSA------------ 221 Query: 396 GRILFTPWEQLLNIKYVHLNYNSLSGSIPRSXXXXXXXXXXXXSTNQFENQLPEFSNESS 455 ++++ ++ N LSG R+ S+NQF +P +S Sbjct: 222 -------------LQHLDISGNKLSGDFSRAISTCTELKLLNISSNQFVGPIPPLPLKS- 267 Query: 456 SVMNFLDLSGNRLEGPIPISIFFELRNLLTLDLSSNKFSRLKLASSKPRGTPNXXXXXXX 515 + +L L+ N+ G IP + L LDLS N F + P P Sbjct: 268 --LQYLSLAENKFTGEIPDFLSGACDTLTGLDLSGNHF-----YGAVP---PFFGSCSLL 317 Query: 516 XXXXXXXXXISGEIPNWIWEFSANLVFLNLSHNLLESLQEPYFIAGVGLLDLHSNELQGS 575 SGE+P +++L + + G+ +LDL NE G Sbjct: 318 ESLALSSNNFSGELP-------------------MDTLLK---MRGLKVLDLSFNEFSGE 355 Query: 576 IPYMSPNTSY----MDYSNNNFT--TIPADIGNFMSGTIFFSAANNSLTGVIPQSVCNAT 629 +P N S +D S+NNF+ +P N + NN TG IP ++ N + Sbjct: 356 LPESLTNLSASLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCS 415 Query: 630 YFSVLDLSNNSLSGTIPTCLITNSSRTLGVLNLRGNSLNGTLSDRVPGICGLQILDLNGN 689 L LS N LSGTIP+ L S L L L N L G + + + L+ L L+ N Sbjct: 416 ELVSLHLSFNYLSGTIPSSL--GSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFN 473 Query: 690 QLEGMVPKSLANCKMLQVLDLGNNNFSKKFPCWLKNASSLQVLVLRSNNFSGNISCPRNN 749 L G +P L+NC L + L NN + + P W+ +L +L L +N+FSGNI P Sbjct: 474 DLTGEIPSGLSNCTNLNWISLSNNRLTGEIPKWIGRLENLAILKLSNNSFSGNI--PAEL 531 Query: 750 VSWPLLQIIDLASNKFSGRLSKKWLLTLEKMMNAETKSGSELKHLQYGFM-----GGYQF 804 L +DL +N F+G + K+ A +G +++ M G Sbjct: 532 GDCRSLIWLDLNTNLFNGTIPAAMFKQSGKIA-ANFIAGKRYVYIKNDGMKKECHGAGNL 590 Query: 805 YQXXXXXXXKSVEILVRKVSNIFTSIDFSSNNFEGPIPEEMGRFKSLYALNLSQNVL--- 861 + + + R NI + + + G S+ L++S N+L Sbjct: 591 LEFQGIRSEQLNRLSTRNPCNITSRV------YGGHTSPTFDNNGSMMFLDMSYNMLSGY 644 Query: 862 ---------------------TGSIPSSFGNLEQIESLDLSMNNLSGKIPAPLAXXXXXX 900 +GSIP G+L + LDLS N L G+IP ++ Sbjct: 645 IPKEIGSMPYLFILNLGHNDISGSIPDEVGDLRGLNILDLSSNKLDGRIPQAMSALTMLT 704 Query: 901 XXXXXXXXXXGKIPTSTQLQSFSPTSYEGNKGLYGPPL 938 G IP Q ++F P + N GL G PL Sbjct: 705 EIDLSNNNLSGPIPEMGQFETFPPAKFLNNPGLCGYPL 742
>pdb|3RGX|A Chain A, Structural Insight Into Brassinosteroid Perception By Bri1 Length = 768 Back     alignment and structure
>pdb|1OGQ|A Chain A, The Crystal Structure Of Pgip (Polygalacturonase Inhibiting Protein), A Leucine Rich Repeat Protein Involved In Plant Defense Length = 313 Back     alignment and structure
>pdb|1OGQ|A Chain A, The Crystal Structure Of Pgip (Polygalacturonase Inhibiting Protein), A Leucine Rich Repeat Protein Involved In Plant Defense Length = 313 Back     alignment and structure
>pdb|1OGQ|A Chain A, The Crystal Structure Of Pgip (Polygalacturonase Inhibiting Protein), A Leucine Rich Repeat Protein Involved In Plant Defense Length = 313 Back     alignment and structure
>pdb|4FCG|A Chain A, Structure Of The Leucine-Rich Repeat Domain Of The Type Iii Effector Xcv3220 (Xopl) Length = 328 Back     alignment and structure
>pdb|3UL8|A Chain A, Crystal Structure Of The Tv3 Mutant V134l Length = 279 Back     alignment and structure
>pdb|2Z63|A Chain A, Crystal Structure Of The Tv8 Hybrid Of Human Tlr4 And Hagfish Vlrb.61 Length = 570 Back     alignment and structure
>pdb|3ULA|A Chain A, Crystal Structure Of The Tv3 Mutant F63w-Md-2-Eritoran Complex Length = 279 Back     alignment and structure
>pdb|4G8A|A Chain A, Crystal Structure Of Human Tlr4 Polymorphic Variant D299g And T399i In Complex With Md-2 And Lps Length = 635 Back     alignment and structure
>pdb|3UL7|A Chain A, Crystal Structure Of The Tv3 Mutant F63w Length = 278 Back     alignment and structure
>pdb|2Z62|A Chain A, Crystal Structure Of The Tv3 Hybrid Of Human Tlr4 And Hagfish Vlrb.61 Length = 276 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query1007
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 1e-161
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 1e-86
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 1e-67
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 1e-60
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 1e-49
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 2e-36
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 8e-33
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 3e-19
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 7e-15
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 4e-70
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 3e-66
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 6e-58
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 2e-52
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 3e-43
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 2e-40
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 5e-27
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 2e-67
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 5e-63
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 4e-62
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 9e-44
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 1e-18
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 2e-08
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 2e-08
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 3e-62
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 3e-51
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 6e-47
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 1e-19
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 3e-57
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 4e-52
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 7e-46
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 4e-40
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 2e-35
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 2e-31
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 1e-23
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 1e-56
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 6e-53
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 2e-46
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 1e-44
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 2e-43
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 5e-40
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 6e-40
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 1e-31
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 8e-55
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 9e-54
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 5e-53
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 4e-50
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 2e-45
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 6e-44
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 8e-31
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 2e-10
3j0a_A844 TOLL-like receptor 5; membrane protein, leucine-ri 6e-46
3j0a_A844 TOLL-like receptor 5; membrane protein, leucine-ri 3e-43
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 2e-42
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 2e-34
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 1e-42
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 6e-39
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 9e-39
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 2e-34
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 1e-31
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 4e-29
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 2e-18
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 2e-08
1o6v_A466 Internalin A; bacterial infection, extracellular r 1e-39
1o6v_A466 Internalin A; bacterial infection, extracellular r 4e-39
1o6v_A466 Internalin A; bacterial infection, extracellular r 4e-37
1o6v_A466 Internalin A; bacterial infection, extracellular r 9e-34
1o6v_A466 Internalin A; bacterial infection, extracellular r 1e-28
1o6v_A466 Internalin A; bacterial infection, extracellular r 6e-25
1o6v_A466 Internalin A; bacterial infection, extracellular r 5e-19
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 1e-37
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 3e-34
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 3e-33
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 7e-32
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 1e-30
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 1e-23
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 7e-09
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 5e-05
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 5e-37
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 2e-33
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 1e-28
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 2e-21
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 7e-20
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 1e-18
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 2e-15
4fmz_A347 Internalin; leucine rich repeat, structural genomi 4e-35
4fmz_A347 Internalin; leucine rich repeat, structural genomi 2e-33
4fmz_A347 Internalin; leucine rich repeat, structural genomi 2e-30
4fmz_A347 Internalin; leucine rich repeat, structural genomi 2e-23
4fmz_A347 Internalin; leucine rich repeat, structural genomi 1e-22
4fmz_A347 Internalin; leucine rich repeat, structural genomi 6e-22
4fmz_A347 Internalin; leucine rich repeat, structural genomi 2e-11
4fmz_A347 Internalin; leucine rich repeat, structural genomi 9e-10
4fmz_A 347 Internalin; leucine rich repeat, structural genomi 5e-08
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 7e-30
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 8e-29
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 4e-28
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 2e-25
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 2e-25
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 5e-22
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 2e-18
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 3e-18
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 5e-17
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 3e-16
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 2e-09
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 5e-04
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 3e-28
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 4e-27
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 2e-25
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 2e-24
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 7e-07
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 9e-04
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 1e-27
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 6e-24
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 2e-22
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 3e-21
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 9e-18
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 2e-17
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 3e-12
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 2e-07
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 2e-27
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 2e-26
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 7e-23
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 2e-19
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 4e-19
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 7e-18
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 4e-15
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 2e-13
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 3e-27
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 3e-22
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 4e-22
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 6e-20
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 3e-14
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 1e-13
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 2e-13
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 5e-10
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 3e-27
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 5e-18
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 3e-15
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 5e-08
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 5e-25
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 1e-22
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 3e-22
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 2e-20
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 1e-18
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 6e-14
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 4e-24
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 2e-23
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 7e-21
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 2e-17
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 2e-17
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 2e-16
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 8e-16
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 4e-24
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 6e-24
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 2e-23
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 7e-21
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 5e-20
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 2e-15
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 9e-14
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 7e-13
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 3e-08
3o53_A 317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 1e-07
3o53_A 317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 4e-04
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 9e-24
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 5e-11
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 1e-10
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 3e-10
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 6e-09
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 3e-23
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 4e-16
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 4e-16
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 7e-12
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 3e-10
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 8e-05
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 3e-04
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 2e-21
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 1e-19
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 2e-19
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 1e-16
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 2e-16
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 3e-09
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 2e-21
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 4e-21
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 1e-14
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 6e-14
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 4e-20
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 1e-19
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 1e-19
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 7e-19
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 3e-13
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 1e-11
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 3e-08
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 1e-05
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 1e-19
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 4e-19
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 2e-18
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 3e-15
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 3e-11
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 8e-11
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 1e-05
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 1e-18
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 1e-15
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 1e-14
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 2e-12
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 3e-12
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 7e-10
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 1e-09
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 1e-04
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 9e-04
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 3e-18
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 4e-18
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 2e-15
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 5e-15
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 9e-13
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 1e-11
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 1e-11
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 1e-09
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 8e-05
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 1e-04
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 5e-04
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 4e-18
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 5e-17
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 3e-15
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 9e-15
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 3e-10
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 2e-09
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 3e-08
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 6e-18
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 2e-15
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 4e-14
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 5e-10
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 1e-09
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 3e-08
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 9e-08
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 7e-07
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 1e-17
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 2e-15
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 3e-14
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 6e-13
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 1e-12
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 1e-11
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 3e-08
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 8e-16
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 7e-13
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 8e-13
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 9e-12
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 2e-06
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 4e-05
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 2e-04
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 2e-04
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 9e-16
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 2e-15
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 2e-15
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 6e-14
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 2e-13
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 7e-13
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 7e-12
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 1e-11
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 1e-10
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 7e-09
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 5e-08
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 8e-07
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 2e-15
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 1e-14
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 2e-14
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 2e-14
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 1e-12
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 3e-09
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 1e-06
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 2e-06
4ezg_A197 Putative uncharacterized protein; internalin-A, le 1e-14
4ezg_A197 Putative uncharacterized protein; internalin-A, le 1e-13
4ezg_A197 Putative uncharacterized protein; internalin-A, le 3e-13
4ezg_A197 Putative uncharacterized protein; internalin-A, le 2e-12
4ezg_A197 Putative uncharacterized protein; internalin-A, le 2e-11
4ezg_A197 Putative uncharacterized protein; internalin-A, le 1e-09
4ezg_A197 Putative uncharacterized protein; internalin-A, le 8e-09
4ezg_A197 Putative uncharacterized protein; internalin-A, le 2e-07
4ezg_A197 Putative uncharacterized protein; internalin-A, le 2e-06
4ezg_A197 Putative uncharacterized protein; internalin-A, le 5e-06
4ezg_A197 Putative uncharacterized protein; internalin-A, le 3e-05
4ezg_A197 Putative uncharacterized protein; internalin-A, le 9e-05
4ezg_A197 Putative uncharacterized protein; internalin-A, le 3e-04
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 2e-14
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 8e-11
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 1e-05
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 8e-14
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 1e-12
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 6e-10
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 7e-09
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 1e-07
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 2e-04
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 8e-14
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 7e-11
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 8e-11
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 5e-08
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 5e-08
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 3e-07
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 2e-06
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 1e-13
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 2e-07
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 2e-06
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 3e-05
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 1e-13
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 1e-13
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 3e-12
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 7e-12
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 2e-11
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 7e-05
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 1e-04
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 2e-13
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 3e-10
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 1e-09
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 1e-08
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 5e-08
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 6e-07
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 1e-05
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 2e-05
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 1e-11
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 3e-11
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 3e-09
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 3e-09
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 1e-04
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 6e-04
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 1e-11
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 2e-10
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 9e-06
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 1e-05
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 5e-04
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 1e-11
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 2e-11
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 6e-09
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 2e-08
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 4e-08
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 3e-04
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 6e-04
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 7e-11
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 3e-08
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 1e-10
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 1e-09
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 1e-09
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 1e-10
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 8e-08
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 2e-07
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 1e-05
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 2e-05
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 2e-10
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 6e-10
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 1e-08
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 6e-08
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 4e-07
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 4e-06
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 2e-05
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 3e-05
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 9e-05
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-10
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 5e-10
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 2e-08
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 6e-08
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 8e-07
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 2e-04
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 7e-10
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 2e-09
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 5e-09
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 4e-07
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 2e-05
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 1e-09
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 3e-06
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 2e-05
3m19_A251 Variable lymphocyte receptor A diversity region; a 1e-08
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 2e-08
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 5e-08
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 3e-05
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 1e-04
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 1e-04
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 2e-04
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 2e-04
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 6e-04
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 6e-04
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 2e-07
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 7e-06
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 7e-04
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 2e-07
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 2e-05
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 4e-05
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 1e-04
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 4e-04
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 6e-04
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 7e-04
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 4e-07
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 6e-07
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 6e-05
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 2e-06
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 5e-06
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 3e-05
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 1e-04
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 2e-04
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 6e-06
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 2e-05
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 1e-04
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 2e-04
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 3e-04
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 7e-06
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 3e-05
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 2e-04
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 7e-04
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 7e-04
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 9e-04
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 1e-05
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 2e-04
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 2e-05
3e6j_A229 Variable lymphocyte receptor diversity region; var 4e-05
3e6j_A229 Variable lymphocyte receptor diversity region; var 1e-04
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 4e-05
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 2e-04
1w8a_A192 SLIT protein; signaling protein, secreted protein, 6e-05
1w8a_A192 SLIT protein; signaling protein, secreted protein, 1e-04
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 5e-04
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
 Score =  493 bits (1271), Expect = e-161
 Identities = 216/957 (22%), Positives = 333/957 (34%), Gaps = 229/957 (23%)

Query: 28  SGQCQSDQQSLLLQMKNSFILSKDSITSTKLSQWSSHHSSDCCDWNGVDCDEAGHVIGLD 87
             Q    +   L+  K+             L  WSS  + + C ++GV C     V  +D
Sbjct: 6   PSQSLYREIHQLISFKDVLP------DKNLLPDWSS--NKNPCTFDGVTCR-DDKVTSID 56

Query: 88  LSREPIIGGLENATGLFSLQYLRSLNLGFTLFSGIQIPSRLANLTNLTYLNLSQSGFIQD 147
           LS                       +    +     + S L +LT L  L LS S     
Sbjct: 57  LS-----------------------SKPLNVGFS-AVSSSLLSLTGLESLFLSNSHINGS 92

Query: 148 IPIEISSLTRLVTLDLSAEPSGGFSFLEISNLSLFLQNLTELRELHLDNVDLFASGTDWC 207
           +         L +LDLS            ++LS  +  LT                    
Sbjct: 93  VS-GFKCSASLTSLDLSR-----------NSLSGPVTTLTS------------------- 121

Query: 208 KALSFLPNLQVLSLSRCELSGPIN-QYLANLRSLSAIRLPNNYGLSSPVPEFLA---NFS 263
             L     L+ L++S   L  P        L SL  + L  N  +S              
Sbjct: 122 --LGSCSGLKFLNVSSNTLDFPGKVSGGLKLNSLEVLDLSANS-ISGANVVGWVLSDGCG 178

Query: 264 HLTALDLGDCQLQGKFPEKILQVPTLETLDLSDNPSLQGSLPHFPKNSSLRNLILFGTGF 323
            L  L +   ++ G     + +   LE LD+S N                         F
Sbjct: 179 ELKHLAISGNKISGDVD--VSRCVNLEFLDVSSN------------------------NF 212

Query: 324 SGTLPNSIGNLENLANVDISSCNFTGPIPTSMANLTRLFHLDFSSNHFSGPIPSLGLSRN 383
           S  +P  +G+   L ++DIS    +G    +++  T L  L+ SSN F GPIP L L  +
Sbjct: 213 STGIP-FLGDCSALQHLDISGNKLSGDFSRAISTCTELKLLNISSNQFVGPIPPLPLK-S 270

Query: 384 LSYLDLSSNDLTGRILFTPWEQLLNIKYVHLNYNSLSGSIPRSLFLLPTLEMLLLSTNQF 443
           L YL L+ N  TG I          +  + L+ N   G++P        LE         
Sbjct: 271 LQYLSLAENKFTGEIPDFLSGACDTLTGLDLSGNHFYGAVPPFFGSCSLLE--------- 321

Query: 444 ENQLPEFSNESSSVMNFLDLSGNRLEGPIPISIFFELRNLLTLDLSSNKFSRLKLASSKP 503
                            L LS N   G +P+    ++R                      
Sbjct: 322 ----------------SLALSSNNFSGELPMDTLLKMRG--------------------- 344

Query: 504 RGTPNLNKQSKLSSLDLSDNQISGEIPNWIWEFSANLVFLNLSHNLLESLQEPYFIAGVG 563
                      L  LDLS N+ SGE+P  +   SA+L+ L+LS N               
Sbjct: 345 -----------LKVLDLSFNEFSGELPESLTNLSASLLTLDLSSNNFS------------ 381

Query: 564 LLDLHSNELQGSIPYMSPNTSYMDYSNNNFTTIPADIGNFMSGTI-FFSAANNSLTGVIP 622
                     G I                      ++      T+      NN  TG IP
Sbjct: 382 ----------GPIL--------------------PNLCQNPKNTLQELYLQNNGFTGKIP 411

Query: 623 QSVCNATYFSVLDLSNNSLSGTIPTCLITNSSRTLGVLNLRGNSLNGTLSDRVPGICGLQ 682
            ++ N +    L LS N LSGTIP+ L + S   L  L L  N L G +   +  +  L+
Sbjct: 412 PTLSNCSELVSLHLSFNYLSGTIPSSLGSLSK--LRDLKLWLNMLEGEIPQELMYVKTLE 469

Query: 683 ILDLNGNQLEGMVPKSLANCKMLQVLDLGNNNFSKKFPCWLKNASSLQVLVLRSNNFSGN 742
            L L+ N L G +P  L+NC  L  + L NN  + + P W+    +L +L L +N+FSGN
Sbjct: 470 TLILDFNDLTGEIPSGLSNCTNLNWISLSNNRLTGEIPKWIGRLENLAILKLSNNSFSGN 529

Query: 743 ISCPRNNVSWPLLQIIDLASNKFSGRLSKKWLLTLEKMMNAETKSGSELKHLQYGFMGGY 802
           I  P        L  +DL +N F+G +    +      + A   +G    +++   M   
Sbjct: 530 I--PAELGDCRSLIWLDLNTNLFNGTIP-AAMFKQSGKIAANFIAGKRYVYIKNDGMKKE 586

Query: 803 QFYQVTVTVTVKSVEILVRKVSNIFTSIDFSSNNFEGPIPEEMGRFKSLYALNLSQNVLT 862
                 +          + ++S      + +S  + G          S+  L++S N+L+
Sbjct: 587 CHGAGNLLEFQGIRSEQLNRLSTR-NPCNITSRVYGGHTSPTFDNNGSMMFLDMSYNMLS 645

Query: 863 GSIPSSFGNLEQIESLDLSMNNLSGKIPAPLANLNFLSVLNLSYNNL------------- 909
           G IP   G++  +  L+L  N++SG IP  + +L  L++L+LS N L             
Sbjct: 646 GYIPKEIGSMPYLFILNLGHNDISGSIPDEVGDLRGLNILDLSSNKLDGRIPQAMSALTM 705

Query: 910 -----------VGKIPTSTQLQSFSPTSYEGNKGLYGPPLTNDSQTHSPELQASPPS 955
                       G IP   Q ++F P  +  N GL G PL     +++        S
Sbjct: 706 LTEIDLSNNNLSGPIPEMGQFETFPPAKFLNNPGLCGYPLPRCDPSNADGYAHHQRS 762


>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336 Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208 Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208 Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Length = 372 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Length = 176 Back     alignment and structure

Structure Templates Detected by HHsearch ?

No hit with probability above 80.00


Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 1007
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 2e-19
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 4e-17
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 1e-16
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 1e-15
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 2e-13
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 4e-13
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 2e-09
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 2e-08
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 1e-04
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 2e-16
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 4e-16
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 5e-16
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 7e-15
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 3e-11
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 5e-08
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 2e-13
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 6e-10
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 3e-09
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 3e-08
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 6e-07
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 1e-11
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 5e-11
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 1e-10
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 4e-10
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 4e-10
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 5e-10
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 7e-10
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 7e-07
d1xkua_ 305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 4e-06
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 5e-10
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 4e-09
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 9e-08
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 3e-05
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 9e-05
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 1e-04
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 6e-04
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 0.002
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 4e-09
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 8e-09
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 1e-08
d2astb2 284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 5e-05
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 1e-04
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 2e-04
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 6e-08
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 1e-06
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 3e-06
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 4e-06
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 8e-05
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 4e-04
d1p9ag_ 266 c.10.2.7 (G:) von Willebrand factor binding domain 0.001
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 0.002
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 2e-07
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 2e-04
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 2e-04
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 4e-04
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 8e-04
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 0.001
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 0.003
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 3e-07
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 3e-05
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 7e-05
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 1e-04
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 2e-04
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 2e-04
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 5e-04
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 0.003
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 0.004
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 4e-07
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 6e-06
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 8e-06
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 2e-05
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 3e-04
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 4e-04
d1a9na_162 c.10.2.4 (A:) Splicesomal U2A' protein {Human (Hom 8e-05
d1a9na_162 c.10.2.4 (A:) Splicesomal U2A' protein {Human (Hom 0.002
d1h6ta2210 c.10.2.1 (A:31-240) Internalin B {Listeria monocyt 1e-04
d2ca6a1344 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom 2e-04
d2ca6a1344 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom 2e-04
d2omxa2199 c.10.2.1 (A:37-235) Internalin B {Listeria monocyt 0.003
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Internalin LRR domain
domain: Internalin A
species: Listeria monocytogenes [TaxId: 1639]
 Score = 89.3 bits (220), Expect = 2e-19
 Identities = 72/382 (18%), Positives = 129/382 (33%), Gaps = 19/382 (4%)

Query: 333 NLENLANVDISSCNFTGPIPTSMANLTRLFHLDFSSNHFSGPIPSLGLSRNLSYLDLSSN 392
            L       +   N T  +  +  +L ++  L          I  +    NL+ ++ S+N
Sbjct: 20  ALAEKMKTVLGKTNVTDTVSQT--DLDQVTTLQADRLGIKS-IDGVEYLNNLTQINFSNN 76

Query: 393 DLTGRILFTPWEQLLNIKYVHLNYNSLSGSIPRSLFLLPTLEMLLLSTNQFENQLPEFSN 452
            LT         +L++I   +     ++     +     TL    ++       L   + 
Sbjct: 77  QLTDITPLKNLTKLVDILMNNNQIADITPLANLTNLTGLTLFNNQITDIDPLKNLTNLNR 136

Query: 453 ESSSVMNFLDLSGNRLEGPIPISIFFELRNLLTLDLSSNKFSRLKLASSKPRGTPNLNKQ 512
              S     D+S       +    F      L    +     RL ++S+K      L K 
Sbjct: 137 LELSSNTISDISALSGLTSLQQLSFGNQVTDLKPLANLTTLERLDISSNKVSDISVLAKL 196

Query: 513 SKLSSLDLSDNQISGEIPNWIWEFSANLVFLNLSHNLLESLQEPYFIAGVGLLDLHSNEL 572
           + L SL  ++NQIS   P  I     NL  L+L+ N L+ +     +  +  LDL +N++
Sbjct: 197 TNLESLIATNNQISDITPLGILT---NLDELSLNGNQLKDIGTLASLTNLTDLDLANNQI 253

Query: 573 QGSIPYMS-PNTSYMDYSNNNFTTIPADIGNFMSGTIFFSAANNSLTGVIPQSVCNATYF 631
               P       + +    N  + I          T   +   N         + N    
Sbjct: 254 SNLAPLSGLTKLTELKLGANQISNIS----PLAGLTALTNLELNENQLEDISPISNLKNL 309

Query: 632 SVLDLSNNSLSGTIPTCLITNSSRTLGVLNLRGNSLNGTLSDRVPGICGLQILDLNGNQL 691
           + L L  N++S   P   +T     L  L    N ++   S  +  +  +  L    NQ+
Sbjct: 310 TYLTLYFNNISDISPVSSLTK----LQRLFFANNKVSDVSS--LANLTNINWLSAGHNQI 363

Query: 692 EGMVPKSLANCKMLQVLDLGNN 713
             + P  LAN   +  L L + 
Sbjct: 364 SDLTP--LANLTRITQLGLNDQ 383


>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 210 Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344 Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344 Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 199 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query1007
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 100.0
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 100.0
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 100.0
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 100.0
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 100.0
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 100.0
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 100.0
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 100.0
d1p9ag_266 von Willebrand factor binding domain of glycoprote 100.0
d1p9ag_266 von Willebrand factor binding domain of glycoprote 100.0
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.97
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.97
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 99.96
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.95
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.95
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 99.94
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.94
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.93
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.93
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.93
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.92
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.92
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.91
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.91
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.89
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.88
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 99.83
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.79
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.74
d2ifga3156 High affinity nerve growth factor receptor, N-term 99.72
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.69
d2ifga3156 High affinity nerve growth factor receptor, N-term 99.65
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.64
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 98.86
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 98.62
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 98.22
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Polygalacturonase inhibiting protein PGIP
domain: Polygalacturonase inhibiting protein PGIP
species: Kidney bean (Phaseolus vulgaris) [TaxId: 3885]
Probab=100.00  E-value=0  Score=291.93  Aligned_cols=294  Identities=30%  Similarity=0.440  Sum_probs=163.4

Q ss_pred             CCCHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCC--CCCEECCCC---CCEEEEECCCCCCCCCCCCCCCCC
Q ss_conf             997887999999561199898976888878988899999942--010240999---987999599999533225888553
Q 001842           30 QCQSDQQSLLLQMKNSFILSKDSITSTKLSQWSSHHSSDCCD--WNGVDCDEA---GHVIGLDLSREPIIGGLENATGLF  104 (1007)
Q Consensus        30 ~~~~~~~~~ll~~k~~~~~~~~~~~~~~~~~w~~~~~~~~c~--w~gv~c~~~---~~v~~L~L~~~~l~~~~~~~~~l~  104 (1007)
                      -|.++||+||++||+++.+ |     ..+++|  ..++|||.  |.||+|+..   +||++|+|+++.+.|....+.+++
T Consensus         2 ~c~~~e~~aLl~~k~~~~~-~-----~~l~sW--~~~~d~C~~~w~gv~C~~~~~~~~v~~L~L~~~~l~g~~~lp~~l~   73 (313)
T d1ogqa_           2 LCNPQDKQALLQIKKDLGN-P-----TTLSSW--LPTTDCCNRTWLGVLCDTDTQTYRVNNLDLSGLNLPKPYPIPSSLA   73 (313)
T ss_dssp             CSCHHHHHHHHHHHHHTTC-C-----GGGTTC--CTTSCTTTTCSTTEEECCSSSCCCEEEEEEECCCCSSCEECCGGGG
T ss_pred             CCCHHHHHHHHHHHHHCCC-C-----CCCCCC--CCCCCCCCCCCCCEEEECCCCCEEEEEEECCCCCCCCCCCCCHHHH
T ss_conf             9898999999999997799-9-----867788--9999998894889697489994798899898998888887984784


Q ss_pred             CCCCCCEEECCC-CCCCCCCCCCCCCCCCCCCEEECCCCCCCCCCCCCCCCCCCCCEEECCCCCCCCCCCCCCCCHHHHH
Q ss_conf             688778332799-9999998780035999999885899999756871222889998995799999997532235267762
Q 001842          105 SLQYLRSLNLGF-TLFSGIQIPSRLANLTNLTYLNLSQSGFIQDIPIEISSLTRLVTLDLSAEPSGGFSFLEISNLSLFL  183 (1007)
Q Consensus       105 ~l~~L~~L~Ls~-n~~~~~~lp~~l~~l~~L~~L~Ls~n~~~~~lp~~l~~l~~L~~L~Ls~n~~~~~~~~~~~~~~~~l  183 (1007)
                      ++++|++|+|++ |.+.|. +|..++++++|++|++++|.+.+..+..+..+.+|++++++.|..       ...+    
T Consensus        74 ~L~~L~~L~Ls~~N~l~g~-iP~~i~~L~~L~~L~Ls~N~l~~~~~~~~~~~~~L~~l~l~~N~~-------~~~~----  141 (313)
T d1ogqa_          74 NLPYLNFLYIGGINNLVGP-IPPAIAKLTQLHYLYITHTNVSGAIPDFLSQIKTLVTLDFSYNAL-------SGTL----  141 (313)
T ss_dssp             GCTTCSEEEEEEETTEESC-CCGGGGGCTTCSEEEEEEECCEEECCGGGGGCTTCCEEECCSSEE-------ESCC----
T ss_pred             CCCCCCCCCCCCCCCCCCC-CCCCCCCCCCCCHHHHCCCCCCCCCCCCCCCHHHHCCCCCCCCCC-------CCCC----
T ss_conf             6753352020265433300-243114542001102035643443322222011100111122455-------5568----


Q ss_pred             CCCCCCCEEECCCCCCCCCCCHHHHHHCCCCCCCEEECCCCCCCCCCHHHHCCCCCC-CEEECCCCCCCCCCCHHHHCCC
Q ss_conf             047777546558723667661266750899998699723767999650210189999-9897899989998820432099
Q 001842          184 QNLTELRELHLDNVDLFASGTDWCKALSFLPNLQVLSLSRCELSGPINQYLANLRSL-SAIRLPNNYGLSSPVPEFLANF  262 (1007)
Q Consensus       184 ~~l~~L~~L~L~~~~~~~~~~~~~~~l~~l~~L~~L~L~~~~l~~~~~~~l~~l~~L-~~L~L~~n~~~~~~~~~~l~~l  262 (1007)
                                             +..+..++.++.+++++|.+.+.+|..+..+..+ +.++++.| .+.+..+..+..+
T Consensus       142 -----------------------p~~l~~l~~L~~l~l~~n~l~~~ip~~~~~l~~l~~~l~~~~n-~l~~~~~~~~~~l  197 (313)
T d1ogqa_         142 -----------------------PPSISSLPNLVGITFDGNRISGAIPDSYGSFSKLFTSMTISRN-RLTGKIPPTFANL  197 (313)
T ss_dssp             -----------------------CGGGGGCTTCCEEECCSSCCEEECCGGGGCCCTTCCEEECCSS-EEEEECCGGGGGC
T ss_pred             -----------------------CHHHCCCCCCCEEECCCCCCCCCCCCCCCCCCCCCCCCCCCCC-CCCCCCCCCCCCC
T ss_conf             -----------------------5122067400000023553356203121443112323102246-4353324332222


Q ss_pred             CCCCEEECCCCCCCCCCCHHCCCCCCCCEEECCCCCCCCCCCCCCCCCCCCCEEEECCCCCCCCCCCCCCCCCCCCEEEC
Q ss_conf             99879954698587665521049999899918999999888999999998869990177785454301128999989973
Q 001842          263 SHLTALDLGDCQLQGKFPEKILQVPTLETLDLSDNPSLQGSLPHFPKNSSLRNLILFGTGFSGTLPNSIGNLENLANVDI  342 (1007)
Q Consensus       263 ~~L~~L~L~~n~l~~~~~~~l~~l~~L~~L~Ls~n~~~~~~~~~~~~l~~L~~L~L~~n~~~~~~p~~l~~l~~L~~L~L  342 (1007)
                      ..+ .+++..+...+..|..+..+++++.++++++. ..+.++.+..+++|+.|++++|++++.+|..++++++|++|++
T Consensus       198 ~~~-~l~l~~~~~~~~~~~~~~~~~~l~~l~~~~~~-l~~~~~~~~~~~~L~~L~Ls~N~l~g~iP~~l~~L~~L~~L~L  275 (313)
T d1ogqa_         198 NLA-FVDLSRNMLEGDASVLFGSDKNTQKIHLAKNS-LAFDLGKVGLSKNLNGLDLRNNRIYGTLPQGLTQLKFLHSLNV  275 (313)
T ss_dssp             CCS-EEECCSSEEEECCGGGCCTTSCCSEEECCSSE-ECCBGGGCCCCTTCCEEECCSSCCEECCCGGGGGCTTCCEEEC
T ss_pred             CCC-CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC-CCCCCCCCCCCCCCCCCCCCCCEECCCCCHHHHCCCCCCEEEC
T ss_conf             222-33333343322222222222221112222222-2222222224554444447657066608768847999998979


Q ss_pred             CCCCCCCCCCCCCCCCCCCCEEEECCCC
Q ss_conf             4875878883001287887687701475
Q 001842          343 SSCNFTGPIPTSMANLTRLFHLDFSSNH  370 (1007)
Q Consensus       343 s~n~l~~~~~~~l~~l~~L~~L~L~~n~  370 (1007)
                      ++|+++|.+|. ++++++|+.+++.+|+
T Consensus       276 s~N~l~g~iP~-~~~L~~L~~l~l~~N~  302 (313)
T d1ogqa_         276 SFNNLCGEIPQ-GGNLQRFDVSAYANNK  302 (313)
T ss_dssp             CSSEEEEECCC-STTGGGSCGGGTCSSS
T ss_pred             CCCCCCCCCCC-CCCCCCCCHHHHCCCC
T ss_conf             58835166898-6667998978868895



>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure