Citrus Sinensis ID: 001849
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 1005 | ||||||
| 284026888 | 1424 | CC-NBS-LRR protein [Quercus suber] | 0.902 | 0.636 | 0.414 | 1e-174 | |
| 400131587 | 1388 | FB_MR5 [Malus x robusta] | 0.868 | 0.628 | 0.411 | 1e-161 | |
| 225449649 | 1418 | PREDICTED: putative disease resistance p | 0.888 | 0.629 | 0.395 | 1e-156 | |
| 356554923 | 1399 | PREDICTED: putative disease resistance R | 0.874 | 0.628 | 0.384 | 1e-148 | |
| 224059584 | 1418 | cc-nbs-lrr resistance protein [Populus t | 0.901 | 0.638 | 0.388 | 1e-143 | |
| 225450023 | 1396 | PREDICTED: putative disease resistance p | 0.861 | 0.620 | 0.369 | 1e-142 | |
| 147766392 | 1471 | hypothetical protein VITISV_007674 [Viti | 0.870 | 0.594 | 0.367 | 1e-141 | |
| 225450003 | 1452 | PREDICTED: putative disease resistance R | 0.898 | 0.621 | 0.378 | 1e-139 | |
| 359487416 | 1472 | PREDICTED: putative disease resistance p | 0.870 | 0.594 | 0.363 | 1e-138 | |
| 359487225 | 1373 | PREDICTED: putative disease resistance R | 0.856 | 0.627 | 0.375 | 1e-138 |
| >gi|284026888|gb|ADB66335.1| CC-NBS-LRR protein [Quercus suber] | Back alignment and taxonomy information |
|---|
Score = 617 bits (1592), Expect = e-174, Method: Compositional matrix adjust.
Identities = 400/965 (41%), Positives = 564/965 (58%), Gaps = 58/965 (6%)
Query: 1 MHDLVSDLAQWAAGEMYFTMEYTSEVNKQQRFSRYLRHLSYIRGDYDGVQRFGDLYDIQH 60
MHDL++DLAQW AG YF +E + N+Q + S RHLS++ YDG ++F + + +H
Sbjct: 491 MHDLITDLAQWVAGISYFRLETKLKGNEQSKVSSKARHLSFVGSRYDGAKKFEAISEFKH 550
Query: 61 LRTFLPVILSNSKPGYLAPSMLPKLL-KLQSLRVFSLRGYRILELPDSVGDLRYLRYLNL 119
LRTFLP++ YL+ ++ +LL KLQ+LRV SL GYRI+ LP ++GDL++LRYL+L
Sbjct: 551 LRTFLPLMAPYVGYSYLSYHIINQLLPKLQNLRVLSLSGYRIVYLPQTIGDLKHLRYLDL 610
Query: 120 SGTEIRTLPESVSKLYNLHSLLLEDCDRLEKLCADMGNLVKLHHLKNSNTKSLEEMPVGI 179
S T++R+LP S+S LYNL +LLLE+C L+ L D G L L HL + LE MP+ I
Sbjct: 611 SCTQLRSLPTSISTLYNLQTLLLENCTSLKFLPPDFGKLFNLRHLNIFGSNLLEGMPLSI 670
Query: 180 GRLTCLQTLCSFVVGK-DSGSGLRELKLLTQLRGTLCISNLENVKHIVDAEDAQLDRKEN 238
G L+ LQTL +FVVGK DS +REL L LRGTLCIS LENV +A D+ L K++
Sbjct: 671 GNLSSLQTLSNFVVGKADSFCVIRELGPLVHLRGTLCISKLENVTKAQEARDSYLYGKQD 730
Query: 239 LKELWLRWTLYGSYSREAETEMGVLDMLKPHTNLEQFCIKGYGGMKFPTWLGDSSFSKLV 298
L E+ + W+ + S++ ET++ VL+ML+P+ L++ +K YGG KFPTW+GD SFS LV
Sbjct: 731 LNEVVMEWSSNLNESQDEETQLEVLNMLQPNVKLKELTVKCYGGTKFPTWIGDPSFSNLV 790
Query: 299 TLKFKNCDMCTALPSVGQLPSLKHLTVRGMSKVKRLGSEFYGDDSPIPFPRLETLRFEDL 358
L+F+NCD C +LP VGQLP LK L ++GM+ VK +G EFYG+ PF LETL FED+
Sbjct: 791 LLRFENCDNCNSLPPVGQLPFLKDLLIKGMAGVKSVGREFYGESCSRPFQSLETLHFEDM 850
Query: 359 QEWEDSIPHGSSQGVERFPKLRELRILRCSKLKGTFPEHLPALEMLVIEGCEELLVSVSS 418
W + IP G + E F L +L I+RC L P+HLP+L+ LVI GC ++VSVS+
Sbjct: 851 PRWVNWIPLGVN---EAFACLHKLSIIRCHNLVRKLPDHLPSLKKLVIHGCWNMVVSVSN 907
Query: 419 LPALCKFIISGCKKVVWESATGHLGSQNSVVCRDTSNQVFLAGPLKPQLPKLEEL-ILST 477
LP LC +I GCK+V ES+ G GS S+ S L + K+E L I+ +
Sbjct: 908 LPMLCVLVIEGCKRVECESSVG-FGSPYSMAFSKISEFGNATAGLMHGVSKVEYLKIVDS 966
Query: 478 KEQTYIWKSHDGLLQDVCSLKSLEIRSCPKLQSLVAEEEKDQQQQLYELLEYLRLSYCEG 537
++ T +W+ L + L+ L I CP L S A +L+ +++ C G
Sbjct: 967 EKLTTLWEKIPEGLHRLKFLRELSIEDCPTLVSFPA-------SGFPSMLKVIQIKSCSG 1019
Query: 538 LVK-LPQSSLSL---SSLREIEIYGCRSLVSFPEVALPSKLKKIEISSCDALKSLPEAWM 593
L LP+ +L + L + + C S+ S LP+ LKK+EIS C L+ + +
Sbjct: 1020 LKSLLPEGTLHSRENACLERLCVVRCDSMKSIARGQLPTTLKKLEISHCMNLQCVLDEGE 1079
Query: 594 CDTNSSLEILEISGCDSLTYIAGVQLPPSLKRLKICHCDNIRTLTVEEGIQCSSGRRYTS 653
++SS E S T+ L+ L I C ++ TLT SSG+
Sbjct: 1080 GSSSSSGMHDEDINNRSKTH---------LQYLDIKSCPSLTTLT-------SSGK--LP 1121
Query: 654 SLLEHLEIYSCPSLTCIFSKNELPATLESLEVGNLPPSLKLLLVWGCSKLESIAEMLDNN 713
+ L HL + CP L C+ S +LPA L+ LE+ ++ SKL+ IAE L N
Sbjct: 1122 ATLTHLLLRECPKLMCLSSTGKLPAALQYLEIQSI------------SKLQKIAERLHQN 1169
Query: 714 TSLEKINISGCGNLQTLPSGLHNLCQLQEISIASCGNLVSSPEGGLPCAKLAMLAIYNCK 773
TSLE I I C L++LP LHNL +L++ I C + S P GLP + L +L I NCK
Sbjct: 1170 TSLECIKIWNCHGLKSLPEDLHNLSKLRQFLIFWCQSFSSFPAAGLP-SNLRVLGIKNCK 1228
Query: 774 RLEALPKGLHNLKSLQELRIGKGV-ALPSLEEDGLPTNLHVLLINGNMEIWKSMIERGRG 832
L+ALP G+ NL SLQ+L I + +LPS +E GLPTNL + L +++ +K M E G
Sbjct: 1229 NLKALPNGMRNLTSLQKLDISHRLDSLPSPQE-GLPTNL-IELNMHDLKFYKPMFE--WG 1284
Query: 833 FHRFSSLRQLTIMNCDDDMVSFPPKADDKGSGTVLPLPASLTYLRIEGFPNLERLT-SSI 891
+ +SL +L+I D+ S+P ++ +G ++ LP SL+ L I F NLE L+
Sbjct: 1285 LQQPTSLIKLSIHGECLDVDSYP---GERENGVMMLLPNSLSILCISYFQNLECLSPKGF 1341
Query: 892 VDLQNLTGLVLGNCPKLKYFPEKGLPSSLLQLSINRCPLIEEKCRKDGGQYWDLLTHIPR 951
+L +L L + NC KL P++GLP SL QL I CPL+ + C + GQ W + HIP
Sbjct: 1342 QNLTSLNQLKIYNCLKLTSLPKEGLPPSLTQLEIRNCPLLSQHCNNEKGQEWSKIAHIPC 1401
Query: 952 VEISD 956
V I +
Sbjct: 1402 VLIDN 1406
|
Source: Quercus suber Species: Quercus suber Genus: Quercus Family: Fagaceae Order: Fagales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|400131587|emb|CCH50986.1| FB_MR5 [Malus x robusta] | Back alignment and taxonomy information |
|---|
| >gi|225449649|ref|XP_002262753.1| PREDICTED: putative disease resistance protein At3g14460 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|356554923|ref|XP_003545790.1| PREDICTED: putative disease resistance RPP13-like protein 1-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|224059584|ref|XP_002299919.1| cc-nbs-lrr resistance protein [Populus trichocarpa] gi|222847177|gb|EEE84724.1| cc-nbs-lrr resistance protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|225450023|ref|XP_002272823.1| PREDICTED: putative disease resistance protein At3g14460-like [Vitis vinifera] gi|451798994|gb|AGF69195.1| disease resistance protein At3g14460-like protein 2 [Vitis labrusca] | Back alignment and taxonomy information |
|---|
| >gi|147766392|emb|CAN67818.1| hypothetical protein VITISV_007674 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|225450003|ref|XP_002272221.1| PREDICTED: putative disease resistance RPP13-like protein 1 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|359487416|ref|XP_002272889.2| PREDICTED: putative disease resistance protein At3g14460 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|359487225|ref|XP_002268551.2| PREDICTED: putative disease resistance RPP13-like protein 1-like [Vitis vinifera] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 1005 | ||||||
| TAIR|locus:2091662 | 1424 | AT3G14460 [Arabidopsis thalian | 0.405 | 0.286 | 0.401 | 3.2e-89 | |
| TAIR|locus:2091672 | 1054 | AT3G14470 [Arabidopsis thalian | 0.4 | 0.381 | 0.402 | 2.5e-77 | |
| UNIPROTKB|O48647 | 1802 | O48647 "XA1" [Oryza sativa (ta | 0.600 | 0.335 | 0.244 | 2.1e-23 | |
| TAIR|locus:2163426 | 1187 | TAO1 "target of AVRB operation | 0.301 | 0.255 | 0.257 | 1.2e-15 | |
| TAIR|locus:2094498 | 1981 | AT3G25510 [Arabidopsis thalian | 0.342 | 0.173 | 0.262 | 3.4e-13 | |
| TAIR|locus:2053405 | 1215 | AT2G14080 [Arabidopsis thalian | 0.357 | 0.295 | 0.248 | 3.1e-14 | |
| TAIR|locus:2147992 | 1189 | AT5G11250 [Arabidopsis thalian | 0.290 | 0.245 | 0.272 | 1.7e-13 | |
| TAIR|locus:2129236 | 1301 | SNC1 "SUPPRESSOR OF NPR1-1, CO | 0.369 | 0.285 | 0.239 | 3.2e-08 | |
| TAIR|locus:2117617 | 549 | PIRL4 "plant intracellular ras | 0.102 | 0.187 | 0.377 | 4e-12 | |
| TAIR|locus:2205804 | 1556 | AT1G27180 [Arabidopsis thalian | 0.384 | 0.248 | 0.238 | 7.5e-08 |
| TAIR|locus:2091662 AT3G14460 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 688 (247.2 bits), Expect = 3.2e-89, Sum P(2) = 3.2e-89
Identities = 171/426 (40%), Positives = 244/426 (57%)
Query: 1 MHDLVSDLAQWAAGEMYFTMEYTSEVNKQQRFSRYLRHLSYIRGDYDGVQRFGDLYDIQH 60
MHDL++DLA+ +G+ F +E + N + S RH S+ R D F + +
Sbjct: 487 MHDLMNDLAKAVSGDFCFRLE---DDNIPEIPST-TRHFSFSRSQCDASVAFRSICGAEF 542
Query: 61 LRTFLPVILSNSKPGY-LAPSMLPKLLK-LQSLRVFSLRGYRILELPDSVGDLRYLRYLN 118
LRT LP S L +L LL L LR+ SL Y+I LP S+ L+ LRYL+
Sbjct: 543 LRTILPFNSPTSLESLQLTEKVLNPLLNALSGLRILSLSHYQITNLPKSLKGLKLLRYLD 602
Query: 119 LSGTEIRTLPESVSKLYNLHSLLLEDCDRLEKLCADMGNLVKLHHLKNSNTKSLEEMPVG 178
LS T+I+ LPE V L NL +LLL +C L L + L+ L L T L EMP G
Sbjct: 603 LSSTKIKELPEFVCTLCNLQTLLLSNCRDLTSLPKSIAELINLRLLDLVGTP-LVEMPPG 661
Query: 179 IGRLTCLQTLCSFVVGKDSGSGLRELKLLTQLRGTLCISNLENVKHIVDAEDAQLDRKEN 238
I +L LQ L +FV+G+ SG+GL ELK L+ LRGTL IS L+NV +A+DA L RK
Sbjct: 662 IKKLRSLQKLSNFVIGRLSGAGLHELKELSHLRGTLRISELQNVAFASEAKDAGLKRKPF 721
Query: 239 LKELWLRWTLYGS------YSREAETEMGVLDMLKPHTNLEQFCIKGYGGMKFPTWLGDS 292
L L L+WT+ GS ++ A + VL ML+PH +L+ FCI+ Y G FP WLGDS
Sbjct: 722 LDGLILKWTVKGSGFVPGSFNALACDQKEVLRMLEPHPHLKTFCIESYQGGAFPKWLGDS 781
Query: 293 SFSKLVTLKFKNCDMCTALPSVGQLPSLKHLTVRGMSKVKRLGSEFY-GDDSP--IPFPR 349
SF + ++ +C++C +LP VGQLPSLK+L++ + ++++G +F+ G+++ +PF
Sbjct: 782 SFFGITSVTLSSCNLCISLPPVGQLPSLKYLSIEKFNILQKVGLDFFFGENNSRGVPFQS 841
Query: 350 LETLRFEDLQEWEDSIPHGSSQGVERFPKLRELRILRCSKLKGTFPEHLPALEMLVIEGC 409
L+ L+F + W++ I G+ FP L++L I RC L+ FPE LP+ + I C
Sbjct: 842 LQILKFYGMPRWDEWICPELEDGI--FPCLQKLIIQRCPSLRKKFPEGLPSSTEVTISDC 899
Query: 410 EELLVS 415
VS
Sbjct: 900 PLRAVS 905
|
|
| TAIR|locus:2091672 AT3G14470 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|O48647 O48647 "XA1" [Oryza sativa (taxid:4530)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2163426 TAO1 "target of AVRB operation1" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2094498 AT3G25510 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2053405 AT2G14080 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2147992 AT5G11250 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2129236 SNC1 "SUPPRESSOR OF NPR1-1, CONSTITUTIVE 1" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2117617 PIRL4 "plant intracellular ras group-related LRR 4" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2205804 AT1G27180 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
| GSVIVG00010803001 | SubName- Full=Chromosome chr13 scaffold_286, whole genome shotgun sequence; (1418 aa) | |||||||
(Vitis vinifera) | ||||||||
| Sorry, there are no predicted associations at the current settings. |
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 1005 | |||
| PLN03210 | 1153 | PLN03210, PLN03210, Resistant to P | 1e-13 | |
| PLN03210 | 1153 | PLN03210, PLN03210, Resistant to P | 2e-09 | |
| PLN03210 | 1153 | PLN03210, PLN03210, Resistant to P | 5e-09 | |
| PLN03210 | 1153 | PLN03210, PLN03210, Resistant to P | 5e-06 | |
| PRK15386 | 426 | PRK15386, PRK15386, type III secretion protein Gog | 5e-05 | |
| COG4886 | 394 | COG4886, COG4886, Leucine-rich repeat (LRR) protei | 2e-04 | |
| COG4886 | 394 | COG4886, COG4886, Leucine-rich repeat (LRR) protei | 8e-04 | |
| pfam13855 | 60 | pfam13855, LRR_8, Leucine rich repeat | 0.002 |
| >gnl|CDD|215633 PLN03210, PLN03210, Resistant to P | Back alignment and domain information |
|---|
Score = 75.3 bits (185), Expect = 1e-13
Identities = 71/245 (28%), Positives = 120/245 (48%), Gaps = 36/245 (14%)
Query: 536 EGLVKL--PQSSL--------SLSSLREIEIYGCRSLVSFPEVALPSKLKKIEISSCDAL 585
E LVKL S L SL+ LR I++ G ++L P++++ + L+ +++S C +L
Sbjct: 611 ENLVKLQMQGSKLEKLWDGVHSLTGLRNIDLRGSKNLKEIPDLSMATNLETLKLSDCSSL 670
Query: 586 KSLPEAWMCDTNSSLEILEISGCDSLTYI-AGVQLPPSLKRLKICHCD----------NI 634
LP + + LE L++S C++L + G+ L SL RL + C NI
Sbjct: 671 VELPSS--IQYLNKLEDLDMSRCENLEILPTGINL-KSLYRLNLSGCSRLKSFPDISTNI 727
Query: 635 RTLTVEEGIQCSSGRRYTSSL-LEHL-EIYSCPSLTCIFSKNELPAT-LESLEVGNLPPS 691
L ++E ++ + S+L LE+L E+ C + + P T L ++ L PS
Sbjct: 728 SWLDLDE----TAIEEFPSNLRLENLDELILCEMKSEKLWERVQPLTPLMTM----LSPS 779
Query: 692 LKLLLVWGCSKLESIAEMLDNNTSLEKINISGCGNLQTLPSGLHNLCQLQEISIASCGNL 751
L L + L + + N LE + I C NL+TLP+G+ NL L+ + ++ C L
Sbjct: 780 LTRLFLSDIPSLVELPSSIQNLHKLEHLEIENCINLETLPTGI-NLESLESLDLSGCSRL 838
Query: 752 VSSPE 756
+ P+
Sbjct: 839 RTFPD 843
|
syringae 6; Provisional. Length = 1153 |
| >gnl|CDD|215633 PLN03210, PLN03210, Resistant to P | Back alignment and domain information |
|---|
| >gnl|CDD|215633 PLN03210, PLN03210, Resistant to P | Back alignment and domain information |
|---|
| >gnl|CDD|215633 PLN03210, PLN03210, Resistant to P | Back alignment and domain information |
|---|
| >gnl|CDD|237954 PRK15386, PRK15386, type III secretion protein GogB; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] | Back alignment and domain information |
|---|
| >gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] | Back alignment and domain information |
|---|
| >gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 1005 | |||
| PLN00113 | 968 | leucine-rich repeat receptor-like protein kinase; | 100.0 | |
| PLN00113 | 968 | leucine-rich repeat receptor-like protein kinase; | 100.0 | |
| PLN03210 | 1153 | Resistant to P. syringae 6; Provisional | 99.94 | |
| KOG0472 | 565 | consensus Leucine-rich repeat protein [Function un | 99.94 | |
| PLN03210 | 1153 | Resistant to P. syringae 6; Provisional | 99.94 | |
| KOG0618 | 1081 | consensus Serine/threonine phosphatase 2C containi | 99.94 | |
| KOG0472 | 565 | consensus Leucine-rich repeat protein [Function un | 99.93 | |
| KOG4194 | 873 | consensus Membrane glycoprotein LIG-1 [Signal tran | 99.92 | |
| KOG4194 | 873 | consensus Membrane glycoprotein LIG-1 [Signal tran | 99.92 | |
| KOG0618 | 1081 | consensus Serine/threonine phosphatase 2C containi | 99.91 | |
| KOG0444 | 1255 | consensus Cytoskeletal regulator Flightless-I (con | 99.88 | |
| KOG0444 | 1255 | consensus Cytoskeletal regulator Flightless-I (con | 99.87 | |
| KOG4658 | 889 | consensus Apoptotic ATPase [Signal transduction me | 99.87 | |
| PRK15387 | 788 | E3 ubiquitin-protein ligase SspH2; Provisional | 99.63 | |
| KOG4237 | 498 | consensus Extracellular matrix protein slit, conta | 99.61 | |
| KOG4237 | 498 | consensus Extracellular matrix protein slit, conta | 99.61 | |
| PRK15387 | 788 | E3 ubiquitin-protein ligase SspH2; Provisional | 99.6 | |
| KOG0617 | 264 | consensus Ras suppressor protein (contains leucine | 99.51 | |
| PRK15370 | 754 | E3 ubiquitin-protein ligase SlrP; Provisional | 99.47 | |
| KOG4658 | 889 | consensus Apoptotic ATPase [Signal transduction me | 99.45 | |
| KOG0617 | 264 | consensus Ras suppressor protein (contains leucine | 99.45 | |
| PRK15370 | 754 | E3 ubiquitin-protein ligase SlrP; Provisional | 99.44 | |
| cd00116 | 319 | LRR_RI Leucine-rich repeats (LRRs), ribonuclease i | 99.14 | |
| cd00116 | 319 | LRR_RI Leucine-rich repeats (LRRs), ribonuclease i | 99.12 | |
| PF14580 | 175 | LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ | 98.98 | |
| KOG4341 | 483 | consensus F-box protein containing LRR [General fu | 98.89 | |
| KOG4341 | 483 | consensus F-box protein containing LRR [General fu | 98.86 | |
| KOG0532 | 722 | consensus Leucine-rich repeat (LRR) protein, conta | 98.77 | |
| PF14580 | 175 | LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ | 98.75 | |
| COG4886 | 394 | Leucine-rich repeat (LRR) protein [Function unknow | 98.74 | |
| KOG3207 | 505 | consensus Beta-tubulin folding cofactor E [Posttra | 98.73 | |
| KOG0532 | 722 | consensus Leucine-rich repeat (LRR) protein, conta | 98.64 | |
| COG4886 | 394 | Leucine-rich repeat (LRR) protein [Function unknow | 98.59 | |
| KOG3207 | 505 | consensus Beta-tubulin folding cofactor E [Posttra | 98.56 | |
| PF13855 | 61 | LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF | 98.54 | |
| PRK15386 | 426 | type III secretion protein GogB; Provisional | 98.53 | |
| PLN03150 | 623 | hypothetical protein; Provisional | 98.52 | |
| KOG1259 | 490 | consensus Nischarin, modulator of integrin alpha5 | 98.48 | |
| PF13855 | 61 | LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF | 98.44 | |
| PLN03150 | 623 | hypothetical protein; Provisional | 98.4 | |
| KOG1259 | 490 | consensus Nischarin, modulator of integrin alpha5 | 98.38 | |
| PRK15386 | 426 | type III secretion protein GogB; Provisional | 98.34 | |
| PF12799 | 44 | LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ | 98.25 | |
| KOG2120 | 419 | consensus SCF ubiquitin ligase, Skp2 component [Po | 98.21 | |
| KOG0531 | 414 | consensus Protein phosphatase 1, regulatory subuni | 98.13 | |
| KOG2120 | 419 | consensus SCF ubiquitin ligase, Skp2 component [Po | 98.12 | |
| PF12799 | 44 | LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ | 97.94 | |
| KOG1909 | 382 | consensus Ran GTPase-activating protein [RNA proce | 97.93 | |
| KOG4579 | 177 | consensus Leucine-rich repeat (LRR) protein associ | 97.79 | |
| KOG1859 | 1096 | consensus Leucine-rich repeat proteins [General fu | 97.76 | |
| KOG1909 | 382 | consensus Ran GTPase-activating protein [RNA proce | 97.75 | |
| KOG0531 | 414 | consensus Protein phosphatase 1, regulatory subuni | 97.74 | |
| KOG2982 | 418 | consensus Uncharacterized conserved protein [Funct | 97.54 | |
| KOG4579 | 177 | consensus Leucine-rich repeat (LRR) protein associ | 97.51 | |
| KOG3665 | 699 | consensus ZYG-1-like serine/threonine protein kina | 97.48 | |
| KOG2982 | 418 | consensus Uncharacterized conserved protein [Funct | 97.46 | |
| KOG1859 | 1096 | consensus Leucine-rich repeat proteins [General fu | 97.42 | |
| KOG1947 | 482 | consensus Leucine rich repeat proteins, some prote | 97.3 | |
| KOG1644 | 233 | consensus U2-associated snRNP A' protein [RNA proc | 97.29 | |
| KOG1947 | 482 | consensus Leucine rich repeat proteins, some prote | 97.26 | |
| KOG3665 | 699 | consensus ZYG-1-like serine/threonine protein kina | 97.25 | |
| COG5238 | 388 | RNA1 Ran GTPase-activating protein (RanGAP) involv | 96.9 | |
| PF00560 | 22 | LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le | 96.49 | |
| KOG1644 | 233 | consensus U2-associated snRNP A' protein [RNA proc | 96.43 | |
| KOG2123 | 388 | consensus Uncharacterized conserved protein [Funct | 96.37 | |
| KOG2739 | 260 | consensus Leucine-rich acidic nuclear protein [Cel | 96.28 | |
| KOG2123 | 388 | consensus Uncharacterized conserved protein [Funct | 96.05 | |
| COG5238 | 388 | RNA1 Ran GTPase-activating protein (RanGAP) involv | 95.99 | |
| PF00560 | 22 | LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le | 95.91 | |
| KOG2739 | 260 | consensus Leucine-rich acidic nuclear protein [Cel | 95.59 | |
| PF13306 | 129 | LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ | 95.31 | |
| PF13504 | 17 | LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO | 94.82 | |
| KOG0473 | 326 | consensus Leucine-rich repeat protein [Function un | 94.61 | |
| KOG0473 | 326 | consensus Leucine-rich repeat protein [Function un | 94.6 | |
| PF13504 | 17 | LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO | 93.9 | |
| PF13306 | 129 | LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ | 93.58 | |
| smart00369 | 26 | LRR_TYP Leucine-rich repeats, typical (most popula | 92.07 | |
| smart00370 | 26 | LRR Leucine-rich repeats, outliers. | 92.07 | |
| KOG3864 | 221 | consensus Uncharacterized conserved protein [Funct | 91.98 | |
| KOG3864 | 221 | consensus Uncharacterized conserved protein [Funct | 91.94 | |
| smart00370 | 26 | LRR Leucine-rich repeats, outliers. | 87.2 | |
| smart00369 | 26 | LRR_TYP Leucine-rich repeats, typical (most popula | 87.2 |
| >PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional | Back alignment and domain information |
|---|
Probab=100.00 E-value=3e-41 Score=423.98 Aligned_cols=227 Identities=14% Similarity=0.090 Sum_probs=159.4
Q ss_pred ccccEEeeccccCccccCcccCCCCCccEEEEcCCCCccccCC-CCCCCCCcEEEEccCCCCCCCchhhccCCCCCccEE
Q 001849 525 ELLEYLRLSYCEGLVKLPQSSLSLSSLREIEIYGCRSLVSFPE-VALPSKLKKIEISSCDALKSLPEAWMCDTNSSLEIL 603 (1005)
Q Consensus 525 ~~L~~L~ls~~~~l~~~~~~~~~l~~L~~L~l~~~~~l~~~~~-~~~~~~L~~L~l~~~~~~~~~~~~~~~~~~~~L~~L 603 (1005)
++|+.|++++|...+.+|..+..+++|+.|++++|.....+|. +..+++|+.|++++|.....++..+ ..+++|+.|
T Consensus 380 ~~L~~L~l~~n~l~~~~p~~~~~~~~L~~L~L~~n~l~~~~p~~~~~l~~L~~L~Ls~N~l~~~~~~~~--~~l~~L~~L 457 (968)
T PLN00113 380 GNLFKLILFSNSLEGEIPKSLGACRSLRRVRLQDNSFSGELPSEFTKLPLVYFLDISNNNLQGRINSRK--WDMPSLQML 457 (968)
T ss_pred CCCCEEECcCCEecccCCHHHhCCCCCCEEECcCCEeeeECChhHhcCCCCCEEECcCCcccCccChhh--ccCCCCcEE
Confidence 6788888888888788888888999999999999876655553 4567889999999987666666544 567888999
Q ss_pred EEeCCCCCCcccCCCCCCCcceEeeeecCCCccccccccccccCCCCCCCCCcceEEEccCCCCcccccCCCcchhhccc
Q 001849 604 EISGCDSLTYIAGVQLPPSLKRLKICHCDNIRTLTVEEGIQCSSGRRYTSSLLEHLEIYSCPSLTCIFSKNELPATLESL 683 (1005)
Q Consensus 604 ~l~~~~~l~~~~~~~~~~~L~~L~l~~~~~l~~l~~~~~~~~~~~~~~~~~~L~~L~l~~c~~l~~~~~~~~~~~~l~~~ 683 (1005)
++++|.....++.....++|+.|++++|...+.+|..
T Consensus 458 ~L~~n~~~~~~p~~~~~~~L~~L~ls~n~l~~~~~~~------------------------------------------- 494 (968)
T PLN00113 458 SLARNKFFGGLPDSFGSKRLENLDLSRNQFSGAVPRK------------------------------------------- 494 (968)
T ss_pred ECcCceeeeecCcccccccceEEECcCCccCCccChh-------------------------------------------
Confidence 9988876655555444456666666666433322210
Q ss_pred ccCCCCCCccEEEEcCCCChhhHHHhccCCCCCceEEecCCCCcccccccccCCCCccEEEeccCCCcccCCCCCCCccc
Q 001849 684 EVGNLPPSLKLLLVWGCSKLESIAEMLDNNTSLEKINISGCGNLQTLPSGLHNLCQLQEISIASCGNLVSSPEGGLPCAK 763 (1005)
Q Consensus 684 ~~~~l~~~L~~L~l~~~~~~~~~~~~~~~l~~L~~L~L~~n~~~~~~~~~l~~l~~L~~L~l~~~~~l~~~~~~~~~~~~ 763 (1005)
+.. .++|++|++++|...+.+|..+.++++|++|++++|.+.+.+|..+.++++|++|++++|+..+.+|..+..+++
T Consensus 495 -~~~-l~~L~~L~Ls~N~l~~~~p~~~~~l~~L~~L~Ls~N~l~~~~p~~~~~l~~L~~L~Ls~N~l~~~~p~~l~~l~~ 572 (968)
T PLN00113 495 -LGS-LSELMQLKLSENKLSGEIPDELSSCKKLVSLDLSHNQLSGQIPASFSEMPVLSQLDLSQNQLSGEIPKNLGNVES 572 (968)
T ss_pred -hhh-hhccCEEECcCCcceeeCChHHcCccCCCEEECCCCcccccCChhHhCcccCCEEECCCCcccccCChhHhcCcc
Confidence 011 146777777777777777777777777888888877777777777777777888888877766677777767777
Q ss_pred ccccccccccccccCccccCCCcccceeecccCCCC
Q 001849 764 LAMLAIYNCKRLEALPKGLHNLKSLQELRIGKGVAL 799 (1005)
Q Consensus 764 L~~L~l~~~~~l~~~p~~~~~l~~L~~L~l~~~~~l 799 (1005)
|+.|++++|+..+.+|.. +.+..+....+.+|+.+
T Consensus 573 L~~l~ls~N~l~~~~p~~-~~~~~~~~~~~~~n~~l 607 (968)
T PLN00113 573 LVQVNISHNHLHGSLPST-GAFLAINASAVAGNIDL 607 (968)
T ss_pred cCEEeccCCcceeeCCCc-chhcccChhhhcCCccc
Confidence 777788877777777653 22233334444454433
|
|
| >PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional | Back alignment and domain information |
|---|
| >PLN03210 Resistant to P | Back alignment and domain information |
|---|
| >KOG0472 consensus Leucine-rich repeat protein [Function unknown] | Back alignment and domain information |
|---|
| >PLN03210 Resistant to P | Back alignment and domain information |
|---|
| >KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0472 consensus Leucine-rich repeat protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional | Back alignment and domain information |
|---|
| >KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional | Back alignment and domain information |
|---|
| >KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional | Back alignment and domain information |
|---|
| >KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional | Back alignment and domain information |
|---|
| >cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily | Back alignment and domain information |
|---|
| >cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily | Back alignment and domain information |
|---|
| >PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A | Back alignment and domain information |
|---|
| >KOG4341 consensus F-box protein containing LRR [General function prediction only] | Back alignment and domain information |
|---|
| >KOG4341 consensus F-box protein containing LRR [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] | Back alignment and domain information |
|---|
| >PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A | Back alignment and domain information |
|---|
| >COG4886 Leucine-rich repeat (LRR) protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] | Back alignment and domain information |
|---|
| >COG4886 Leucine-rich repeat (LRR) protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A | Back alignment and domain information |
|---|
| >PRK15386 type III secretion protein GogB; Provisional | Back alignment and domain information |
|---|
| >PLN03150 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] | Back alignment and domain information |
|---|
| >PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A | Back alignment and domain information |
|---|
| >PLN03150 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] | Back alignment and domain information |
|---|
| >PRK15386 type III secretion protein GogB; Provisional | Back alignment and domain information |
|---|
| >PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B | Back alignment and domain information |
|---|
| >KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B | Back alignment and domain information |
|---|
| >KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG2982 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] | Back alignment and domain information |
|---|
| >KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] | Back alignment and domain information |
|---|
| >KOG2982 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] | Back alignment and domain information |
|---|
| >KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] | Back alignment and domain information |
|---|
| >COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] | Back alignment and domain information |
|---|
| >PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] | Back alignment and domain information |
|---|
| >KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG2123 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] | Back alignment and domain information |
|---|
| >KOG2123 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] | Back alignment and domain information |
|---|
| >PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] | Back alignment and domain information |
|---|
| >KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] | Back alignment and domain information |
|---|
| >PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A | Back alignment and domain information |
|---|
| >PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D | Back alignment and domain information |
|---|
| >KOG0473 consensus Leucine-rich repeat protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG0473 consensus Leucine-rich repeat protein [Function unknown] | Back alignment and domain information |
|---|
| >PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D | Back alignment and domain information |
|---|
| >PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A | Back alignment and domain information |
|---|
| >smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily | Back alignment and domain information |
|---|
| >smart00370 LRR Leucine-rich repeats, outliers | Back alignment and domain information |
|---|
| >KOG3864 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG3864 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >smart00370 LRR Leucine-rich repeats, outliers | Back alignment and domain information |
|---|
| >smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 1005 | ||||
| 4fcg_A | 328 | Structure Of The Leucine-Rich Repeat Domain Of The | 8e-04 |
| >pdb|4FCG|A Chain A, Structure Of The Leucine-Rich Repeat Domain Of The Type Iii Effector Xcv3220 (Xopl) Length = 328 | Back alignment and structure |
|
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 1005 | |||
| 4fcg_A | 328 | Uncharacterized protein; structural genomics, PSI- | 2e-19 | |
| 4fcg_A | 328 | Uncharacterized protein; structural genomics, PSI- | 3e-19 | |
| 4fcg_A | 328 | Uncharacterized protein; structural genomics, PSI- | 1e-18 | |
| 4fcg_A | 328 | Uncharacterized protein; structural genomics, PSI- | 8e-17 | |
| 4fcg_A | 328 | Uncharacterized protein; structural genomics, PSI- | 3e-10 | |
| 4fcg_A | 328 | Uncharacterized protein; structural genomics, PSI- | 1e-06 | |
| 3jqh_A | 167 | C-type lectin domain family 4 member M; DC-signr, | 5e-16 | |
| 3jqh_A | 167 | C-type lectin domain family 4 member M; DC-signr, | 2e-10 | |
| 3jqh_A | 167 | C-type lectin domain family 4 member M; DC-signr, | 3e-08 | |
| 3jqh_A | 167 | C-type lectin domain family 4 member M; DC-signr, | 3e-06 | |
| 3jqh_A | 167 | C-type lectin domain family 4 member M; DC-signr, | 2e-05 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 3e-15 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 1e-08 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 4e-08 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 1e-05 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 5e-05 | |
| 3j0a_A | 844 | TOLL-like receptor 5; membrane protein, leucine-ri | 4e-15 | |
| 3j0a_A | 844 | TOLL-like receptor 5; membrane protein, leucine-ri | 4e-08 | |
| 2p1m_B | 594 | Transport inhibitor response 1 protein; F-BOX, leu | 4e-13 | |
| 2p1m_B | 594 | Transport inhibitor response 1 protein; F-BOX, leu | 5e-08 | |
| 2p1m_B | 594 | Transport inhibitor response 1 protein; F-BOX, leu | 5e-08 | |
| 2z81_A | 549 | CD282 antigen, TOLL-like receptor 2, variable lymp | 6e-13 | |
| 2z81_A | 549 | CD282 antigen, TOLL-like receptor 2, variable lymp | 6e-08 | |
| 2z81_A | 549 | CD282 antigen, TOLL-like receptor 2, variable lymp | 1e-04 | |
| 3bz5_A | 457 | Internalin-J, INLJ; leucine rich repeat (LRR), cys | 9e-12 | |
| 3bz5_A | 457 | Internalin-J, INLJ; leucine rich repeat (LRR), cys | 1e-07 | |
| 3bz5_A | 457 | Internalin-J, INLJ; leucine rich repeat (LRR), cys | 4e-07 | |
| 3bz5_A | 457 | Internalin-J, INLJ; leucine rich repeat (LRR), cys | 7e-07 | |
| 3bz5_A | 457 | Internalin-J, INLJ; leucine rich repeat (LRR), cys | 3e-05 | |
| 3bz5_A | 457 | Internalin-J, INLJ; leucine rich repeat (LRR), cys | 6e-04 | |
| 4eco_A | 636 | Uncharacterized protein; leucine-rich repeats, pro | 8e-11 | |
| 4eco_A | 636 | Uncharacterized protein; leucine-rich repeats, pro | 5e-07 | |
| 4eco_A | 636 | Uncharacterized protein; leucine-rich repeats, pro | 6e-07 | |
| 4eco_A | 636 | Uncharacterized protein; leucine-rich repeats, pro | 1e-05 | |
| 4eco_A | 636 | Uncharacterized protein; leucine-rich repeats, pro | 6e-05 | |
| 4eco_A | 636 | Uncharacterized protein; leucine-rich repeats, pro | 3e-04 | |
| 4eco_A | 636 | Uncharacterized protein; leucine-rich repeats, pro | 5e-04 | |
| 3ogk_B | 592 | Coronatine-insensitive protein 1; leucine rich rep | 4e-10 | |
| 3ogk_B | 592 | Coronatine-insensitive protein 1; leucine rich rep | 4e-08 | |
| 3ogk_B | 592 | Coronatine-insensitive protein 1; leucine rich rep | 4e-06 | |
| 3ogk_B | 592 | Coronatine-insensitive protein 1; leucine rich rep | 2e-04 | |
| 3ogk_B | 592 | Coronatine-insensitive protein 1; leucine rich rep | 3e-04 | |
| 3oja_A | 487 | Leucine-rich immune molecule 1; coiled-coil, helix | 3e-09 | |
| 3oja_A | 487 | Leucine-rich immune molecule 1; coiled-coil, helix | 5e-06 | |
| 3o53_A | 317 | Protein LRIM1, AGAP006348-PA; leucine-rich repeat, | 3e-09 | |
| 3o53_A | 317 | Protein LRIM1, AGAP006348-PA; leucine-rich repeat, | 2e-06 | |
| 3o53_A | 317 | Protein LRIM1, AGAP006348-PA; leucine-rich repeat, | 5e-04 | |
| 2z63_A | 570 | TOLL-like receptor 4, variable lymphocyte recepto; | 4e-09 | |
| 2z63_A | 570 | TOLL-like receptor 4, variable lymphocyte recepto; | 6e-05 | |
| 2z63_A | 570 | TOLL-like receptor 4, variable lymphocyte recepto; | 4e-04 | |
| 3g06_A | 622 | SSPH2 (leucine-rich repeat protein); E3 ubiquitin | 2e-08 | |
| 3g06_A | 622 | SSPH2 (leucine-rich repeat protein); E3 ubiquitin | 3e-07 | |
| 3g06_A | 622 | SSPH2 (leucine-rich repeat protein); E3 ubiquitin | 1e-05 | |
| 3g06_A | 622 | SSPH2 (leucine-rich repeat protein); E3 ubiquitin | 2e-05 | |
| 3g06_A | 622 | SSPH2 (leucine-rich repeat protein); E3 ubiquitin | 4e-04 | |
| 3g06_A | 622 | SSPH2 (leucine-rich repeat protein); E3 ubiquitin | 5e-04 | |
| 3g06_A | 622 | SSPH2 (leucine-rich repeat protein); E3 ubiquitin | 6e-04 | |
| 4ecn_A | 876 | Leucine-rich repeat protein; leucine-rich repeats, | 2e-08 | |
| 4ecn_A | 876 | Leucine-rich repeat protein; leucine-rich repeats, | 2e-08 | |
| 4ecn_A | 876 | Leucine-rich repeat protein; leucine-rich repeats, | 6e-08 | |
| 4ecn_A | 876 | Leucine-rich repeat protein; leucine-rich repeats, | 2e-07 | |
| 4ecn_A | 876 | Leucine-rich repeat protein; leucine-rich repeats, | 5e-07 | |
| 4ecn_A | 876 | Leucine-rich repeat protein; leucine-rich repeats, | 3e-06 | |
| 4ecn_A | 876 | Leucine-rich repeat protein; leucine-rich repeats, | 7e-05 | |
| 4ecn_A | 876 | Leucine-rich repeat protein; leucine-rich repeats, | 6e-04 | |
| 3t6q_A | 606 | CD180 antigen; protein-protein complex, leucine ri | 4e-08 | |
| 3t6q_A | 606 | CD180 antigen; protein-protein complex, leucine ri | 1e-07 | |
| 3t6q_A | 606 | CD180 antigen; protein-protein complex, leucine ri | 7e-06 | |
| 3t6q_A | 606 | CD180 antigen; protein-protein complex, leucine ri | 2e-04 | |
| 3t6q_A | 606 | CD180 antigen; protein-protein complex, leucine ri | 7e-04 | |
| 3t6q_A | 606 | CD180 antigen; protein-protein complex, leucine ri | 8e-04 | |
| 2z7x_B | 520 | TOLL-like receptor 1, variable lymphocyte recepto; | 2e-07 | |
| 2z7x_B | 520 | TOLL-like receptor 1, variable lymphocyte recepto; | 3e-04 | |
| 3vq2_A | 606 | TLR4, TOLL-like receptor 4; leucine rich repeat MD | 3e-07 | |
| 3vq2_A | 606 | TLR4, TOLL-like receptor 4; leucine rich repeat MD | 1e-06 | |
| 3vq2_A | 606 | TLR4, TOLL-like receptor 4; leucine rich repeat MD | 1e-04 | |
| 2xwt_C | 239 | Thyrotropin receptor; signaling protein-immune sys | 5e-07 | |
| 2id5_A | 477 | Lingo-1, leucine rich repeat neuronal 6A; CNS-spec | 6e-07 | |
| 2id5_A | 477 | Lingo-1, leucine rich repeat neuronal 6A; CNS-spec | 1e-04 | |
| 1jl5_A | 454 | Outer protein YOPM; leucine-rich repeat, molecular | 7e-07 | |
| 1jl5_A | 454 | Outer protein YOPM; leucine-rich repeat, molecular | 8e-06 | |
| 1jl5_A | 454 | Outer protein YOPM; leucine-rich repeat, molecular | 9e-06 | |
| 1jl5_A | 454 | Outer protein YOPM; leucine-rich repeat, molecular | 1e-05 | |
| 1jl5_A | 454 | Outer protein YOPM; leucine-rich repeat, molecular | 2e-04 | |
| 1jl5_A | 454 | Outer protein YOPM; leucine-rich repeat, molecular | 2e-04 | |
| 2z66_A | 306 | Variable lymphocyte receptor B, TOLL-like recepto; | 2e-06 | |
| 2z66_A | 306 | Variable lymphocyte receptor B, TOLL-like recepto; | 5e-04 | |
| 1m9s_A | 605 | Internalin B; cell invasion, GW domains, SH3 domai | 2e-06 | |
| 1m9s_A | 605 | Internalin B; cell invasion, GW domains, SH3 domai | 2e-04 | |
| 1m9s_A | 605 | Internalin B; cell invasion, GW domains, SH3 domai | 8e-04 | |
| 4fmz_A | 347 | Internalin; leucine rich repeat, structural genomi | 2e-06 | |
| 4fmz_A | 347 | Internalin; leucine rich repeat, structural genomi | 5e-06 | |
| 4fmz_A | 347 | Internalin; leucine rich repeat, structural genomi | 7e-05 | |
| 4fmz_A | 347 | Internalin; leucine rich repeat, structural genomi | 2e-04 | |
| 4fmz_A | 347 | Internalin; leucine rich repeat, structural genomi | 3e-04 | |
| 4fmz_A | 347 | Internalin; leucine rich repeat, structural genomi | 7e-04 | |
| 4fdw_A | 401 | Leucine rich hypothetical protein; putative cell s | 2e-06 | |
| 4fdw_A | 401 | Leucine rich hypothetical protein; putative cell s | 8e-05 | |
| 1dce_A | 567 | Protein (RAB geranylgeranyltransferase alpha subun | 3e-06 | |
| 1dce_A | 567 | Protein (RAB geranylgeranyltransferase alpha subun | 1e-04 | |
| 2ast_B | 336 | S-phase kinase-associated protein 2; SCF-substrate | 4e-06 | |
| 2ast_B | 336 | S-phase kinase-associated protein 2; SCF-substrate | 2e-04 | |
| 2ast_B | 336 | S-phase kinase-associated protein 2; SCF-substrate | 3e-04 | |
| 4ezg_A | 197 | Putative uncharacterized protein; internalin-A, le | 4e-06 | |
| 4ezg_A | 197 | Putative uncharacterized protein; internalin-A, le | 2e-04 | |
| 3sb4_A | 329 | Hypothetical leucine rich repeat protein; LRR, rig | 8e-06 | |
| 3oja_B | 597 | Anopheles plasmodium-responsive leucine-rich REPE | 1e-05 | |
| 3oja_B | 597 | Anopheles plasmodium-responsive leucine-rich REPE | 2e-05 | |
| 3oja_B | 597 | Anopheles plasmodium-responsive leucine-rich REPE | 1e-04 | |
| 3oja_B | 597 | Anopheles plasmodium-responsive leucine-rich REPE | 2e-04 | |
| 3cvr_A | 571 | Invasion plasmid antigen; leucine rich repeat and | 1e-05 | |
| 3cvr_A | 571 | Invasion plasmid antigen; leucine rich repeat and | 1e-05 | |
| 3cvr_A | 571 | Invasion plasmid antigen; leucine rich repeat and | 2e-04 | |
| 3o6n_A | 390 | APL1; leucine-rich repeat, protein binding; HET: N | 1e-05 | |
| 3o6n_A | 390 | APL1; leucine-rich repeat, protein binding; HET: N | 2e-05 | |
| 3o6n_A | 390 | APL1; leucine-rich repeat, protein binding; HET: N | 7e-05 | |
| 3o6n_A | 390 | APL1; leucine-rich repeat, protein binding; HET: N | 2e-04 | |
| 1o6v_A | 466 | Internalin A; bacterial infection, extracellular r | 1e-05 | |
| 1o6v_A | 466 | Internalin A; bacterial infection, extracellular r | 1e-04 | |
| 1o6v_A | 466 | Internalin A; bacterial infection, extracellular r | 1e-04 | |
| 1o6v_A | 466 | Internalin A; bacterial infection, extracellular r | 2e-04 | |
| 1o6v_A | 466 | Internalin A; bacterial infection, extracellular r | 5e-04 | |
| 3fxi_A | 605 | TLR4, htoll, TOLL-like receptor 4; leucine rich re | 2e-05 | |
| 3zyj_A | 440 | Leucine-rich repeat-containing protein 4C; cell ad | 3e-05 | |
| 1ziw_A | 680 | TOLL-like receptor 3; innate immunity, immune syst | 3e-05 | |
| 1ziw_A | 680 | TOLL-like receptor 3; innate immunity, immune syst | 9e-05 | |
| 1ziw_A | 680 | TOLL-like receptor 3; innate immunity, immune syst | 6e-04 | |
| 3a79_B | 562 | TLR6, VLRB.59, TOLL-like receptor 6, variable lymp | 4e-05 | |
| 3rgz_A | 768 | Protein brassinosteroid insensitive 1; phytohormon | 6e-05 | |
| 3rgz_A | 768 | Protein brassinosteroid insensitive 1; phytohormon | 1e-04 | |
| 3rgz_A | 768 | Protein brassinosteroid insensitive 1; phytohormon | 3e-04 | |
| 1a9n_A | 176 | U2A', U2A'; complex (nuclear protein/RNA), RNA, sn | 7e-05 | |
| 4ay9_X | 350 | Follicle-stimulating hormone receptor; hormone-rec | 1e-04 | |
| 4ay9_X | 350 | Follicle-stimulating hormone receptor; hormone-rec | 5e-04 | |
| 1xku_A | 330 | Decorin; proteoglycan, leucine-rich repeat, struct | 2e-04 | |
| 1xku_A | 330 | Decorin; proteoglycan, leucine-rich repeat, struct | 6e-04 | |
| 3zyi_A | 452 | Leucine-rich repeat-containing protein 4; cell adh | 2e-04 | |
| 3zyi_A | 452 | Leucine-rich repeat-containing protein 4; cell adh | 4e-04 | |
| 1h6u_A | 308 | Internalin H; cell adhesion, leucine rich repeat, | 3e-04 | |
| 1ogq_A | 313 | PGIP-2, polygalacturonase inhibiting protein; inhi | 4e-04 | |
| 1h6t_A | 291 | Internalin B; cell adhesion, leucine rich repeat, | 4e-04 | |
| 3v47_A | 455 | TOLL-like receptor 5B and variable lymphocyte REC | 6e-04 | |
| 1ozn_A | 285 | Reticulon 4 receptor; NOGO receptor, MAD, myelinat | 8e-04 |
| >4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 | Back alignment and structure |
|---|
Score = 89.6 bits (223), Expect = 2e-19
Identities = 28/109 (25%), Positives = 45/109 (41%)
Query: 80 SMLPKLLKLQSLRVFSLRGYRILELPDSVGDLRYLRYLNLSGTEIRTLPESVSKLYNLHS 139
+ L +L+ L I LP S+ +L+ L+ L + + + L ++ L L
Sbjct: 174 DASGEHQGLVNLQSLRLEWTGIRSLPASIANLQNLKSLKIRNSPLSALGPAIHHLPKLEE 233
Query: 140 LLLEDCDRLEKLCADMGNLVKLHHLKNSNTKSLEEMPVGIGRLTCLQTL 188
L L C L G L L + +L +P+ I RLT L+ L
Sbjct: 234 LDLRGCTALRNYPPIFGGRAPLKRLILKDCSNLLTLPLDIHRLTQLEKL 282
|
| >4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 | Back alignment and structure |
|---|
| >4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 | Back alignment and structure |
|---|
| >4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 | Back alignment and structure |
|---|
| >4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 | Back alignment and structure |
|---|
| >4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 | Back alignment and structure |
|---|
| >3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 | Back alignment and structure |
|---|
| >2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 | Back alignment and structure |
|---|
| >2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 | Back alignment and structure |
|---|
| >2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 | Back alignment and structure |
|---|
| >2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 | Back alignment and structure |
|---|
| >2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 | Back alignment and structure |
|---|
| >2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 | Back alignment and structure |
|---|
| >3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 | Back alignment and structure |
|---|
| >3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 | Back alignment and structure |
|---|
| >3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 | Back alignment and structure |
|---|
| >3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 | Back alignment and structure |
|---|
| >3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 | Back alignment and structure |
|---|
| >3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 | Back alignment and structure |
|---|
| >4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 | Back alignment and structure |
|---|
| >4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 | Back alignment and structure |
|---|
| >4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 | Back alignment and structure |
|---|
| >4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 | Back alignment and structure |
|---|
| >4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 | Back alignment and structure |
|---|
| >4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 | Back alignment and structure |
|---|
| >4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 | Back alignment and structure |
|---|
| >3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 | Back alignment and structure |
|---|
| >3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 | Back alignment and structure |
|---|
| >3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 | Back alignment and structure |
|---|
| >3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 | Back alignment and structure |
|---|
| >3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 | Back alignment and structure |
|---|
| >3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 | Back alignment and structure |
|---|
| >3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 | Back alignment and structure |
|---|
| >3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 | Back alignment and structure |
|---|
| >3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 | Back alignment and structure |
|---|
| >3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 | Back alignment and structure |
|---|
| >2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 | Back alignment and structure |
|---|
| >2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 | Back alignment and structure |
|---|
| >2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 | Back alignment and structure |
|---|
| >3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 | Back alignment and structure |
|---|
| >3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 | Back alignment and structure |
|---|
| >3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 | Back alignment and structure |
|---|
| >3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 | Back alignment and structure |
|---|
| >3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 | Back alignment and structure |
|---|
| >3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 | Back alignment and structure |
|---|
| >3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 | Back alignment and structure |
|---|
| >4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 | Back alignment and structure |
|---|
| >4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 | Back alignment and structure |
|---|
| >4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 | Back alignment and structure |
|---|
| >4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 | Back alignment and structure |
|---|
| >4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 | Back alignment and structure |
|---|
| >4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 | Back alignment and structure |
|---|
| >4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 | Back alignment and structure |
|---|
| >4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 | Back alignment and structure |
|---|
| >3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 | Back alignment and structure |
|---|
| >3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 | Back alignment and structure |
|---|
| >3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 | Back alignment and structure |
|---|
| >3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 | Back alignment and structure |
|---|
| >3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 | Back alignment and structure |
|---|
| >3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 | Back alignment and structure |
|---|
| >2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 | Back alignment and structure |
|---|
| >2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 | Back alignment and structure |
|---|
| >3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 | Back alignment and structure |
|---|
| >3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 | Back alignment and structure |
|---|
| >3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 | Back alignment and structure |
|---|
| >2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 | Back alignment and structure |
|---|
| >2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 | Back alignment and structure |
|---|
| >2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 | Back alignment and structure |
|---|
| >1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 | Back alignment and structure |
|---|
| >1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 | Back alignment and structure |
|---|
| >1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 | Back alignment and structure |
|---|
| >1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 | Back alignment and structure |
|---|
| >1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 | Back alignment and structure |
|---|
| >1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 | Back alignment and structure |
|---|
| >2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 | Back alignment and structure |
|---|
| >2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 | Back alignment and structure |
|---|
| >1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 | Back alignment and structure |
|---|
| >1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 | Back alignment and structure |
|---|
| >1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 | Back alignment and structure |
|---|
| >4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 | Back alignment and structure |
|---|
| >4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 | Back alignment and structure |
|---|
| >4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 | Back alignment and structure |
|---|
| >4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 | Back alignment and structure |
|---|
| >4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 | Back alignment and structure |
|---|
| >4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 | Back alignment and structure |
|---|
| >4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Length = 401 | Back alignment and structure |
|---|
| >4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Length = 401 | Back alignment and structure |
|---|
| >1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 | Back alignment and structure |
|---|
| >1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 | Back alignment and structure |
|---|
| >2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336 | Back alignment and structure |
|---|
| >2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336 | Back alignment and structure |
|---|
| >2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336 | Back alignment and structure |
|---|
| >4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 | Back alignment and structure |
|---|
| >4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 | Back alignment and structure |
|---|
| >3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Length = 329 | Back alignment and structure |
|---|
| >3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 | Back alignment and structure |
|---|
| >3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 | Back alignment and structure |
|---|
| >3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 | Back alignment and structure |
|---|
| >3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 | Back alignment and structure |
|---|
| >3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 | Back alignment and structure |
|---|
| >3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 | Back alignment and structure |
|---|
| >3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 | Back alignment and structure |
|---|
| >3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 | Back alignment and structure |
|---|
| >3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 | Back alignment and structure |
|---|
| >3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 | Back alignment and structure |
|---|
| >3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 | Back alignment and structure |
|---|
| >1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 | Back alignment and structure |
|---|
| >1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 | Back alignment and structure |
|---|
| >1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 | Back alignment and structure |
|---|
| >1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 | Back alignment and structure |
|---|
| >1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 | Back alignment and structure |
|---|
| >3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 | Back alignment and structure |
|---|
| >3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 | Back alignment and structure |
|---|
| >1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 | Back alignment and structure |
|---|
| >1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 | Back alignment and structure |
|---|
| >1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 | Back alignment and structure |
|---|
| >3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 | Back alignment and structure |
|---|
| >3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 | Back alignment and structure |
|---|
| >3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 | Back alignment and structure |
|---|
| >3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 | Back alignment and structure |
|---|
| >1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 | Back alignment and structure |
|---|
| >4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 | Back alignment and structure |
|---|
| >4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 | Back alignment and structure |
|---|
| >1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 | Back alignment and structure |
|---|
| >1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 | Back alignment and structure |
|---|
| >3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 | Back alignment and structure |
|---|
| >3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 | Back alignment and structure |
|---|
| >1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 | Back alignment and structure |
|---|
| >1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 | Back alignment and structure |
|---|
| >1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 | Back alignment and structure |
|---|
| >3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 | Back alignment and structure |
|---|
| >1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
No hit with probability above 80.00
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 1005 | ||||
| d2astb2 | 284 | c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 | 1e-04 | |
| d2astb2 | 284 | c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 | 2e-04 | |
| d2astb2 | 284 | c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 | 0.003 | |
| d1xkua_ | 305 | c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 | 0.001 | |
| d1xkua_ | 305 | c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 | 0.003 | |
| d1dcea3 | 124 | c.10.2.2 (A:444-567) Rab geranylgeranyltransferase | 0.002 | |
| d1a9na_ | 162 | c.10.2.4 (A:) Splicesomal U2A' protein {Human (Hom | 0.002 | |
| d2omza2 | 384 | c.10.2.1 (A:33-416) Internalin A {Listeria monocyt | 0.003 | |
| d1jl5a_ | 353 | c.10.2.6 (A:) Leucine rich effector protein YopM { | 0.003 |
| >d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) superfamily: RNI-like family: Cyclin A/CDK2-associated p19, Skp2 domain: Cyclin A/CDK2-associated p19, Skp2 species: Human (Homo sapiens) [TaxId: 9606]
Score = 42.8 bits (99), Expect = 1e-04
Identities = 32/230 (13%), Positives = 68/230 (29%), Gaps = 12/230 (5%)
Query: 104 LPDSVGDL--RYLRYLNLSGTEIRTLPESVSKLYNLHSLLLEDCD-RLEKLCADMGNLVK 160
PD G L + + + + + + + L + + L + K
Sbjct: 13 HPDVTGRLLSQGVIAFRCPRSFMDQPLAEHFSPFRVQHMDLSNSVIEVSTLHGILSQCSK 72
Query: 161 LHHLKNSNTKSLEEMPVGIGRLTCLQTLCSFVVGKDSGSGLRELKLLTQLRGTLCISNLE 220
L +L + + + + + + L L S L+ + C E
Sbjct: 73 LQNLSLEGLRLSDPIVNTLAKNSNLVRLNLSGCSGFSEFALQT-------LLSSCSRLDE 125
Query: 221 NVKHIVDAEDAQLDRKENLKELWLRWTLYGSYSREAETEMGVLDMLKPHTNLEQFCIKGY 280
+ + L S R+ + + +++ NL +
Sbjct: 126 LNLSWCFDFTEKHVQVAVAHVSETITQLNLSGYRKNLQKSDLSTLVRRCPNLVHLDLSDS 185
Query: 281 GGMKFPTWLGDSSFSKLVTLKFKNCDMCT--ALPSVGQLPSLKHLTVRGM 328
+K + + L L C L +G++P+LK L V G+
Sbjct: 186 VMLKNDCFQEFFQLNYLQHLSLSRCYDIIPETLLELGEIPTLKTLQVFGI 235
|
| >d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 | Back information, alignment and structure |
|---|
| >d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 | Back information, alignment and structure |
|---|
| >d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 | Back information, alignment and structure |
|---|
| >d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 | Back information, alignment and structure |
|---|
| >d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 | Back information, alignment and structure |
|---|
| >d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Length = 162 | Back information, alignment and structure |
|---|
| >d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 | Back information, alignment and structure |
|---|
| >d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 1005 | |||
| d2omza2 | 384 | Internalin A {Listeria monocytogenes [TaxId: 1639] | 100.0 | |
| d2omza2 | 384 | Internalin A {Listeria monocytogenes [TaxId: 1639] | 100.0 | |
| d1ogqa_ | 313 | Polygalacturonase inhibiting protein PGIP {Kidney | 99.97 | |
| d1xkua_ | 305 | Decorin {Cow (Bos taurus) [TaxId: 9913]} | 99.96 | |
| d1ogqa_ | 313 | Polygalacturonase inhibiting protein PGIP {Kidney | 99.96 | |
| d1xkua_ | 305 | Decorin {Cow (Bos taurus) [TaxId: 9913]} | 99.96 | |
| d1jl5a_ | 353 | Leucine rich effector protein YopM {Yersinia pesti | 99.95 | |
| d1jl5a_ | 353 | Leucine rich effector protein YopM {Yersinia pesti | 99.95 | |
| d1p9ag_ | 266 | von Willebrand factor binding domain of glycoprote | 99.93 | |
| d1ozna_ | 284 | Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma | 99.93 | |
| d2astb2 | 284 | Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa | 99.86 | |
| d1h6ua2 | 227 | Internalin H {Listeria monocytogenes [TaxId: 1639] | 99.85 | |
| d1xwdc1 | 242 | Follicle-stimulating hormone receptor {Human (Homo | 99.84 | |
| d1h6ua2 | 227 | Internalin H {Listeria monocytogenes [TaxId: 1639] | 99.84 | |
| d1h6ta2 | 210 | Internalin B {Listeria monocytogenes [TaxId: 1639] | 99.83 | |
| d1z7xw1 | 460 | Ribonuclease inhibitor {Human (Homo sapiens) [TaxI | 99.82 | |
| d2omxa2 | 199 | Internalin B {Listeria monocytogenes [TaxId: 1639] | 99.82 | |
| d1a9na_ | 162 | Splicesomal U2A' protein {Human (Homo sapiens) [Ta | 99.76 | |
| d1z7xw1 | 460 | Ribonuclease inhibitor {Human (Homo sapiens) [TaxI | 99.75 | |
| d1w8aa_ | 192 | Slit {Fruit fly (Drosophila melanogaster) [TaxId: | 99.71 | |
| d1a9na_ | 162 | Splicesomal U2A' protein {Human (Homo sapiens) [Ta | 99.7 | |
| d1w8aa_ | 192 | Slit {Fruit fly (Drosophila melanogaster) [TaxId: | 99.69 | |
| d1dcea3 | 124 | Rab geranylgeranyltransferase alpha-subunit, C-ter | 99.69 | |
| d1dcea3 | 124 | Rab geranylgeranyltransferase alpha-subunit, C-ter | 99.69 | |
| d1m9la_ | 198 | Outer arm dynein light chain 1 {Green algae (Chlam | 99.64 | |
| d1m9la_ | 198 | Outer arm dynein light chain 1 {Green algae (Chlam | 99.54 | |
| d2ifga3 | 156 | High affinity nerve growth factor receptor, N-term | 99.52 | |
| d2ifga3 | 156 | High affinity nerve growth factor receptor, N-term | 99.51 | |
| d2ca6a1 | 344 | Rna1p (RanGAP1), N-terminal domain {Fission yeast | 99.49 | |
| d1koha1 | 162 | mRNA export factor tap {Human (Homo sapiens) [TaxI | 98.84 | |
| d1koha1 | 162 | mRNA export factor tap {Human (Homo sapiens) [TaxI | 98.71 | |
| d1pgva_ | 167 | Tropomodulin C-terminal domain {nematode (Caenorha | 97.99 | |
| d1pgva_ | 167 | Tropomodulin C-terminal domain {nematode (Caenorha | 97.89 | |
| d1io0a_ | 166 | Tropomodulin C-terminal domain {Chicken (Gallus ga | 97.63 | |
| d1io0a_ | 166 | Tropomodulin C-terminal domain {Chicken (Gallus ga | 97.4 |
| >d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) superfamily: L domain-like family: Internalin LRR domain domain: Internalin A species: Listeria monocytogenes [TaxId: 1639]
Probab=100.00 E-value=1.7e-31 Score=161.56 Aligned_cols=85 Identities=19% Similarity=0.352 Sum_probs=64.3
Q ss_pred CCCCCCEEEECCCCCCCCCCCCCCCCCCCEEECCCCCCCCCCHHHHCCCCCCEECCCCCCCCCCCHHHHCCCCCCCEEEC
Q ss_conf 69974399922899843691114989785997438877436833340135535122355311000031005378988973
Q 001849 87 KLQSLRVFSLRGYRILELPDSVGDLRYLRYLNLSGTEIRTLPESVSKLYNLHSLLLEDCDRLEKLCADMGNLVKLHHLKN 166 (1005)
Q Consensus 87 ~l~~Lr~L~L~~~~i~~lp~~~~~l~~L~~L~L~~n~i~~lp~~i~~L~~L~~L~L~~~~~~~~lp~~i~~L~~L~~L~L 166 (1005)
.+.+|++|+++++.|+.+ +.+..+++|++|++++|.++.+|. ++++++|++|++++|. +..++ .++.+++|+.|++
T Consensus 42 ~l~~l~~L~l~~~~I~~l-~gl~~L~nL~~L~Ls~N~l~~l~~-l~~L~~L~~L~L~~n~-i~~i~-~l~~l~~L~~L~~ 117 (384)
T d2omza2 42 DLDQVTTLQADRLGIKSI-DGVEYLNNLTQINFSNNQLTDITP-LKNLTKLVDILMNNNQ-IADIT-PLANLTNLTGLTL 117 (384)
T ss_dssp HHTTCCEEECCSSCCCCC-TTGGGCTTCCEEECCSSCCCCCGG-GTTCTTCCEEECCSSC-CCCCG-GGTTCTTCCEEEC
T ss_pred HHCCCCEEECCCCCCCCC-CCCCCCCCCCEEECCCCCCCCCCC-CCCCCCCCCCCCCCCC-CCCCC-CCCCCCCCCCCCC
T ss_conf 957878998999898776-242458999989681881798863-3477110103013433-32222-1112334333443
Q ss_pred CCCCCCCCCC
Q ss_conf 5886654332
Q 001849 167 SNTKSLEEMP 176 (1005)
Q Consensus 167 ~~n~~~~~lp 176 (1005)
+++. ...++
T Consensus 118 ~~~~-~~~~~ 126 (384)
T d2omza2 118 FNNQ-ITDID 126 (384)
T ss_dssp CSSC-CCCCG
T ss_pred CCCC-CCCCC
T ss_conf 3222-22222
|
| >d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} | Back information, alignment and structure |
|---|
| >d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} | Back information, alignment and structure |
|---|
| >d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} | Back information, alignment and structure |
|---|
| >d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} | Back information, alignment and structure |
|---|
| >d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} | Back information, alignment and structure |
|---|
| >d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} | Back information, alignment and structure |
|---|
| >d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} | Back information, alignment and structure |
|---|
| >d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|