Citrus Sinensis ID: 001957


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820-------830-------840-------850-------860-------870-------880-------890-------900-------910-------920-------930-------940-------950-------960-------970-------980-------990-
MEGTHDIFMASTSLRRSASRWNTNSIGAFSRSSREEDDEEALKWAALEKLPTYNRLRKGILTTSRGEANEVDVYNLGLQERQRLIDKLVKVTDVDNERFLLKLKNRIDRVGIDLPKVEVRYEHLNVEAEAFLASNALPSFIKFYTNIFEDILNYLRIIPSKKRHLTILKDVSGVIKPGRLTLLLGPPSSGKTTLLLALAGKLDPTLKVSGTVTYNGHDMDEFVPQRTAAYISQHDNHIGEMTVRETLAFSARCQGVGTRYEMLTELARREKAAGIKPDPDIDVYMKAIATEGQEANVITDYYLKVLGLDVCADTMVGDEMIRGISGGQKKRVTTGEMMVGPALALFMDEISTGLDSSTTFQIVNCLRQNIHINSGTAVISLLQPAPETYDLFDDIILLSDGQIVYQGPRELVLEFFASMGFRCPKRKGVADFLQEVTSRKDQRQYWAHKEKPYRFVTVQEFAEAFQSFHVGQKISDELRTPFDKSKSHRAALTTETYGVGKRELLKANISRELLLMKRNSFVYIFKLIQIAFVAVVYMTLFLRTKMHKDTVTDGGIFAGATFFAITMVNFNGFSEISMTIAKLPVFYKQRDFRFFPPWAYAIPSWILKIPVSFLEVAVWVFLSYYVVGYDSNAGRFFKQYALLLGVNQMASALFRFIAVTGRNMVVANTFGSFALLVLLSLGGFILSREDIKKWWKWAYWCSPLTYAQNAIVANEFLGHSWKKFTQDSSETLGVQVLKSRGFFAHEYWYWLGLGALFGFVLLLNFAYTLALTFLDPFEKPRAVITEEIESNEQDDRIGGNVQLSTLGGSSNHNTRSGSTDDIRGQQSSSQSLSLAEAEASRPKKKGMVLPFEPHSLTFDEVVYSVDMPEEMKVQGVLEDKLVLLNGVSGAFRPGVLTALMGVSGAGKTTLMDVLAGRKTGGYITGNITISGYPKKQETFARISGYCEQNDIHSPFVTIYESLLFSAWLRLSPEVDSETRKVGTKSPRVLGH
cccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHccccHHHHHHcccccccccccccccccccHHHHHHHHccccccccccHHHHHHHHHHHHHHccccccccEEEEEEEEEEEEEEccccccccHHHHHHHHHHHHHHHHcccccccccccccccccEEEEccEEEEEEccccccHHHHHHHHHccccccccEEEEEEEccccccccccccEEEEEcccccccccccHHHHHHHHHHHcccccccHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccHHHHHHHHcccccccEEcccccHHHHHHHHHHHHHHHHHHHccccEEEEEcccccHHHHccccEEEEcccEEEEEccHHHHHHHHHccccccccccccccccccccccccccccccccccccccccHHHHHHHHHccHHHHHHHHHHccccccccccccccccccccccHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHEEEEEcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHccEEccccccccHHHHHHHcHHHHHHHHHHHcccccccccccccccccccccEEEEcccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccHHHccccccccccccccEEccccccccccccccccccccccccccccHHHHHHHHcccccccccccccccEEEEccEEEEEccccHHHHcccccccccccccccEEEcccEEEEEcccccccHHHHHHHHHccccccEEEEEEEEccccccccccccccHHHHcccccccccHHHHHHHHHHHccccccccHHHHHHHHHHHHHccc
ccccHHHHHHHccccccccHcccccccccccccccccHHHHHHHHHHHccccHHHHHHHHHcccccccEEEEHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccEEEEEEEEEEEEEEEEcccccccccHHHHHHHHHHHHHHHHHcccccccEEEEccccccEcccEEEEEEccccccHHHHHHHHHccccccEEEEEEEEEcccccccccHHHEEEEEEccccccccEEEEEHHHHHHHHcccccHHHHHHHHHHHHHHcccccccccHEEEEcccccccccHHHHHHHHHHHcccHHHHHHccccccccccccccEEEEEEHHEcccccEEEEccccccccHHHHHHHHHHHHHHHHHcccEEEEEEccccHHHHHHHHHHHHHccccEEEEccHHHHHHHHHHccccccccccccHHHHHcccHHHHHHHcccccccEEEEcHHHHHHHHHccHHHHHHHHHHHcccccccccccccccccccccHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHcccccccEEEEEccEEHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHcccEEccccccHHEEEEEEHcHHHHHHHHHHHHHccccccccccccccccHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccEEEcccHHHHHcccccccEEEEEEcccccccccccccccccccccccccccccccccccccccccEEEccccEEEEEccEEEEEccHHHHHHccccHHHHHHHHcccccccccHHHHHHccccccHccHHHHHcccccccEEEEEEEEEccccccccEEEEcccccccccccccEEEEEHHHHHHHHcccccccHHHHHHHHHHHHHHcc
MEGTHDIFMASTSLRRSasrwntnsigafsrssreedDEEALKWAALEklptynrlrKGILttsrgeanevdvynLGLQERQRLIDKLVKVTDVDNERFLLKLKNRIDrvgidlpkVEVRYEHLNVEAEAFlasnalpsfIKFYTNIFEDILNYLRiipskkrhLTILKdvsgvikpgrltlllgppssgkTTLLLALAgkldptlkvsgtvtynghdmdefvpqRTAAYISQHDNHIGEMTVRETLAFSARCQGVGTRYEMLTELARREkaagikpdpdiDVYMKAIATEGQEANVITDYYLKVLgldvcadtmvgdemirgisggqkkrvttgemmvgPALALFMDEistgldssttFQIVNCLRQNIHINSGTAVISllqpapetydlfddiillsdgqivyqgPRELVLEFFAsmgfrcpkrkgVADFLQEVTSRKDQRqywahkekpyrfVTVQEFAEAFQSFHvgqkisdelrtpfdkskshraalttetygvgKRELLKANISRELLLMKRNSFVYIFKLIQIAFVAVVYMTLFLRTkmhkdtvtdggifaGATFFAITMVNFNGFSEISMTIAKlpvfykqrdfrffppwayaipswilkiPVSFLEVAVWVFLSYYVVgydsnagrFFKQYALLLGVNQMASALFRFIAVTGRNMVVANTFGSFALLVLLSLGGFILSREDIKKWWKWaywcspltyAQNAIVANEFLGHSWKKFTQDSSETLGVQVLKSRGFFAHEYWYWLGLGALFGFVLLLNFAYTLAltfldpfekpraVITEEIesneqddriggnvqlstlggssnhntrsgstddirgqqsssqSLSLAEAEasrpkkkgmvlpfephsltfdevvysvdmpeemkvQGVLEDKLVLLngvsgafrpGVLTALMgvsgagktTLMDVLAgrktggyitgnitisgypkkqeTFARISGyceqndihspFVTIYESLLFSAWLrlspevdsetrkvgtksprvlgh
megthdifmastslrrsasrwntnsigafsrssreeddEEALKWAaleklptynrlrkgilttsrgeanevdvynlglqerqrLIDKlvkvtdvdnerfllklknridrvgidlPKVEVRYEHLNVEAEAFLASNALPSFIKFYTNIFEDILNYLRIIPSKKRHLTILKDvsgvikpgrltlllgppssGKTTLLLALAGKLDPTLKVSGTVTYNGHDMDEFVPQRTAAYISQHDNHIGEMTVRETLAFSARCQGVGTRYEMLTELARRekaagikpdpdiDVYMKAIATEGQEANVITDYYLKVLGLDVCADTMVGDEmirgisggqkkrvttGEMMVGPALALFMDEISTGLDSSTTFQIVNCLRQNIHINSGTAVISLLQPAPETYDLFDDIILLSDGQIVYQGPRELVLEFFASMGFRCPKRKGVADFLQEvtsrkdqrqywaHKEKPYRFVTVQEFAEAFQSFHVGQKISDElrtpfdkskshraalttetygvgkrellKANISRELLLMKRNSFVYIFKLIQIAFVAVVYMTLFLRTKMHKDTVTDGGIFAGATFFAITMVNFNGFSEISMTIAKLPVFYKQRDFRFFPPWAYAIPSWILKIPVSFLEVAVWVFLSYYVVGYDSNAGRFFKQYALLLGVNQMASALFRFIAVTGRNMVVANTFGSFALLVLLSLGGFILSREDIKKWWKWAYWCSPLTYAQNAIVANEFLGHSWKKFTQDSSETLGVQVLKSRGFFAHEYWYWLGLGALFGFVLLLNFAYTLALTFLDPFEKPRAVITEEiesneqddrigGNVQLStlggssnhntrsgstddirgqqSSSQSLSLAEAEasrpkkkgmvlpfephslTFDEVVYSVDMPEEMKVQGVLEDKLVLLNGVSGAFRPGVLTALMGVSGAGKTTLMDVLAGrktggyitgnitisgypKKQETFARISGYCEQNDIHSPFVTIYESLLFSAWLRlspevdsetrkvgtksprvlgh
MEGTHDIFMASTSLRRSASRWNTNSIGAFsrssreeddeeALKWAALEKLPTYNRLRKGILTTSRGEANEVDVYNLGLQERQRLIDKLVKVTDVDNERFLLKLKNRIDRVGIDLPKVEVRYEHLNVEAEAFLASNALPSFIKFYTNIFEDILNYLRIIPSKKRHLTILKDVSGVIKPGRLTLLLGPPssgkttlllalagklDPTLKVSGTVTYNGHDMDEFVPQRTAAYISQHDNHIGEMTVRETLAFSARCQGVGTRYEMLTELARREKAAGIKPDPDIDVYMKAIATEGQEANVITDYYLKVLGLDVCADTMVGDEMIRGISGGQKKRVTTGEMMVGPALALFMDEISTGLDSSTTFQIVNCLRQNIHINSGTAVISLLQPAPETYDLFDDIILLSDGQIVYQGPRELVLEFFASMGFRCPKRKGVADFLQEVTSRKDQRQYWAHKEKPYRFVTVQEFAEAFQSFHVGQKISDELRTPFDKSKSHRAALTTETYGVGKRELLKANISRELLLMKRNSFVYIFKLIQIAFVAVVYMTLFLRTKMHKDTVTDGGIFAGATFFAITMVNFNGFSEISMTIAKLPVFYKQRDFRFFPPWAYAIPSWILKIPVSFLEVAVWVFLSYYVVGYDSNAGRFFKQYALLLGVNQMASALFRFIAVTGRNMVVANTfgsfallvllslggfilsREDIKKWWKWAYWCSPLTYAQNAIVANEFLGHSWKKFTQDSSETLGVQVLKSRGFFAHEYWYWlglgalfgfvlllnfAYTLALTFLDPFEKPRAVITEEIESNEQDDRIGGNVQLSTLGGSSNHNTRSGSTDDIRGqqsssqslslaeaeasRPKKKGMVLPFEPHSLTFDEVVYSVDMPEEMKVQGVLEDKLVLLNGVSGAFRPGVLTALMGVSGAGKTTLMDVLAGRKTGGYITGNITISGYPKKQETFARISGYCEQNDIHSPFVTIYESLLFSAWLRLSPEVDSETRKVGTKSPRVLGH
*****************************************LKWAALEKLPTYNRLRKGILTTSRGEANEVDVYNLGLQERQRLIDKLVKVTDVDNERFLLKLKNRIDRVGIDLPKVEVRYEHLNVEAEAFLASNALPSFIKFYTNIFEDILNYLRIIPSKKRHLTILKDVSGVIKPGRLTLLLGPPSSGKTTLLLALAGKLDPTLKVSGTVTYNGHDMDEFVPQRTAAYISQHDNHIGEMTVRETLAFSARCQGVGTRYEMLTELARREKAAGIKPDPDIDVYMKAIATEGQEANVITDYYLKVLGLDVCADTMVGDEMIRGISGGQKKRVTTGEMMVGPALALFMDEISTGLDSSTTFQIVNCLRQNIHINSGTAVISLLQPAPETYDLFDDIILLSDGQIVYQGPRELVLEFFASMGFRCPKRKGVADFLQEVTSRKDQRQYWAHKEKPYRFVTVQEFAEAFQSFHVGQKI****************ALTTETYGVGKRELLKANISRELLLMKRNSFVYIFKLIQIAFVAVVYMTLFLRTKMHKDTVTDGGIFAGATFFAITMVNFNGFSEISMTIAKLPVFYKQRDFRFFPPWAYAIPSWILKIPVSFLEVAVWVFLSYYVVGYDSNAGRFFKQYALLLGVNQMASALFRFIAVTGRNMVVANTFGSFALLVLLSLGGFILSREDIKKWWKWAYWCSPLTYAQNAIVANEFLGHSWKKFTQDSSETLGVQVLKSRGFFAHEYWYWLGLGALFGFVLLLNFAYTLALTFLDPFEKPRAVI****************************************************************LPFEPHSLTFDEVVYSVDMPEEMKVQGVLEDKLVLLNGVSGAFRPGVLTALMGVSGAGKTTLMDVLAGRKTGGYITGNITISGYPKKQETFARISGYCEQNDIHSPFVTIYESLLFSAWLRL*********************
*********************************************************************************************VDNERFLLK*K***********KVEVRYEHLNVEAEAFLASNALPSFIKFYTNIFEDILNY***********TILKDVSGVIKPGRLTLLLGPPSSGKTTLLLALAGKLDPTLKVSGTVTYNGHDMDEFVPQRTAAYISQHDNHIGEMTVRETLAFSARCQGVGTRYEML***********IKPDPDIDVYMKAIATEGQEANVITDYYLKVLGLDVCADTMVGDEMIRGISGGQKKRVTTGEMMVGPALALFMDEISTGLDSSTTFQIVNCLRQNIHINSGTAVISLLQPAPETYDLFDDIILLSDGQIVYQGPRELVLEFFASMGFRCPKRKGVADFLQEVTSRKDQRQYWAHKEKPYRFVTVQEFAEAFQSFHVGQKISD***********************GKRELLKANISRELLLMKRNSFVYIFKLIQIAFVAVVYMTLFLRTKMHKDTVTDGGIFAGATFFAITMVNFNGFSEISMTIAKLPVFYKQRDFRFFPPWAYAIPSWILKIPVSFLEVAVWVFLSYYVVGYDSNAGRFFKQYALLLGVNQMASALFRFIAVTGRNMVVANTFGSFALLVLLSLGGFILSREDIKKWWKWAYWCSPLTYAQNAIVANEFLGHSWKKFTQDSSETLGVQVLKSRGFFAHEYWYWLGLGALFGFVLLLNFAYTLALTFLDPFEKPRAV********************************************************************EPHSLTFDEVVYSVDMPEEMK***VLEDKLVLLNGVSGAFRPGVLTALMGVSGAGKTTLMDVLAGRKTGGYITGNITISGYPKKQETFARISGYCEQNDIHSPFVTIYESLLFSAWLRLSPEVDSETRKVGTKSPRVLGH
MEGTHDIFMASTSLRRSASRWNTNSIGA*************LKWAALEKLPTYNRLRKGILTTSRGEANEVDVYNLGLQERQRLIDKLVKVTDVDNERFLLKLKNRIDRVGIDLPKVEVRYEHLNVEAEAFLASNALPSFIKFYTNIFEDILNYLRIIPSKKRHLTILKDVSGVIKPGRLTLLLGPPSSGKTTLLLALAGKLDPTLKVSGTVTYNGHDMDEFVPQRTAAYISQHDNHIGEMTVRETLAFSARCQGVGTRYEMLTELARREKAAGIKPDPDIDVYMKAIATEGQEANVITDYYLKVLGLDVCADTMVGDEMIRGISGGQKKRVTTGEMMVGPALALFMDEISTGLDSSTTFQIVNCLRQNIHINSGTAVISLLQPAPETYDLFDDIILLSDGQIVYQGPRELVLEFFASMGFRCPKRKGVADFLQEVTSRKDQRQYWAHKEKPYRFVTVQEFAEAFQSFHVGQKISDELRTPFDKSKSHRAALTTETYGVGKRELLKANISRELLLMKRNSFVYIFKLIQIAFVAVVYMTLFLRTKMHKDTVTDGGIFAGATFFAITMVNFNGFSEISMTIAKLPVFYKQRDFRFFPPWAYAIPSWILKIPVSFLEVAVWVFLSYYVVGYDSNAGRFFKQYALLLGVNQMASALFRFIAVTGRNMVVANTFGSFALLVLLSLGGFILSREDIKKWWKWAYWCSPLTYAQNAIVANEFLGHSWKKFTQDSSETLGVQVLKSRGFFAHEYWYWLGLGALFGFVLLLNFAYTLALTFLDPFEKPRAVITEEIESNEQDDRIGGNVQLSTLGG***********************************KKGMVLPFEPHSLTFDEVVYSVDMPEEMKVQGVLEDKLVLLNGVSGAFRPGVLTALMGVSGAGKTTLMDVLAGRKTGGYITGNITISGYPKKQETFARISGYCEQNDIHSPFVTIYESLLFSAWLRLSP*******************
************************************DDEEALKWAALEKLPTYNRLRKGILTTSRGEANEVDVYNLGLQERQRLIDKLVKVTDVDNERFLLKLKNRIDRVGIDLPKVEVRYEHLNVEAEAFLASNALPSFIKFYTNIFEDILNYLRIIPSKKRHLTILKDVSGVIKPGRLTLLLGPPSSGKTTLLLALAGKLDPTLKVSGTVTYNGHDMDEFVPQRTAAYISQHDNHIGEMTVRETLAFSARCQGVGTRYEMLTELARREKAAGIKPDPDIDVYMKAIATEGQEANVITDYYLKVLGLDVCADTMVGDEMIRGISGGQKKRVTTGEMMVGPALALFMDEISTGLDSSTTFQIVNCLRQNIHINSGTAVISLLQPAPETYDLFDDIILLSDGQIVYQGPRELVLEFFASMGFRCPKRKGVADFLQEVTSRKDQRQYWAHKEKPYRFVTVQEFAEAFQSFHVGQKISDELRTPFDKSKSHRAALTTETYGVGKRELLKANISRELLLMKRNSFVYIFKLIQIAFVAVVYMTLFLRTKMHKDTVTDGGIFAGATFFAITMVNFNGFSEISMTIAKLPVFYKQRDFRFFPPWAYAIPSWILKIPVSFLEVAVWVFLSYYVVGYDSNAGRFFKQYALLLGVNQMASALFRFIAVTGRNMVVANTFGSFALLVLLSLGGFILSREDIKKWWKWAYWCSPLTYAQNAIVANEFLGHSWKKFTQDSSETLGVQVLKSRGFFAHEYWYWLGLGALFGFVLLLNFAYTLALTFLDPFEKPRAVITEEIESNEQ****GGNVQLST***************************************KGMVLPFEPHSLTFDEVVYSVDMPEEMKVQGVLEDKLVLLNGVSGAFRPGVLTALMGVSGAGKTTLMDVLAGRKTGGYITGNITISGYPKKQETFARISGYCEQNDIHSPFVTIYESLLFSAWLRLSPEVDSETRKVGTKSPRVLGH
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHoooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHooooooooooooHHHHHHHHHHHHHHHHHHHHiiHHHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHHHoooHHHHHHHHHHHHHHHHHHHHiiiiiiiiHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHoooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MEGTHDIFMASTSLRRSASRWNTNSIGAFSRSSREEDDEEALKWAALEKLPTYNRLRKGILTTSRGEANEVDVYNLGLQERQRLIDKLVKVTDVDNERFLLKLKNRIDRVGIDLPKVEVRYEHLNVEAEAFLASNALPSFIKFYTNIFEDILNYLRIIPSKKRHLTILKDVSGVIKPGRLTLLLGPPSSGKTTLLLALAGKLDPTLKVSGTVTYNGHDMDEFVPQRTAAYISQHDNHIGEMTVRETLAFSARCQGVGTRYEMLTELARREKAAGIKPDPDIDVYMKAIATEGQEANVITDYYLKVLGLDVCADTMVGDEMIRGISGGQKKRVTTGEMMVGPALALFMDEISTGLDSSTTFQIVNCLRQNIHINSGTAVISLLQPAPETYDLFDDIILLSDGQIVYQGPRELVLEFFASMGFRCPKRKGVADFLQEVTSRKDQRQYWAHKEKPYRFVTVQEFAEAFQSFHVGQKISDELRTPFDKSKSHRAALTTETYGVGKRELLKANISRELLLMKRNSFVYIFKLIQIAFVAVVYMTLFLRTKMHKDTVTDGGIFAGATFFAITMVNFNGFSEISMTIAKLPVFYKQRDFRFFPPWAYAIPSWILKIPVSFLEVAVWVFLSYYVVGYDSNAGRFFKQYALLLGVNQMASALFRFIAVTGRNMVVANTFGSFALLVLLSLGGFILSREDIKKWWKWAYWCSPLTYAQNAIVANEFLGHSWKKFTQDSSETLGVQVLKSRGFFAHEYWYWLGLGALFGFVLLLNFAYTLALTFLDPFEKPRAVITEEIESNEQDDRIGGNVQLSTLGGSSNHNTRSGSTDDIRGQQSSSQSLSLAEAEASRPKKKGMVLPFEPHSLTFDEVVYSVDMPEEMKVQGVLEDKLVLLNGVSGAFRPGVLTALMGVSGAGKTTLMDVLAGRKTGGYITGNITISGYPKKQETFARISGYCEQNDIHSPFVTIYESLLFSAWLRLSPEVDSETRKVGTKSPRVLGH
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query991 2.2.26 [Sep-21-2011]
Q76CU2 1434 Pleiotropic drug resistan N/A no 0.949 0.656 0.689 0.0
Q949G3 1436 Pleiotropic drug resistan N/A no 0.939 0.648 0.679 0.0
Q8GU88 1444 Putative pleiotropic drug yes no 0.961 0.659 0.662 0.0
Q9M9E1 1423 ABC transporter G family yes no 0.955 0.665 0.656 0.0
O24367 1441 Pleiotropic drug resistan N/A no 0.958 0.659 0.668 0.0
Q8GU92 1464 Probable pleiotropic drug no no 0.960 0.650 0.663 0.0
Q8GU89 1450 Pleiotropic drug resistan no no 0.964 0.659 0.658 0.0
Q7PC80 1468 Probable pleiotropic drug no no 0.942 0.636 0.666 0.0
Q0JLC5 1457 Pleiotropic drug resistan no no 0.958 0.652 0.661 0.0
A2WSH0 1457 Pleiotropic drug resistan N/A no 0.958 0.652 0.660 0.0
>sp|Q76CU2|PDR1_TOBAC Pleiotropic drug resistance protein 1 OS=Nicotiana tabacum GN=PDR1 PE=2 SV=1 Back     alignment and function desciption
 Score = 1406 bits (3639), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 669/970 (68%), Positives = 791/970 (81%), Gaps = 29/970 (2%)

Query: 13  SLR-RSASRWNTNSIGAFSRSSREEDDEEALKWAALEKLPTYNRLRKGILTTSRGEANEV 71
           SLR  S S W  N +  FSRSSR+EDDEEALKWAALEKLPT++RLRKG+L  S+G A EV
Sbjct: 21  SLRANSNSIWRNNGVEIFSRSSRDEDDEEALKWAALEKLPTFDRLRKGLLFGSQGAAAEV 80

Query: 72  DVYNLGLQERQRLIDKLVKVTDVDNERFLLKLKNRIDRVGIDLPKVEVRYEHLNVEAEAF 131
           D+ +LG QER+ L+++LVKV D DNE+FLLKLKNRIDRVGIDLP +EVRYEHLN++A+A+
Sbjct: 81  DINDLGFQERKNLLERLVKVADEDNEKFLLKLKNRIDRVGIDLPTIEVRYEHLNIDADAY 140

Query: 132 LASNALPSFIKFYTNIFEDILNYLRIIPSKKRHLTILKDVSGVIKPGRLTLLLGPPSSGK 191
           + S +LP+F+ F TN  E +LN L I+ S+KR LTILKD+SG+IKP R+TLLLGPPSSGK
Sbjct: 141 VGSRSLPTFMNFMTNFVETLLNSLHILSSRKRQLTILKDISGIIKPCRMTLLLGPPSSGK 200

Query: 192 TTLLLALAGKLDPTLKVSGTVTYNGHDMDEFVPQRTAAYISQHDNHIGEMTVRETLAFSA 251
           TTLLLALAGKLDP LKV+G V+YNGH++ EFVPQRTAAYISQHD HIGEMTVRETL FSA
Sbjct: 201 TTLLLALAGKLDPALKVTGKVSYNGHELHEFVPQRTAAYISQHDLHIGEMTVRETLEFSA 260

Query: 252 RCQGVGTRYEMLTELARREKAAGIKPDPDIDVYMKAIATEGQEANVITDYYLKVLGLDVC 311
           RCQGVG+R+EML EL+RREKAA IKPD DID+YMKA ATEGQEANV+TDY LK+LGLD+C
Sbjct: 261 RCQGVGSRFEMLAELSRREKAANIKPDADIDIYMKAAATEGQEANVVTDYVLKILGLDIC 320

Query: 312 ADTMVGDEMIRGISGGQKKRVTTGEMMVGPALALFMDEISTGLDSSTTFQIVNCLRQNIH 371
           ADTMVGD+MIRGISGGQKKRVTTGEM+VGP+ ALFMDEISTGLDSSTT+ IVN LRQ++ 
Sbjct: 321 ADTMVGDDMIRGISGGQKKRVTTGEMLVGPSKALFMDEISTGLDSSTTYSIVNSLRQSVQ 380

Query: 372 INSGTAVISLLQPAPETYDLFDDIILLSDGQIVYQGPRELVLEFFASMGFRCPKRKGVAD 431
           I  GTAVISLLQPAPETY+LFDDIILLSDG IVYQGPR+ VLEFF SMGF+CP+RKGVAD
Sbjct: 381 ILKGTAVISLLQPAPETYNLFDDIILLSDGYIVYQGPRDDVLEFFESMGFKCPQRKGVAD 440

Query: 432 FLQEVTSRKDQRQYWAHKEKPYRFVTVQEFAEAFQSFHVGQKISDELRTPFDKSKSHRAA 491
           FLQEVTS+KDQ+QYW+ + +PYRF+T +EFAEA+QSFHVG+K+ DEL TPFDK+K H AA
Sbjct: 441 FLQEVTSKKDQQQYWSKRNEPYRFITSKEFAEAYQSFHVGRKLGDELATPFDKTKCHPAA 500

Query: 492 LTTETYGVGKRELLKANISRELLLMKRNSFVYIFKLIQIAFVAVVYMTLFLRTKMHKDTV 551
           LT E YG+GK+ELLK    RELLLMKRNSFVY+FK  Q+  +A++ MTLF RT+M +DT 
Sbjct: 501 LTNEKYGIGKKELLKVCTERELLLMKRNSFVYMFKFSQLTIMALITMTLFFRTEMPRDTT 560

Query: 552 TDGGIFAGATFFAITMVNFNGFSEISMTIAKLPVFYKQRDFRFFPPWAYAIPSWILKIPV 611
            DGGI+AGA FF + M+ FNG SE++MTI KLPVFYKQRD  FFP WAYAIPSWILKIPV
Sbjct: 561 DDGGIYAGALFFVVIMIMFNGMSELAMTIFKLPVFYKQRDLLFFPSWAYAIPSWILKIPV 620

Query: 612 SFLEVAVWVFLSYYVVGYDSNAGRFFKQYALLLGVNQMASALFRFIAVTGRNMVVANTFG 671
           + +EV +WV L+YYV+G+D N  RF KQ+ LL+ VNQMAS +FRFI   GR M VA+TFG
Sbjct: 621 TLVEVGLWVILTYYVIGFDPNITRFLKQFLLLIVVNQMASGMFRFIGAVGRTMGVASTFG 680

Query: 672 SFALLVLLSLGGFILSREDIKKWWKWAYWCSPLTYAQNAIVANEFLGHSWKKFTQDSSET 731
           SFALL+  +LGGF+LSR+D+K WW W YW SP+ Y+ N+I+ NEF G  W       +ET
Sbjct: 681 SFALLLQFALGGFVLSRDDVKSWWIWGYWISPMMYSVNSILVNEFDGKKWNHIVPGGNET 740

Query: 732 LGVQVLKSRGFFAHEYWYWLGLGALFGFVLLLNFAYTLALTFLDPFEKPRAVITEEIESN 791
           LG  V+KSRGFF   YWYW+G+GAL GF ++ NF Y+LAL +L+PF+KP+AV+ E+ E+ 
Sbjct: 741 LGSTVVKSRGFFPEAYWYWIGVGALVGFTVVFNFCYSLALAYLNPFDKPQAVLPEDGENA 800

Query: 792 EQDDRIGGNVQLSTLGGSSNHNTRSGSTDDIRGQQSSSQSLSLAEAEASRPKKKGMVLPF 851
           E              G  S+  T +   D I   Q++               KKGMVLPF
Sbjct: 801 EN-------------GEVSSQITSTDGGDSISESQNN---------------KKGMVLPF 832

Query: 852 EPHSLTFDEVVYSVDMPEEMKVQGVLEDKLVLLNGVSGAFRPGVLTALMGVSGAGKTTLM 911
           EPHS+TFD+VVYSVDMP+EMK QG  ED+LVLL GVSGAFRPGVLTALMGVSGAGKTTLM
Sbjct: 833 EPHSITFDDVVYSVDMPQEMKEQGAGEDRLVLLKGVSGAFRPGVLTALMGVSGAGKTTLM 892

Query: 912 DVLAGRKTGGYITGNITISGYPKKQETFARISGYCEQNDIHSPFVTIYESLLFSAWLRLS 971
           DVLAGRKTGGYI G I ISGYPKKQETFARISGYCEQNDIHSP+VT+YESL++SAWLRL 
Sbjct: 893 DVLAGRKTGGYIDGEIKISGYPKKQETFARISGYCEQNDIHSPYVTVYESLVYSAWLRLP 952

Query: 972 PEVDSETRKV 981
            +VD +TRK+
Sbjct: 953 QDVDEKTRKM 962




May be a general defense protein.
Nicotiana tabacum (taxid: 4097)
>sp|Q949G3|PDR1_NICPL Pleiotropic drug resistance protein 1 OS=Nicotiana plumbaginifolia GN=PDR1 PE=1 SV=1 Back     alignment and function description
>sp|Q8GU88|PDR7_ORYSJ Putative pleiotropic drug resistance protein 7 OS=Oryza sativa subsp. japonica GN=PDR7 PE=3 SV=1 Back     alignment and function description
>sp|Q9M9E1|AB40G_ARATH ABC transporter G family member 40 OS=Arabidopsis thaliana GN=ABCG40 PE=1 SV=1 Back     alignment and function description
>sp|O24367|TUR2_SPIPO Pleiotropic drug resistance protein TUR2 OS=Spirodela polyrrhiza GN=TUR2 PE=1 SV=1 Back     alignment and function description
>sp|Q8GU92|PDR2_ORYSJ Probable pleiotropic drug resistance protein 2 OS=Oryza sativa subsp. japonica GN=PDR2 PE=3 SV=1 Back     alignment and function description
>sp|Q8GU89|PDR4_ORYSJ Pleiotropic drug resistance protein 4 OS=Oryza sativa subsp. japonica GN=PDR4 PE=2 SV=1 Back     alignment and function description
>sp|Q7PC80|PDR1_ORYSJ Probable pleiotropic drug resistance protein 1 OS=Oryza sativa subsp. japonica GN=PDR1 PE=3 SV=1 Back     alignment and function description
>sp|Q0JLC5|PDR3_ORYSJ Pleiotropic drug resistance protein 3 OS=Oryza sativa subsp. japonica GN=PDR3 PE=2 SV=1 Back     alignment and function description
>sp|A2WSH0|PDR3_ORYSI Pleiotropic drug resistance protein 3 OS=Oryza sativa subsp. indica GN=PDR3 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query991
297743362 3142 unnamed protein product [Vitis vinifera] 0.982 0.309 0.721 0.0
359482993 1430 PREDICTED: pleiotropic drug resistance p 0.965 0.669 0.723 0.0
359482991 1445 PREDICTED: pleiotropic drug resistance p 0.973 0.667 0.719 0.0
359482989 1426 PREDICTED: pleiotropic drug resistance p 0.961 0.668 0.721 0.0
356550580 1426 PREDICTED: pleiotropic drug resistance p 0.960 0.667 0.710 0.0
359482642 1429 PREDICTED: pleiotropic drug resistance p 0.962 0.667 0.711 0.0
356555825 1427 PREDICTED: pleiotropic drug resistance p 0.958 0.665 0.716 0.0
255543331 1429 ATP-binding cassette transporter, putati 0.962 0.667 0.712 0.0
356555801 1426 PREDICTED: pleiotropic drug resistance p 0.960 0.667 0.714 0.0
297743343 1642 unnamed protein product [Vitis vinifera] 0.947 0.571 0.714 0.0
>gi|297743362|emb|CBI36229.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
 Score = 1496 bits (3872), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 709/982 (72%), Positives = 834/982 (84%), Gaps = 8/982 (0%)

Query: 3   GTHDIFMASTSLRRSASRWNTNSIGAFSRSSREEDDEEALKWAALEKLPTYNRLRKGILT 62
            T +I+ A+ SLRR+ S W ++    FSRSSR+EDDEEALKWAALEKLPTYNRLRKG+L 
Sbjct: 2   ATAEIYRAAGSLRRNGSMWRSSGADVFSRSSRDEDDEEALKWAALEKLPTYNRLRKGLLM 61

Query: 63  TSRGEANEVDVYNLGLQERQRLIDKLVKVTDVDNERFLLKLKNRIDRVGIDLPKVEVRYE 122
            S+G A+EVDV NLG QE+Q L+++LVK+ + DNE+FLL+L+NRI+RVGI +P++EVR+E
Sbjct: 62  GSQGAASEVDVDNLGYQEKQSLMERLVKIAEEDNEKFLLRLRNRIERVGITIPEIEVRFE 121

Query: 123 HLNVEAEAFLASNALPSFIKFYTNIFEDILNYLRIIPSKKRHLTILKDVSGVIKPGRLTL 182
           HL ++AEAF+ S ALPSF  F  N  ED L  LRI+PS++R  TIL DVSG+IKP R+TL
Sbjct: 122 HLTIDAEAFIGSRALPSFHNFMFNKIEDALTGLRILPSRRRKFTILHDVSGIIKPQRMTL 181

Query: 183 LLGPPSSGKTTLLLALAGKLDPTLKVSGTVTYNGHDMDEFVPQRTAAYISQHDNHIGEMT 242
           LLGPPSSGKTTLLLAL+GKLDPTLKV+G VTYNGH MDEFVPQRTAAYISQHD HIGEMT
Sbjct: 182 LLGPPSSGKTTLLLALSGKLDPTLKVTGRVTYNGHGMDEFVPQRTAAYISQHDTHIGEMT 241

Query: 243 VRETLAFSARCQGVGTRYEMLTELARREKAAGIKPDPDIDVYMKAIATEGQEANVITDYY 302
           VRETLAFSARCQGVG RY+ML EL+RREKAA IKPDPD+DV+MKA ATEGQ+ NV+TDY 
Sbjct: 242 VRETLAFSARCQGVGDRYDMLAELSRREKAANIKPDPDLDVFMKAAATEGQKENVVTDYT 301

Query: 303 LKVLGLDVCADTMVGDEMIRGISGGQKKRVTTGEMMVGPALALFMDEISTGLDSSTTFQI 362
           LK+LGLD+CADTMVGDEMIRGISGGQ+KRVTTGEM+VGP+ ALFMDEISTGLDSSTTFQI
Sbjct: 302 LKILGLDICADTMVGDEMIRGISGGQRKRVTTGEMLVGPSKALFMDEISTGLDSSTTFQI 361

Query: 363 VNCLRQNIHINSGTAVISLLQPAPETYDLFDDIILLSDGQIVYQGPRELVLEFFASMGFR 422
           VNCL+Q IHI +GTAVISLLQPAPETY+LFDDIILLSDG+I+YQGPRE VLEFF S GFR
Sbjct: 362 VNCLKQTIHILNGTAVISLLQPAPETYNLFDDIILLSDGRIIYQGPREDVLEFFESTGFR 421

Query: 423 CPKRKGVADFLQEVTSRKDQRQYWAHKEKPYRFVTVQEFAEAFQSFHVGQKISDELRTPF 482
           CP+RKGVADFLQEVTS+KDQ+QYWA KE+PYRFVTV+EFAEAFQSFH G+K+ DEL +P+
Sbjct: 422 CPERKGVADFLQEVTSKKDQQQYWARKEEPYRFVTVKEFAEAFQSFHTGRKVGDELASPY 481

Query: 483 DKSKSHRAALTTETYGVGKRELLKANISRELLLMKRNSFVYIFKLIQIAFVAVVYMTLFL 542
           DK+KSH AALTT+ YGV K+ELL AN+SRE LLMKRNSFVY+FKL Q+A +AV+ MTLFL
Sbjct: 482 DKTKSHPAALTTKKYGVNKKELLDANMSREYLLMKRNSFVYVFKLTQLAIMAVITMTLFL 541

Query: 543 RTKMHKDTVTDGGIFAGATFFAITMVNFNGFSEISMTIAKLPVFYKQRDFRFFPPWAYAI 602
           RT+MHK++V DG I+ GA FF + M+ FNG +E++M IAKLPVFYKQRD  F+P WAYA+
Sbjct: 542 RTEMHKNSVDDGNIYTGALFFTVVMIMFNGMAELAMAIAKLPVFYKQRDLLFYPAWAYAL 601

Query: 603 PSWILKIPVSFLEVAVWVFLSYYVVGYDSNAGRFFKQYALLLGVNQMASALFRFIAVTGR 662
           P+WILKIP++F+EV VWVF++YYV+G+D N  R F+QY LLL VNQMAS LFR IA  GR
Sbjct: 602 PTWILKIPITFIEVGVWVFMTYYVIGFDPNVERLFRQYLLLLLVNQMASGLFRLIASAGR 661

Query: 663 NMVVANTFGSFALLVLLSLGGFILSREDIKKWWKWAYWCSPLTYAQNAIVANEFLGHSWK 722
           NM+V+NTFG+F LL+LL+LGGFILS +D+KKWW W YWCSPL YAQNAIV NEFLGHSWK
Sbjct: 662 NMIVSNTFGAFVLLMLLALGGFILSHDDVKKWWIWGYWCSPLMYAQNAIVVNEFLGHSWK 721

Query: 723 KFTQDSSETLGVQVLKSRGFFAHEYWYWLGLGALFGFVLLLNFAYTLALTFLDPFEKPRA 782
           K    S+E+LGV VL +RGFF   YWYW+G GALFGF+LL NF YTL L FL+PF+KP+A
Sbjct: 722 KNVTGSTESLGVTVLNNRGFFTEAYWYWIGAGALFGFILLFNFGYTLCLNFLNPFDKPQA 781

Query: 783 VITEEIESNEQDDRIGGNVQLSTLGGSSNHNTRSGSTDDIRGQQSSSQSLSLAE---AEA 839
           VI EE ++ E     GG ++LS    S +    +   ++I G+  SS S ++ E   A A
Sbjct: 782 VIVEESDNAE----TGGQIELSQRNSSIDQAASTERGEEI-GRSISSTSSAVREEAVAGA 836

Query: 840 SRPKKKGMVLPFEPHSLTFDEVVYSVDMPEEMKVQGVLEDKLVLLNGVSGAFRPGVLTAL 899
           +  KKKGMVLPF+P+S+TFD++ YSVDMPEEMK QGV+EDKL LL GVSGAFRPGVLTAL
Sbjct: 837 NHNKKKGMVLPFQPYSITFDDIRYSVDMPEEMKSQGVVEDKLELLKGVSGAFRPGVLTAL 896

Query: 900 MGVSGAGKTTLMDVLAGRKTGGYITGNITISGYPKKQETFARISGYCEQNDIHSPFVTIY 959
           MGVSGAGKTTLMDVLAGRKTGGYI GNITISGYPKKQETFARISGYCEQNDIHSP VT+Y
Sbjct: 897 MGVSGAGKTTLMDVLAGRKTGGYIEGNITISGYPKKQETFARISGYCEQNDIHSPHVTVY 956

Query: 960 ESLLFSAWLRLSPEVDSETRKV 981
           ESLL+SAWLRL  +V SETR++
Sbjct: 957 ESLLYSAWLRLPSDVKSETRQM 978




Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|359482993|ref|XP_002285178.2| PREDICTED: pleiotropic drug resistance protein 1 isoform 1 [Vitis vinifera] Back     alignment and taxonomy information
>gi|359482991|ref|XP_003632876.1| PREDICTED: pleiotropic drug resistance protein 1 isoform 3 [Vitis vinifera] Back     alignment and taxonomy information
>gi|359482989|ref|XP_003632875.1| PREDICTED: pleiotropic drug resistance protein 1 isoform 2 [Vitis vinifera] Back     alignment and taxonomy information
>gi|356550580|ref|XP_003543663.1| PREDICTED: pleiotropic drug resistance protein 1-like [Glycine max] Back     alignment and taxonomy information
>gi|359482642|ref|XP_002285020.2| PREDICTED: pleiotropic drug resistance protein 1-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|356555825|ref|XP_003546230.1| PREDICTED: pleiotropic drug resistance protein 1-like [Glycine max] Back     alignment and taxonomy information
>gi|255543331|ref|XP_002512728.1| ATP-binding cassette transporter, putative [Ricinus communis] gi|223547739|gb|EEF49231.1| ATP-binding cassette transporter, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|356555801|ref|XP_003546218.1| PREDICTED: pleiotropic drug resistance protein 1-like isoform 1 [Glycine max] Back     alignment and taxonomy information
>gi|297743343|emb|CBI36210.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms


Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q9M9E1AB40G_ARATHNo assigned EC number0.65650.95560.6654yesno
Q8GU88PDR7_ORYSJNo assigned EC number0.66280.96160.6599yesno

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Your Input:
ABC
SubName- Full=Chromosome chr9 scaffold_7, whole genome shotgun sequence; (1433 aa)
(Vitis vinifera)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query991
PLN03140 1470 PLN03140, PLN03140, ABC transporter G family membe 0.0
TIGR00956 1394 TIGR00956, 3a01205, Pleiotropic Drug Resistance (P 0.0
TIGR00955617 TIGR00955, 3a01204, The Eye Pigment Precursor Tran 6e-77
cd03232192 cd03232, ABCG_PDR_domain2, Second domain of the pl 3e-49
pfam01061210 pfam01061, ABC2_membrane, ABC-2 type transporter 4e-49
TIGR009561394 TIGR00956, 3a01205, Pleiotropic Drug Resistance (P 7e-44
cd03234226 cd03234, ABCG_White, White pigment protein homolog 1e-41
cd03233202 cd03233, ABCG_PDR_domain1, First domain of the ple 4e-39
COG1131293 COG1131, CcmA, ABC-type multidrug transport system 9e-38
cd03233202 cd03233, ABCG_PDR_domain1, First domain of the ple 6e-37
PLN031401470 PLN03140, PLN03140, ABC transporter G family membe 7e-35
PLN03211659 PLN03211, PLN03211, ABC transporter G-25; Provisio 3e-34
cd03213194 cd03213, ABCG_EPDR, Eye pigment and drug resistanc 2e-32
cd03213194 cd03213, ABCG_EPDR, Eye pigment and drug resistanc 4e-30
pfam0837065 pfam08370, PDR_assoc, Plant PDR ABC transporter as 5e-28
cd03263220 cd03263, ABC_subfamily_A, ATP-binding cassette dom 5e-23
COG1120258 COG1120, FepC, ABC-type cobalamin/Fe3+-siderophore 7e-22
TIGR00955 617 TIGR00955, 3a01204, The Eye Pigment Precursor Tran 1e-21
cd03232192 cd03232, ABCG_PDR_domain2, Second domain of the pl 1e-21
cd03225211 cd03225, ABC_cobalt_CbiO_domain1, First domain of 1e-21
cd03234226 cd03234, ABCG_White, White pigment protein homolog 1e-20
cd03213194 cd03213, ABCG_EPDR, Eye pigment and drug resistanc 2e-20
COG1122235 COG1122, CbiO, ABC-type cobalt transport system, A 3e-18
COG1118345 COG1118, CysA, ABC-type sulfate/molybdate transpor 5e-18
cd03255218 cd03255, ABC_MJ0796_LolCDE_FtsE, ATP-binding casse 7e-18
cd03261235 cd03261, ABC_Org_Solvent_Resistant, ATP-binding ca 6e-17
COG4555245 COG4555, NatA, ABC-type Na+ transport system, ATPa 1e-16
COG3839338 COG3839, MalK, ABC-type sugar transport systems, A 2e-16
cd03256241 cd03256, ABC_PhnC_transporter, ATP-binding cassett 2e-16
TIGR00968237 TIGR00968, 3a0106s01, sulfate ABC transporter, ATP 4e-16
COG1136226 COG1136, SalX, ABC-type antimicrobial peptide tran 6e-16
cd03257228 cd03257, ABC_NikE_OppD_transporters, ATP-binding c 8e-16
cd03259213 cd03259, ABC_Carb_Solutes_like, ATP-binding casset 2e-15
COG1121254 COG1121, ZnuC, ABC-type Mn/Zn transport systems, A 5e-15
cd03224222 cd03224, ABC_TM1139_LivF_branched, ATP-binding cas 8e-15
TIGR01978243 TIGR01978, sufC, FeS assembly ATPase SufC 8e-15
COG3638258 COG3638, COG3638, ABC-type phosphate/phosphonate t 8e-15
COG3842352 COG3842, PotA, ABC-type spermidine/putrescine tran 1e-14
COG4988559 COG4988, CydD, ABC-type transport system involved 1e-14
cd03219236 cd03219, ABC_Mj1267_LivG_branched, ATP-binding cas 2e-14
COG1131 293 COG1131, CcmA, ABC-type multidrug transport system 5e-14
TIGR03375694 TIGR03375, type_I_sec_LssB, type I secretion syste 5e-14
PLN03211 659 PLN03211, PLN03211, ABC transporter G-25; Provisio 9e-14
COG4559259 COG4559, COG4559, ABC-type hemin transport system, 1e-13
COG0411250 COG0411, LivG, ABC-type branched-chain amino acid 1e-13
cd03296239 cd03296, ABC_CysA_sulfate_importer, ATP-binding ca 1e-13
cd03235213 cd03235, ABC_Metallic_Cations, ATP-binding cassett 1e-13
TIGR02857529 TIGR02857, CydD, thiol reductant ABC exporter, Cyd 1e-13
PRK13539207 PRK13539, PRK13539, cytochrome c biogenesis protei 2e-13
cd03245220 cd03245, ABCC_bacteriocin_exporters, ATP-binding c 2e-13
TIGR03873256 TIGR03873, F420-0_ABC_ATP, proposed F420-0 ABC tra 3e-13
cd03264211 cd03264, ABC_drug_resistance_like, ABC-type multid 3e-13
COG0396251 COG0396, sufC, Cysteine desulfurase activator ATPa 3e-13
cd03232192 cd03232, ABCG_PDR_domain2, Second domain of the pl 4e-13
cd03230173 cd03230, ABC_DR_subfamily_A, ATP-binding cassette 5e-13
TIGR02315243 TIGR02315, ABC_phnC, phosphonate ABC transporter, 5e-13
PRK13548258 PRK13548, hmuV, hemin importer ATP-binding subunit 6e-13
cd03293220 cd03293, ABC_NrtD_SsuB_transporters, ATP-binding c 7e-13
COG1127263 COG1127, Ttg2A, ABC-type transport system involved 9e-13
COG2274709 COG2274, SunT, ABC-type bacteriocin/lantibiotic ex 9e-13
cd03233202 cd03233, ABCG_PDR_domain1, First domain of the ple 1e-12
cd03263220 cd03263, ABC_subfamily_A, ATP-binding cassette dom 1e-12
cd03266218 cd03266, ABC_NatA_sodium_exporter, ATP-binding cas 1e-12
cd03228171 cd03228, ABCC_MRP_Like, ATP-binding cassette domai 1e-12
cd03297214 cd03297, ABC_ModC_molybdenum_transporter, ATP-bind 2e-12
cd03250204 cd03250, ABCC_MRP_domain1, ATP-binding cassette do 2e-12
cd03249238 cd03249, ABC_MTABC3_MDL1_MDL2, ATP-binding cassett 2e-12
cd03253236 cd03253, ABCC_ATM1_transporter, ATP-binding casset 2e-12
COG0410237 COG0410, LivF, ABC-type branched-chain amino acid 3e-12
TIGR02868530 TIGR02868, CydC, thiol reductant ABC exporter, Cyd 3e-12
TIGR02982220 TIGR02982, heterocyst_DevA, ABC exporter ATP-bindi 4e-12
cd03301213 cd03301, ABC_MalK_N, The N-terminal ATPase domain 4e-12
PRK11231255 PRK11231, fecE, iron-dicitrate transporter ATP-bin 6e-12
cd03300232 cd03300, ABC_PotA_N, ATP-binding cassette domain o 1e-11
PRK13547272 PRK13547, hmuV, hemin importer ATP-binding subunit 2e-11
cd03226205 cd03226, ABC_cobalt_CbiO_domain2, Second domain of 2e-11
cd00267157 cd00267, ABC_ATPase, ATP-binding cassette transpor 2e-11
cd03260227 cd03260, ABC_PstB_phosphate_transporter, ATP-bindi 2e-11
cd03269210 cd03269, ABC_putative_ATPase, ATP-binding cassette 3e-11
COG4604252 COG4604, CeuD, ABC-type enterochelin transport sys 3e-11
COG1123539 COG1123, COG1123, ATPase components of various ABC 3e-11
TIGR03864236 TIGR03864, PQQ_ABC_ATP, ABC transporter, ATP-bindi 3e-11
cd03265220 cd03265, ABC_DrrA, Daunorubicin/doxorubicin resist 4e-11
cd03251234 cd03251, ABCC_MsbA, ATP-binding cassette domain of 4e-11
COG1135339 COG1135, AbcC, ABC-type metal ion transport system 5e-11
COG1123539 COG1123, COG1123, ATPase components of various ABC 7e-11
cd03299235 cd03299, ABC_ModC_like, ATP-binding cassette domai 8e-11
cd03292214 cd03292, ABC_FtsE_transporter, ATP-binding cassett 1e-10
TIGR02203571 TIGR02203, MsbA_lipidA, lipid A export permease/AT 2e-10
PRK09700510 PRK09700, PRK09700, D-allose transporter ATP-bindi 2e-10
TIGR03258362 TIGR03258, PhnT, 2-aminoethylphosphonate ABC trans 2e-10
COG4181228 COG4181, COG4181, Predicted ABC-type transport sys 4e-10
PRK09452375 PRK09452, potA, putrescine/spermidine ABC transpor 4e-10
cd03258233 cd03258, ABC_MetN_methionine_transporter, ATP-bind 5e-10
PRK13640282 PRK13640, cbiO, cobalt transporter ATP-binding sub 5e-10
cd03264211 cd03264, ABC_drug_resistance_like, ABC-type multid 6e-10
cd03214180 cd03214, ABC_Iron-Siderophores_B12_Hemin, ATP-bind 6e-10
COG1132567 COG1132, MdlB, ABC-type multidrug transport system 6e-10
COG1119257 COG1119, ModF, ABC-type molybdenum transport syste 7e-10
TIGR01193708 TIGR01193, bacteriocin_ABC, ABC-type bacteriocin t 8e-10
COG3840231 COG3840, ThiQ, ABC-type thiamine transport system, 1e-09
COG0444316 COG0444, DppD, ABC-type dipeptide/oligopeptide/nic 1e-09
COG4525259 COG4525, TauB, ABC-type taurine transport system, 1e-09
COG1125309 COG1125, OpuBA, ABC-type proline/glycine betaine t 1e-09
TIGR01166190 TIGR01166, cbiO, cobalt transport protein ATP-bind 1e-09
cd03230173 cd03230, ABC_DR_subfamily_A, ATP-binding cassette 2e-09
COG4586325 COG4586, COG4586, ABC-type uncharacterized transpo 2e-09
TIGR01188302 TIGR01188, drrA, daunorubicin resistance ABC trans 3e-09
TIGR03522301 TIGR03522, GldA_ABC_ATP, gliding motility-associat 5e-09
COG4987573 COG4987, CydC, ABC-type transport system involved 6e-09
COG4133209 COG4133, CcmA, ABC-type transport system involved 7e-09
TIGR01187325 TIGR01187, potA, spermidine/putrescine ABC transpo 7e-09
cd03254229 cd03254, ABCC_Glucan_exporter_like, ATP-binding ca 8e-09
TIGR01189198 TIGR01189, ccmA, heme ABC exporter, ATP-binding pr 1e-08
COG1116248 COG1116, TauB, ABC-type nitrate/sulfonate/bicarbon 1e-08
TIGR01277213 TIGR01277, thiQ, thiamine ABC transporter, ATP-bin 1e-08
COG1126240 COG1126, GlnQ, ABC-type polar amino acid transport 2e-08
TIGR03265353 TIGR03265, PhnT2, putative 2-aminoethylphosphonate 2e-08
cd03252237 cd03252, ABCC_Hemolysin, ATP-binding cassette doma 4e-08
PRK11248255 PRK11248, tauB, taurine transporter ATP-binding su 5e-08
PRK13537306 PRK13537, PRK13537, nodulation ABC transporter Nod 5e-08
TIGR02673214 TIGR02673, FtsE, cell division ATP-binding protein 5e-08
COG4152300 COG4152, COG4152, ABC-type uncharacterized transpo 5e-08
PRK13547 272 PRK13547, hmuV, hemin importer ATP-binding subunit 6e-08
cd03229178 cd03229, ABC_Class3, ATP-binding cassette domain o 7e-08
cd03268208 cd03268, ABC_BcrA_bacitracin_resist, ATP-binding c 9e-08
PRK10253265 PRK10253, PRK10253, iron-enterobactin transporter 9e-08
cd03295242 cd03295, ABC_OpuCA_Osmoprotection, ATP-binding cas 1e-07
TIGR01842544 TIGR01842, type_I_sec_PrtD, type I secretion syste 1e-07
PRK10851353 PRK10851, PRK10851, sulfate/thiosulfate transporte 1e-07
PRK10247225 PRK10247, PRK10247, putative ABC transporter ATP-b 1e-07
COG4136213 COG4136, COG4136, ABC-type uncharacterized transpo 1e-07
cd00267157 cd00267, ABC_ATPase, ATP-binding cassette transpor 2e-07
cd00267157 cd00267, ABC_ATPase, ATP-binding cassette transpor 2e-07
cd03214180 cd03214, ABC_Iron-Siderophores_B12_Hemin, ATP-bind 2e-07
PRK13639275 PRK13639, cbiO, cobalt transporter ATP-binding sub 2e-07
TIGR02769265 TIGR02769, nickel_nikE, nickel import ATP-binding 2e-07
COG0488530 COG0488, Uup, ATPase components of ABC transporter 2e-07
TIGR02323253 TIGR02323, CP_lyasePhnK, phosphonate C-P lyase sys 3e-07
COG1117253 COG1117, PstB, ABC-type phosphate transport system 3e-07
COG1124252 COG1124, DppF, ABC-type dipeptide/oligopeptide/nic 3e-07
TIGR03410230 TIGR03410, urea_trans_UrtE, urea ABC transporter, 3e-07
cd03225211 cd03225, ABC_cobalt_CbiO_domain1, First domain of 4e-07
PRK14239252 PRK14239, PRK14239, phosphate transporter ATP-bind 4e-07
PRK14272252 PRK14272, PRK14272, phosphate ABC transporter ATP- 4e-07
PRK09580248 PRK09580, sufC, cysteine desulfurase ATPase compon 4e-07
TIGR02770230 TIGR02770, nickel_nikD, nickel import ATP-binding 5e-07
cd03298211 cd03298, ABC_ThiQ_thiamine_transporter, ATP-bindin 5e-07
pfam00005119 pfam00005, ABC_tran, ABC transporter 6e-07
PRK13643288 PRK13643, cbiO, cobalt transporter ATP-binding sub 6e-07
TIGR00972247 TIGR00972, 3a0107s01c2, phosphate ABC transporter, 7e-07
COG4619223 COG4619, COG4619, ABC-type uncharacterized transpo 7e-07
PRK13636283 PRK13636, cbiO, cobalt transporter ATP-binding sub 7e-07
PRK14250241 PRK14250, PRK14250, phosphate ABC transporter ATP- 7e-07
TIGR01184230 TIGR01184, ntrCD, nitrate transport ATP-binding su 8e-07
PRK13651305 PRK13651, PRK13651, cobalt transporter ATP-binding 8e-07
COG1136226 COG1136, SalX, ABC-type antimicrobial peptide tran 1e-06
COG4988 559 COG4988, CydD, ABC-type transport system involved 1e-06
TIGR01288303 TIGR01288, nodI, ATP-binding ABC transporter famil 1e-06
cd03217200 cd03217, ABC_FeS_Assembly, ABC-type transport syst 1e-06
PRK13536340 PRK13536, PRK13536, nodulation factor exporter sub 1e-06
COG4618580 COG4618, ArpD, ABC-type protease/lipase transport 1e-06
PRK09536402 PRK09536, btuD, corrinoid ABC transporter ATPase; 2e-06
TIGR03005252 TIGR03005, ectoine_ehuA, ectoine/hydroxyectoine AB 2e-06
COG5265497 COG5265, ATM1, ABC-type transport system involved 2e-06
PRK13538204 PRK13538, PRK13538, cytochrome c biogenesis protei 2e-06
TIGR02204576 TIGR02204, MsbA_rel, ABC transporter, permease/ATP 2e-06
TIGR03771223 TIGR03771, anch_rpt_ABC, anchored repeat-type ABC 2e-06
cd03255218 cd03255, ABC_MJ0796_LolCDE_FtsE, ATP-binding casse 3e-06
PRK13638271 PRK13638, cbiO, cobalt transporter ATP-binding sub 3e-06
cd03216163 cd03216, ABC_Carb_Monos_I, First domain of the ATP 3e-06
PRK13548 258 PRK13548, hmuV, hemin importer ATP-binding subunit 5e-06
cd03294269 cd03294, ABC_Pro_Gly_Betaine, ATP-binding cassette 5e-06
PRK03695248 PRK03695, PRK03695, vitamin B12-transporter ATPase 7e-06
CHL00131252 CHL00131, ycf16, sulfate ABC transporter protein; 7e-06
PRK13635279 PRK13635, cbiO, cobalt transporter ATP-binding sub 8e-06
cd03231201 cd03231, ABC_CcmA_heme_exporter, Cytochrome c biog 8e-06
cd03235213 cd03235, ABC_Metallic_Cations, ATP-binding cassett 9e-06
cd03262213 cd03262, ABC_HisP_GlnQ, ATP-binding cassette domai 9e-06
TIGR03864 236 TIGR03864, PQQ_ABC_ATP, ABC transporter, ATP-bindi 1e-05
COG4175386 COG4175, ProV, ABC-type proline/glycine betaine tr 1e-05
PRK11160574 PRK11160, PRK11160, cysteine/glutathione ABC trans 1e-05
COG4148352 COG4148, ModC, ABC-type molybdate transport system 1e-05
PRK11432351 PRK11432, fbpC, ferric transporter ATP-binding sub 1e-05
PRK13637287 PRK13637, cbiO, cobalt transporter ATP-binding sub 1e-05
cd03219 236 cd03219, ABC_Mj1267_LivG_branched, ATP-binding cas 2e-05
cd03228171 cd03228, ABCC_MRP_Like, ATP-binding cassette domai 2e-05
cd03217200 cd03217, ABC_FeS_Assembly, ABC-type transport syst 2e-05
PRK13543214 PRK13543, PRK13543, cytochrome c biogenesis protei 2e-05
PRK14247250 PRK14247, PRK14247, phosphate ABC transporter ATP- 2e-05
PRK14270251 PRK14270, PRK14270, phosphate ABC transporter ATP- 2e-05
PRK14255252 PRK14255, PRK14255, phosphate ABC transporter ATP- 2e-05
TIGR01186363 TIGR01186, proV, glycine betaine/L-proline transpo 2e-05
cd03259213 cd03259, ABC_Carb_Solutes_like, ATP-binding casset 3e-05
PRK11174588 PRK11174, PRK11174, cysteine/glutathione ABC trans 3e-05
cd03247178 cd03247, ABCC_cytochrome_bd, ATP-binding cassette 3e-05
cd03246173 cd03246, ABCC_Protease_Secretion, ATP-binding cass 3e-05
TIGR01192585 TIGR01192, chvA, glucan exporter ATP-binding prote 3e-05
TIGR01978 243 TIGR01978, sufC, FeS assembly ATPase SufC 4e-05
cd03246173 cd03246, ABCC_Protease_Secretion, ATP-binding cass 4e-05
TIGR02142354 TIGR02142, modC_ABC, molybdenum ABC transporter, A 4e-05
COG1134249 COG1134, TagH, ABC-type polysaccharide/polyol phos 4e-05
COG1129 500 COG1129, MglA, ABC-type sugar transport system, AT 4e-05
cd03267236 cd03267, ABC_NatA_like, ATP-binding cassette domai 4e-05
COG2884223 COG2884, FtsE, Predicted ATPase involved in cell d 4e-05
PRK13549 506 PRK13549, PRK13549, xylose transporter ATP-binding 5e-05
TIGR03411242 TIGR03411, urea_trans_UrtD, urea ABC transporter, 5e-05
TIGR012572272 TIGR01257, rim_protein, retinal-specific rim ABC t 5e-05
COG1120 258 COG1120, FepC, ABC-type cobalamin/Fe3+-siderophore 6e-05
cd03296 239 cd03296, ABC_CysA_sulfate_importer, ATP-binding ca 6e-05
COG0842286 COG0842, COG0842, ABC-type multidrug transport sys 6e-05
cd03226205 cd03226, ABC_cobalt_CbiO_domain2, Second domain of 7e-05
COG1129500 COG1129, MglA, ABC-type sugar transport system, AT 7e-05
cd03290218 cd03290, ABCC_SUR1_N, ATP-binding cassette domain 7e-05
cd03229178 cd03229, ABC_Class3, ATP-binding cassette domain o 8e-05
COG1121 254 COG1121, ZnuC, ABC-type Mn/Zn transport systems, A 1e-04
TIGR02857529 TIGR02857, CydD, thiol reductant ABC exporter, Cyd 1e-04
COG0396 251 COG0396, sufC, Cysteine desulfurase activator ATPa 1e-04
COG1123 539 COG1123, COG1123, ATPase components of various ABC 1e-04
COG4608268 COG4608, AppF, ABC-type oligopeptide transport sys 1e-04
TIGR03797686 TIGR03797, NHLM_micro_ABC2, NHLM bacteriocin syste 1e-04
PLN032321495 PLN03232, PLN03232, ABC transporter C family membe 1e-04
PRK13647274 PRK13647, cbiO, cobalt transporter ATP-binding sub 1e-04
COG4138248 COG4138, BtuD, ABC-type cobalamin transport system 1e-04
PRK11607377 PRK11607, potG, putrescine transporter ATP-binding 1e-04
TIGR02211221 TIGR02211, LolD_lipo_ex, lipoprotein releasing sys 1e-04
cd03248226 cd03248, ABCC_TAP, ATP-binding cassette domain of 1e-04
PRK13632271 PRK13632, cbiO, cobalt transporter ATP-binding sub 1e-04
PRK10575265 PRK10575, PRK10575, iron-hydroxamate transporter A 1e-04
COG4559 259 COG4559, COG4559, ABC-type hemin transport system, 2e-04
TIGR02868530 TIGR02868, CydC, thiol reductant ABC exporter, Cyd 2e-04
TIGR01257 2272 TIGR01257, rim_protein, retinal-specific rim ABC t 2e-04
TIGR01257 2272 TIGR01257, rim_protein, retinal-specific rim ABC t 2e-04
TIGR03608206 TIGR03608, L_ocin_972_ABC, putative bacteriocin ex 2e-04
cd03221144 cd03221, ABCF_EF-3, ATP-binding cassette domain of 2e-04
cd03220224 cd03220, ABC_KpsT_Wzt, ATP-binding cassette compon 2e-04
PRK10771232 PRK10771, thiQ, thiamine transporter ATP-binding s 2e-04
PRK14246257 PRK14246, PRK14246, phosphate ABC transporter ATP- 2e-04
COG1101263 COG1101, PhnK, ABC-type uncharacterized transport 2e-04
PRK09544251 PRK09544, znuC, high-affinity zinc transporter ATP 2e-04
TIGR03796710 TIGR03796, NHLM_micro_ABC1, NHLM bacteriocin syste 2e-04
TIGR02314343 TIGR02314, ABC_MetN, D-methionine ABC transporter, 2e-04
cd03229178 cd03229, ABC_Class3, ATP-binding cassette domain o 3e-04
COG0488530 COG0488, Uup, ATPase components of ABC transporter 3e-04
COG0488530 COG0488, Uup, ATPase components of ABC transporter 3e-04
PRK14240250 PRK14240, PRK14240, phosphate transporter ATP-bind 3e-04
PRK14256252 PRK14256, PRK14256, phosphate ABC transporter ATP- 3e-04
TIGR01846694 TIGR01846, type_I_sec_HlyB, type I secretion syste 3e-04
COG4674 249 COG4674, COG4674, Uncharacterized ABC-type transpo 3e-04
smart00382148 smart00382, AAA, ATPases associated with a variety 3e-04
PRK14259269 PRK14259, PRK14259, phosphate ABC transporter ATP- 3e-04
COG0411 250 COG0411, LivG, ABC-type branched-chain amino acid 4e-04
TIGR01166190 TIGR01166, cbiO, cobalt transport protein ATP-bind 4e-04
cd03218232 cd03218, ABC_YhbG, ATP-binding cassette component 4e-04
PRK10789569 PRK10789, PRK10789, putative multidrug transporter 4e-04
COG4674249 COG4674, COG4674, Uncharacterized ABC-type transpo 5e-04
PRK13633280 PRK13633, PRK13633, cobalt transporter ATP-binding 5e-04
COG3839 338 COG3839, MalK, ABC-type sugar transport systems, A 6e-04
cd03256 241 cd03256, ABC_PhnC_transporter, ATP-binding cassett 6e-04
COG3638 258 COG3638, COG3638, ABC-type phosphate/phosphonate t 6e-04
COG2274 709 COG2274, SunT, ABC-type bacteriocin/lantibiotic ex 6e-04
COG4181228 COG4181, COG4181, Predicted ABC-type transport sys 6e-04
TIGR03411 242 TIGR03411, urea_trans_UrtD, urea ABC transporter, 6e-04
COG3845 501 COG3845, COG3845, ABC-type uncharacterized transpo 6e-04
TIGR03740223 TIGR03740, galliderm_ABC, gallidermin-class lantib 6e-04
PRK14251251 PRK14251, PRK14251, phosphate ABC transporter ATP- 6e-04
COG3842 352 COG3842, PotA, ABC-type spermidine/putrescine tran 7e-04
TIGR00958711 TIGR00958, 3a01208, Conjugate Transporter-2 (CT2) 7e-04
COG1137243 COG1137, YhbG, ABC-type (unclassified) transport s 7e-04
cd03293220 cd03293, ABC_NrtD_SsuB_transporters, ATP-binding c 8e-04
COG4133209 COG4133, CcmA, ABC-type transport system involved 8e-04
PRK14242253 PRK14242, PRK14242, phosphate transporter ATP-bind 8e-04
PRK14274259 PRK14274, PRK14274, phosphate ABC transporter ATP- 8e-04
COG4107258 COG4107, PhnK, ABC-type phosphonate transport syst 8e-04
COG4152 300 COG4152, COG4152, ABC-type uncharacterized transpo 9e-04
COG4136213 COG4136, COG4136, ABC-type uncharacterized transpo 9e-04
PRK11614237 PRK11614, livF, leucine/isoleucine/valine transpor 9e-04
cd03245220 cd03245, ABCC_bacteriocin_exporters, ATP-binding c 0.001
cd03260 227 cd03260, ABC_PstB_phosphate_transporter, ATP-bindi 0.001
cd03214180 cd03214, ABC_Iron-Siderophores_B12_Hemin, ATP-bind 0.001
cd03268208 cd03268, ABC_BcrA_bacitracin_resist, ATP-binding c 0.001
PRK11288501 PRK11288, araG, L-arabinose transporter ATP-bindin 0.001
PRK10584228 PRK10584, PRK10584, putative ABC transporter ATP-b 0.001
PRK11629233 PRK11629, lolD, lipoprotein transporter ATP-bindin 0.001
PRK13631320 PRK13631, cbiO, cobalt transporter ATP-binding sub 0.001
TIGR02633 500 TIGR02633, xylG, D-xylose ABC transporter, ATP-bin 0.001
COG1118 345 COG1118, CysA, ABC-type sulfate/molybdate transpor 0.002
cd03261 235 cd03261, ABC_Org_Solvent_Resistant, ATP-binding ca 0.002
COG1124 252 COG1124, DppF, ABC-type dipeptide/oligopeptide/nic 0.002
TIGR03608206 TIGR03608, L_ocin_972_ABC, putative bacteriocin ex 0.002
PRK11288 501 PRK11288, araG, L-arabinose transporter ATP-bindin 0.002
PRK10584228 PRK10584, PRK10584, putative ABC transporter ATP-b 0.002
PRK11264250 PRK11264, PRK11264, putative amino-acid ABC transp 0.002
PRK15439 510 PRK15439, PRK15439, autoinducer 2 ABC transporter 0.002
cd03223166 cd03223, ABCD_peroxisomal_ALDP, ATP-binding casset 0.002
PRK14253249 PRK14253, PRK14253, phosphate ABC transporter ATP- 0.002
PRK14261253 PRK14261, PRK14261, phosphate ABC transporter ATP- 0.002
TIGR03269520 TIGR03269, met_CoM_red_A2, methyl coenzyme M reduc 0.002
COG4172534 COG4172, COG4172, ABC-type uncharacterized transpo 0.002
cd03237246 cd03237, ABC_RNaseL_inhibitor_domain2, The ATP-bin 0.002
PLN03130 1622 PLN03130, PLN03130, ABC transporter C family membe 0.002
cd03228171 cd03228, ABCC_MRP_Like, ATP-binding cassette domai 0.003
TIGR03258 362 TIGR03258, PhnT, 2-aminoethylphosphonate ABC trans 0.003
COG1116 248 COG1116, TauB, ABC-type nitrate/sulfonate/bicarbon 0.003
COG4107258 COG4107, PhnK, ABC-type phosphonate transport syst 0.003
PRK10535648 PRK10535, PRK10535, macrolide transporter ATP-bind 0.003
pfam13481154 pfam13481, AAA_25, AAA domain 0.003
PRK13634290 PRK13634, cbiO, cobalt transporter ATP-binding sub 0.003
cd03238176 cd03238, ABC_UvrA, ATP-binding cassette domain of 0.003
PRK11701258 PRK11701, phnK, phosphonate C-P lyase system prote 0.003
PRK10419268 PRK10419, nikE, nickel transporter ATP-binding pro 0.003
cd03224222 cd03224, ABC_TM1139_LivF_branched, ATP-binding cas 0.004
COG4525 259 COG4525, TauB, ABC-type taurine transport system, 0.004
PRK09580 248 PRK09580, sufC, cysteine desulfurase ATPase compon 0.004
PRK14266250 PRK14266, PRK14266, phosphate ABC transporter ATP- 0.004
>gnl|CDD|215599 PLN03140, PLN03140, ABC transporter G family member; Provisional Back     alignment and domain information
 Score = 1345 bits (3483), Expect = 0.0
 Identities = 569/985 (57%), Positives = 718/985 (72%), Gaps = 18/985 (1%)

Query: 11  STSLRRSASRWNTNSIGAFS-------RSSREEDDEEALKWAALEKLPTYNRLRKGILTT 63
             S+ RS SR + N    FS       R+S  ++DEEALKWAA+EKLPTY+RLR  I+ +
Sbjct: 9   RRSISRSVSRSSRNMEDVFSGGSQSRRRTSSVDEDEEALKWAAIEKLPTYSRLRTSIMKS 68

Query: 64  --------SRGEANEVDVYNLGLQERQRLIDKLVKVTDVDNERFLLKLKNRIDRVGIDLP 115
                   ++    EVDV  L   +RQ+ ID + KV + DNE+FL K +NRIDRVGI LP
Sbjct: 69  FVENDVYGNQLLHKEVDVTKLDGNDRQKFIDMVFKVAEEDNEKFLKKFRNRIDRVGIKLP 128

Query: 116 KVEVRYEHLNVEAEAFLASNALPSFIKFYTNIFEDILNYLRIIPSKKRHLTILKDVSGVI 175
            VEVR+EHL VEA+ ++ S ALP+      NI E  L  L I  +KK  LTILKD SG+I
Sbjct: 129 TVEVRFEHLTVEADCYIGSRALPTLPNAARNIAESALGMLGINLAKKTKLTILKDASGII 188

Query: 176 KPGRLTLLLGPPSSGKTTLLLALAGKLDPTLKVSGTVTYNGHDMDEFVPQRTAAYISQHD 235
           KP R+TLLLGPPSSGKTTLLLALAGKLDP+LKVSG +TYNG+ ++EFVP++T+AYISQ+D
Sbjct: 189 KPSRMTLLLGPPSSGKTTLLLALAGKLDPSLKVSGEITYNGYRLNEFVPRKTSAYISQND 248

Query: 236 NHIGEMTVRETLAFSARCQGVGTRYEMLTELARREKAAGIKPDPDIDVYMKAIATEGQEA 295
            H+G MTV+ETL FSARCQGVGTRY++L+ELARREK AGI P+ ++D++MKA A EG ++
Sbjct: 249 VHVGVMTVKETLDFSARCQGVGTRYDLLSELARREKDAGIFPEAEVDLFMKATAMEGVKS 308

Query: 296 NVITDYYLKVLGLDVCADTMVGDEMIRGISGGQKKRVTTGEMMVGPALALFMDEISTGLD 355
           ++ITDY LK+LGLD+C DT+VGDEMIRGISGGQKKRVTTGEM+VGP   LFMDEISTGLD
Sbjct: 309 SLITDYTLKILGLDICKDTIVGDEMIRGISGGQKKRVTTGEMIVGPTKTLFMDEISTGLD 368

Query: 356 SSTTFQIVNCLRQNIHINSGTAVISLLQPAPETYDLFDDIILLSDGQIVYQGPRELVLEF 415
           SSTT+QIV CL+Q +H+   T ++SLLQPAPET+DLFDDIILLS+GQIVYQGPR+ +LEF
Sbjct: 369 SSTTYQIVKCLQQIVHLTEATVLMSLLQPAPETFDLFDDIILLSEGQIVYQGPRDHILEF 428

Query: 416 FASMGFRCPKRKGVADFLQEVTSRKDQRQYWAHKEKPYRFVTVQEFAEAFQSFHVGQKIS 475
           F S GF+CP+RKG ADFLQEVTS+KDQ QYWA + KPYR+++V EFAE F+SFHVG ++ 
Sbjct: 429 FESCGFKCPERKGTADFLQEVTSKKDQEQYWADRNKPYRYISVSEFAERFKSFHVGMQLE 488

Query: 476 DELRTPFDKSKSHRAALTTETYGVGKRELLKANISRELLLMKRNSFVYIFKLIQIAFVAV 535
           +EL  PFDKS+SH+AAL    Y V K ELLKA   +E LLMKRN+FVY+FK +QI  VA 
Sbjct: 489 NELSVPFDKSQSHKAALVFSKYSVPKMELLKACWDKEWLLMKRNAFVYVFKTVQIIIVAA 548

Query: 536 VYMTLFLRTKMHKDTVTDGGIFAGATFFAITMVNFNGFSEISMTIAKLPVFYKQRDFRFF 595
           +  T+FLRT+MH     DG ++ GA  F++ +  FNGF+E+++ I +LPVFYKQRD  F 
Sbjct: 549 IASTVFLRTEMHTRNEEDGALYIGALLFSMIINMFNGFAELALMIQRLPVFYKQRDLLFH 608

Query: 596 PPWAYAIPSWILKIPVSFLEVAVWVFLSYYVVGYDSNAGRFFKQYALLLGVNQMASALFR 655
           PPW + +P+++L IP+S +E  VWV ++YY +G+   A RFFKQ  L+  + QMA+ +FR
Sbjct: 609 PPWTFTLPTFLLGIPISIIESVVWVVITYYSIGFAPEASRFFKQLLLVFLIQQMAAGIFR 668

Query: 656 FIAVTGRNMVVANTFGSFALLVLLSLGGFILSREDIKKWWKWAYWCSPLTYAQNAIVANE 715
            IA   R M++ANT G+  LL++  LGGFIL + +I  WW+WAYW SPL+Y  NA+  NE
Sbjct: 669 LIASVCRTMIIANTGGALVLLLVFLLGGFILPKGEIPNWWEWAYWVSPLSYGFNALAVNE 728

Query: 716 FLGHSW-KKFTQDSSETLGVQVLKSRGFFAHEYWYWLGLGALFGFVLLLNFAYTLALTFL 774
                W  K   D+S  LG  VL     F  + WYW+G+GAL GF +L N  +TLALT+L
Sbjct: 729 MFAPRWMNKMASDNSTRLGTAVLNIFDVFTDKNWYWIGVGALLGFTILFNVLFTLALTYL 788

Query: 775 DPFEKPRAVITEEIESNEQDDRIGGNVQLSTLGGSSNHNTRSGSTDDIRGQQSSSQSLSL 834
           +P  K +A+I+EE     + +       LS+  G++          +  G   +    S 
Sbjct: 789 NPLGKKQAIISEETAEEMEGEEDSIPRSLSSADGNNTREVAIQRMSNPEGLSKNRD--SS 846

Query: 835 AEAEASRPKKKGMVLPFEPHSLTFDEVVYSVDMPEEMKVQGVLEDKLVLLNGVSGAFRPG 894
            EA      K+GMVLPF P +++FD+V Y VDMP EMK QGV ED+L LL  V+GAFRPG
Sbjct: 847 LEAANGVAPKRGMVLPFTPLAMSFDDVNYFVDMPAEMKEQGVTEDRLQLLREVTGAFRPG 906

Query: 895 VLTALMGVSGAGKTTLMDVLAGRKTGGYITGNITISGYPKKQETFARISGYCEQNDIHSP 954
           VLTALMGVSGAGKTTLMDVLAGRKTGGYI G+I ISG+PKKQETFARISGYCEQNDIHSP
Sbjct: 907 VLTALMGVSGAGKTTLMDVLAGRKTGGYIEGDIRISGFPKKQETFARISGYCEQNDIHSP 966

Query: 955 FVTIYESLLFSAWLRLSPEVDSETR 979
            VT+ ESL++SA+LRL  EV  E +
Sbjct: 967 QVTVRESLIYSAFLRLPKEVSKEEK 991


Length = 1470

>gnl|CDD|233208 TIGR00956, 3a01205, Pleiotropic Drug Resistance (PDR) Family protein Back     alignment and domain information
>gnl|CDD|233207 TIGR00955, 3a01204, The Eye Pigment Precursor Transporter (EPP) Family protein Back     alignment and domain information
>gnl|CDD|213199 cd03232, ABCG_PDR_domain2, Second domain of the pleiotropic drug resistance-like (PDR) subfamily G of ATP-binding cassette transporters Back     alignment and domain information
>gnl|CDD|216273 pfam01061, ABC2_membrane, ABC-2 type transporter Back     alignment and domain information
>gnl|CDD|233208 TIGR00956, 3a01205, Pleiotropic Drug Resistance (PDR) Family protein Back     alignment and domain information
>gnl|CDD|213201 cd03234, ABCG_White, White pigment protein homolog of ABCG transporter subfamily Back     alignment and domain information
>gnl|CDD|213200 cd03233, ABCG_PDR_domain1, First domain of the pleiotropic drug resistance-like subfamily G of ATP-binding cassette transporters Back     alignment and domain information
>gnl|CDD|224054 COG1131, CcmA, ABC-type multidrug transport system, ATPase component [Defense mechanisms] Back     alignment and domain information
>gnl|CDD|213200 cd03233, ABCG_PDR_domain1, First domain of the pleiotropic drug resistance-like subfamily G of ATP-binding cassette transporters Back     alignment and domain information
>gnl|CDD|215599 PLN03140, PLN03140, ABC transporter G family member; Provisional Back     alignment and domain information
>gnl|CDD|215634 PLN03211, PLN03211, ABC transporter G-25; Provisional Back     alignment and domain information
>gnl|CDD|213180 cd03213, ABCG_EPDR, Eye pigment and drug resistance transporter subfamily G of the ATP-binding cassette superfamily Back     alignment and domain information
>gnl|CDD|213180 cd03213, ABCG_EPDR, Eye pigment and drug resistance transporter subfamily G of the ATP-binding cassette superfamily Back     alignment and domain information
>gnl|CDD|219810 pfam08370, PDR_assoc, Plant PDR ABC transporter associated Back     alignment and domain information
>gnl|CDD|213230 cd03263, ABC_subfamily_A, ATP-binding cassette domain of the lipid transporters, subfamily A Back     alignment and domain information
>gnl|CDD|224045 COG1120, FepC, ABC-type cobalamin/Fe3+-siderophores transport systems, ATPase components [Inorganic ion transport and metabolism / Coenzyme metabolism] Back     alignment and domain information
>gnl|CDD|233207 TIGR00955, 3a01204, The Eye Pigment Precursor Transporter (EPP) Family protein Back     alignment and domain information
>gnl|CDD|213199 cd03232, ABCG_PDR_domain2, Second domain of the pleiotropic drug resistance-like (PDR) subfamily G of ATP-binding cassette transporters Back     alignment and domain information
>gnl|CDD|213192 cd03225, ABC_cobalt_CbiO_domain1, First domain of the ATP-binding cassette component of cobalt transport system Back     alignment and domain information
>gnl|CDD|213201 cd03234, ABCG_White, White pigment protein homolog of ABCG transporter subfamily Back     alignment and domain information
>gnl|CDD|213180 cd03213, ABCG_EPDR, Eye pigment and drug resistance transporter subfamily G of the ATP-binding cassette superfamily Back     alignment and domain information
>gnl|CDD|224047 COG1122, CbiO, ABC-type cobalt transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|224043 COG1118, CysA, ABC-type sulfate/molybdate transport systems, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|213222 cd03255, ABC_MJ0796_LolCDE_FtsE, ATP-binding cassette domain of the transporters involved in export of lipoprotein and macrolide, and cell division protein Back     alignment and domain information
>gnl|CDD|213228 cd03261, ABC_Org_Solvent_Resistant, ATP-binding cassette transport system involved in resistant to organic solvents Back     alignment and domain information
>gnl|CDD|226927 COG4555, NatA, ABC-type Na+ transport system, ATPase component [Energy production and conversion / Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|226359 COG3839, MalK, ABC-type sugar transport systems, ATPase components [Carbohydrate transport and metabolism] Back     alignment and domain information
>gnl|CDD|213223 cd03256, ABC_PhnC_transporter, ATP-binding cassette domain of the binding protein-dependent phosphonate transport system Back     alignment and domain information
>gnl|CDD|130041 TIGR00968, 3a0106s01, sulfate ABC transporter, ATP-binding protein Back     alignment and domain information
>gnl|CDD|224059 COG1136, SalX, ABC-type antimicrobial peptide transport system, ATPase component [Defense mechanisms] Back     alignment and domain information
>gnl|CDD|213224 cd03257, ABC_NikE_OppD_transporters, ATP-binding cassette domain of nickel/oligopeptides specific transporters Back     alignment and domain information
>gnl|CDD|213226 cd03259, ABC_Carb_Solutes_like, ATP-binding cassette domain of the carbohydrate and solute transporters-like Back     alignment and domain information
>gnl|CDD|224046 COG1121, ZnuC, ABC-type Mn/Zn transport systems, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|213191 cd03224, ABC_TM1139_LivF_branched, ATP-binding cassette domain of branched-chain amino acid transporter Back     alignment and domain information
>gnl|CDD|233665 TIGR01978, sufC, FeS assembly ATPase SufC Back     alignment and domain information
>gnl|CDD|226164 COG3638, COG3638, ABC-type phosphate/phosphonate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|226361 COG3842, PotA, ABC-type spermidine/putrescine transport systems, ATPase components [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|227321 COG4988, CydD, ABC-type transport system involved in cytochrome bd biosynthesis, ATPase and permease components [Energy production and conversion / Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|213186 cd03219, ABC_Mj1267_LivG_branched, ATP-binding cassette component of branched chain amino acids transport system Back     alignment and domain information
>gnl|CDD|224054 COG1131, CcmA, ABC-type multidrug transport system, ATPase component [Defense mechanisms] Back     alignment and domain information
>gnl|CDD|234189 TIGR03375, type_I_sec_LssB, type I secretion system ATPase, LssB family Back     alignment and domain information
>gnl|CDD|215634 PLN03211, PLN03211, ABC transporter G-25; Provisional Back     alignment and domain information
>gnl|CDD|226929 COG4559, COG4559, ABC-type hemin transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|223488 COG0411, LivG, ABC-type branched-chain amino acid transport systems, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|213263 cd03296, ABC_CysA_sulfate_importer, ATP-binding cassette domain of the sulfate transporter Back     alignment and domain information
>gnl|CDD|213202 cd03235, ABC_Metallic_Cations, ATP-binding cassette domain of the metal-type transporters Back     alignment and domain information
>gnl|CDD|234033 TIGR02857, CydD, thiol reductant ABC exporter, CydD subunit Back     alignment and domain information
>gnl|CDD|237421 PRK13539, PRK13539, cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>gnl|CDD|213212 cd03245, ABCC_bacteriocin_exporters, ATP-binding cassette domain of bacteriocin exporters, subfamily C Back     alignment and domain information
>gnl|CDD|163585 TIGR03873, F420-0_ABC_ATP, proposed F420-0 ABC transporter, ATP-binding protein Back     alignment and domain information
>gnl|CDD|213231 cd03264, ABC_drug_resistance_like, ABC-type multidrug transport system, ATPase component Back     alignment and domain information
>gnl|CDD|223473 COG0396, sufC, Cysteine desulfurase activator ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|213199 cd03232, ABCG_PDR_domain2, Second domain of the pleiotropic drug resistance-like (PDR) subfamily G of ATP-binding cassette transporters Back     alignment and domain information
>gnl|CDD|213197 cd03230, ABC_DR_subfamily_A, ATP-binding cassette domain of the drug resistance transporter and related proteins, subfamily A Back     alignment and domain information
>gnl|CDD|131368 TIGR02315, ABC_phnC, phosphonate ABC transporter, ATP-binding protein Back     alignment and domain information
>gnl|CDD|237422 PRK13548, hmuV, hemin importer ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|213260 cd03293, ABC_NrtD_SsuB_transporters, ATP-binding cassette domain of the nitrate and sulfonate transporters Back     alignment and domain information
>gnl|CDD|224052 COG1127, Ttg2A, ABC-type transport system involved in resistance to organic solvents, ATPase component [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>gnl|CDD|225183 COG2274, SunT, ABC-type bacteriocin/lantibiotic exporters, contain an N-terminal double-glycine peptidase domain [Defense mechanisms] Back     alignment and domain information
>gnl|CDD|213200 cd03233, ABCG_PDR_domain1, First domain of the pleiotropic drug resistance-like subfamily G of ATP-binding cassette transporters Back     alignment and domain information
>gnl|CDD|213230 cd03263, ABC_subfamily_A, ATP-binding cassette domain of the lipid transporters, subfamily A Back     alignment and domain information
>gnl|CDD|213233 cd03266, ABC_NatA_sodium_exporter, ATP-binding cassette domain of the Na+ transporter Back     alignment and domain information
>gnl|CDD|213195 cd03228, ABCC_MRP_Like, ATP-binding cassette domain of multidrug resistance protein-like transporters Back     alignment and domain information
>gnl|CDD|213264 cd03297, ABC_ModC_molybdenum_transporter, ATP-binding cassette domain of the molybdenum transport system Back     alignment and domain information
>gnl|CDD|213217 cd03250, ABCC_MRP_domain1, ATP-binding cassette domain 1 of multidrug resistance-associated protein, subfamily C Back     alignment and domain information
>gnl|CDD|213216 cd03249, ABC_MTABC3_MDL1_MDL2, ATP-binding cassette domain of a mitochondrial protein MTABC3 and related proteins Back     alignment and domain information
>gnl|CDD|213220 cd03253, ABCC_ATM1_transporter, ATP-binding cassette domain of iron-sulfur clusters transporter, subfamily C Back     alignment and domain information
>gnl|CDD|223487 COG0410, LivF, ABC-type branched-chain amino acid transport systems, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|234041 TIGR02868, CydC, thiol reductant ABC exporter, CydC subunit Back     alignment and domain information
>gnl|CDD|132027 TIGR02982, heterocyst_DevA, ABC exporter ATP-binding subunit, DevA family Back     alignment and domain information
>gnl|CDD|213268 cd03301, ABC_MalK_N, The N-terminal ATPase domain of the maltose transporter, MalK Back     alignment and domain information
>gnl|CDD|183044 PRK11231, fecE, iron-dicitrate transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|213267 cd03300, ABC_PotA_N, ATP-binding cassette domain of the polyamine transporter Back     alignment and domain information
>gnl|CDD|184132 PRK13547, hmuV, hemin importer ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|213193 cd03226, ABC_cobalt_CbiO_domain2, Second domain of the ATP-binding cassette component of cobalt transport system Back     alignment and domain information
>gnl|CDD|213179 cd00267, ABC_ATPase, ATP-binding cassette transporter nucleotide-binding domain Back     alignment and domain information
>gnl|CDD|213227 cd03260, ABC_PstB_phosphate_transporter, ATP-binding cassette domain of the phosphate transport system Back     alignment and domain information
>gnl|CDD|213236 cd03269, ABC_putative_ATPase, ATP-binding cassette domain of an uncharacterized transporter Back     alignment and domain information
>gnl|CDD|226963 COG4604, CeuD, ABC-type enterochelin transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|224048 COG1123, COG1123, ATPase components of various ABC-type transport systems, contain duplicated ATPase [General function prediction only] Back     alignment and domain information
>gnl|CDD|188394 TIGR03864, PQQ_ABC_ATP, ABC transporter, ATP-binding subunit, PQQ-dependent alcohol dehydrogenase system Back     alignment and domain information
>gnl|CDD|213232 cd03265, ABC_DrrA, Daunorubicin/doxorubicin resistance ATP-binding protein Back     alignment and domain information
>gnl|CDD|213218 cd03251, ABCC_MsbA, ATP-binding cassette domain of the bacterial lipid flippase and related proteins, subfamily C Back     alignment and domain information
>gnl|CDD|224058 COG1135, AbcC, ABC-type metal ion transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|224048 COG1123, COG1123, ATPase components of various ABC-type transport systems, contain duplicated ATPase [General function prediction only] Back     alignment and domain information
>gnl|CDD|213266 cd03299, ABC_ModC_like, ATP-binding cassette domain similar to the molybdate transporter Back     alignment and domain information
>gnl|CDD|213259 cd03292, ABC_FtsE_transporter, ATP-binding cassette domain of the cell division transporter Back     alignment and domain information
>gnl|CDD|131258 TIGR02203, MsbA_lipidA, lipid A export permease/ATP-binding protein MsbA Back     alignment and domain information
>gnl|CDD|182036 PRK09700, PRK09700, D-allose transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|132302 TIGR03258, PhnT, 2-aminoethylphosphonate ABC transport system, ATP-binding component PhnT Back     alignment and domain information
>gnl|CDD|226647 COG4181, COG4181, Predicted ABC-type transport system involved in lysophospholipase L1 biosynthesis, ATPase component [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>gnl|CDD|236523 PRK09452, potA, putrescine/spermidine ABC transporter ATPase protein; Reviewed Back     alignment and domain information
>gnl|CDD|213225 cd03258, ABC_MetN_methionine_transporter, ATP-binding cassette domain of methionine transporter Back     alignment and domain information
>gnl|CDD|184200 PRK13640, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|213231 cd03264, ABC_drug_resistance_like, ABC-type multidrug transport system, ATPase component Back     alignment and domain information
>gnl|CDD|213181 cd03214, ABC_Iron-Siderophores_B12_Hemin, ATP-binding component of iron-siderophores, vitamin B12 and hemin transporters and related proteins Back     alignment and domain information
>gnl|CDD|224055 COG1132, MdlB, ABC-type multidrug transport system, ATPase and permease components [Defense mechanisms] Back     alignment and domain information
>gnl|CDD|224044 COG1119, ModF, ABC-type molybdenum transport system, ATPase component/photorepair protein PhrA [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|130261 TIGR01193, bacteriocin_ABC, ABC-type bacteriocin transporter Back     alignment and domain information
>gnl|CDD|226360 COG3840, ThiQ, ABC-type thiamine transport system, ATPase component [Coenzyme metabolism] Back     alignment and domain information
>gnl|CDD|223521 COG0444, DppD, ABC-type dipeptide/oligopeptide/nickel transport system, ATPase component [Amino acid transport and metabolism / Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|226905 COG4525, TauB, ABC-type taurine transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|224050 COG1125, OpuBA, ABC-type proline/glycine betaine transport systems, ATPase components [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|130234 TIGR01166, cbiO, cobalt transport protein ATP-binding subunit Back     alignment and domain information
>gnl|CDD|213197 cd03230, ABC_DR_subfamily_A, ATP-binding cassette domain of the drug resistance transporter and related proteins, subfamily A Back     alignment and domain information
>gnl|CDD|226952 COG4586, COG4586, ABC-type uncharacterized transport system, ATPase component [General function prediction only] Back     alignment and domain information
>gnl|CDD|130256 TIGR01188, drrA, daunorubicin resistance ABC transporter ATP-binding subunit Back     alignment and domain information
>gnl|CDD|132561 TIGR03522, GldA_ABC_ATP, gliding motility-associated ABC transporter ATP-binding subunit GldA Back     alignment and domain information
>gnl|CDD|227320 COG4987, CydC, ABC-type transport system involved in cytochrome bd biosynthesis, fused ATPase and permease components [Energy production and conversion / Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|226617 COG4133, CcmA, ABC-type transport system involved in cytochrome c biogenesis, ATPase component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|162242 TIGR01187, potA, spermidine/putrescine ABC transporter ATP-binding subunit Back     alignment and domain information
>gnl|CDD|213221 cd03254, ABCC_Glucan_exporter_like, ATP-binding cassette domain of glucan transporter and related proteins, subfamily C Back     alignment and domain information
>gnl|CDD|233305 TIGR01189, ccmA, heme ABC exporter, ATP-binding protein CcmA Back     alignment and domain information
>gnl|CDD|224041 COG1116, TauB, ABC-type nitrate/sulfonate/bicarbonate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|130344 TIGR01277, thiQ, thiamine ABC transporter, ATP-binding protein Back     alignment and domain information
>gnl|CDD|224051 COG1126, GlnQ, ABC-type polar amino acid transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|234152 TIGR03265, PhnT2, putative 2-aminoethylphosphonate ABC transporter, ATP-binding protein Back     alignment and domain information
>gnl|CDD|213219 cd03252, ABCC_Hemolysin, ATP-binding cassette domain of hemolysin B, subfamily C Back     alignment and domain information
>gnl|CDD|183056 PRK11248, tauB, taurine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|237420 PRK13537, PRK13537, nodulation ABC transporter NodI; Provisional Back     alignment and domain information
>gnl|CDD|131721 TIGR02673, FtsE, cell division ATP-binding protein FtsE Back     alignment and domain information
>gnl|CDD|226631 COG4152, COG4152, ABC-type uncharacterized transport system, ATPase component [General function prediction only] Back     alignment and domain information
>gnl|CDD|184132 PRK13547, hmuV, hemin importer ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|213196 cd03229, ABC_Class3, ATP-binding cassette domain of the binding protein-dependent transport systems Back     alignment and domain information
>gnl|CDD|213235 cd03268, ABC_BcrA_bacitracin_resist, ATP-binding cassette domain of the bacitracin-resistance transporter Back     alignment and domain information
>gnl|CDD|182336 PRK10253, PRK10253, iron-enterobactin transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|213262 cd03295, ABC_OpuCA_Osmoprotection, ATP-binding cassette domain of the osmoprotectant transporter Back     alignment and domain information
>gnl|CDD|200134 TIGR01842, type_I_sec_PrtD, type I secretion system ABC transporter, PrtD family Back     alignment and domain information
>gnl|CDD|182778 PRK10851, PRK10851, sulfate/thiosulfate transporter subunit; Provisional Back     alignment and domain information
>gnl|CDD|182331 PRK10247, PRK10247, putative ABC transporter ATP-binding protein YbbL; Provisional Back     alignment and domain information
>gnl|CDD|226620 COG4136, COG4136, ABC-type uncharacterized transport system, ATPase component [General function prediction only] Back     alignment and domain information
>gnl|CDD|213179 cd00267, ABC_ATPase, ATP-binding cassette transporter nucleotide-binding domain Back     alignment and domain information
>gnl|CDD|213179 cd00267, ABC_ATPase, ATP-binding cassette transporter nucleotide-binding domain Back     alignment and domain information
>gnl|CDD|213181 cd03214, ABC_Iron-Siderophores_B12_Hemin, ATP-binding component of iron-siderophores, vitamin B12 and hemin transporters and related proteins Back     alignment and domain information
>gnl|CDD|184199 PRK13639, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|131816 TIGR02769, nickel_nikE, nickel import ATP-binding protein NikE Back     alignment and domain information
>gnl|CDD|223562 COG0488, Uup, ATPase components of ABC transporters with duplicated ATPase domains [General function prediction only] Back     alignment and domain information
>gnl|CDD|188208 TIGR02323, CP_lyasePhnK, phosphonate C-P lyase system protein PhnK Back     alignment and domain information
>gnl|CDD|224042 COG1117, PstB, ABC-type phosphate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|224049 COG1124, DppF, ABC-type dipeptide/oligopeptide/nickel transport system, ATPase component [Amino acid transport and metabolism / Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|234199 TIGR03410, urea_trans_UrtE, urea ABC transporter, ATP-binding protein UrtE Back     alignment and domain information
>gnl|CDD|213192 cd03225, ABC_cobalt_CbiO_domain1, First domain of the ATP-binding cassette component of cobalt transport system Back     alignment and domain information
>gnl|CDD|184585 PRK14239, PRK14239, phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|172760 PRK14272, PRK14272, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|181965 PRK09580, sufC, cysteine desulfurase ATPase component; Reviewed Back     alignment and domain information
>gnl|CDD|131817 TIGR02770, nickel_nikD, nickel import ATP-binding protein NikD Back     alignment and domain information
>gnl|CDD|213265 cd03298, ABC_ThiQ_thiamine_transporter, ATP-binding cassette domain of the thiamine transport system Back     alignment and domain information
>gnl|CDD|215650 pfam00005, ABC_tran, ABC transporter Back     alignment and domain information
>gnl|CDD|184203 PRK13643, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|188099 TIGR00972, 3a0107s01c2, phosphate ABC transporter, ATP-binding protein Back     alignment and domain information
>gnl|CDD|226970 COG4619, COG4619, ABC-type uncharacterized transport system, ATPase component [General function prediction only] Back     alignment and domain information
>gnl|CDD|184196 PRK13636, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|237648 PRK14250, PRK14250, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|130252 TIGR01184, ntrCD, nitrate transport ATP-binding subunits C and D Back     alignment and domain information
>gnl|CDD|184210 PRK13651, PRK13651, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|224059 COG1136, SalX, ABC-type antimicrobial peptide transport system, ATPase component [Defense mechanisms] Back     alignment and domain information
>gnl|CDD|227321 COG4988, CydD, ABC-type transport system involved in cytochrome bd biosynthesis, ATPase and permease components [Energy production and conversion / Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|130355 TIGR01288, nodI, ATP-binding ABC transporter family nodulation protein NodI Back     alignment and domain information
>gnl|CDD|213184 cd03217, ABC_FeS_Assembly, ABC-type transport system involved in Fe-S cluster assembly, ATPase component Back     alignment and domain information
>gnl|CDD|237419 PRK13536, PRK13536, nodulation factor exporter subunit NodI; Provisional Back     alignment and domain information
>gnl|CDD|226969 COG4618, ArpD, ABC-type protease/lipase transport system, ATPase and permease components [General function prediction only] Back     alignment and domain information
>gnl|CDD|236554 PRK09536, btuD, corrinoid ABC transporter ATPase; Reviewed Back     alignment and domain information
>gnl|CDD|132050 TIGR03005, ectoine_ehuA, ectoine/hydroxyectoine ABC transporter, ATP-binding protein Back     alignment and domain information
>gnl|CDD|227590 COG5265, ATM1, ABC-type transport system involved in Fe-S cluster assembly, permease and ATPase components [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|184125 PRK13538, PRK13538, cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>gnl|CDD|131259 TIGR02204, MsbA_rel, ABC transporter, permease/ATP-binding protein Back     alignment and domain information
>gnl|CDD|163483 TIGR03771, anch_rpt_ABC, anchored repeat-type ABC transporter, ATP-binding subunit Back     alignment and domain information
>gnl|CDD|213222 cd03255, ABC_MJ0796_LolCDE_FtsE, ATP-binding cassette domain of the transporters involved in export of lipoprotein and macrolide, and cell division protein Back     alignment and domain information
>gnl|CDD|184198 PRK13638, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|213183 cd03216, ABC_Carb_Monos_I, First domain of the ATP-binding cassette component of monosaccharide transport system Back     alignment and domain information
>gnl|CDD|237422 PRK13548, hmuV, hemin importer ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|213261 cd03294, ABC_Pro_Gly_Betaine, ATP-binding cassette domain of the osmoprotectant proline/glycine betaine uptake system Back     alignment and domain information
>gnl|CDD|235150 PRK03695, PRK03695, vitamin B12-transporter ATPase; Provisional Back     alignment and domain information
>gnl|CDD|214372 CHL00131, ycf16, sulfate ABC transporter protein; Validated Back     alignment and domain information
>gnl|CDD|184195 PRK13635, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|213198 cd03231, ABC_CcmA_heme_exporter, Cytochrome c biogenesis ATP-binding export protein Back     alignment and domain information
>gnl|CDD|213202 cd03235, ABC_Metallic_Cations, ATP-binding cassette domain of the metal-type transporters Back     alignment and domain information
>gnl|CDD|213229 cd03262, ABC_HisP_GlnQ, ATP-binding cassette domain of the histidine and glutamine transporters Back     alignment and domain information
>gnl|CDD|188394 TIGR03864, PQQ_ABC_ATP, ABC transporter, ATP-binding subunit, PQQ-dependent alcohol dehydrogenase system Back     alignment and domain information
>gnl|CDD|226643 COG4175, ProV, ABC-type proline/glycine betaine transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|236865 PRK11160, PRK11160, cysteine/glutathione ABC transporter membrane/ATP-binding component; Reviewed Back     alignment and domain information
>gnl|CDD|226628 COG4148, ModC, ABC-type molybdate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|183133 PRK11432, fbpC, ferric transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|237455 PRK13637, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|213186 cd03219, ABC_Mj1267_LivG_branched, ATP-binding cassette component of branched chain amino acids transport system Back     alignment and domain information
>gnl|CDD|213195 cd03228, ABCC_MRP_Like, ATP-binding cassette domain of multidrug resistance protein-like transporters Back     alignment and domain information
>gnl|CDD|213184 cd03217, ABC_FeS_Assembly, ABC-type transport system involved in Fe-S cluster assembly, ATPase component Back     alignment and domain information
>gnl|CDD|184129 PRK13543, PRK13543, cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>gnl|CDD|172735 PRK14247, PRK14247, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|184597 PRK14270, PRK14270, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|172743 PRK14255, PRK14255, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|130254 TIGR01186, proV, glycine betaine/L-proline transport ATP binding subunit Back     alignment and domain information
>gnl|CDD|213226 cd03259, ABC_Carb_Solutes_like, ATP-binding cassette domain of the carbohydrate and solute transporters-like Back     alignment and domain information
>gnl|CDD|236870 PRK11174, PRK11174, cysteine/glutathione ABC transporter membrane/ATP-binding component; Reviewed Back     alignment and domain information
>gnl|CDD|213214 cd03247, ABCC_cytochrome_bd, ATP-binding cassette domain of CydCD, subfamily C Back     alignment and domain information
>gnl|CDD|213213 cd03246, ABCC_Protease_Secretion, ATP-binding cassette domain of PrtD, subfamily C Back     alignment and domain information
>gnl|CDD|130260 TIGR01192, chvA, glucan exporter ATP-binding protein Back     alignment and domain information
>gnl|CDD|233665 TIGR01978, sufC, FeS assembly ATPase SufC Back     alignment and domain information
>gnl|CDD|213213 cd03246, ABCC_Protease_Secretion, ATP-binding cassette domain of PrtD, subfamily C Back     alignment and domain information
>gnl|CDD|131197 TIGR02142, modC_ABC, molybdenum ABC transporter, ATP-binding protein Back     alignment and domain information
>gnl|CDD|224057 COG1134, TagH, ABC-type polysaccharide/polyol phosphate transport system, ATPase component [Carbohydrate transport and metabolism / Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>gnl|CDD|224053 COG1129, MglA, ABC-type sugar transport system, ATPase component [Carbohydrate transport and metabolism] Back     alignment and domain information
>gnl|CDD|213234 cd03267, ABC_NatA_like, ATP-binding cassette domain of an uncharacterized transporter similar in sequence to NatA Back     alignment and domain information
>gnl|CDD|225438 COG2884, FtsE, Predicted ATPase involved in cell division [Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|184134 PRK13549, PRK13549, xylose transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|234200 TIGR03411, urea_trans_UrtD, urea ABC transporter, ATP-binding protein UrtD Back     alignment and domain information
>gnl|CDD|130324 TIGR01257, rim_protein, retinal-specific rim ABC transporter Back     alignment and domain information
>gnl|CDD|224045 COG1120, FepC, ABC-type cobalamin/Fe3+-siderophores transport systems, ATPase components [Inorganic ion transport and metabolism / Coenzyme metabolism] Back     alignment and domain information
>gnl|CDD|213263 cd03296, ABC_CysA_sulfate_importer, ATP-binding cassette domain of the sulfate transporter Back     alignment and domain information
>gnl|CDD|223912 COG0842, COG0842, ABC-type multidrug transport system, permease component [Defense mechanisms] Back     alignment and domain information
>gnl|CDD|213193 cd03226, ABC_cobalt_CbiO_domain2, Second domain of the ATP-binding cassette component of cobalt transport system Back     alignment and domain information
>gnl|CDD|224053 COG1129, MglA, ABC-type sugar transport system, ATPase component [Carbohydrate transport and metabolism] Back     alignment and domain information
>gnl|CDD|213257 cd03290, ABCC_SUR1_N, ATP-binding cassette domain of the sulfonylurea receptor, subfamily C Back     alignment and domain information
>gnl|CDD|213196 cd03229, ABC_Class3, ATP-binding cassette domain of the binding protein-dependent transport systems Back     alignment and domain information
>gnl|CDD|224046 COG1121, ZnuC, ABC-type Mn/Zn transport systems, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|234033 TIGR02857, CydD, thiol reductant ABC exporter, CydD subunit Back     alignment and domain information
>gnl|CDD|223473 COG0396, sufC, Cysteine desulfurase activator ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|224048 COG1123, COG1123, ATPase components of various ABC-type transport systems, contain duplicated ATPase [General function prediction only] Back     alignment and domain information
>gnl|CDD|226967 COG4608, AppF, ABC-type oligopeptide transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|234357 TIGR03797, NHLM_micro_ABC2, NHLM bacteriocin system ABC transporter, ATP-binding protein Back     alignment and domain information
>gnl|CDD|215640 PLN03232, PLN03232, ABC transporter C family member; Provisional Back     alignment and domain information
>gnl|CDD|237457 PRK13647, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|226622 COG4138, BtuD, ABC-type cobalamin transport system, ATPase component [Coenzyme metabolism] Back     alignment and domain information
>gnl|CDD|183226 PRK11607, potG, putrescine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|131266 TIGR02211, LolD_lipo_ex, lipoprotein releasing system, ATP-binding protein Back     alignment and domain information
>gnl|CDD|213215 cd03248, ABCC_TAP, ATP-binding cassette domain of the Transporter Associated with Antigen Processing, subfamily C Back     alignment and domain information
>gnl|CDD|237452 PRK13632, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|182561 PRK10575, PRK10575, iron-hydroxamate transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|226929 COG4559, COG4559, ABC-type hemin transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|234041 TIGR02868, CydC, thiol reductant ABC exporter, CydC subunit Back     alignment and domain information
>gnl|CDD|130324 TIGR01257, rim_protein, retinal-specific rim ABC transporter Back     alignment and domain information
>gnl|CDD|130324 TIGR01257, rim_protein, retinal-specific rim ABC transporter Back     alignment and domain information
>gnl|CDD|188353 TIGR03608, L_ocin_972_ABC, putative bacteriocin export ABC transporter, lactococcin 972 group Back     alignment and domain information
>gnl|CDD|213188 cd03221, ABCF_EF-3, ATP-binding cassette domain of elongation factor 3, subfamily F Back     alignment and domain information
>gnl|CDD|213187 cd03220, ABC_KpsT_Wzt, ATP-binding cassette component of polysaccharide transport system Back     alignment and domain information
>gnl|CDD|182716 PRK10771, thiQ, thiamine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|172734 PRK14246, PRK14246, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|224026 COG1101, PhnK, ABC-type uncharacterized transport system, ATPase component [General function prediction only] Back     alignment and domain information
>gnl|CDD|181939 PRK09544, znuC, high-affinity zinc transporter ATPase; Reviewed Back     alignment and domain information
>gnl|CDD|163508 TIGR03796, NHLM_micro_ABC1, NHLM bacteriocin system ABC transporter, peptidase/ATP-binding protein Back     alignment and domain information
>gnl|CDD|131367 TIGR02314, ABC_MetN, D-methionine ABC transporter, ATP-binding protein Back     alignment and domain information
>gnl|CDD|213196 cd03229, ABC_Class3, ATP-binding cassette domain of the binding protein-dependent transport systems Back     alignment and domain information
>gnl|CDD|223562 COG0488, Uup, ATPase components of ABC transporters with duplicated ATPase domains [General function prediction only] Back     alignment and domain information
>gnl|CDD|223562 COG0488, Uup, ATPase components of ABC transporters with duplicated ATPase domains [General function prediction only] Back     alignment and domain information
>gnl|CDD|184586 PRK14240, PRK14240, phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|172744 PRK14256, PRK14256, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|233596 TIGR01846, type_I_sec_HlyB, type I secretion system ABC transporter, HlyB family Back     alignment and domain information
>gnl|CDD|227019 COG4674, COG4674, Uncharacterized ABC-type transport system, ATPase component [General function prediction only] Back     alignment and domain information
>gnl|CDD|214640 smart00382, AAA, ATPases associated with a variety of cellular activities Back     alignment and domain information
>gnl|CDD|172747 PRK14259, PRK14259, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|223488 COG0411, LivG, ABC-type branched-chain amino acid transport systems, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|130234 TIGR01166, cbiO, cobalt transport protein ATP-binding subunit Back     alignment and domain information
>gnl|CDD|213185 cd03218, ABC_YhbG, ATP-binding cassette component of YhbG transport system Back     alignment and domain information
>gnl|CDD|182732 PRK10789, PRK10789, putative multidrug transporter membrane\ATP-binding components; Provisional Back     alignment and domain information
>gnl|CDD|227019 COG4674, COG4674, Uncharacterized ABC-type transport system, ATPase component [General function prediction only] Back     alignment and domain information
>gnl|CDD|237453 PRK13633, PRK13633, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|226359 COG3839, MalK, ABC-type sugar transport systems, ATPase components [Carbohydrate transport and metabolism] Back     alignment and domain information
>gnl|CDD|213223 cd03256, ABC_PhnC_transporter, ATP-binding cassette domain of the binding protein-dependent phosphonate transport system Back     alignment and domain information
>gnl|CDD|226164 COG3638, COG3638, ABC-type phosphate/phosphonate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|225183 COG2274, SunT, ABC-type bacteriocin/lantibiotic exporters, contain an N-terminal double-glycine peptidase domain [Defense mechanisms] Back     alignment and domain information
>gnl|CDD|226647 COG4181, COG4181, Predicted ABC-type transport system involved in lysophospholipase L1 biosynthesis, ATPase component [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>gnl|CDD|234200 TIGR03411, urea_trans_UrtD, urea ABC transporter, ATP-binding protein UrtD Back     alignment and domain information
>gnl|CDD|226364 COG3845, COG3845, ABC-type uncharacterized transport systems, ATPase components [General function prediction only] Back     alignment and domain information
>gnl|CDD|163452 TIGR03740, galliderm_ABC, gallidermin-class lantibiotic protection ABC transporter, ATP-binding subunit Back     alignment and domain information
>gnl|CDD|172739 PRK14251, PRK14251, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|226361 COG3842, PotA, ABC-type spermidine/putrescine transport systems, ATPase components [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|233209 TIGR00958, 3a01208, Conjugate Transporter-2 (CT2) Family protein Back     alignment and domain information
>gnl|CDD|224060 COG1137, YhbG, ABC-type (unclassified) transport system, ATPase component [General function prediction only] Back     alignment and domain information
>gnl|CDD|213260 cd03293, ABC_NrtD_SsuB_transporters, ATP-binding cassette domain of the nitrate and sulfonate transporters Back     alignment and domain information
>gnl|CDD|226617 COG4133, CcmA, ABC-type transport system involved in cytochrome c biogenesis, ATPase component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|172730 PRK14242, PRK14242, phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|172762 PRK14274, PRK14274, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|226592 COG4107, PhnK, ABC-type phosphonate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|226631 COG4152, COG4152, ABC-type uncharacterized transport system, ATPase component [General function prediction only] Back     alignment and domain information
>gnl|CDD|226620 COG4136, COG4136, ABC-type uncharacterized transport system, ATPase component [General function prediction only] Back     alignment and domain information
>gnl|CDD|183231 PRK11614, livF, leucine/isoleucine/valine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|213212 cd03245, ABCC_bacteriocin_exporters, ATP-binding cassette domain of bacteriocin exporters, subfamily C Back     alignment and domain information
>gnl|CDD|213227 cd03260, ABC_PstB_phosphate_transporter, ATP-binding cassette domain of the phosphate transport system Back     alignment and domain information
>gnl|CDD|213181 cd03214, ABC_Iron-Siderophores_B12_Hemin, ATP-binding component of iron-siderophores, vitamin B12 and hemin transporters and related proteins Back     alignment and domain information
>gnl|CDD|213235 cd03268, ABC_BcrA_bacitracin_resist, ATP-binding cassette domain of the bacitracin-resistance transporter Back     alignment and domain information
>gnl|CDD|183077 PRK11288, araG, L-arabinose transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|182569 PRK10584, PRK10584, putative ABC transporter ATP-binding protein YbbA; Provisional Back     alignment and domain information
>gnl|CDD|183244 PRK11629, lolD, lipoprotein transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|237451 PRK13631, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|131681 TIGR02633, xylG, D-xylose ABC transporter, ATP-binding protein Back     alignment and domain information
>gnl|CDD|224043 COG1118, CysA, ABC-type sulfate/molybdate transport systems, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|213228 cd03261, ABC_Org_Solvent_Resistant, ATP-binding cassette transport system involved in resistant to organic solvents Back     alignment and domain information
>gnl|CDD|224049 COG1124, DppF, ABC-type dipeptide/oligopeptide/nickel transport system, ATPase component [Amino acid transport and metabolism / Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|188353 TIGR03608, L_ocin_972_ABC, putative bacteriocin export ABC transporter, lactococcin 972 group Back     alignment and domain information
>gnl|CDD|183077 PRK11288, araG, L-arabinose transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|182569 PRK10584, PRK10584, putative ABC transporter ATP-binding protein YbbA; Provisional Back     alignment and domain information
>gnl|CDD|183063 PRK11264, PRK11264, putative amino-acid ABC transporter ATP-binding protein YecC; Provisional Back     alignment and domain information
>gnl|CDD|185336 PRK15439, PRK15439, autoinducer 2 ABC transporter ATP-binding protein LsrA; Provisional Back     alignment and domain information
>gnl|CDD|213190 cd03223, ABCD_peroxisomal_ALDP, ATP-binding cassette domain of peroxisomal transporter, subfamily D Back     alignment and domain information
>gnl|CDD|172741 PRK14253, PRK14253, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|172749 PRK14261, PRK14261, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|132313 TIGR03269, met_CoM_red_A2, methyl coenzyme M reductase system, component A2 Back     alignment and domain information
>gnl|CDD|226641 COG4172, COG4172, ABC-type uncharacterized transport system, duplicated ATPase component [General function prediction only] Back     alignment and domain information
>gnl|CDD|213204 cd03237, ABC_RNaseL_inhibitor_domain2, The ATP-binding cassette domain 2 of RNase L inhibitor Back     alignment and domain information
>gnl|CDD|215595 PLN03130, PLN03130, ABC transporter C family member; Provisional Back     alignment and domain information
>gnl|CDD|213195 cd03228, ABCC_MRP_Like, ATP-binding cassette domain of multidrug resistance protein-like transporters Back     alignment and domain information
>gnl|CDD|132302 TIGR03258, PhnT, 2-aminoethylphosphonate ABC transport system, ATP-binding component PhnT Back     alignment and domain information
>gnl|CDD|224041 COG1116, TauB, ABC-type nitrate/sulfonate/bicarbonate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|226592 COG4107, PhnK, ABC-type phosphonate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|182528 PRK10535, PRK10535, macrolide transporter ATP-binding /permease protein; Provisional Back     alignment and domain information
>gnl|CDD|222165 pfam13481, AAA_25, AAA domain Back     alignment and domain information
>gnl|CDD|237454 PRK13634, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|213205 cd03238, ABC_UvrA, ATP-binding cassette domain of the excision repair protein UvrA Back     alignment and domain information
>gnl|CDD|183280 PRK11701, phnK, phosphonate C-P lyase system protein PhnK; Provisional Back     alignment and domain information
>gnl|CDD|236689 PRK10419, nikE, nickel transporter ATP-binding protein NikE; Provisional Back     alignment and domain information
>gnl|CDD|213191 cd03224, ABC_TM1139_LivF_branched, ATP-binding cassette domain of branched-chain amino acid transporter Back     alignment and domain information
>gnl|CDD|226905 COG4525, TauB, ABC-type taurine transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|181965 PRK09580, sufC, cysteine desulfurase ATPase component; Reviewed Back     alignment and domain information
>gnl|CDD|237651 PRK14266, PRK14266, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 991
KOG0065 1391 consensus Pleiotropic drug resistance proteins (PD 100.0
PLN03140 1470 ABC transporter G family member; Provisional 100.0
TIGR00956 1394 3a01205 Pleiotropic Drug Resistance (PDR) Family p 100.0
KOG0061613 consensus Transporter, ABC superfamily (Breast can 100.0
PLN03211659 ABC transporter G-25; Provisional 100.0
TIGR00955617 3a01204 The Eye Pigment Precursor Transporter (EPP 100.0
PLN031401470 ABC transporter G family member; Provisional 100.0
KOG00651391 consensus Pleiotropic drug resistance proteins (PD 100.0
TIGR009561394 3a01205 Pleiotropic Drug Resistance (PDR) Family p 100.0
KOG00551228 consensus Multidrug/pheromone exporter, ABC superf 100.0
TIGR01257 2272 rim_protein retinal-specific rim ABC transporter. 100.0
PTZ00265 1466 multidrug resistance protein (mdr1); Provisional 100.0
COG1126240 GlnQ ABC-type polar amino acid transport system, A 100.0
COG1123539 ATPase components of various ABC-type transport sy 100.0
PLN032321495 ABC transporter C family member; Provisional 100.0
PLN03130 1622 ABC transporter C family member; Provisional 100.0
COG1135339 AbcC ABC-type metal ion transport system, ATPase c 100.0
TIGR009571522 MRP_assoc_pro multi drug resistance-associated pro 100.0
COG1125309 OpuBA ABC-type proline/glycine betaine transport s 100.0
COG3839338 MalK ABC-type sugar transport systems, ATPase comp 100.0
COG3842352 PotA ABC-type spermidine/putrescine transport syst 100.0
COG1131293 CcmA ABC-type multidrug transport system, ATPase c 100.0
COG1120258 FepC ABC-type cobalamin/Fe3+-siderophores transpor 100.0
PRK10762501 D-ribose transporter ATP binding protein; Provisio 100.0
PRK15134529 microcin C ABC transporter ATP-binding protein Yej 100.0
TIGR03269520 met_CoM_red_A2 methyl coenzyme M reductase system, 100.0
COG1116248 TauB ABC-type nitrate/sulfonate/bicarbonate transp 100.0
PRK09700510 D-allose transporter ATP-binding protein; Provisio 100.0
COG1127263 Ttg2A ABC-type transport system involved in resist 100.0
PTZ00243 1560 ABC transporter; Provisional 100.0
COG1117253 PstB ABC-type phosphate transport system, ATPase c 100.0
PRK10261623 glutathione transporter ATP-binding protein; Provi 100.0
COG1118345 CysA ABC-type sulfate/molybdate transport systems, 100.0
PRK11288501 araG L-arabinose transporter ATP-binding protein; 100.0
COG3638258 ABC-type phosphate/phosphonate transport system, A 100.0
COG1136226 SalX ABC-type antimicrobial peptide transport syst 100.0
TIGR01271 1490 CFTR_protein cystic fibrosis transmembrane conduct 100.0
TIGR02633500 xylG D-xylose ABC transporter, ATP-binding protein 100.0
COG1121254 ZnuC ABC-type Mn/Zn transport systems, ATPase comp 100.0
COG4555245 NatA ABC-type Na+ transport system, ATPase compone 100.0
KOG0058716 consensus Peptide exporter, ABC superfamily [Intra 100.0
TIGR02314343 ABC_MetN D-methionine ABC transporter, ATP-binding 100.0
TIGR03265353 PhnT2 putative 2-aminoethylphosphonate ABC transpo 100.0
PRK11650356 ugpC glycerol-3-phosphate transporter ATP-binding 100.0
PRK11432351 fbpC ferric transporter ATP-binding subunit; Provi 100.0
TIGR03258362 PhnT 2-aminoethylphosphonate ABC transport system, 100.0
COG2274709 SunT ABC-type bacteriocin/lantibiotic exporters, c 100.0
PRK09452375 potA putrescine/spermidine ABC transporter ATPase 100.0
PRK13537306 nodulation ABC transporter NodI; Provisional 100.0
PRK10938490 putative molybdenum transport ATP-binding protein 100.0
COG1122235 CbiO ABC-type cobalt transport system, ATPase comp 100.0
PRK10851353 sulfate/thiosulfate transporter subunit; Provision 100.0
COG1124252 DppF ABC-type dipeptide/oligopeptide/nickel transp 100.0
cd03261235 ABC_Org_Solvent_Resistant ABC (ATP-binding cassett 100.0
COG3840231 ThiQ ABC-type thiamine transport system, ATPase co 100.0
PRK11607377 potG putrescine transporter ATP-binding subunit; P 100.0
COG0410237 LivF ABC-type branched-chain amino acid transport 100.0
TIGR01186363 proV glycine betaine/L-proline transport ATP bindi 100.0
PRK11000369 maltose/maltodextrin transporter ATP-binding prote 100.0
PRK11819556 putative ABC transporter ATP-binding protein; Revi 100.0
COG2884223 FtsE Predicted ATPase involved in cell division [C 100.0
KOG0057591 consensus Mitochondrial Fe/S cluster exporter, ABC 100.0
COG0411250 LivG ABC-type branched-chain amino acid transport 100.0
PRK11153343 metN DL-methionine transporter ATP-binding subunit 100.0
PRK13536340 nodulation factor exporter subunit NodI; Provision 100.0
TIGR01188302 drrA daunorubicin resistance ABC transporter ATP-b 100.0
PRK15064530 ABC transporter ATP-binding protein; Provisional 100.0
TIGR03719552 ABC_ABC_ChvD ATP-binding cassette protein, ChvD fa 100.0
cd03259213 ABC_Carb_Solutes_like ABC Carbohydrate and Solute 100.0
PRK13637287 cbiO cobalt transporter ATP-binding subunit; Provi 100.0
KOG00541381 consensus Multidrug resistance-associated protein/ 100.0
cd03265220 ABC_DrrA DrrA is the ATP-binding protein component 100.0
TIGR01288303 nodI ATP-binding ABC transporter family nodulation 100.0
cd03296239 ABC_CysA_sulfate_importer Part of the ABC transpor 100.0
PRK13634290 cbiO cobalt transporter ATP-binding subunit; Provi 100.0
PRK13643288 cbiO cobalt transporter ATP-binding subunit; Provi 100.0
cd03258233 ABC_MetN_methionine_transporter MetN (also known a 100.0
cd03219236 ABC_Mj1267_LivG_branched The Mj1267/LivG ABC trans 100.0
COG4559259 ABC-type hemin transport system, ATPase component 100.0
cd03301213 ABC_MalK_N The N-terminal ATPase domain of the mal 100.0
PRK11174588 cysteine/glutathione ABC transporter membrane/ATP- 100.0
cd03218232 ABC_YhbG The ABC transporters belonging to the Yhb 100.0
cd03293220 ABC_NrtD_SsuB_transporters NrtD and SsuB are the A 100.0
cd03260227 ABC_PstB_phosphate_transporter Phosphate uptake is 100.0
TIGR03522301 GldA_ABC_ATP gliding motility-associated ABC trans 100.0
TIGR00960216 3a0501s02 Type II (General) Secretory Pathway (IIS 100.0
cd03263220 ABC_subfamily_A The ABCA subfamily mediates the tr 100.0
KOG0056790 consensus Heavy metal exporter HMT1, ABC superfami 100.0
cd03256241 ABC_PhnC_transporter ABC-type phosphate/phosphonat 100.0
PRK13650279 cbiO cobalt transporter ATP-binding subunit; Provi 100.0
cd03224222 ABC_TM1139_LivF_branched LivF (TM1139) is part of 100.0
COG0444316 DppD ABC-type dipeptide/oligopeptide/nickel transp 100.0
cd03294269 ABC_Pro_Gly_Bertaine This family comprises the gly 100.0
KOG00551228 consensus Multidrug/pheromone exporter, ABC superf 100.0
PRK13647274 cbiO cobalt transporter ATP-binding subunit; Provi 100.0
COG1132567 MdlB ABC-type multidrug transport system, ATPase a 100.0
PRK13651305 cobalt transporter ATP-binding subunit; Provisiona 100.0
PRK13631320 cbiO cobalt transporter ATP-binding subunit; Provi 100.0
cd03269210 ABC_putative_ATPase This subfamily is involved in 100.0
COG4175386 ProV ABC-type proline/glycine betaine transport sy 100.0
cd03255218 ABC_MJ0796_Lo1CDE_FtsE This family is comprised of 100.0
PRK11831269 putative ABC transporter ATP-binding protein YrbF; 100.0
cd03234226 ABCG_White The White subfamily represents ABC tran 100.0
cd03295242 ABC_OpuCA_Osmoprotection OpuCA is a the ATP bindin 100.0
cd03233202 ABC_PDR_domain1 The pleiotropic drug resistance (P 100.0
PRK15079331 oligopeptide ABC transporter ATP-binding protein O 100.0
PRK10070400 glycine betaine transporter ATP-binding subunit; P 100.0
PRK11629233 lolD lipoprotein transporter ATP-binding subunit; 100.0
TIGR03864236 PQQ_ABC_ATP ABC transporter, ATP-binding subunit, 100.0
PRK09536402 btuD corrinoid ABC transporter ATPase; Reviewed 100.0
PRK13646286 cbiO cobalt transporter ATP-binding subunit; Provi 100.0
PRK09473330 oppD oligopeptide transporter ATP-binding componen 100.0
cd03268208 ABC_BcrA_bacitracin_resist The BcrA subfamily repr 100.0
COG1137243 YhbG ABC-type (unclassified) transport system, ATP 100.0
TIGR02315243 ABC_phnC phosphonate ABC transporter, ATP-binding 100.0
cd03266218 ABC_NatA_sodium_exporter NatA is the ATPase compon 100.0
PRK13635279 cbiO cobalt transporter ATP-binding subunit; Provi 100.0
PRK09493240 glnQ glutamine ABC transporter ATP-binding protein 100.0
PRK11264250 putative amino-acid ABC transporter ATP-binding pr 100.0
PRK11022326 dppD dipeptide transporter ATP-binding subunit; Pr 100.0
cd03226205 ABC_cobalt_CbiO_domain2 Domain II of the ABC compo 100.0
TIGR03797686 NHPM_micro_ABC2 NHPM bacteriocin system ABC transp 100.0
PRK13636283 cbiO cobalt transporter ATP-binding subunit; Provi 100.0
TIGR02211221 LolD_lipo_ex lipoprotein releasing system, ATP-bin 100.0
cd03264211 ABC_drug_resistance_like ABC-type multidrug transp 100.0
cd03267236 ABC_NatA_like Similar in sequence to NatA, this is 100.0
PRK11248255 tauB taurine transporter ATP-binding subunit; Prov 100.0
PRK13632271 cbiO cobalt transporter ATP-binding subunit; Provi 100.0
TIGR03415382 ABC_choXWV_ATP choline ABC transporter, ATP-bindin 100.0
TIGR03410230 urea_trans_UrtE urea ABC transporter, ATP-binding 100.0
PRK11308327 dppF dipeptide transporter ATP-binding subunit; Pr 100.0
cd03292214 ABC_FtsE_transporter FtsE is a hydrophilic nucleot 100.0
cd03257228 ABC_NikE_OppD_transporters The ABC transporter sub 100.0
PRK11176582 lipid transporter ATP-binding/permease protein; Pr 100.0
PRK11247257 ssuB aliphatic sulfonates transport ATP-binding su 100.0
PRK13652277 cbiO cobalt transporter ATP-binding subunit; Provi 100.0
COG4987573 CydC ABC-type transport system involved in cytochr 100.0
TIGR03375694 type_I_sec_LssB type I secretion system ATPase, Ls 100.0
TIGR03005252 ectoine_ehuA ectoine/hydroxyectoine ABC transporte 100.0
PRK10895241 lipopolysaccharide ABC transporter ATP-binding pro 100.0
COG4988559 CydD ABC-type transport system involved in cytochr 100.0
PRK11614237 livF leucine/isoleucine/valine transporter ATP-bin 100.0
PRK14273254 phosphate ABC transporter ATP-binding protein; Pro 100.0
TIGR02673214 FtsE cell division ATP-binding protein FtsE. This 100.0
PRK13633280 cobalt transporter ATP-binding subunit; Provisiona 100.0
PRK13548258 hmuV hemin importer ATP-binding subunit; Provision 100.0
TIGR00972247 3a0107s01c2 phosphate ABC transporter, ATP-binding 100.0
PRK10790592 putative multidrug transporter membrane\ATP-bindin 100.0
cd03300232 ABC_PotA_N PotA is an ABC-type transporter and the 100.0
PRK14242253 phosphate transporter ATP-binding protein; Provisi 100.0
PRK13648269 cbiO cobalt transporter ATP-binding subunit; Provi 100.0
PRK11160574 cysteine/glutathione ABC transporter membrane/ATP- 100.0
PRK10584228 putative ABC transporter ATP-binding protein YbbA; 100.0
PRK13640282 cbiO cobalt transporter ATP-binding subunit; Provi 100.0
TIGR01193708 bacteriocin_ABC ABC-type bacteriocin transporter. 100.0
PRK14247250 phosphate ABC transporter ATP-binding protein; Pro 100.0
PRK15093330 antimicrobial peptide ABC transporter ATP-binding 100.0
TIGR03411242 urea_trans_UrtD urea ABC transporter, ATP-binding 100.0
PRK11300255 livG leucine/isoleucine/valine transporter ATP-bin 100.0
PRK13649280 cbiO cobalt transporter ATP-binding subunit; Provi 100.0
TIGR03740223 galliderm_ABC gallidermin-class lantibiotic protec 100.0
PRK13644274 cbiO cobalt transporter ATP-binding subunit; Provi 100.0
PRK13638271 cbiO cobalt transporter ATP-binding subunit; Provi 100.0
TIGR03796710 NHPM_micro_ABC1 NHPM bacteriocin system ABC transp 100.0
PRK14268258 phosphate ABC transporter ATP-binding protein; Pro 100.0
PRK10908222 cell division protein FtsE; Provisional 100.0
PRK13639275 cbiO cobalt transporter ATP-binding subunit; Provi 100.0
PRK14250241 phosphate ABC transporter ATP-binding protein; Pro 100.0
PRK13641287 cbiO cobalt transporter ATP-binding subunit; Provi 100.0
PRK11124242 artP arginine transporter ATP-binding subunit; Pro 100.0
PRK14267253 phosphate ABC transporter ATP-binding protein; Pro 100.0
cd03298211 ABC_ThiQ_thiamine_transporter ABC-type thiamine tr 100.0
PRK10619257 histidine/lysine/arginine/ornithine transporter su 100.0
TIGR01978243 sufC FeS assembly ATPase SufC. SufC is part of the 100.0
TIGR00958711 3a01208 Conjugate Transporter-2 (CT2) Family prote 100.0
cd03299235 ABC_ModC_like Archeal protein closely related to M 100.0
TIGR00968237 3a0106s01 sulfate ABC transporter, ATP-binding pro 100.0
PRK11144352 modC molybdate transporter ATP-binding protein; Pr 100.0
PRK10575265 iron-hydroxamate transporter ATP-binding subunit; 100.0
PRK10253265 iron-enterobactin transporter ATP-binding protein; 100.0
TIGR02770230 nickel_nikD nickel import ATP-binding protein NikD 100.0
PRK14237267 phosphate transporter ATP-binding protein; Provisi 100.0
PRK13645289 cbiO cobalt transporter ATP-binding subunit; Provi 100.0
PRK14235267 phosphate transporter ATP-binding protein; Provisi 100.0
PRK10744260 pstB phosphate transporter ATP-binding protein; Pr 100.0
TIGR01184230 ntrCD nitrate transport ATP-binding subunits C and 100.0
PRK10771232 thiQ thiamine transporter ATP-binding subunit; Pro 100.0
COG4525259 TauB ABC-type taurine transport system, ATPase com 100.0
TIGR02769265 nickel_nikE nickel import ATP-binding protein NikE 100.0
cd03262213 ABC_HisP_GlnQ_permeases HisP and GlnQ are the ATP- 100.0
TIGR02142354 modC_ABC molybdenum ABC transporter, ATP-binding p 100.0
PRK14245250 phosphate ABC transporter ATP-binding protein; Pro 100.0
PRK13642277 cbiO cobalt transporter ATP-binding subunit; Provi 100.0
PRK14257329 phosphate ABC transporter ATP-binding protein; Pro 100.0
PRK11231255 fecE iron-dicitrate transporter ATP-binding subuni 100.0
PRK09984262 phosphonate/organophosphate ester transporter subu 100.0
PTZ002651466 multidrug resistance protein (mdr1); Provisional 100.0
TIGR01277213 thiQ thiamine ABC transporter, ATP-binding protein 100.0
PRK14256252 phosphate ABC transporter ATP-binding protein; Pro 100.0
PRK14239252 phosphate transporter ATP-binding protein; Provisi 100.0
PRK14241258 phosphate transporter ATP-binding protein; Provisi 100.0
cd03225211 ABC_cobalt_CbiO_domain1 Domain I of the ABC compon 100.0
PRK14270251 phosphate ABC transporter ATP-binding protein; Pro 100.0
TIGR03873256 F420-0_ABC_ATP proposed F420-0 ABC transporter, AT 100.0
PRK14269246 phosphate ABC transporter ATP-binding protein; Pro 100.0
TIGR01842544 type_I_sec_PrtD type I secretion system ABC transp 100.0
PRK14274259 phosphate ABC transporter ATP-binding protein; Pro 100.0
PRK11147635 ABC transporter ATPase component; Reviewed 100.0
PRK14240250 phosphate transporter ATP-binding protein; Provisi 100.0
PRK14259269 phosphate ABC transporter ATP-binding protein; Pro 100.0
cd03213194 ABCG_EPDR ABCG transporters are involved in eye pi 100.0
PRK14262250 phosphate ABC transporter ATP-binding protein; Pro 100.0
PRK11701258 phnK phosphonate C-P lyase system protein PhnK; Pr 100.0
PRK10418254 nikD nickel transporter ATP-binding protein NikD; 100.0
cd03235213 ABC_Metallic_Cations ABC component of the metal-ty 100.0
TIGR01846694 type_I_sec_HlyB type I secretion system ABC transp 100.0
TIGR02203571 MsbA_lipidA lipid A export permease/ATP-binding pr 100.0
COG4181228 Predicted ABC-type transport system involved in ly 100.0
PRK14244251 phosphate ABC transporter ATP-binding protein; Pro 100.0
PRK14248268 phosphate ABC transporter ATP-binding protein; Pro 100.0
PRK15112267 antimicrobial peptide ABC system ATP-binding prote 100.0
PRK13657588 cyclic beta-1,2-glucan ABC transporter; Provisiona 100.0
PRK14271276 phosphate ABC transporter ATP-binding protein; Pro 100.0
PRK14258261 phosphate ABC transporter ATP-binding protein; Pro 100.0
PRK14272252 phosphate ABC transporter ATP-binding protein; Pro 100.0
PRK14253249 phosphate ABC transporter ATP-binding protein; Pro 100.0
PRK14236272 phosphate transporter ATP-binding protein; Provisi 100.0
PRK10789569 putative multidrug transporter membrane\ATP-bindin 100.0
TIGR02982220 heterocyst_DevA ABC exporter ATP-binding subunit, 100.0
PRK14255252 phosphate ABC transporter ATP-binding protein; Pro 100.0
PRK13547272 hmuV hemin importer ATP-binding subunit; Provision 100.0
PRK14249251 phosphate ABC transporter ATP-binding protein; Pro 100.0
cd03232192 ABC_PDR_domain2 The pleiotropic drug resistance-li 100.0
PRK14251251 phosphate ABC transporter ATP-binding protein; Pro 100.0
PRK14261253 phosphate ABC transporter ATP-binding protein; Pro 100.0
PRK14260259 phosphate ABC transporter ATP-binding protein; Pro 100.0
PRK15439510 autoinducer 2 ABC transporter ATP-binding protein 100.0
cd03297214 ABC_ModC_molybdenum_transporter ModC is an ABC-typ 100.0
TIGR01192585 chvA glucan exporter ATP-binding protein. This mod 100.0
COG1123539 ATPase components of various ABC-type transport sy 100.0
PRK14275286 phosphate ABC transporter ATP-binding protein; Pro 100.0
cd03252237 ABCC_Hemolysin The ABC-transporter hemolysin B is 100.0
PRK13549506 xylose transporter ATP-binding subunit; Provisiona 100.0
COG4152300 ABC-type uncharacterized transport system, ATPase 100.0
TIGR02323253 CP_lyasePhnK phosphonate C-P lyase system protein 100.0
cd03245220 ABCC_bacteriocin_exporters ABC-type bacteriocin ex 100.0
COG4618580 ArpD ABC-type protease/lipase transport system, AT 100.0
PRK14263261 phosphate ABC transporter ATP-binding protein; Pro 100.0
PRK14238271 phosphate transporter ATP-binding protein; Provisi 100.0
TIGR012572272 rim_protein retinal-specific rim ABC transporter. 100.0
PRK14265274 phosphate ABC transporter ATP-binding protein; Pro 100.0
PRK10419268 nikE nickel transporter ATP-binding protein NikE; 100.0
cd03249238 ABC_MTABC3_MDL1_MDL2 MTABC3 (also known as ABCB6) 100.0
PRK14243264 phosphate transporter ATP-binding protein; Provisi 100.0
PRK14254285 phosphate ABC transporter ATP-binding protein; Pro 100.0
TIGR03608206 L_ocin_972_ABC putative bacteriocin export ABC tra 100.0
TIGR02204576 MsbA_rel ABC transporter, permease/ATP-binding pro 100.0
COG4148352 ModC ABC-type molybdate transport system, ATPase c 100.0
PRK10247225 putative ABC transporter ATP-binding protein YbbL; 100.0
cd03289275 ABCC_CFTR2 The CFTR subfamily domain 2. The cystic 100.0
PRK10261623 glutathione transporter ATP-binding protein; Provi 100.0
cd03254229 ABCC_Glucan_exporter_like Glucan exporter ATP-bind 100.0
PRK03695248 vitamin B12-transporter ATPase; Provisional 100.0
cd03251234 ABCC_MsbA MsbA is an essential ABC transporter, cl 100.0
PRK14266250 phosphate ABC transporter ATP-binding protein; Pro 100.0
COG5265497 ATM1 ABC-type transport system involved in Fe-S cl 100.0
CHL00131252 ycf16 sulfate ABC transporter protein; Validated 100.0
PRK14246257 phosphate ABC transporter ATP-binding protein; Pro 100.0
PRK15056272 manganese/iron transporter ATP-binding protein; Pr 100.0
PLN032321495 ABC transporter C family member; Provisional 100.0
COG4604252 CeuD ABC-type enterochelin transport system, ATPas 100.0
PLN031301622 ABC transporter C family member; Provisional 100.0
PRK14252265 phosphate ABC transporter ATP-binding protein; Pro 100.0
cd03220224 ABC_KpsT_Wzt ABC_KpsT_Wzt The KpsT/Wzt ABC transpo 100.0
cd03217200 ABC_FeS_Assembly ABC-type transport system involve 100.0
PRK13543214 cytochrome c biogenesis protein CcmA; Provisional 100.0
PRK09580248 sufC cysteine desulfurase ATPase component; Review 100.0
PRK13546264 teichoic acids export protein ATP-binding subunit; 100.0
PRK14264305 phosphate ABC transporter ATP-binding protein; Pro 100.0
TIGR02868529 CydC thiol reductant ABC exporter, CydC subunit. T 100.0
PRK13538204 cytochrome c biogenesis protein CcmA; Provisional 100.0
COG4161242 ArtP ABC-type arginine transport system, ATPase co 100.0
PRK15134529 microcin C ABC transporter ATP-binding protein Yej 100.0
PRK09544251 znuC high-affinity zinc transporter ATPase; Review 100.0
cd03244221 ABCC_MRP_domain2 Domain 2 of the ABC subfamily C. 100.0
PRK10982491 galactose/methyl galaxtoside transporter ATP-bindi 100.0
cd03230173 ABC_DR_subfamily_A This family of ATP-binding prot 100.0
cd03231201 ABC_CcmA_heme_exporter CcmA, the ATP-binding compo 100.0
TIGR03269520 met_CoM_red_A2 methyl coenzyme M reductase system, 100.0
cd03253236 ABCC_ATM1_transporter ATM1 is an ABC transporter t 100.0
cd03288257 ABCC_SUR2 The SUR domain 2. The sulfonylurea recep 100.0
TIGR01166190 cbiO cobalt transport protein ATP-binding subunit. 100.0
TIGR01189198 ccmA heme ABC exporter, ATP-binding protein CcmA. 100.0
TIGR009571522 MRP_assoc_pro multi drug resistance-associated pro 100.0
COG4598256 HisP ABC-type histidine transport system, ATPase c 100.0
TIGR02324224 CP_lyasePhnL phosphonate C-P lyase system protein 100.0
PRK13539207 cytochrome c biogenesis protein CcmA; Provisional 100.0
PRK13545549 tagH teichoic acids export protein ATP-binding sub 100.0
cd03229178 ABC_Class3 This class is comprised of all BPD (Bin 100.0
TIGR01187325 potA spermidine/putrescine ABC transporter ATP-bin 100.0
TIGR02857529 CydD thiol reductant ABC exporter, CydD subunit. U 100.0
cd03215182 ABC_Carb_Monos_II This family represents domain II 100.0
PTZ002431560 ABC transporter; Provisional 100.0
cd03369207 ABCC_NFT1 Domain 2 of NFT1 (New full-length MRP-ty 100.0
PRK15177213 Vi polysaccharide export ATP-binding protein VexC; 100.0
cd03248226 ABCC_TAP TAP, the Transporter Associated with Anti 100.0
PRK09700510 D-allose transporter ATP-binding protein; Provisio 100.0
TIGR03771223 anch_rpt_ABC anchored repeat-type ABC transporter, 100.0
cd03246173 ABCC_Protease_Secretion This family represents the 100.0
PRK13549506 xylose transporter ATP-binding subunit; Provisiona 100.0
cd03247178 ABCC_cytochrome_bd The CYD subfamily implicated in 100.0
PRK13540200 cytochrome c biogenesis protein CcmA; Provisional 100.0
cd03291282 ABCC_CFTR1 The CFTR subfamily domain 1. The cystic 100.0
PRK11288501 araG L-arabinose transporter ATP-binding protein; 100.0
PRK10762501 D-ribose transporter ATP binding protein; Provisio 100.0
COG4172534 ABC-type uncharacterized transport system, duplica 100.0
COG1129500 MglA ABC-type sugar transport system, ATPase compo 100.0
PRK10522547 multidrug transporter membrane component/ATP-bindi 100.0
COG4586325 ABC-type uncharacterized transport system, ATPase 100.0
COG0396251 sufC Cysteine desulfurase activator ATPase [Posttr 100.0
TIGR012711490 CFTR_protein cystic fibrosis transmembrane conduct 100.0
cd03237246 ABC_RNaseL_inhibitor_domain2 The ATPase domain 2 o 100.0
COG4619223 ABC-type uncharacterized transport system, ATPase 100.0
cd03214180 ABC_Iron-Siderophores_B12_Hemin ABC transporters, 100.0
TIGR02633500 xylG D-xylose ABC transporter, ATP-binding protein 100.0
cd03290218 ABCC_SUR1_N The SUR domain 1. The sulfonylurea rec 100.0
PRK15439510 autoinducer 2 ABC transporter ATP-binding protein 100.0
cd03250204 ABCC_MRP_domain1 Domain 1 of the ABC subfamily C. 100.0
COG4674249 Uncharacterized ABC-type transport system, ATPase 100.0
PRK13541195 cytochrome c biogenesis protein CcmA; Provisional 99.98
PRK10535648 macrolide transporter ATP-binding /permease protei 99.98
cd03216163 ABC_Carb_Monos_I This family represents the domain 99.98
cd03223166 ABCD_peroxisomal_ALDP Peroxisomal ATP-binding cass 99.98
cd03228171 ABCC_MRP_Like The MRP (Mutidrug Resistance Protein 99.98
COG1119257 ModF ABC-type molybdenum transport system, ATPase 99.98
TIGR01194555 cyc_pep_trnsptr cyclic peptide transporter. This m 99.97
PRK15064530 ABC transporter ATP-binding protein; Provisional 99.97
PRK10938490 putative molybdenum transport ATP-binding protein 99.97
COG4172534 ABC-type uncharacterized transport system, duplica 99.97
PRK10982491 galactose/methyl galaxtoside transporter ATP-bindi 99.97
COG1101263 PhnK ABC-type uncharacterized transport system, AT 99.97
COG4608268 AppF ABC-type oligopeptide transport system, ATPas 99.97
PRK11819556 putative ABC transporter ATP-binding protein; Revi 99.97
TIGR03719552 ABC_ABC_ChvD ATP-binding cassette protein, ChvD fa 99.97
PRK13409590 putative ATPase RIL; Provisional 99.97
COG3845501 ABC-type uncharacterized transport systems, ATPase 99.97
KOG0059885 consensus Lipid exporter ABCA1 and related protein 99.97
cd03236255 ABC_RNaseL_inhibitor_domain1 The ATPase domain 1 o 99.97
PRK10636638 putative ABC transporter ATP-binding protein; Prov 99.97
COG4167267 SapF ABC-type antimicrobial peptide transport syst 99.97
TIGR00954659 3a01203 Peroxysomal Fatty Acyl CoA Transporter (FA 99.97
PRK11147635 ABC transporter ATPase component; Reviewed 99.96
COG1134249 TagH ABC-type polysaccharide/polyol phosphate tran 99.96
cd03221144 ABCF_EF-3 ABCF_EF-3 Elongation factor 3 (EF-3) is 99.96
COG4133209 CcmA ABC-type transport system involved in cytochr 99.96
PLN03073718 ABC transporter F family; Provisional 99.96
PRK10636638 putative ABC transporter ATP-binding protein; Prov 99.96
cd03222177 ABC_RNaseL_inhibitor The ABC ATPase RNase L inhibi 99.96
cd03238176 ABC_UvrA The excision repair protein UvrA; Nucleot 99.96
COG4136213 ABC-type uncharacterized transport system, ATPase 99.96
PRK13409590 putative ATPase RIL; Provisional 99.96
KOG00541381 consensus Multidrug resistance-associated protein/ 99.95
COG4107258 PhnK ABC-type phosphonate transport system, ATPase 99.95
cd00267157 ABC_ATPase ABC (ATP-binding cassette) transporter 99.95
COG0488530 Uup ATPase components of ABC transporters with dup 99.95
PF00005137 ABC_tran: ABC transporter This structure is on hol 99.95
PLN03073718 ABC transporter F family; Provisional 99.94
KOG0061 613 consensus Transporter, ABC superfamily (Breast can 99.94
cd03270226 ABC_UvrA_I The excision repair protein UvrA domain 99.94
cd03271261 ABC_UvrA_II The excision repair protein UvrA domai 99.93
COG4778235 PhnL ABC-type phosphonate transport system, ATPase 99.92
cd03278197 ABC_SMC_barmotin Barmotin is a tight junction-asso 99.92
COG4138248 BtuD ABC-type cobalamin transport system, ATPase c 99.91
COG0488530 Uup ATPase components of ABC transporters with dup 99.91
COG1129500 MglA ABC-type sugar transport system, ATPase compo 99.91
cd03272243 ABC_SMC3_euk Eukaryotic SMC3 proteins; SMC protein 99.9
cd03274212 ABC_SMC4_euk Eukaryotic SMC4 proteins; SMC protein 99.88
cd03240204 ABC_Rad50 The catalytic domains of Rad50 are simil 99.88
cd03273251 ABC_SMC2_euk Eukaryotic SMC2 proteins; SMC protein 99.87
COG4178604 ABC-type uncharacterized transport system, permeas 99.86
PRK00349943 uvrA excinuclease ABC subunit A; Reviewed 99.86
COG3845501 ABC-type uncharacterized transport systems, ATPase 99.86
cd03279213 ABC_sbcCD SbcCD and other Mre11/Rad50 (MR) complex 99.86
KOG0927614 consensus Predicted transporter (ABC superfamily) 99.86
PRK00635 1809 excinuclease ABC subunit A; Provisional 99.85
TIGR00630924 uvra excinuclease ABC, A subunit. This family is b 99.83
TIGR00955 617 3a01204 The Eye Pigment Precursor Transporter (EPP 99.83
COG4170330 SapD ABC-type antimicrobial peptide transport syst 99.82
COG4615546 PvdE ABC-type siderophore export system, fused ATP 99.82
KOG0927614 consensus Predicted transporter (ABC superfamily) 99.82
PLN03211 659 ABC transporter G-25; Provisional 99.82
COG1245591 Predicted ATPase, RNase L inhibitor (RLI) homolog 99.81
cd03276198 ABC_SMC6_euk Eukaryotic SMC6 proteins; SMC protein 99.81
cd03275247 ABC_SMC1_euk Eukaryotic SMC1 proteins; SMC protein 99.78
KOG2355291 consensus Predicted ABC-type transport, ATPase com 99.77
COG1131 293 CcmA ABC-type multidrug transport system, ATPase c 99.77
cd03277213 ABC_SMC5_euk Eukaryotic SMC5 proteins; SMC protein 99.76
KOG0060659 consensus Long-chain acyl-CoA transporter, ABC sup 99.76
cd03280200 ABC_MutS2 MutS2 homologs in bacteria and eukaryote 99.75
COG2401593 ABC-type ATPase fused to a predicted acetyltransfe 99.73
KOG0066807 consensus eIF2-interacting protein ABC50 (ABC supe 99.72
KOG0059 885 consensus Lipid exporter ABCA1 and related protein 99.72
KOG0062582 consensus ATPase component of ABC transporters wit 99.72
PF01061210 ABC2_membrane: ABC-2 type transporter; InterPro: I 99.71
KOG0062582 consensus ATPase component of ABC transporters wit 99.7
cd03233202 ABC_PDR_domain1 The pleiotropic drug resistance (P 99.68
cd03239178 ABC_SMC_head The structural maintenance of chromos 99.67
COG1245591 Predicted ATPase, RNase L inhibitor (RLI) homolog 99.67
COG3842 352 PotA ABC-type spermidine/putrescine transport syst 99.67
COG1116 248 TauB ABC-type nitrate/sulfonate/bicarbonate transp 99.65
COG3839 338 MalK ABC-type sugar transport systems, ATPase comp 99.63
cd03285222 ABC_MSH2_euk MutS2 homolog in eukaryotes. The MutS 99.63
KOG0064728 consensus Peroxisomal long-chain acyl-CoA transpor 99.62
cd03227162 ABC_Class2 ABC-type Class 2 contains systems invol 99.62
cd03241276 ABC_RecN RecN ATPase involved in DNA repair; ABC ( 99.62
COG0178935 UvrA Excinuclease ATPase subunit [DNA replication, 99.61
PRK13537 306 nodulation ABC transporter NodI; Provisional 99.61
cd03283199 ABC_MutS-like MutS-like homolog in eukaryotes. The 99.61
TIGR03265 353 PhnT2 putative 2-aminoethylphosphonate ABC transpo 99.59
PRK006351809 excinuclease ABC subunit A; Provisional 99.59
cd03232192 ABC_PDR_domain2 The pleiotropic drug resistance-li 99.59
PRK11432 351 fbpC ferric transporter ATP-binding subunit; Provi 99.59
COG1136226 SalX ABC-type antimicrobial peptide transport syst 99.58
cd03234226 ABCG_White The White subfamily represents ABC tran 99.58
cd03261 235 ABC_Org_Solvent_Resistant ABC (ATP-binding cassett 99.57
COG1118 345 CysA ABC-type sulfate/molybdate transport systems, 99.57
COG1126 240 GlnQ ABC-type polar amino acid transport system, A 99.57
TIGR00630924 uvra excinuclease ABC, A subunit. This family is b 99.56
cd03269210 ABC_putative_ATPase This subfamily is involved in 99.56
KOG0058 716 consensus Peptide exporter, ABC superfamily [Intra 99.56
PRK11650 356 ugpC glycerol-3-phosphate transporter ATP-binding 99.56
COG1125 309 OpuBA ABC-type proline/glycine betaine transport s 99.55
cd03265220 ABC_DrrA DrrA is the ATP-binding protein component 99.55
PRK11607 377 potG putrescine transporter ATP-binding subunit; P 99.55
COG0410 237 LivF ABC-type branched-chain amino acid transport 99.55
PRK00349943 uvrA excinuclease ABC subunit A; Reviewed 99.55
PRK09452 375 potA putrescine/spermidine ABC transporter ATPase 99.55
COG1120 258 FepC ABC-type cobalamin/Fe3+-siderophores transpor 99.55
COG4525 259 TauB ABC-type taurine transport system, ATPase com 99.55
cd03242270 ABC_RecF RecF is a recombinational DNA repair ATPa 99.55
cd03243202 ABC_MutS_homologs The MutS protein initiates DNA m 99.54
cd03255218 ABC_MJ0796_Lo1CDE_FtsE This family is comprised of 99.54
cd03268208 ABC_BcrA_bacitracin_resist The BcrA subfamily repr 99.54
TIGR03522 301 GldA_ABC_ATP gliding motility-associated ABC trans 99.54
cd03263220 ABC_subfamily_A The ABCA subfamily mediates the tr 99.54
KOG0066807 consensus eIF2-interacting protein ABC50 (ABC supe 99.54
TIGR03258 362 PhnT 2-aminoethylphosphonate ABC transport system, 99.54
PRK13536 340 nodulation factor exporter subunit NodI; Provision 99.54
cd03224222 ABC_TM1139_LivF_branched LivF (TM1139) is part of 99.54
PRK10851 353 sulfate/thiosulfate transporter subunit; Provision 99.53
cd03295 242 ABC_OpuCA_Osmoprotection OpuCA is a the ATP bindin 99.53
cd03219 236 ABC_Mj1267_LivG_branched The Mj1267/LivG ABC trans 99.53
cd03293220 ABC_NrtD_SsuB_transporters NrtD and SsuB are the A 99.53
cd03218 232 ABC_YhbG The ABC transporters belonging to the Yhb 99.53
TIGR00960216 3a0501s02 Type II (General) Secretory Pathway (IIS 99.53
TIGR01288 303 nodI ATP-binding ABC transporter family nodulation 99.53
TIGR02314 343 ABC_MetN D-methionine ABC transporter, ATP-binding 99.52
cd03258 233 ABC_MetN_methionine_transporter MetN (also known a 99.52
cd03301213 ABC_MalK_N The N-terminal ATPase domain of the mal 99.52
PRK11000 369 maltose/maltodextrin transporter ATP-binding prote 99.52
cd03213194 ABCG_EPDR ABCG transporters are involved in eye pi 99.52
PRK14267 253 phosphate ABC transporter ATP-binding protein; Pro 99.52
PRK11629233 lolD lipoprotein transporter ATP-binding subunit; 99.52
cd03266218 ABC_NatA_sodium_exporter NatA is the ATPase compon 99.52
TIGR01188 302 drrA daunorubicin resistance ABC transporter ATP-b 99.52
PRK13539207 cytochrome c biogenesis protein CcmA; Provisional 99.52
cd03260227 ABC_PstB_phosphate_transporter Phosphate uptake is 99.52
PRK14247 250 phosphate ABC transporter ATP-binding protein; Pro 99.52
PRK13538204 cytochrome c biogenesis protein CcmA; Provisional 99.51
PRK11153 343 metN DL-methionine transporter ATP-binding subunit 99.51
cd03257228 ABC_NikE_OppD_transporters The ABC transporter sub 99.51
TIGR02673214 FtsE cell division ATP-binding protein FtsE. This 99.51
cd03259213 ABC_Carb_Solutes_like ABC Carbohydrate and Solute 99.51
cd03226205 ABC_cobalt_CbiO_domain2 Domain II of the ABC compo 99.51
cd03292214 ABC_FtsE_transporter FtsE is a hydrophilic nucleot 99.51
TIGR02211221 LolD_lipo_ex lipoprotein releasing system, ATP-bin 99.51
TIGR01193 708 bacteriocin_ABC ABC-type bacteriocin transporter. 99.5
cd03264211 ABC_drug_resistance_like ABC-type multidrug transp 99.5
PRK10895 241 lipopolysaccharide ABC transporter ATP-binding pro 99.5
PRK13540200 cytochrome c biogenesis protein CcmA; Provisional 99.5
PRK14241 258 phosphate transporter ATP-binding protein; Provisi 99.5
TIGR02868529 CydC thiol reductant ABC exporter, CydC subunit. T 99.5
cd03262213 ABC_HisP_GlnQ_permeases HisP and GlnQ are the ATP- 99.5
PRK11248 255 tauB taurine transporter ATP-binding subunit; Prov 99.5
PRK10908222 cell division protein FtsE; Provisional 99.5
TIGR01186 363 proV glycine betaine/L-proline transport ATP bindi 99.5
cd03296 239 ABC_CysA_sulfate_importer Part of the ABC transpor 99.5
PRK13543214 cytochrome c biogenesis protein CcmA; Provisional 99.5
TIGR03740 223 galliderm_ABC gallidermin-class lantibiotic protec 99.5
PRK14259 269 phosphate ABC transporter ATP-binding protein; Pro 99.5
TIGR00972 247 3a0107s01c2 phosphate ABC transporter, ATP-binding 99.5
PRK13637 287 cbiO cobalt transporter ATP-binding subunit; Provi 99.49
PRK09493 240 glnQ glutamine ABC transporter ATP-binding protein 99.49
cd03256 241 ABC_PhnC_transporter ABC-type phosphate/phosphonat 99.49
PRK13634 290 cbiO cobalt transporter ATP-binding subunit; Provi 99.49
TIGR03608206 L_ocin_972_ABC putative bacteriocin export ABC tra 99.49
cd03230173 ABC_DR_subfamily_A This family of ATP-binding prot 99.49
cd03231201 ABC_CcmA_heme_exporter CcmA, the ATP-binding compo 99.49
TIGR01189198 ccmA heme ABC exporter, ATP-binding protein CcmA. 99.49
TIGR03864 236 PQQ_ABC_ATP ABC transporter, ATP-binding subunit, 99.48
>KOG0065 consensus Pleiotropic drug resistance proteins (PDR1-15), ABC superfamily [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
Probab=100.00  E-value=1.9e-184  Score=1658.31  Aligned_cols=877  Identities=52%  Similarity=0.897  Sum_probs=811.8

Q ss_pred             CCcHHHhHHHHHhhCCchhhhhhcccccC-CCCcccccccCCCHHhHHHHHHHHHhhcccChHHHHHHHHHhhhhcCCCC
Q 001957           36 EDDEEALKWAALEKLPTYNRLRKGILTTS-RGEANEVDVYNLGLQERQRLIDKLVKVTDVDNERFLLKLKNRIDRVGIDL  114 (991)
Q Consensus        36 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~-~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  114 (991)
                      +||||++||||+|||||++|   +++.+. ++   ++|+.+++..++..+.++..+..++|+++++.++++|.+++  +.
T Consensus        12 ~~~e~~~~~a~~~~~pt~~~---~~~~~~~~~---~~d~~~~~~~~~~~~~~~~~~~~~~d~~~~l~~~r~~~~~~--~~   83 (1391)
T KOG0065|consen   12 DEDEEALRWAAIERLPTFDR---SLLRSIFES---EVDVTKLDPDDDPKFIEKSSKHWEQDNEKLLEKLRERIDRV--EL   83 (1391)
T ss_pred             chhHHHHHHHHHhcCccccc---hhhhhhccC---cccccCCCcccchhHHHHhHHHHhhhHHHHHHHHHhhcCcc--cC
Confidence            44999999999999999998   555432 22   79999999999999999999999999999999999999998  88


Q ss_pred             CceEEEEeeeEEEEEEecCCCCCCchHHHHHHHHHHHHhhhhhcCCccccceeeeceEEEEeCCeEEEEEcCCCCcHHHH
Q 001957          115 PKVEVRYEHLNVEAEAFLASNALPSFIKFYTNIFEDILNYLRIIPSKKRHLTILKDVSGVIKPGRLTLLLGPPSSGKTTL  194 (991)
Q Consensus       115 p~~~v~f~~l~~~~~~~~~~~~~~t~~~~~~~~~~~~~~~~~~~~~~~~~~~iL~~vs~~i~~Ge~~allGpsGsGKSTL  194 (991)
                      |.++++++++.+++++..|    ||++|...+.++.++...+..  ++.+.+||+|+||.++||+|++++||||||||||
T Consensus        84 p~~~~~~~~~gv~a~~~~~----~t~~n~~~~~~~~~~~~~~~~--~~~~~~il~~~sg~~~pg~m~lvLG~pgsG~ttl  157 (1391)
T KOG0065|consen   84 PTIEVRFSALGVEADVTYG----PTLVNILSNPLESILRMLGKR--KKKKIQILKDISGIIKPGEMTLVLGPPGSGKTTL  157 (1391)
T ss_pred             CceEEEeeecccccccccc----hhhhhhhhhHHHHHhhhcccc--ccccceeecCcceeEcCCceEEEecCCCCchHHH
Confidence            9999999999999998766    999999999999887766554  4556789999999999999999999999999999


Q ss_pred             HHHHhcCcCCCCCeeeEEEECCeeCCCccccceEEEEecCCCCCCCCCHHHHHHHHHHhcCCCchhhhhHHHHHHHHHcC
Q 001957          195 LLALAGKLDPTLKVSGTVTYNGHDMDEFVPQRTAAYISQHDNHIGEMTVRETLAFSARCQGVGTRYEMLTELARREKAAG  274 (991)
Q Consensus       195 L~~LaG~~~~~~~~~G~I~~nG~~~~~~~~~~~~~yv~Q~d~~~~~lTV~E~l~f~~~~~~~~~~~~~~~~~~~~~~~~~  274 (991)
                      |++|+|.++...+..|+|+|||++.+++.+++.++|++|+|.|+|+|||||||+|+++|++++.|++   ++.|+++.+ 
T Consensus       158 lkal~g~~~~~~~~~~~isy~G~~~~e~~~~~~~aY~~e~DvH~p~lTVreTldFa~rck~~~~r~~---~~~R~e~~~-  233 (1391)
T KOG0065|consen  158 LKALAGKLDNFLKSSGEITYNGHDLKEFVPKKTVAYNSEQDVHFPELTVRETLDFAARCKGPGSRYD---EVSRREKLA-  233 (1391)
T ss_pred             HHHHhCCCcccccCCCceeECCCcccccccCceEEeccccccccceeEEeehhhHHHhccCCccccc---cccHHHHHH-
Confidence            9999999988777789999999999999889999999999999999999999999999999988865   455555431 


Q ss_pred             CCCCCChHHHHHHHHhhhhhhhHHHHHHHHHcCCcccccccccCcccCCCChhHhHHHHHHHHHhcCCcEeEEeCCCCCC
Q 001957          275 IKPDPDIDVYMKAIATEGQEANVITDYYLKVLGLDVCADTMVGDEMIRGISGGQKKRVTTGEMMVGPALALFMDEISTGL  354 (991)
Q Consensus       275 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~lgL~~~~dt~vg~~~~~~LSGGqrqRvsia~~L~~~p~vLllDEPTsGL  354 (991)
                                            .++|++++++||++|+||+|||++.||+||||||||+||++++++++++||||+|+||
T Consensus       234 ----------------------~~~d~~lkilGL~~~~dT~VGnd~~RGvSGGerKRvsi~E~~v~~~~~~~~De~t~GL  291 (1391)
T KOG0065|consen  234 ----------------------AMTDYLLKILGLDHCADTLVGNDMVRGVSGGERKRVSIGEMLVGPASILFWDEITRGL  291 (1391)
T ss_pred             ----------------------HHHHHHHHHhCchhhccceecccccccccCcccceeeeeeeeecCcceeeeecccccc
Confidence                                  2689999999999999999999999999999999999999999999999999999999


Q ss_pred             CHHHHHHHHHHHHHHhhccCceEEEEEecCCchhHhhcCeEEEecCCeEEEecCHHHHHHHHHhcCCCCCCCCCHHHHHH
Q 001957          355 DSSTTFQIVNCLRQNIHINSGTAVISLLQPAPETYDLFDDIILLSDGQIVYQGPRELVLEFFASMGFRCPKRKGVADFLQ  434 (991)
Q Consensus       355 D~~t~~~i~~~L~~l~~~~~~t~ii~i~q~~~~~~~lfD~vilL~~G~iv~~G~~~~~~~~f~~~G~~~p~~~~~adfl~  434 (991)
                      |++|+++|+++||+++|..+.|.+++++||+++++++||+|++|++|++||+||++++++||+++||.||+++++|||++
T Consensus       292 DSsTal~iik~lr~~a~~~~~t~~vsi~Q~s~~~~~lFD~v~lL~eG~~iy~Gp~d~~~~yFe~~Gf~cP~r~~~ADfLt  371 (1391)
T KOG0065|consen  292 DSSTAFQIIKALRQLAHITGATALVSILQPSPEIYDLFDDVILLSEGYQIYQGPRDEVLPYFEDMGFKCPPRKGTADFLT  371 (1391)
T ss_pred             cHHHHHHHHHHHHHHHhhhcceEEEEeccCChHHHHhhhheeeeeccceEEeccHHHHHHHHHhcCccCCCccCHHHHHH
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HhcCchhhhhhhhccCCCccccCHHHHHHHHHhccccccchhhhcCCccCcccccccccccccCCcHHHHHHHHHHHHHH
Q 001957          435 EVTSRKDQRQYWAHKEKPYRFVTVQEFAEAFQSFHVGQKISDELRTPFDKSKSHRAALTTETYGVGKRELLKANISRELL  514 (991)
Q Consensus       435 ~v~s~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~s~~~~~~~~~~R~~l  514 (991)
                      ++++.+++.|||..++.|+.+.++.||.+.|.+++.++++..+++.++++.+.|+.++..++|.+++|+|+++|+.|+++
T Consensus       372 ~vts~k~~~~~~~~~~~~~~~~~~~ef~~~~~~s~~~~~l~~~l~~~~~~~k~~~~al~s~~y~v~~~~qvk~c~~R~f~  451 (1391)
T KOG0065|consen  372 EVTSKKDQEQYWNKRSKPYPYTSVSEFAEYFLNSEDYAKLKKELSKPYDKSKKHKAALVSSKYSVPYWEQVKACTIREFL  451 (1391)
T ss_pred             HhhcCccccccccccCCCcccCCHHHHHHHHhcchhhHHHHHHhcchhhhhhccchhhcCCceeccHHHHHHHHHHHHHH
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHhChHHHHHHHHHHHHHHHHHHHhhccccCCCCccccccchhhHHHHHHHHHHHhHHHHHHHHhhcchhhhhhhccCc
Q 001957          515 LMKRNSFVYIFKLIQIAFVAVVYMTLFLRTKMHKDTVTDGGIFAGATFFAITMVNFNGFSEISMTIAKLPVFYKQRDFRF  594 (991)
Q Consensus       515 ~~~R~~~~~~~r~~~~~~~ali~g~lf~~~~~~~~~~~~~~~~~g~lff~~~~~~~~~~~~~~~~~~~~~vf~ker~~~~  594 (991)
                      +++||++++++++++.+++|+|+|++|+++++  ++..++..+.|++||++++.+|++++|++++++++|||+|||+..|
T Consensus       452 l~k~n~~~~~~~~~~~~i~ali~gslF~~~~~--~t~~~~~~~~~~lffsll~~~f~~laEi~~~~~~~pv~~Khr~~~f  529 (1391)
T KOG0065|consen  452 LMKRNYFYYVFKTVQLVIQALITGSLFYRTPM--STTSGGYSRGGALFFALLFNLFNGLAEIALTFQRLPVFYKHRDLSF  529 (1391)
T ss_pred             HHhCCceEEEhHHHHHHHHHHHHhhheeeccC--cccccchhhhhHHHHHHHHHHHHhHHHHHHHHhhcchHHHhhcccc
Confidence            99999999999999999999999999999985  5667788899999999999999999999999999999999999999


Q ss_pred             cChhhHHHHHHHHHhhHHHHHHHHhhhhhhhccCCccchHHHHHHHHHHHHHHHHHHHHHHHHHHhccchHHHHHHHHHH
Q 001957          595 FPPWAYAIPSWILKIPVSFLEVAVWVFLSYYVVGYDSNAGRFFKQYALLLGVNQMASALFRFIAVTGRNMVVANTFGSFA  674 (991)
Q Consensus       595 Y~~~ay~la~~l~~iP~~~~~~~i~~~i~Yf~~Gl~~~~~~ff~~~l~~~~~~~~~~sl~~~i~a~~~~~~~A~~~~~~~  674 (991)
                      |+||||.+|.+++++|+.++++++|.+|+||++||.+++++||+|+|+++++++|++++|++++++++++.+|+++|++.
T Consensus       530 Y~p~A~al~s~l~~~P~~~i~~~vf~iI~Yfl~gl~~~A~rFF~~fL~lf~~~~~~s~lFr~ia~l~~t~~~An~~g~~~  609 (1391)
T KOG0065|consen  530 YPPWAEALASTLLKIPSSFIESVVFVIITYFLIGLKRNAGRFFIQFLFLFLCQFCMSGLFRFIASLSRTLSIANLIGGIL  609 (1391)
T ss_pred             cChHHHHHHHHHHhCcHHHHHHHHHHHHHHHHhcCCcchHHHHHHHHHHHHHHHHHHHHHHHHHHhcchHHHHhhHhHHH
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHHhccccCcCCchhhhHHhHhhcHHHHHHHHHHhhhhcCCccccccCCC---------------Ccchhhhhhcc
Q 001957          675 LLVLLSLGGFILSREDIKKWWKWAYWCSPLTYAQNAIVANEFLGHSWKKFTQDS---------------SETLGVQVLKS  739 (991)
Q Consensus       675 ~~~~~lf~Gf~i~~~~ip~~~~W~~~isp~~Y~~~al~~nef~~~~~~~~~~~~---------------~~~~G~~~L~~  739 (991)
                      ++++.+++||+||+++||+||+|++|+||++|+++++++|||++.+|.|.|.++               ..+.|.++|+.
T Consensus       610 ~L~i~m~~Gf~Ip~~~m~~W~~Wi~yinPl~Y~fesl~~NEF~~~~~~c~p~gp~y~n~~~~~~~c~~~~~~~G~~~v~g  689 (1391)
T KOG0065|consen  610 LLVLFMYGGFVIPKKDMPPWFRWIAYINPLMYAFESLMSNEFHGRRWPCSPSGPAYDNISIENKVCAATGATLGNDYVSG  689 (1391)
T ss_pred             HHHHHHHcceeeeccccchHHHHHHHHCHHHHHHHHHHHhhhhcccCCCCCCCCcccccccccccchhhccccCceEEec
Confidence            999999999999999999999999999999999999999999999999973221               25678999999


Q ss_pred             cCcc-----cccchhhHHHHHHHHHHHHHHHHHHHHHHhcCCCCCCcceeeccccccccccccCCcccccccCCCCCCCC
Q 001957          740 RGFF-----AHEYWYWLGLGALFGFVLLLNFAYTLALTFLDPFEKPRAVITEEIESNEQDDRIGGNVQLSTLGGSSNHNT  814 (991)
Q Consensus       740 ~~~~-----~~~~~~w~~~g~l~~~~~~f~~~~~l~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  814 (991)
                      ++|.     ...+|+|+|+|+++||.++|++++.+++.|++|..+++++++.++..++.......               
T Consensus       690 ~~~l~~~~~y~~~~~Wr~~gillgf~v~f~~~~~ia~~yl~p~~~~~~~l~~~~~~~~~~~~~~~---------------  754 (1391)
T KOG0065|consen  690 RDYLKVQYQYEYKWYWRNFGILLGFTVFFNFVFLIALEYLKPLKKSGAILVFKKGKEKKKVKSAG---------------  754 (1391)
T ss_pred             ccccccccccccceeEeehhHHHHHHHHHHHHHHHHHHhcCccccccceeeeccchhhhcchhcc---------------
Confidence            9888     77789999999999999999999999999999999999887755443321110000               


Q ss_pred             CCCCCCccccccCccchhhhhhhhcCCCCCCCCccCCCCcceeecceEEEeeCchhhhhccccccceeeccCceeeeeCC
Q 001957          815 RSGSTDDIRGQQSSSQSLSLAEAEASRPKKKGMVLPFEPHSLTFDEVVYSVDMPEEMKVQGVLEDKLVLLNGVSGAFRPG  894 (991)
Q Consensus       815 ~~~~p~~~~~~~~~~~~~~~~~~~~~~~~~~~~~lp~~~~~l~f~dv~y~v~~~~~~k~~g~~~~~~~lL~~VSg~~~pG  894 (991)
                       . .+.          ... ... ....+++++++|++|..++++||.|.+++|-+++.||   +++|||+||||+||||
T Consensus       755 -~-~~~----------~~~-~~~-s~~~~~~~~~~~~~~~~~~~~~V~~w~dl~~~~~~qG---~~~qLL~~V~G~~kPG  817 (1391)
T KOG0065|consen  755 -S-SSE----------IEK-LDD-SSHQEKNKMVLPFTPLSLTFKDVFYWVDLPYEMPIQG---GTRQLLNNVSGAFKPG  817 (1391)
T ss_pred             -c-ccc----------ccc-ccc-ccccccccccCCCccccccccceEEEEeCCccccccc---cceEhhhcCceEecCC
Confidence             0 000          000 000 0111356889999999999999999999999999998   7899999999999999


Q ss_pred             eEEEEeeccCCChhhhhhhhhccccCCeeeEEEEEcCccCCcccccceeeEEeccCCCCCCCCHHHHHHhhhhccCCCCC
Q 001957          895 VLTALMGVSGAGKTTLMDVLAGRKTGGYITGNITISGYPKKQETFARISGYCEQNDIHSPFVTIYESLLFSAWLRLSPEV  974 (991)
Q Consensus       895 ~ltALmG~SGAGKTTLldvLagRkt~G~i~G~I~inG~~~~~~tf~r~~GY~eQ~Dih~p~~TVrEsL~fsA~LRlp~~v  974 (991)
                      +||||||+|||||||||||||||||+|+|+|||+|||+|++|++|+|++|||||+|+|+|++||||||+|||+||||++|
T Consensus       818 ~LTALMG~SGAGKTTLLdvLA~R~t~G~I~Gdi~i~G~p~~q~tF~R~~GYvqQ~DiH~~~~TVrESL~fSA~LRlp~~v  897 (1391)
T KOG0065|consen  818 VLTALMGESGAGKTTLLDVLAGRKTGGYIEGDILISGFPKDQETFARVSGYVEQQDIHSPELTVRESLRFSAALRLPKEV  897 (1391)
T ss_pred             ceeehhcCCCCchHHHHHHHhcCcccceEEeEEEECCeeCchhhhccccceeecccccCcccchHHHHHHHHHHcCCCcC
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             CHHHHhccccce
Q 001957          975 DSETRKVGTKSP  986 (991)
Q Consensus       975 ~~~~k~~~veev  986 (991)
                      +.+||++|||||
T Consensus       898 ~~~ek~~yVe~V  909 (1391)
T KOG0065|consen  898 SDEEKYEYVEEV  909 (1391)
T ss_pred             CHHHHHHHHHHH
Confidence            999999999998



>PLN03140 ABC transporter G family member; Provisional Back     alignment and domain information
>TIGR00956 3a01205 Pleiotropic Drug Resistance (PDR) Family protein Back     alignment and domain information
>KOG0061 consensus Transporter, ABC superfamily (Breast cancer resistance protein) [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PLN03211 ABC transporter G-25; Provisional Back     alignment and domain information
>TIGR00955 3a01204 The Eye Pigment Precursor Transporter (EPP) Family protein Back     alignment and domain information
>PLN03140 ABC transporter G family member; Provisional Back     alignment and domain information
>KOG0065 consensus Pleiotropic drug resistance proteins (PDR1-15), ABC superfamily [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>TIGR00956 3a01205 Pleiotropic Drug Resistance (PDR) Family protein Back     alignment and domain information
>KOG0055 consensus Multidrug/pheromone exporter, ABC superfamily [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>TIGR01257 rim_protein retinal-specific rim ABC transporter Back     alignment and domain information
>PTZ00265 multidrug resistance protein (mdr1); Provisional Back     alignment and domain information
>COG1126 GlnQ ABC-type polar amino acid transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>COG1123 ATPase components of various ABC-type transport systems, contain duplicated ATPase [General function prediction only] Back     alignment and domain information
>PLN03232 ABC transporter C family member; Provisional Back     alignment and domain information
>PLN03130 ABC transporter C family member; Provisional Back     alignment and domain information
>COG1135 AbcC ABC-type metal ion transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>TIGR00957 MRP_assoc_pro multi drug resistance-associated protein (MRP) Back     alignment and domain information
>COG1125 OpuBA ABC-type proline/glycine betaine transport systems, ATPase components [Amino acid transport and metabolism] Back     alignment and domain information
>COG3839 MalK ABC-type sugar transport systems, ATPase components [Carbohydrate transport and metabolism] Back     alignment and domain information
>COG3842 PotA ABC-type spermidine/putrescine transport systems, ATPase components [Amino acid transport and metabolism] Back     alignment and domain information
>COG1131 CcmA ABC-type multidrug transport system, ATPase component [Defense mechanisms] Back     alignment and domain information
>COG1120 FepC ABC-type cobalamin/Fe3+-siderophores transport systems, ATPase components [Inorganic ion transport and metabolism / Coenzyme metabolism] Back     alignment and domain information
>PRK10762 D-ribose transporter ATP binding protein; Provisional Back     alignment and domain information
>PRK15134 microcin C ABC transporter ATP-binding protein YejF; Provisional Back     alignment and domain information
>TIGR03269 met_CoM_red_A2 methyl coenzyme M reductase system, component A2 Back     alignment and domain information
>COG1116 TauB ABC-type nitrate/sulfonate/bicarbonate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK09700 D-allose transporter ATP-binding protein; Provisional Back     alignment and domain information
>COG1127 Ttg2A ABC-type transport system involved in resistance to organic solvents, ATPase component [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>PTZ00243 ABC transporter; Provisional Back     alignment and domain information
>COG1117 PstB ABC-type phosphate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK10261 glutathione transporter ATP-binding protein; Provisional Back     alignment and domain information
>COG1118 CysA ABC-type sulfate/molybdate transport systems, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK11288 araG L-arabinose transporter ATP-binding protein; Provisional Back     alignment and domain information
>COG3638 ABC-type phosphate/phosphonate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>COG1136 SalX ABC-type antimicrobial peptide transport system, ATPase component [Defense mechanisms] Back     alignment and domain information
>TIGR01271 CFTR_protein cystic fibrosis transmembrane conductor regulator (CFTR) Back     alignment and domain information
>TIGR02633 xylG D-xylose ABC transporter, ATP-binding protein Back     alignment and domain information
>COG1121 ZnuC ABC-type Mn/Zn transport systems, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>COG4555 NatA ABC-type Na+ transport system, ATPase component [Energy production and conversion / Inorganic ion transport and metabolism] Back     alignment and domain information
>KOG0058 consensus Peptide exporter, ABC superfamily [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>TIGR02314 ABC_MetN D-methionine ABC transporter, ATP-binding protein Back     alignment and domain information
>TIGR03265 PhnT2 putative 2-aminoethylphosphonate ABC transporter, ATP-binding protein Back     alignment and domain information
>PRK11650 ugpC glycerol-3-phosphate transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK11432 fbpC ferric transporter ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR03258 PhnT 2-aminoethylphosphonate ABC transport system, ATP-binding component PhnT Back     alignment and domain information
>COG2274 SunT ABC-type bacteriocin/lantibiotic exporters, contain an N-terminal double-glycine peptidase domain [Defense mechanisms] Back     alignment and domain information
>PRK09452 potA putrescine/spermidine ABC transporter ATPase protein; Reviewed Back     alignment and domain information
>PRK13537 nodulation ABC transporter NodI; Provisional Back     alignment and domain information
>PRK10938 putative molybdenum transport ATP-binding protein ModF; Provisional Back     alignment and domain information
>COG1122 CbiO ABC-type cobalt transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK10851 sulfate/thiosulfate transporter subunit; Provisional Back     alignment and domain information
>COG1124 DppF ABC-type dipeptide/oligopeptide/nickel transport system, ATPase component [Amino acid transport and metabolism / Inorganic ion transport and metabolism] Back     alignment and domain information
>cd03261 ABC_Org_Solvent_Resistant ABC (ATP-binding cassette) transport system involved in resistant to organic solvents; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules Back     alignment and domain information
>COG3840 ThiQ ABC-type thiamine transport system, ATPase component [Coenzyme metabolism] Back     alignment and domain information
>PRK11607 potG putrescine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>COG0410 LivF ABC-type branched-chain amino acid transport systems, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR01186 proV glycine betaine/L-proline transport ATP binding subunit Back     alignment and domain information
>PRK11000 maltose/maltodextrin transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK11819 putative ABC transporter ATP-binding protein; Reviewed Back     alignment and domain information
>COG2884 FtsE Predicted ATPase involved in cell division [Cell division and chromosome partitioning] Back     alignment and domain information
>KOG0057 consensus Mitochondrial Fe/S cluster exporter, ABC superfamily [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>COG0411 LivG ABC-type branched-chain amino acid transport systems, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>PRK11153 metN DL-methionine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13536 nodulation factor exporter subunit NodI; Provisional Back     alignment and domain information
>TIGR01188 drrA daunorubicin resistance ABC transporter ATP-binding subunit Back     alignment and domain information
>PRK15064 ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR03719 ABC_ABC_ChvD ATP-binding cassette protein, ChvD family Back     alignment and domain information
>cd03259 ABC_Carb_Solutes_like ABC Carbohydrate and Solute Transporters-like subgroup Back     alignment and domain information
>PRK13637 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>KOG0054 consensus Multidrug resistance-associated protein/mitoxantrone resistance protein, ABC superfamily [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>cd03265 ABC_DrrA DrrA is the ATP-binding protein component of a bacterial exporter complex that confers resistance to the antibiotics daunorubicin and doxorubicin Back     alignment and domain information
>TIGR01288 nodI ATP-binding ABC transporter family nodulation protein NodI Back     alignment and domain information
>cd03296 ABC_CysA_sulfate_importer Part of the ABC transporter complex cysAWTP involved in sulfate import Back     alignment and domain information
>PRK13634 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13643 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03258 ABC_MetN_methionine_transporter MetN (also known as YusC) is an ABC-type transporter encoded by metN of the metNPQ operon in Bacillus subtilis that is involved in methionine transport Back     alignment and domain information
>cd03219 ABC_Mj1267_LivG_branched The Mj1267/LivG ABC transporter subfamily is involved in the transport of the hydrophobic amino acids leucine, isoleucine and valine Back     alignment and domain information
>COG4559 ABC-type hemin transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>cd03301 ABC_MalK_N The N-terminal ATPase domain of the maltose transporter, MalK Back     alignment and domain information
>PRK11174 cysteine/glutathione ABC transporter membrane/ATP-binding component; Reviewed Back     alignment and domain information
>cd03218 ABC_YhbG The ABC transporters belonging to the YhbG family are similar to members of the Mj1267_LivG family, which is involved in the transport of branched-chain amino acids Back     alignment and domain information
>cd03293 ABC_NrtD_SsuB_transporters NrtD and SsuB are the ATP-binding subunits of the bacterial ABC-type nitrate and sulfonate transport systems, respectively Back     alignment and domain information
>cd03260 ABC_PstB_phosphate_transporter Phosphate uptake is of fundamental importance in the cell physiology of bacteria because phosphate is required as a nutrient Back     alignment and domain information
>TIGR03522 GldA_ABC_ATP gliding motility-associated ABC transporter ATP-binding subunit GldA Back     alignment and domain information
>TIGR00960 3a0501s02 Type II (General) Secretory Pathway (IISP) Family protein Back     alignment and domain information
>cd03263 ABC_subfamily_A The ABCA subfamily mediates the transport of a variety of lipid compounds Back     alignment and domain information
>KOG0056 consensus Heavy metal exporter HMT1, ABC superfamily [Inorganic ion transport and metabolism] Back     alignment and domain information
>cd03256 ABC_PhnC_transporter ABC-type phosphate/phosphonate transport system Back     alignment and domain information
>PRK13650 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03224 ABC_TM1139_LivF_branched LivF (TM1139) is part of the LIV-I bacterial ABC-type two-component transport system that imports neutral, branched-chain amino acids Back     alignment and domain information
>COG0444 DppD ABC-type dipeptide/oligopeptide/nickel transport system, ATPase component [Amino acid transport and metabolism / Inorganic ion transport and metabolism] Back     alignment and domain information
>cd03294 ABC_Pro_Gly_Bertaine This family comprises the glycine betaine/L-proline ATP binding subunit in bacteria and its equivalents in archaea Back     alignment and domain information
>KOG0055 consensus Multidrug/pheromone exporter, ABC superfamily [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PRK13647 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>COG1132 MdlB ABC-type multidrug transport system, ATPase and permease components [Defense mechanisms] Back     alignment and domain information
>PRK13651 cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13631 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03269 ABC_putative_ATPase This subfamily is involved in drug resistance, nodulation, lipid transport, and bacteriocin and lantibiotic immunity Back     alignment and domain information
>COG4175 ProV ABC-type proline/glycine betaine transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>cd03255 ABC_MJ0796_Lo1CDE_FtsE This family is comprised of MJ0796 ATP-binding cassette, macrolide-specific ABC-type efflux carrier (MacAB), and proteins involved in cell division (FtsE), and release of liporoteins from the cytoplasmic membrane (LolCDE) Back     alignment and domain information
>PRK11831 putative ABC transporter ATP-binding protein YrbF; Provisional Back     alignment and domain information
>cd03234 ABCG_White The White subfamily represents ABC transporters homologous to the Drosophila white gene, which acts as a dimeric importer for eye pigment precursors Back     alignment and domain information
>cd03295 ABC_OpuCA_Osmoprotection OpuCA is a the ATP binding component of a bacterial solute transporter that serves a protective role to cells growing in a hyperosmolar environment Back     alignment and domain information
>cd03233 ABC_PDR_domain1 The pleiotropic drug resistance (PDR) family of ATP-binding cassette (ABC) transporters Back     alignment and domain information
>PRK15079 oligopeptide ABC transporter ATP-binding protein OppF; Provisional Back     alignment and domain information
>PRK10070 glycine betaine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK11629 lolD lipoprotein transporter ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR03864 PQQ_ABC_ATP ABC transporter, ATP-binding subunit, PQQ-dependent alcohol dehydrogenase system Back     alignment and domain information
>PRK09536 btuD corrinoid ABC transporter ATPase; Reviewed Back     alignment and domain information
>PRK13646 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK09473 oppD oligopeptide transporter ATP-binding component; Provisional Back     alignment and domain information
>cd03268 ABC_BcrA_bacitracin_resist The BcrA subfamily represents ABC transporters involved in peptide antibiotic resistance Back     alignment and domain information
>COG1137 YhbG ABC-type (unclassified) transport system, ATPase component [General function prediction only] Back     alignment and domain information
>TIGR02315 ABC_phnC phosphonate ABC transporter, ATP-binding protein Back     alignment and domain information
>cd03266 ABC_NatA_sodium_exporter NatA is the ATPase component of a bacterial ABC-type Na+ transport system called NatAB, which catalyzes ATP-dependent electrogenic Na+ extrusion without mechanically coupled proton or K+ uptake Back     alignment and domain information
>PRK13635 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK09493 glnQ glutamine ABC transporter ATP-binding protein; Reviewed Back     alignment and domain information
>PRK11264 putative amino-acid ABC transporter ATP-binding protein YecC; Provisional Back     alignment and domain information
>PRK11022 dppD dipeptide transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03226 ABC_cobalt_CbiO_domain2 Domain II of the ABC component of a cobalt transport family found in bacteria, archaea, and eukaryota Back     alignment and domain information
>TIGR03797 NHPM_micro_ABC2 NHPM bacteriocin system ABC transporter, ATP-binding protein Back     alignment and domain information
>PRK13636 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR02211 LolD_lipo_ex lipoprotein releasing system, ATP-binding protein Back     alignment and domain information
>cd03264 ABC_drug_resistance_like ABC-type multidrug transport system, ATPase component Back     alignment and domain information
>cd03267 ABC_NatA_like Similar in sequence to NatA, this is the ATPase component of a bacterial ABC-type Na+ transport system called NatAB, which catalyzes ATP-dependent electrogenic Na+ extrusion without mechanically coupled to proton or K+ uptake Back     alignment and domain information
>PRK11248 tauB taurine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13632 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR03415 ABC_choXWV_ATP choline ABC transporter, ATP-binding protein Back     alignment and domain information
>TIGR03410 urea_trans_UrtE urea ABC transporter, ATP-binding protein UrtE Back     alignment and domain information
>PRK11308 dppF dipeptide transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03292 ABC_FtsE_transporter FtsE is a hydrophilic nucleotide-binding protein that binds FtsX to form a heterodimeric ATP-binding cassette (ABC)-type transporter that associates with the bacterial inner membrane Back     alignment and domain information
>cd03257 ABC_NikE_OppD_transporters The ABC transporter subfamily specific for the transport of dipeptides, oligopeptides (OppD), and nickel (NikDE) Back     alignment and domain information
>PRK11176 lipid transporter ATP-binding/permease protein; Provisional Back     alignment and domain information
>PRK11247 ssuB aliphatic sulfonates transport ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13652 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>COG4987 CydC ABC-type transport system involved in cytochrome bd biosynthesis, fused ATPase and permease components [Energy production and conversion / Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR03375 type_I_sec_LssB type I secretion system ATPase, LssB family Back     alignment and domain information
>TIGR03005 ectoine_ehuA ectoine/hydroxyectoine ABC transporter, ATP-binding protein Back     alignment and domain information
>PRK10895 lipopolysaccharide ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>COG4988 CydD ABC-type transport system involved in cytochrome bd biosynthesis, ATPase and permease components [Energy production and conversion / Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK11614 livF leucine/isoleucine/valine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK14273 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR02673 FtsE cell division ATP-binding protein FtsE Back     alignment and domain information
>PRK13633 cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13548 hmuV hemin importer ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR00972 3a0107s01c2 phosphate ABC transporter, ATP-binding protein Back     alignment and domain information
>PRK10790 putative multidrug transporter membrane\ATP-binding components; Provisional Back     alignment and domain information
>cd03300 ABC_PotA_N PotA is an ABC-type transporter and the ATPase component of the spermidine/putrescine-preferential uptake system consisting of PotA, -B, -C, and -D Back     alignment and domain information
>PRK14242 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK13648 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK11160 cysteine/glutathione ABC transporter membrane/ATP-binding component; Reviewed Back     alignment and domain information
>PRK10584 putative ABC transporter ATP-binding protein YbbA; Provisional Back     alignment and domain information
>PRK13640 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR01193 bacteriocin_ABC ABC-type bacteriocin transporter Back     alignment and domain information
>PRK14247 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK15093 antimicrobial peptide ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR03411 urea_trans_UrtD urea ABC transporter, ATP-binding protein UrtD Back     alignment and domain information
>PRK11300 livG leucine/isoleucine/valine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13649 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR03740 galliderm_ABC gallidermin-class lantibiotic protection ABC transporter, ATP-binding subunit Back     alignment and domain information
>PRK13644 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13638 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR03796 NHPM_micro_ABC1 NHPM bacteriocin system ABC transporter, peptidase/ATP-binding protein Back     alignment and domain information
>PRK14268 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK10908 cell division protein FtsE; Provisional Back     alignment and domain information
>PRK13639 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK14250 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK13641 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK11124 artP arginine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK14267 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03298 ABC_ThiQ_thiamine_transporter ABC-type thiamine tranport system; part of the binding-protein-dependent transport system tbpA-thiPQ for thiamine and TPP Back     alignment and domain information
>PRK10619 histidine/lysine/arginine/ornithine transporter subunit; Provisional Back     alignment and domain information
>TIGR01978 sufC FeS assembly ATPase SufC Back     alignment and domain information
>TIGR00958 3a01208 Conjugate Transporter-2 (CT2) Family protein Back     alignment and domain information
>cd03299 ABC_ModC_like Archeal protein closely related to ModC Back     alignment and domain information
>TIGR00968 3a0106s01 sulfate ABC transporter, ATP-binding protein Back     alignment and domain information
>PRK11144 modC molybdate transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK10575 iron-hydroxamate transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK10253 iron-enterobactin transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR02770 nickel_nikD nickel import ATP-binding protein NikD Back     alignment and domain information
>PRK14237 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK13645 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK14235 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK10744 pstB phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR01184 ntrCD nitrate transport ATP-binding subunits C and D Back     alignment and domain information
>PRK10771 thiQ thiamine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>COG4525 TauB ABC-type taurine transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>TIGR02769 nickel_nikE nickel import ATP-binding protein NikE Back     alignment and domain information
>cd03262 ABC_HisP_GlnQ_permeases HisP and GlnQ are the ATP-binding components of the bacterial periplasmic histidine and glutamine permeases, repectively Back     alignment and domain information
>TIGR02142 modC_ABC molybdenum ABC transporter, ATP-binding protein Back     alignment and domain information
>PRK14245 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK13642 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK14257 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK11231 fecE iron-dicitrate transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK09984 phosphonate/organophosphate ester transporter subunit; Provisional Back     alignment and domain information
>PTZ00265 multidrug resistance protein (mdr1); Provisional Back     alignment and domain information
>TIGR01277 thiQ thiamine ABC transporter, ATP-binding protein Back     alignment and domain information
>PRK14256 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14239 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14241 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03225 ABC_cobalt_CbiO_domain1 Domain I of the ABC component of a cobalt transport family found in bacteria, archaea, and eukaryota Back     alignment and domain information
>PRK14270 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR03873 F420-0_ABC_ATP proposed F420-0 ABC transporter, ATP-binding protein Back     alignment and domain information
>PRK14269 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR01842 type_I_sec_PrtD type I secretion system ABC transporter, PrtD family Back     alignment and domain information
>PRK14274 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK11147 ABC transporter ATPase component; Reviewed Back     alignment and domain information
>PRK14240 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14259 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03213 ABCG_EPDR ABCG transporters are involved in eye pigment (EP) precursor transport, regulation of lipid-trafficking mechanisms, and pleiotropic drug resistance (DR) Back     alignment and domain information
>PRK14262 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK11701 phnK phosphonate C-P lyase system protein PhnK; Provisional Back     alignment and domain information
>PRK10418 nikD nickel transporter ATP-binding protein NikD; Provisional Back     alignment and domain information
>cd03235 ABC_Metallic_Cations ABC component of the metal-type transporters Back     alignment and domain information
>TIGR01846 type_I_sec_HlyB type I secretion system ABC transporter, HlyB family Back     alignment and domain information
>TIGR02203 MsbA_lipidA lipid A export permease/ATP-binding protein MsbA Back     alignment and domain information
>COG4181 Predicted ABC-type transport system involved in lysophospholipase L1 biosynthesis, ATPase component [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>PRK14244 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14248 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK15112 antimicrobial peptide ABC system ATP-binding protein SapF; Provisional Back     alignment and domain information
>PRK13657 cyclic beta-1,2-glucan ABC transporter; Provisional Back     alignment and domain information
>PRK14271 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14258 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14272 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14253 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14236 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK10789 putative multidrug transporter membrane\ATP-binding components; Provisional Back     alignment and domain information
>TIGR02982 heterocyst_DevA ABC exporter ATP-binding subunit, DevA family Back     alignment and domain information
>PRK14255 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK13547 hmuV hemin importer ATP-binding subunit; Provisional Back     alignment and domain information
>PRK14249 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03232 ABC_PDR_domain2 The pleiotropic drug resistance-like (PDR) family of ATP-binding cassette (ABC) transporters Back     alignment and domain information
>PRK14251 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14261 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14260 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK15439 autoinducer 2 ABC transporter ATP-binding protein LsrA; Provisional Back     alignment and domain information
>cd03297 ABC_ModC_molybdenum_transporter ModC is an ABC-type transporter and the ATPase component of a molybdate transport system that also includes the periplasmic binding protein ModA and the membrane protein ModB Back     alignment and domain information
>TIGR01192 chvA glucan exporter ATP-binding protein Back     alignment and domain information
>COG1123 ATPase components of various ABC-type transport systems, contain duplicated ATPase [General function prediction only] Back     alignment and domain information
>PRK14275 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03252 ABCC_Hemolysin The ABC-transporter hemolysin B is a central component of the secretion machinery that translocates the toxin, hemolysin A, in a Sec-independent fashion across both membranes of E Back     alignment and domain information
>PRK13549 xylose transporter ATP-binding subunit; Provisional Back     alignment and domain information
>COG4152 ABC-type uncharacterized transport system, ATPase component [General function prediction only] Back     alignment and domain information
>TIGR02323 CP_lyasePhnK phosphonate C-P lyase system protein PhnK Back     alignment and domain information
>cd03245 ABCC_bacteriocin_exporters ABC-type bacteriocin exporters Back     alignment and domain information
>COG4618 ArpD ABC-type protease/lipase transport system, ATPase and permease components [General function prediction only] Back     alignment and domain information
>PRK14263 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14238 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR01257 rim_protein retinal-specific rim ABC transporter Back     alignment and domain information
>PRK14265 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK10419 nikE nickel transporter ATP-binding protein NikE; Provisional Back     alignment and domain information
>cd03249 ABC_MTABC3_MDL1_MDL2 MTABC3 (also known as ABCB6) is a mitochondrial ATP-binding cassette protein involved in iron homeostasis and one of four ABC transporters expressed in the mitochondrial inner membrane, the other three being MDL1(ABC7), MDL2, and ATM1 Back     alignment and domain information
>PRK14243 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14254 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR03608 L_ocin_972_ABC putative bacteriocin export ABC transporter, lactococcin 972 group Back     alignment and domain information
>TIGR02204 MsbA_rel ABC transporter, permease/ATP-binding protein Back     alignment and domain information
>COG4148 ModC ABC-type molybdate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK10247 putative ABC transporter ATP-binding protein YbbL; Provisional Back     alignment and domain information
>cd03289 ABCC_CFTR2 The CFTR subfamily domain 2 Back     alignment and domain information
>PRK10261 glutathione transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03254 ABCC_Glucan_exporter_like Glucan exporter ATP-binding protein Back     alignment and domain information
>PRK03695 vitamin B12-transporter ATPase; Provisional Back     alignment and domain information
>cd03251 ABCC_MsbA MsbA is an essential ABC transporter, closely related to eukaryotic MDR proteins Back     alignment and domain information
>PRK14266 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>COG5265 ATM1 ABC-type transport system involved in Fe-S cluster assembly, permease and ATPase components [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>CHL00131 ycf16 sulfate ABC transporter protein; Validated Back     alignment and domain information
>PRK14246 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK15056 manganese/iron transporter ATP-binding protein; Provisional Back     alignment and domain information
>PLN03232 ABC transporter C family member; Provisional Back     alignment and domain information
>COG4604 CeuD ABC-type enterochelin transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>PLN03130 ABC transporter C family member; Provisional Back     alignment and domain information
>PRK14252 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03220 ABC_KpsT_Wzt ABC_KpsT_Wzt The KpsT/Wzt ABC transporter subfamily is involved in extracellular polysaccharide export Back     alignment and domain information
>cd03217 ABC_FeS_Assembly ABC-type transport system involved in Fe-S cluster assembly, ATPase component Back     alignment and domain information
>PRK13543 cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>PRK09580 sufC cysteine desulfurase ATPase component; Reviewed Back     alignment and domain information
>PRK13546 teichoic acids export protein ATP-binding subunit; Provisional Back     alignment and domain information
>PRK14264 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR02868 CydC thiol reductant ABC exporter, CydC subunit Back     alignment and domain information
>PRK13538 cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>COG4161 ArtP ABC-type arginine transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>PRK15134 microcin C ABC transporter ATP-binding protein YejF; Provisional Back     alignment and domain information
>PRK09544 znuC high-affinity zinc transporter ATPase; Reviewed Back     alignment and domain information
>cd03244 ABCC_MRP_domain2 Domain 2 of the ABC subfamily C Back     alignment and domain information
>PRK10982 galactose/methyl galaxtoside transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03230 ABC_DR_subfamily_A This family of ATP-binding proteins belongs to a multisubunit transporter involved in drug resistance (BcrA and DrrA), nodulation, lipid transport, and lantibiotic immunity Back     alignment and domain information
>cd03231 ABC_CcmA_heme_exporter CcmA, the ATP-binding component of the bacterial CcmAB transporter Back     alignment and domain information
>TIGR03269 met_CoM_red_A2 methyl coenzyme M reductase system, component A2 Back     alignment and domain information
>cd03253 ABCC_ATM1_transporter ATM1 is an ABC transporter that is expressed in the mitochondria Back     alignment and domain information
>cd03288 ABCC_SUR2 The SUR domain 2 Back     alignment and domain information
>TIGR01166 cbiO cobalt transport protein ATP-binding subunit Back     alignment and domain information
>TIGR01189 ccmA heme ABC exporter, ATP-binding protein CcmA Back     alignment and domain information
>TIGR00957 MRP_assoc_pro multi drug resistance-associated protein (MRP) Back     alignment and domain information
>COG4598 HisP ABC-type histidine transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR02324 CP_lyasePhnL phosphonate C-P lyase system protein PhnL Back     alignment and domain information
>PRK13539 cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>PRK13545 tagH teichoic acids export protein ATP-binding subunit; Provisional Back     alignment and domain information
>cd03229 ABC_Class3 This class is comprised of all BPD (Binding Protein Dependent) systems that are largely represented in archaea and eubacteria and are primarily involved in scavenging solutes from the environment Back     alignment and domain information
>TIGR01187 potA spermidine/putrescine ABC transporter ATP-binding subunit Back     alignment and domain information
>TIGR02857 CydD thiol reductant ABC exporter, CydD subunit Back     alignment and domain information
>cd03215 ABC_Carb_Monos_II This family represents domain II of the carbohydrate uptake proteins that transport only monosaccharides (Monos) Back     alignment and domain information
>PTZ00243 ABC transporter; Provisional Back     alignment and domain information
>cd03369 ABCC_NFT1 Domain 2 of NFT1 (New full-length MRP-type transporter 1) Back     alignment and domain information
>PRK15177 Vi polysaccharide export ATP-binding protein VexC; Provisional Back     alignment and domain information
>cd03248 ABCC_TAP TAP, the Transporter Associated with Antigen Processing; TAP is essential for peptide delivery from the cytosol into the lumen of the endoplasmic reticulum (ER), where these peptides are loaded on major histocompatibility complex (MHC) I molecules Back     alignment and domain information
>PRK09700 D-allose transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR03771 anch_rpt_ABC anchored repeat-type ABC transporter, ATP-binding subunit Back     alignment and domain information
>cd03246 ABCC_Protease_Secretion This family represents the ABC component of the protease secretion system PrtD, a 60-kDa integral membrane protein sharing 37% identity with HlyB, the ABC component of the alpha-hemolysin secretion pathway, in the C-terminal domain Back     alignment and domain information
>PRK13549 xylose transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03247 ABCC_cytochrome_bd The CYD subfamily implicated in cytochrome bd biogenesis Back     alignment and domain information
>PRK13540 cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>cd03291 ABCC_CFTR1 The CFTR subfamily domain 1 Back     alignment and domain information
>PRK11288 araG L-arabinose transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK10762 D-ribose transporter ATP binding protein; Provisional Back     alignment and domain information
>COG4172 ABC-type uncharacterized transport system, duplicated ATPase component [General function prediction only] Back     alignment and domain information
>COG1129 MglA ABC-type sugar transport system, ATPase component [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK10522 multidrug transporter membrane component/ATP-binding component; Provisional Back     alignment and domain information
>COG4586 ABC-type uncharacterized transport system, ATPase component [General function prediction only] Back     alignment and domain information
>COG0396 sufC Cysteine desulfurase activator ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR01271 CFTR_protein cystic fibrosis transmembrane conductor regulator (CFTR) Back     alignment and domain information
>cd03237 ABC_RNaseL_inhibitor_domain2 The ATPase domain 2 of RNase L inhibitor Back     alignment and domain information
>COG4619 ABC-type uncharacterized transport system, ATPase component [General function prediction only] Back     alignment and domain information
>cd03214 ABC_Iron-Siderophores_B12_Hemin ABC transporters, involved in the uptake of siderophores, heme, and vitamin B12, are widely conserved in bacteria and archaea Back     alignment and domain information
>TIGR02633 xylG D-xylose ABC transporter, ATP-binding protein Back     alignment and domain information
>cd03290 ABCC_SUR1_N The SUR domain 1 Back     alignment and domain information
>PRK15439 autoinducer 2 ABC transporter ATP-binding protein LsrA; Provisional Back     alignment and domain information
>cd03250 ABCC_MRP_domain1 Domain 1 of the ABC subfamily C Back     alignment and domain information
>COG4674 Uncharacterized ABC-type transport system, ATPase component [General function prediction only] Back     alignment and domain information
>PRK13541 cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>PRK10535 macrolide transporter ATP-binding /permease protein; Provisional Back     alignment and domain information
>cd03216 ABC_Carb_Monos_I This family represents the domain I of the carbohydrate uptake proteins that transport only monosaccharides (Monos) Back     alignment and domain information
>cd03223 ABCD_peroxisomal_ALDP Peroxisomal ATP-binding cassette transporter (Pat) is involved in the import of very long-chain fatty acids (VLCFA) into the peroxisome Back     alignment and domain information
>cd03228 ABCC_MRP_Like The MRP (Mutidrug Resistance Protein)-like transporters are involved in drug, peptide, and lipid export Back     alignment and domain information
>COG1119 ModF ABC-type molybdenum transport system, ATPase component/photorepair protein PhrA [Inorganic ion transport and metabolism] Back     alignment and domain information
>TIGR01194 cyc_pep_trnsptr cyclic peptide transporter Back     alignment and domain information
>PRK15064 ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK10938 putative molybdenum transport ATP-binding protein ModF; Provisional Back     alignment and domain information
>COG4172 ABC-type uncharacterized transport system, duplicated ATPase component [General function prediction only] Back     alignment and domain information
>PRK10982 galactose/methyl galaxtoside transporter ATP-binding protein; Provisional Back     alignment and domain information
>COG1101 PhnK ABC-type uncharacterized transport system, ATPase component [General function prediction only] Back     alignment and domain information
>COG4608 AppF ABC-type oligopeptide transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>PRK11819 putative ABC transporter ATP-binding protein; Reviewed Back     alignment and domain information
>TIGR03719 ABC_ABC_ChvD ATP-binding cassette protein, ChvD family Back     alignment and domain information
>PRK13409 putative ATPase RIL; Provisional Back     alignment and domain information
>COG3845 ABC-type uncharacterized transport systems, ATPase components [General function prediction only] Back     alignment and domain information
>KOG0059 consensus Lipid exporter ABCA1 and related proteins, ABC superfamily [Lipid transport and metabolism; General function prediction only] Back     alignment and domain information
>cd03236 ABC_RNaseL_inhibitor_domain1 The ATPase domain 1 of RNase L inhibitor Back     alignment and domain information
>PRK10636 putative ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>COG4167 SapF ABC-type antimicrobial peptide transport system, ATPase component [Defense mechanisms] Back     alignment and domain information
>TIGR00954 3a01203 Peroxysomal Fatty Acyl CoA Transporter (FAT) Family protei Back     alignment and domain information
>PRK11147 ABC transporter ATPase component; Reviewed Back     alignment and domain information
>COG1134 TagH ABC-type polysaccharide/polyol phosphate transport system, ATPase component [Carbohydrate transport and metabolism / Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>cd03221 ABCF_EF-3 ABCF_EF-3 Elongation factor 3 (EF-3) is a cytosolic protein required by fungal ribosomes for in vitro protein synthesis and for in vivo growth Back     alignment and domain information
>COG4133 CcmA ABC-type transport system involved in cytochrome c biogenesis, ATPase component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PLN03073 ABC transporter F family; Provisional Back     alignment and domain information
>PRK10636 putative ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03222 ABC_RNaseL_inhibitor The ABC ATPase RNase L inhibitor (RLI) is a key enzyme in ribosomal biogenesis, formation of translation preinitiation complexes, and assembly of HIV capsids Back     alignment and domain information
>cd03238 ABC_UvrA The excision repair protein UvrA; Nucleotide excision repair in eubacteria is a process that repairs DNA damage by the removal of a 12-13-mer oligonucleotide containing the lesion Back     alignment and domain information
>COG4136 ABC-type uncharacterized transport system, ATPase component [General function prediction only] Back     alignment and domain information
>PRK13409 putative ATPase RIL; Provisional Back     alignment and domain information
>KOG0054 consensus Multidrug resistance-associated protein/mitoxantrone resistance protein, ABC superfamily [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>COG4107 PhnK ABC-type phosphonate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>cd00267 ABC_ATPase ABC (ATP-binding cassette) transporter nucleotide-binding domain; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules Back     alignment and domain information
>COG0488 Uup ATPase components of ABC transporters with duplicated ATPase domains [General function prediction only] Back     alignment and domain information
>PF00005 ABC_tran: ABC transporter This structure is on hold until Dec 1999; InterPro: IPR003439 ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energise diverse biological systems Back     alignment and domain information
>PLN03073 ABC transporter F family; Provisional Back     alignment and domain information
>KOG0061 consensus Transporter, ABC superfamily (Breast cancer resistance protein) [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>cd03270 ABC_UvrA_I The excision repair protein UvrA domain I; Nucleotide excision repair in eubacteria is a process that repairs DNA damage by the removal of a 12-13-mer oligonucleotide containing the lesion Back     alignment and domain information
>cd03271 ABC_UvrA_II The excision repair protein UvrA domain II; Nucleotide excision repair in eubacteria is a process that repairs DNA damage by the removal of a 12-13-mer oligonucleotide containing the lesion Back     alignment and domain information
>COG4778 PhnL ABC-type phosphonate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>cd03278 ABC_SMC_barmotin Barmotin is a tight junction-associated protein expressed in rat epithelial cells which is thought to have an important regulatory role in tight junction barrier function Back     alignment and domain information
>COG4138 BtuD ABC-type cobalamin transport system, ATPase component [Coenzyme metabolism] Back     alignment and domain information
>COG0488 Uup ATPase components of ABC transporters with duplicated ATPase domains [General function prediction only] Back     alignment and domain information
>COG1129 MglA ABC-type sugar transport system, ATPase component [Carbohydrate transport and metabolism] Back     alignment and domain information
>cd03272 ABC_SMC3_euk Eukaryotic SMC3 proteins; SMC proteins are large (approximately 110 to 170 kDa), and each is arranged into five recognizable domains Back     alignment and domain information
>cd03274 ABC_SMC4_euk Eukaryotic SMC4 proteins; SMC proteins are large (approximately 110 to 170 kDa), and each is arranged into five recognizable domains Back     alignment and domain information
>cd03240 ABC_Rad50 The catalytic domains of Rad50 are similar to the ATP-binding cassette of ABC transporters, but are not associated with membrane-spanning domains Back     alignment and domain information
>cd03273 ABC_SMC2_euk Eukaryotic SMC2 proteins; SMC proteins are large (approximately 110 to 170 kDa), and each is arranged into five recognizable domains Back     alignment and domain information
>COG4178 ABC-type uncharacterized transport system, permease and ATPase components [General function prediction only] Back     alignment and domain information
>PRK00349 uvrA excinuclease ABC subunit A; Reviewed Back     alignment and domain information
>COG3845 ABC-type uncharacterized transport systems, ATPase components [General function prediction only] Back     alignment and domain information
>cd03279 ABC_sbcCD SbcCD and other Mre11/Rad50 (MR) complexes are implicated in the metabolism of DNA ends Back     alignment and domain information
>KOG0927 consensus Predicted transporter (ABC superfamily) [General function prediction only] Back     alignment and domain information
>PRK00635 excinuclease ABC subunit A; Provisional Back     alignment and domain information
>TIGR00630 uvra excinuclease ABC, A subunit Back     alignment and domain information
>TIGR00955 3a01204 The Eye Pigment Precursor Transporter (EPP) Family protein Back     alignment and domain information
>COG4170 SapD ABC-type antimicrobial peptide transport system, ATPase component [Defense mechanisms] Back     alignment and domain information
>COG4615 PvdE ABC-type siderophore export system, fused ATPase and permease components [Secondary metabolites biosynthesis, transport, and catabolism / Inorganic ion transport and metabolism] Back     alignment and domain information
>KOG0927 consensus Predicted transporter (ABC superfamily) [General function prediction only] Back     alignment and domain information
>PLN03211 ABC transporter G-25; Provisional Back     alignment and domain information
>COG1245 Predicted ATPase, RNase L inhibitor (RLI) homolog [General function prediction only] Back     alignment and domain information
>cd03276 ABC_SMC6_euk Eukaryotic SMC6 proteins; SMC proteins are large (approximately 110 to 170 kDa), and each is arranged into five recognizable domains Back     alignment and domain information
>cd03275 ABC_SMC1_euk Eukaryotic SMC1 proteins; SMC proteins are large (approximately 110 to 170 kDa), and each is arranged into five recognizable domains Back     alignment and domain information
>KOG2355 consensus Predicted ABC-type transport, ATPase component/CCR4 associated factor [General function prediction only; Transcription] Back     alignment and domain information
>COG1131 CcmA ABC-type multidrug transport system, ATPase component [Defense mechanisms] Back     alignment and domain information
>cd03277 ABC_SMC5_euk Eukaryotic SMC5 proteins; SMC proteins are large (approximately 110 to 170 kDa), and each is arranged into five recognizable domains Back     alignment and domain information
>KOG0060 consensus Long-chain acyl-CoA transporter, ABC superfamily (involved in peroxisome organization and biogenesis) [Lipid transport and metabolism; General function prediction only] Back     alignment and domain information
>cd03280 ABC_MutS2 MutS2 homologs in bacteria and eukaryotes Back     alignment and domain information
>COG2401 ABC-type ATPase fused to a predicted acetyltransferase domain [General function prediction only] Back     alignment and domain information
>KOG0066 consensus eIF2-interacting protein ABC50 (ABC superfamily) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG0059 consensus Lipid exporter ABCA1 and related proteins, ABC superfamily [Lipid transport and metabolism; General function prediction only] Back     alignment and domain information
>KOG0062 consensus ATPase component of ABC transporters with duplicated ATPase domains/Translation elongation factor EF-3b [Amino acid transport and metabolism; Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PF01061 ABC2_membrane: ABC-2 type transporter; InterPro: IPR013525 ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energise diverse biological systems Back     alignment and domain information
>KOG0062 consensus ATPase component of ABC transporters with duplicated ATPase domains/Translation elongation factor EF-3b [Amino acid transport and metabolism; Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>cd03233 ABC_PDR_domain1 The pleiotropic drug resistance (PDR) family of ATP-binding cassette (ABC) transporters Back     alignment and domain information
>cd03239 ABC_SMC_head The structural maintenance of chromosomes (SMC) proteins are essential for successful chromosome transmission during replication and segregation of the genome in all organisms Back     alignment and domain information
>COG1245 Predicted ATPase, RNase L inhibitor (RLI) homolog [General function prediction only] Back     alignment and domain information
>COG3842 PotA ABC-type spermidine/putrescine transport systems, ATPase components [Amino acid transport and metabolism] Back     alignment and domain information
>COG1116 TauB ABC-type nitrate/sulfonate/bicarbonate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>COG3839 MalK ABC-type sugar transport systems, ATPase components [Carbohydrate transport and metabolism] Back     alignment and domain information
>cd03285 ABC_MSH2_euk MutS2 homolog in eukaryotes Back     alignment and domain information
>KOG0064 consensus Peroxisomal long-chain acyl-CoA transporter, ABC superfamily [Lipid transport and metabolism] Back     alignment and domain information
>cd03227 ABC_Class2 ABC-type Class 2 contains systems involved in cellular processes other than transport Back     alignment and domain information
>cd03241 ABC_RecN RecN ATPase involved in DNA repair; ABC (ATP-binding cassette) transporter nucleotide-binding domain; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds including sugars, ions, peptides, and more complex organic molecules Back     alignment and domain information
>COG0178 UvrA Excinuclease ATPase subunit [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK13537 nodulation ABC transporter NodI; Provisional Back     alignment and domain information
>cd03283 ABC_MutS-like MutS-like homolog in eukaryotes Back     alignment and domain information
>TIGR03265 PhnT2 putative 2-aminoethylphosphonate ABC transporter, ATP-binding protein Back     alignment and domain information
>PRK00635 excinuclease ABC subunit A; Provisional Back     alignment and domain information
>cd03232 ABC_PDR_domain2 The pleiotropic drug resistance-like (PDR) family of ATP-binding cassette (ABC) transporters Back     alignment and domain information
>PRK11432 fbpC ferric transporter ATP-binding subunit; Provisional Back     alignment and domain information
>COG1136 SalX ABC-type antimicrobial peptide transport system, ATPase component [Defense mechanisms] Back     alignment and domain information
>cd03234 ABCG_White The White subfamily represents ABC transporters homologous to the Drosophila white gene, which acts as a dimeric importer for eye pigment precursors Back     alignment and domain information
>cd03261 ABC_Org_Solvent_Resistant ABC (ATP-binding cassette) transport system involved in resistant to organic solvents; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules Back     alignment and domain information
>COG1118 CysA ABC-type sulfate/molybdate transport systems, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>COG1126 GlnQ ABC-type polar amino acid transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR00630 uvra excinuclease ABC, A subunit Back     alignment and domain information
>cd03269 ABC_putative_ATPase This subfamily is involved in drug resistance, nodulation, lipid transport, and bacteriocin and lantibiotic immunity Back     alignment and domain information
>KOG0058 consensus Peptide exporter, ABC superfamily [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PRK11650 ugpC glycerol-3-phosphate transporter ATP-binding subunit; Provisional Back     alignment and domain information
>COG1125 OpuBA ABC-type proline/glycine betaine transport systems, ATPase components [Amino acid transport and metabolism] Back     alignment and domain information
>cd03265 ABC_DrrA DrrA is the ATP-binding protein component of a bacterial exporter complex that confers resistance to the antibiotics daunorubicin and doxorubicin Back     alignment and domain information
>PRK11607 potG putrescine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>COG0410 LivF ABC-type branched-chain amino acid transport systems, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>PRK00349 uvrA excinuclease ABC subunit A; Reviewed Back     alignment and domain information
>PRK09452 potA putrescine/spermidine ABC transporter ATPase protein; Reviewed Back     alignment and domain information
>COG1120 FepC ABC-type cobalamin/Fe3+-siderophores transport systems, ATPase components [Inorganic ion transport and metabolism / Coenzyme metabolism] Back     alignment and domain information
>COG4525 TauB ABC-type taurine transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>cd03242 ABC_RecF RecF is a recombinational DNA repair ATPase that maintains replication in the presence of DNA damage Back     alignment and domain information
>cd03243 ABC_MutS_homologs The MutS protein initiates DNA mismatch repair by recognizing mispaired and unpaired bases embedded in duplex DNA and activating endo- and exonucleases to remove the mismatch Back     alignment and domain information
>cd03255 ABC_MJ0796_Lo1CDE_FtsE This family is comprised of MJ0796 ATP-binding cassette, macrolide-specific ABC-type efflux carrier (MacAB), and proteins involved in cell division (FtsE), and release of liporoteins from the cytoplasmic membrane (LolCDE) Back     alignment and domain information
>cd03268 ABC_BcrA_bacitracin_resist The BcrA subfamily represents ABC transporters involved in peptide antibiotic resistance Back     alignment and domain information
>TIGR03522 GldA_ABC_ATP gliding motility-associated ABC transporter ATP-binding subunit GldA Back     alignment and domain information
>cd03263 ABC_subfamily_A The ABCA subfamily mediates the transport of a variety of lipid compounds Back     alignment and domain information
>KOG0066 consensus eIF2-interacting protein ABC50 (ABC superfamily) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>TIGR03258 PhnT 2-aminoethylphosphonate ABC transport system, ATP-binding component PhnT Back     alignment and domain information
>PRK13536 nodulation factor exporter subunit NodI; Provisional Back     alignment and domain information
>cd03224 ABC_TM1139_LivF_branched LivF (TM1139) is part of the LIV-I bacterial ABC-type two-component transport system that imports neutral, branched-chain amino acids Back     alignment and domain information
>PRK10851 sulfate/thiosulfate transporter subunit; Provisional Back     alignment and domain information
>cd03295 ABC_OpuCA_Osmoprotection OpuCA is a the ATP binding component of a bacterial solute transporter that serves a protective role to cells growing in a hyperosmolar environment Back     alignment and domain information
>cd03219 ABC_Mj1267_LivG_branched The Mj1267/LivG ABC transporter subfamily is involved in the transport of the hydrophobic amino acids leucine, isoleucine and valine Back     alignment and domain information
>cd03293 ABC_NrtD_SsuB_transporters NrtD and SsuB are the ATP-binding subunits of the bacterial ABC-type nitrate and sulfonate transport systems, respectively Back     alignment and domain information
>cd03218 ABC_YhbG The ABC transporters belonging to the YhbG family are similar to members of the Mj1267_LivG family, which is involved in the transport of branched-chain amino acids Back     alignment and domain information
>TIGR00960 3a0501s02 Type II (General) Secretory Pathway (IISP) Family protein Back     alignment and domain information
>TIGR01288 nodI ATP-binding ABC transporter family nodulation protein NodI Back     alignment and domain information
>TIGR02314 ABC_MetN D-methionine ABC transporter, ATP-binding protein Back     alignment and domain information
>cd03258 ABC_MetN_methionine_transporter MetN (also known as YusC) is an ABC-type transporter encoded by metN of the metNPQ operon in Bacillus subtilis that is involved in methionine transport Back     alignment and domain information
>cd03301 ABC_MalK_N The N-terminal ATPase domain of the maltose transporter, MalK Back     alignment and domain information
>PRK11000 maltose/maltodextrin transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03213 ABCG_EPDR ABCG transporters are involved in eye pigment (EP) precursor transport, regulation of lipid-trafficking mechanisms, and pleiotropic drug resistance (DR) Back     alignment and domain information
>PRK14267 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK11629 lolD lipoprotein transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03266 ABC_NatA_sodium_exporter NatA is the ATPase component of a bacterial ABC-type Na+ transport system called NatAB, which catalyzes ATP-dependent electrogenic Na+ extrusion without mechanically coupled proton or K+ uptake Back     alignment and domain information
>TIGR01188 drrA daunorubicin resistance ABC transporter ATP-binding subunit Back     alignment and domain information
>PRK13539 cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>cd03260 ABC_PstB_phosphate_transporter Phosphate uptake is of fundamental importance in the cell physiology of bacteria because phosphate is required as a nutrient Back     alignment and domain information
>PRK14247 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK13538 cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>PRK11153 metN DL-methionine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03257 ABC_NikE_OppD_transporters The ABC transporter subfamily specific for the transport of dipeptides, oligopeptides (OppD), and nickel (NikDE) Back     alignment and domain information
>TIGR02673 FtsE cell division ATP-binding protein FtsE Back     alignment and domain information
>cd03259 ABC_Carb_Solutes_like ABC Carbohydrate and Solute Transporters-like subgroup Back     alignment and domain information
>cd03226 ABC_cobalt_CbiO_domain2 Domain II of the ABC component of a cobalt transport family found in bacteria, archaea, and eukaryota Back     alignment and domain information
>cd03292 ABC_FtsE_transporter FtsE is a hydrophilic nucleotide-binding protein that binds FtsX to form a heterodimeric ATP-binding cassette (ABC)-type transporter that associates with the bacterial inner membrane Back     alignment and domain information
>TIGR02211 LolD_lipo_ex lipoprotein releasing system, ATP-binding protein Back     alignment and domain information
>TIGR01193 bacteriocin_ABC ABC-type bacteriocin transporter Back     alignment and domain information
>cd03264 ABC_drug_resistance_like ABC-type multidrug transport system, ATPase component Back     alignment and domain information
>PRK10895 lipopolysaccharide ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK13540 cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>PRK14241 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR02868 CydC thiol reductant ABC exporter, CydC subunit Back     alignment and domain information
>cd03262 ABC_HisP_GlnQ_permeases HisP and GlnQ are the ATP-binding components of the bacterial periplasmic histidine and glutamine permeases, repectively Back     alignment and domain information
>PRK11248 tauB taurine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK10908 cell division protein FtsE; Provisional Back     alignment and domain information
>TIGR01186 proV glycine betaine/L-proline transport ATP binding subunit Back     alignment and domain information
>cd03296 ABC_CysA_sulfate_importer Part of the ABC transporter complex cysAWTP involved in sulfate import Back     alignment and domain information
>PRK13543 cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>TIGR03740 galliderm_ABC gallidermin-class lantibiotic protection ABC transporter, ATP-binding subunit Back     alignment and domain information
>PRK14259 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR00972 3a0107s01c2 phosphate ABC transporter, ATP-binding protein Back     alignment and domain information
>PRK13637 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK09493 glnQ glutamine ABC transporter ATP-binding protein; Reviewed Back     alignment and domain information
>cd03256 ABC_PhnC_transporter ABC-type phosphate/phosphonate transport system Back     alignment and domain information
>PRK13634 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR03608 L_ocin_972_ABC putative bacteriocin export ABC transporter, lactococcin 972 group Back     alignment and domain information
>cd03230 ABC_DR_subfamily_A This family of ATP-binding proteins belongs to a multisubunit transporter involved in drug resistance (BcrA and DrrA), nodulation, lipid transport, and lantibiotic immunity Back     alignment and domain information
>cd03231 ABC_CcmA_heme_exporter CcmA, the ATP-binding component of the bacterial CcmAB transporter Back     alignment and domain information
>TIGR01189 ccmA heme ABC exporter, ATP-binding protein CcmA Back     alignment and domain information
>TIGR03864 PQQ_ABC_ATP ABC transporter, ATP-binding subunit, PQQ-dependent alcohol dehydrogenase system Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query991
2it1_A 362 Structure Of Ph0203 Protein From Pyrococcus Horikos 1e-04
2pcj_A224 Crystal Structure Of Abc Transporter (Aq_297) From 4e-04
>pdb|2IT1|A Chain A, Structure Of Ph0203 Protein From Pyrococcus Horikoshii Length = 362 Back     alignment and structure

Iteration: 1

Score = 45.8 bits (107), Expect = 1e-04, Method: Compositional matrix adjust. Identities = 36/120 (30%), Positives = 62/120 (51%), Gaps = 11/120 (9%) Query: 870 EMKVQGVLED--KLVLLNGVSGAFRPGVLTALMGVSGAGKTTLMDVLAG--RKTGGYIT- 924 E+K++ +++ LN ++ + G AL+G SG+GK+TL+ +AG + T G I Sbjct: 3 EIKLENIVKKFGNFTALNNINLKIKDGEFMALLGPSGSGKSTLLYTIAGIYKPTSGKIYF 62 Query: 925 GNITISGYPKKQETFARISGYCEQNDIHSPFVTIYESLLFSAWLRLSP--EVDSETRKVG 982 ++ P K R G QN P +T+Y+++ F LR +P E+D + R+V Sbjct: 63 DEKDVTELPPKD----RNVGLVFQNWALYPHMTVYKNIAFPLELRKAPREEIDKKVREVA 118
>pdb|2PCJ|A Chain A, Crystal Structure Of Abc Transporter (Aq_297) From Aquifex Aeolicus Vf5 Length = 224 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query991
2ihy_A279 ABC transporter, ATP-binding protein; ATPase, ABC 2e-19
2qi9_C249 Vitamin B12 import ATP-binding protein BTUD; inner 1e-18
2qi9_C 249 Vitamin B12 import ATP-binding protein BTUD; inner 4e-06
3gfo_A275 Cobalt import ATP-binding protein CBIO 1; structur 2e-18
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 9e-18
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 4e-14
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-13
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 3e-12
1vt4_I1221 APAF-1 related killer DARK; drosophila apoptosome, 4e-09
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 4e-05
1sgw_A214 Putative ABC transporter; structural genomics, P p 8e-17
1sgw_A214 Putative ABC transporter; structural genomics, P p 1e-04
2nq2_C253 Hypothetical ABC transporter ATP-binding protein H 2e-16
1vpl_A256 ABC transporter, ATP-binding protein; TM0544, stru 4e-16
2yz2_A266 Putative ABC transporter ATP-binding protein TM_0; 2e-15
2pjz_A263 Hypothetical protein ST1066; ATP binding protein, 1e-13
3bk7_A607 ABC transporter ATP-binding protein; ABC ATPase, i 5e-13
3bk7_A607 ABC transporter ATP-binding protein; ABC ATPase, i 8e-09
3bk7_A 607 ABC transporter ATP-binding protein; ABC ATPase, i 1e-05
1g6h_A257 High-affinity branched-chain amino acid transport 5e-12
2zu0_C267 Probable ATP-dependent transporter SUFC; iron-sulf 8e-11
1yqt_A538 RNAse L inhibitor; ATP-binding cassette, ribosome 1e-10
1yqt_A538 RNAse L inhibitor; ATP-binding cassette, ribosome 2e-07
1yqt_A 538 RNAse L inhibitor; ATP-binding cassette, ribosome 3e-05
3ozx_A538 RNAse L inhibitor; ATP binding cassette protein, h 1e-10
3ozx_A538 RNAse L inhibitor; ATP binding cassette protein, h 5e-10
3ozx_A 538 RNAse L inhibitor; ATP binding cassette protein, h 6e-04
3j16_B608 RLI1P; ribosome recycling, translation, eukarya, r 2e-10
3j16_B608 RLI1P; ribosome recycling, translation, eukarya, r 8e-10
3j16_B 608 RLI1P; ribosome recycling, translation, eukarya, r 7e-06
2d2e_A250 SUFC protein; ABC-ATPase, SUF protein, 310-helix, 5e-10
2cbz_A237 Multidrug resistance-associated protein 1; ABC pro 1e-09
3fvq_A359 Fe(3+) IONS import ATP-binding protein FBPC; nucle 8e-09
1ji0_A240 ABC transporter; ATP binding protein, structural g 1e-08
1z47_A355 CYSA, putative ABC-transporter ATP-binding protein 1e-08
2pze_A229 Cystic fibrosis transmembrane conductance regulat; 2e-08
3tui_C366 Methionine import ATP-binding protein METN; ABC-tr 4e-08
1mv5_A243 LMRA, multidrug resistance ABC transporter ATP-bin 1e-07
2bbs_A290 Cystic fibrosis transmembrane conductance regulato 2e-07
3d31_A348 Sulfate/molybdate ABC transporter, ATP-binding pro 4e-07
3tif_A235 Uncharacterized ABC transporter ATP-binding prote; 8e-07
3tif_A 235 Uncharacterized ABC transporter ATP-binding prote; 6e-04
2pcj_A224 ABC transporter, lipoprotein-releasing system ATP- 1e-06
2pcj_A224 ABC transporter, lipoprotein-releasing system ATP- 3e-04
1oxx_K353 GLCV, glucose, ABC transporter, ATP binding protei 9e-06
2ff7_A247 Alpha-hemolysin translocation ATP-binding protein 1e-05
2ixe_A271 Antigen peptide transporter 1; ABC ATPase, hydrola 3e-05
2onk_A240 Molybdate/tungstate ABC transporter, ATP-binding p 3e-05
2iw3_A986 Elongation factor 3A; acetylation, ATP-binding, pr 5e-05
2yl4_A595 ATP-binding cassette SUB-family B member 10, mitoc 2e-04
2it1_A362 362AA long hypothetical maltose/maltodextrin trans 3e-04
2ghi_A260 Transport protein; multidrug resistance protein, M 5e-04
2yyz_A359 Sugar ABC transporter, ATP-binding protein; sugar 7e-04
>2ihy_A ABC transporter, ATP-binding protein; ATPase, ABC cassette, hydrolase; HET: MSE; 1.90A {Staphylococcus aureus} Length = 279 Back     alignment and structure
 Score = 88.8 bits (221), Expect = 2e-19
 Identities = 63/260 (24%), Positives = 95/260 (36%), Gaps = 55/260 (21%)

Query: 166 TILKDVSGVIKPGRLTLLLGPPSSGKTTLLLALAGKLDPTLKVSGTVTYNGHDMDEFVPQ 225
           TILK +S  I  G   +L G   +GKTTLL  L      T   SGTV   G    +    
Sbjct: 35  TILKKISWQIAKGDKWILYGLNGAGKTTLLNILNAYEPAT---SGTVNLFGKMPGKVGYS 91

Query: 226 RTAA-----YISQ--HDNHIGEMTVRETLAFSARCQGVGTRYEMLTELARREKAAGIKPD 278
                    ++S    +       V + +  S   + +G  Y+ + +  R          
Sbjct: 92  AETVRQHIGFVSHSLLEKFQEGERVIDVVI-SGAFKSIG-VYQDIDDEIR---------- 139

Query: 279 PDIDVYMKAIATEGQEANVITDYYLKVLGLDVCADTMVGDEMIRGISGGQKKRVTTGEMM 338
                     A +           LK++G+   A        I  +S G+K+RV     M
Sbjct: 140 --------NEAHQ----------LLKLVGMSAKAQQY-----IGYLSTGEKQRV-----M 171

Query: 339 VGPALA-----LFMDEISTGLDSSTTFQIVNCLRQNIHINSGTAVISLLQPAPETYDLFD 393
           +  AL      L +DE + GLD      +++ L          A+I +     E    F 
Sbjct: 172 IARALMGQPQVLILDEPAAGLDFIARESLLSILDSLSDSYPTLAMIYVTHFIEEITANFS 231

Query: 394 DIILLSDGQIVYQGPRELVL 413
            I+LL DGQ + QG  E +L
Sbjct: 232 KILLLKDGQSIQQGAVEDIL 251


>2qi9_C Vitamin B12 import ATP-binding protein BTUD; inner membrane, membrane, transmembrane, transport, ATP- binding, hydrolase, nucleotide-binding, periplasm; HET: 1PE; 2.60A {Escherichia coli} PDB: 1l7v_C* 4dbl_C Length = 249 Back     alignment and structure
>2qi9_C Vitamin B12 import ATP-binding protein BTUD; inner membrane, membrane, transmembrane, transport, ATP- binding, hydrolase, nucleotide-binding, periplasm; HET: 1PE; 2.60A {Escherichia coli} PDB: 1l7v_C* 4dbl_C Length = 249 Back     alignment and structure
>3gfo_A Cobalt import ATP-binding protein CBIO 1; structural genomics, cell membrane, cobalt transport, hydrolase, ION transport; 2.30A {Clostridium perfringens atcc 13124} Length = 275 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1sgw_A Putative ABC transporter; structural genomics, P protein structure initiative, southeast collaboratory for S genomics, secsg; 1.70A {Pyrococcus furiosus} SCOP: c.37.1.12 Length = 214 Back     alignment and structure
>1sgw_A Putative ABC transporter; structural genomics, P protein structure initiative, southeast collaboratory for S genomics, secsg; 1.70A {Pyrococcus furiosus} SCOP: c.37.1.12 Length = 214 Back     alignment and structure
>2nq2_C Hypothetical ABC transporter ATP-binding protein HI1470; putative iron chelatin ABC transporter, nucleotide binding domain; 2.40A {Haemophilus influenzae} Length = 253 Back     alignment and structure
>1vpl_A ABC transporter, ATP-binding protein; TM0544, structural GENO joint center for structural genomics, JCSG, protein structu initiative, PSI; 2.10A {Thermotoga maritima} SCOP: c.37.1.12 Length = 256 Back     alignment and structure
>2yz2_A Putative ABC transporter ATP-binding protein TM_0; cobalt transport, TM02 hydrolase, inner membrane, membrane, nucleotide-binding; 2.30A {Thermotoga maritima} Length = 266 Back     alignment and structure
>2pjz_A Hypothetical protein ST1066; ATP binding protein, structural genomics, NPPSFA; 1.90A {Sulfolobus tokodaii} Length = 263 Back     alignment and structure
>3bk7_A ABC transporter ATP-binding protein; ABC ATPase, iron-sulfur cluster, adenosine diphosphate, nucleotide-binding; HET: ADP; 2.80A {Pyrococcus abyssi} PDB: 3j15_B* Length = 607 Back     alignment and structure
>3bk7_A ABC transporter ATP-binding protein; ABC ATPase, iron-sulfur cluster, adenosine diphosphate, nucleotide-binding; HET: ADP; 2.80A {Pyrococcus abyssi} PDB: 3j15_B* Length = 607 Back     alignment and structure
>3bk7_A ABC transporter ATP-binding protein; ABC ATPase, iron-sulfur cluster, adenosine diphosphate, nucleotide-binding; HET: ADP; 2.80A {Pyrococcus abyssi} PDB: 3j15_B* Length = 607 Back     alignment and structure
>1g6h_A High-affinity branched-chain amino acid transport ATP-binding protein; beta-core domain; HET: ADP; 1.60A {Methanocaldococcus jannaschii} SCOP: c.37.1.12 PDB: 1gaj_A 1g9x_A* Length = 257 Back     alignment and structure
>2zu0_C Probable ATP-dependent transporter SUFC; iron-sulfur cluster, ABC-ATPase, ATP-binding, cytoplasm, nucleotide-binding; HET: MES; 2.20A {Escherichia coli} PDB: 2d3w_A Length = 267 Back     alignment and structure
>1yqt_A RNAse L inhibitor; ATP-binding cassette, ribosome biogenesis, hydrolyase/translation complex; HET: ADP; 1.90A {Pyrococcus furiosus} Length = 538 Back     alignment and structure
>1yqt_A RNAse L inhibitor; ATP-binding cassette, ribosome biogenesis, hydrolyase/translation complex; HET: ADP; 1.90A {Pyrococcus furiosus} Length = 538 Back     alignment and structure
>1yqt_A RNAse L inhibitor; ATP-binding cassette, ribosome biogenesis, hydrolyase/translation complex; HET: ADP; 1.90A {Pyrococcus furiosus} Length = 538 Back     alignment and structure
>3ozx_A RNAse L inhibitor; ATP binding cassette protein, hydrolase, translation; HET: ADP; 2.05A {Sulfolobus solfataricus} Length = 538 Back     alignment and structure
>3ozx_A RNAse L inhibitor; ATP binding cassette protein, hydrolase, translation; HET: ADP; 2.05A {Sulfolobus solfataricus} Length = 538 Back     alignment and structure
>3ozx_A RNAse L inhibitor; ATP binding cassette protein, hydrolase, translation; HET: ADP; 2.05A {Sulfolobus solfataricus} Length = 538 Back     alignment and structure
>3j16_B RLI1P; ribosome recycling, translation, eukarya, ribosome; HET: ATP; NMR {Saccharomyces cerevisiae} Length = 608 Back     alignment and structure
>3j16_B RLI1P; ribosome recycling, translation, eukarya, ribosome; HET: ATP; NMR {Saccharomyces cerevisiae} Length = 608 Back     alignment and structure
>3j16_B RLI1P; ribosome recycling, translation, eukarya, ribosome; HET: ATP; NMR {Saccharomyces cerevisiae} Length = 608 Back     alignment and structure
>2d2e_A SUFC protein; ABC-ATPase, SUF protein, 310-helix, riken structural genomics/proteomics initiative, RSGI, structural genomics, binding; 1.70A {Thermus thermophilus} PDB: 2d2f_A* Length = 250 Back     alignment and structure
>2cbz_A Multidrug resistance-associated protein 1; ABC proteins, MRP1/ABCC1, nucleotide-binding domain, ATP- binding, hydrolysis, transport; HET: ATP; 1.5A {Homo sapiens} Length = 237 Back     alignment and structure
>3fvq_A Fe(3+) IONS import ATP-binding protein FBPC; nucleotide binding domain, ABC motor domain, ferric iron transport, cell inner membrane; HET: ATP; 1.90A {Neisseria gonorrhoeae} Length = 359 Back     alignment and structure
>1ji0_A ABC transporter; ATP binding protein, structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; HET: ATP; 2.00A {Thermotoga maritima} SCOP: c.37.1.12 Length = 240 Back     alignment and structure
>1z47_A CYSA, putative ABC-transporter ATP-binding protein; alpha/beta motif, beta sandwich, ligand binding protein; 1.90A {Alicyclobacillus acidocaldarius} Length = 355 Back     alignment and structure
>2pze_A Cystic fibrosis transmembrane conductance regulat; NBD, ABC transporter, CFTR, hydrolase; HET: ATP; 1.70A {Homo sapiens} PDB: 2pzg_A* 2pzf_A* 1ckx_A 1cky_A 1ckw_A 1ckz_A Length = 229 Back     alignment and structure
>3tui_C Methionine import ATP-binding protein METN; ABC-transporter, type I ABC type importer, methionine uptake transporter, membrane protein; HET: ADP; 2.90A {Escherichia coli} PDB: 3tuj_C 3tuz_C* 3dhw_C Length = 366 Back     alignment and structure
>1mv5_A LMRA, multidrug resistance ABC transporter ATP-binding and permease protein; asymmetric dimer, tetramer, P-glycoprotein; HET: ATP ADP; 3.10A {Lactococcus lactis} SCOP: c.37.1.12 Length = 243 Back     alignment and structure
>2bbs_A Cystic fibrosis transmembrane conductance regulator; ATP binding cassette, transport protein; HET: ATP; 2.05A {Homo sapiens} PDB: 2bbt_A* 1xmi_A* 1xmj_A* 2bbo_A* 3si7_A* 1r0w_A 1q3h_A 1r0x_A* 1r0y_A* 1r0z_A* 1r10_A* 1xf9_A* 1xfa_A* Length = 290 Back     alignment and structure
>3d31_A Sulfate/molybdate ABC transporter, ATP-binding protein; ATP-binding, nucleotide-binding, membrane, transmembrane, transport protein; 3.00A {Methanosarcina acetivorans} SCOP: b.40.6.3 c.37.1.12 Length = 348 Back     alignment and structure
>3tif_A Uncharacterized ABC transporter ATP-binding prote; nucleotide-binding domain, ABC transporter ATPase; HET: ADP; 1.80A {Methanocaldococcus jannaschii dsm 2661ORGANISM_TAXID} PDB: 1l2t_A* 1f3o_A* Length = 235 Back     alignment and structure
>3tif_A Uncharacterized ABC transporter ATP-binding prote; nucleotide-binding domain, ABC transporter ATPase; HET: ADP; 1.80A {Methanocaldococcus jannaschii dsm 2661ORGANISM_TAXID} PDB: 1l2t_A* 1f3o_A* Length = 235 Back     alignment and structure
>2pcj_A ABC transporter, lipoprotein-releasing system ATP-binding protein; structural genomics; 1.70A {Aquifex aeolicus} PDB: 2pcl_A Length = 224 Back     alignment and structure
>2pcj_A ABC transporter, lipoprotein-releasing system ATP-binding protein; structural genomics; 1.70A {Aquifex aeolicus} PDB: 2pcl_A Length = 224 Back     alignment and structure
>1oxx_K GLCV, glucose, ABC transporter, ATP binding protein; ABC-ATPase, ATP-binding cassette, ATPase, transport protein; 1.45A {Sulfolobus solfataricus} SCOP: b.40.6.3 c.37.1.12 PDB: 1oxs_C 1oxt_A 1oxu_A* 1oxv_A* Length = 353 Back     alignment and structure
>2ff7_A Alpha-hemolysin translocation ATP-binding protein HLYB; ABC-transporter, transport protein; HET: ADP; 1.60A {Escherichia coli} SCOP: c.37.1.12 PDB: 2ffb_A* 2fgk_A* 2ffa_A* 2fgj_A* 2pmk_A* 3b5j_A* 1mt0_A 1xef_A* Length = 247 Back     alignment and structure
>2ixe_A Antigen peptide transporter 1; ABC ATPase, hydrolase; HET: ATP; 2.0A {Rattus norvegicus} PDB: 2ixg_A* 2ixf_A* 1jj7_A* Length = 271 Back     alignment and structure
>2onk_A Molybdate/tungstate ABC transporter, ATP-binding protein; membrane protein; 3.10A {Archaeoglobus fulgidus} SCOP: c.37.1.12 Length = 240 Back     alignment and structure
>2iw3_A Elongation factor 3A; acetylation, ATP-binding, protein biosynthesis, nucleotide-binding, phosphorylation, RNA- binding, rRNA-binding; HET: ADP; 2.4A {Saccharomyces cerevisiae} PDB: 2iwh_A* 2ix3_A 2ix8_A Length = 986 Back     alignment and structure
>2it1_A 362AA long hypothetical maltose/maltodextrin transport ATP-binding protein; structural genomics, NPPSFA; 1.94A {Pyrococcus horikoshii} Length = 362 Back     alignment and structure
>2ghi_A Transport protein; multidrug resistance protein, MDR, structural genomics, structural genomics consortium, SGC; 2.20A {Plasmodium yoelii yoelii str} Length = 260 Back     alignment and structure
>2yyz_A Sugar ABC transporter, ATP-binding protein; sugar transport, alpha and beta proteins (A/B) TM0421, structural genomics, NPPSFA; 2.11A {Thermotoga maritima} Length = 359 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query991
4f4c_A 1321 Multidrug resistance protein PGP-1; ABC transporte 100.0
3g5u_A1284 MCG1178, multidrug resistance protein 1A; P-glycop 100.0
3tui_C366 Methionine import ATP-binding protein METN; ABC-tr 100.0
3fvq_A359 Fe(3+) IONS import ATP-binding protein FBPC; nucle 100.0
3rlf_A381 Maltose/maltodextrin import ATP-binding protein M; 100.0
3tif_A235 Uncharacterized ABC transporter ATP-binding prote; 100.0
2yyz_A359 Sugar ABC transporter, ATP-binding protein; sugar 100.0
3gfo_A275 Cobalt import ATP-binding protein CBIO 1; structur 100.0
4g1u_C266 Hemin import ATP-binding protein HMUV; membrane tr 100.0
2pcj_A224 ABC transporter, lipoprotein-releasing system ATP- 100.0
2it1_A362 362AA long hypothetical maltose/maltodextrin trans 100.0
2olj_A263 Amino acid ABC transporter; ABC domain, ATPase, hy 100.0
1g29_1372 MALK, maltose transport protein MALK; ATPase, acti 100.0
1v43_A372 Sugar-binding transport ATP-binding protein; ATPas 100.0
1b0u_A262 Histidine permease; ABC transporter, transport pro 100.0
1oxx_K353 GLCV, glucose, ABC transporter, ATP binding protei 100.0
1z47_A355 CYSA, putative ABC-transporter ATP-binding protein 100.0
3d31_A348 Sulfate/molybdate ABC transporter, ATP-binding pro 100.0
3nh6_A306 ATP-binding cassette SUB-family B member 6, mitoc; 100.0
1g6h_A257 High-affinity branched-chain amino acid transport 100.0
1vpl_A256 ABC transporter, ATP-binding protein; TM0544, stru 100.0
1ji0_A240 ABC transporter; ATP binding protein, structural g 100.0
2onk_A240 Molybdate/tungstate ABC transporter, ATP-binding p 100.0
2yz2_A266 Putative ABC transporter ATP-binding protein TM_0; 100.0
2ihy_A279 ABC transporter, ATP-binding protein; ATPase, ABC 100.0
2ff7_A247 Alpha-hemolysin translocation ATP-binding protein 100.0
2d2e_A250 SUFC protein; ABC-ATPase, SUF protein, 310-helix, 100.0
2ixe_A271 Antigen peptide transporter 1; ABC ATPase, hydrola 100.0
2zu0_C267 Probable ATP-dependent transporter SUFC; iron-sulf 100.0
2nq2_C253 Hypothetical ABC transporter ATP-binding protein H 100.0
2pjz_A263 Hypothetical protein ST1066; ATP binding protein, 100.0
4a82_A578 Cystic fibrosis transmembrane conductance regulat; 100.0
1mv5_A243 LMRA, multidrug resistance ABC transporter ATP-bin 100.0
2ghi_A260 Transport protein; multidrug resistance protein, M 100.0
2qi9_C249 Vitamin B12 import ATP-binding protein BTUD; inner 100.0
3qf4_A587 ABC transporter, ATP-binding protein; multidrug tr 100.0
3gd7_A390 Fusion complex of cystic fibrosis transmembrane co 100.0
2yl4_A595 ATP-binding cassette SUB-family B member 10, mitoc 100.0
3b5x_A582 Lipid A export ATP-binding/permease protein MSBA; 100.0
3b60_A582 Lipid A export ATP-binding/permease protein MSBA; 100.0
1sgw_A214 Putative ABC transporter; structural genomics, P p 100.0
2cbz_A237 Multidrug resistance-associated protein 1; ABC pro 100.0
3qf4_B598 Uncharacterized ABC transporter ATP-binding prote 100.0
2pze_A229 Cystic fibrosis transmembrane conductance regulat; 100.0
4f4c_A1321 Multidrug resistance protein PGP-1; ABC transporte 100.0
2bbs_A290 Cystic fibrosis transmembrane conductance regulato 100.0
3g5u_A1284 MCG1178, multidrug resistance protein 1A; P-glycop 100.0
3bk7_A607 ABC transporter ATP-binding protein; ABC ATPase, i 99.97
1yqt_A538 RNAse L inhibitor; ATP-binding cassette, ribosome 99.97
3ozx_A538 RNAse L inhibitor; ATP binding cassette protein, h 99.97
3j16_B608 RLI1P; ribosome recycling, translation, eukarya, r 99.97
3ux8_A670 Excinuclease ABC, A subunit; UVRA, nucleotide exci 99.96
2iw3_A986 Elongation factor 3A; acetylation, ATP-binding, pr 99.96
1yqt_A538 RNAse L inhibitor; ATP-binding cassette, ribosome 99.96
3bk7_A607 ABC transporter ATP-binding protein; ABC ATPase, i 99.96
2iw3_A986 Elongation factor 3A; acetylation, ATP-binding, pr 99.95
3ux8_A670 Excinuclease ABC, A subunit; UVRA, nucleotide exci 99.95
3ozx_A538 RNAse L inhibitor; ATP binding cassette protein, h 99.94
3j16_B608 RLI1P; ribosome recycling, translation, eukarya, r 99.93
3pih_A916 Uvrabc system protein A; hydrolase, ABC ATPase, DN 99.93
2r6f_A972 Excinuclease ABC subunit A; UVRA, nucleotide excis 99.93
2vf7_A842 UVRA2, excinuclease ABC, subunit A.; DNA-binding p 99.92
2ygr_A993 Uvrabc system protein A; hydrolase, nucleotide exc 99.92
2npi_A460 Protein CLP1; CLP1-PCF11 complex, ATP binding, ter 99.92
4aby_A415 DNA repair protein RECN; hydrolase, double strand 99.92
3qf7_A365 RAD50; ABC-ATPase, ATPase, hydrolase; HET: ANP; 1. 99.86
3b85_A208 Phosphate starvation-inducible protein; PHOH2, ATP 99.86
1e69_A322 Chromosome segregation SMC protein; structural mai 99.84
1tq4_A413 IIGP1, interferon-inducible GTPase; interferon gam 99.84
1ye8_A178 Protein THEP1, hypothetical UPF0334 kinase-like pr 99.83
2v9p_A305 Replication protein E1; AAA+ molecular motor, DNA 99.83
4gp7_A171 Metallophosphoesterase; polynucleotide kinase phos 99.82
3b9q_A302 Chloroplast SRP receptor homolog, alpha subunit CP 99.79
2o5v_A359 DNA replication and repair protein RECF; ABC ATPas 99.79
3sop_A270 Neuronal-specific septin-3; hydrolase; HET: GDP; 2 99.78
2dpy_A438 FLII, flagellum-specific ATP synthase; beta barrel 99.76
2og2_A359 Putative signal recognition particle receptor; nuc 99.76
1znw_A207 Guanylate kinase, GMP kinase; ATP:GMP-phosphotrans 99.75
1z6g_A218 Guanylate kinase; structural genomics, SGC, struct 99.75
2pt7_A330 CAG-ALFA; ATPase, protein-protein complex, type IV 99.72
3qkt_A339 DNA double-strand break repair RAD50 ATPase; RECA- 99.71
1cr0_A296 DNA primase/helicase; RECA-type protein fold, tran 99.71
3aez_A312 Pantothenate kinase; transferase, homodimer, COA b 99.71
4ad8_A517 DNA repair protein RECN; DNA binding protein, ATPa 99.71
2jeo_A245 Uridine-cytidine kinase 1; UCK, transferase, ATP-b 99.68
3tif_A 235 Uncharacterized ABC transporter ATP-binding prote; 99.68
3pih_A916 Uvrabc system protein A; hydrolase, ABC ATPase, DN 99.67
3thx_A934 DNA mismatch repair protein MSH2; ABC family ATPas 99.65
3fvq_A 359 Fe(3+) IONS import ATP-binding protein FBPC; nucle 99.65
3rlf_A 381 Maltose/maltodextrin import ATP-binding protein M; 99.64
1tf7_A525 KAIC; homohexamer, hexamer, circadian clock protei 99.64
3tui_C 366 Methionine import ATP-binding protein METN; ABC-tr 99.64
1b0u_A 262 Histidine permease; ABC transporter, transport pro 99.63
2obl_A347 ESCN; ATPase, hydrolase; 1.80A {Escherichia coli O 99.63
2pcj_A224 ABC transporter, lipoprotein-releasing system ATP- 99.63
1sgw_A214 Putative ABC transporter; structural genomics, P p 99.63
2olj_A 263 Amino acid ABC transporter; ABC domain, ATPase, hy 99.63
1vpl_A 256 ABC transporter, ATP-binding protein; TM0544, stru 99.63
2yyz_A 359 Sugar ABC transporter, ATP-binding protein; sugar 99.63
1g29_1 372 MALK, maltose transport protein MALK; ATPase, acti 99.62
2it1_A 362 362AA long hypothetical maltose/maltodextrin trans 99.62
1oxx_K 353 GLCV, glucose, ABC transporter, ATP binding protei 99.62
1z47_A 355 CYSA, putative ABC-transporter ATP-binding protein 99.62
2r6f_A972 Excinuclease ABC subunit A; UVRA, nucleotide excis 99.61
1ji0_A 240 ABC transporter; ATP binding protein, structural g 99.61
1v43_A 372 Sugar-binding transport ATP-binding protein; ATPas 99.61
4a74_A231 DNA repair and recombination protein RADA; hydrola 99.61
3gfo_A 275 Cobalt import ATP-binding protein CBIO 1; structur 99.61
4g1u_C 266 Hemin import ATP-binding protein HMUV; membrane tr 99.59
2yz2_A 266 Putative ABC transporter ATP-binding protein TM_0; 99.59
1g6h_A 257 High-affinity branched-chain amino acid transport 99.59
1tf7_A525 KAIC; homohexamer, hexamer, circadian clock protei 99.59
3nh6_A 306 ATP-binding cassette SUB-family B member 6, mitoc; 99.59
2vf7_A842 UVRA2, excinuclease ABC, subunit A.; DNA-binding p 99.58
1f2t_B148 RAD50 ABC-ATPase; DNA double-strand break repair, 99.58
3d31_A 348 Sulfate/molybdate ABC transporter, ATP-binding pro 99.58
2i3b_A189 HCR-ntpase, human cancer-related ntpase; AAA, ross 99.57
2eyu_A261 Twitching motility protein PILT; pilus retraction 99.57
3thx_B918 DNA mismatch repair protein MSH3; ABC family ATPas 99.56
2qnr_A301 Septin-2, protein NEDD5; structural genomics conso 99.56
1w1w_A430 Structural maintenance of chromosome 1; cohesin, c 99.56
2ehv_A251 Hypothetical protein PH0186; KAIC, RECA ATPase, un 99.56
2ihy_A 279 ABC transporter, ATP-binding protein; ATPase, ABC 99.55
2o8b_B1022 DNA mismatch repair protein MSH6; DNA damage respo 99.55
2d2e_A 250 SUFC protein; ABC-ATPase, SUF protein, 310-helix, 99.55
3asz_A211 Uridine kinase; cytidine phosphorylation, transfer 99.55
2ixe_A 271 Antigen peptide transporter 1; ABC ATPase, hydrola 99.55
2ff7_A 247 Alpha-hemolysin translocation ATP-binding protein 99.55
3szr_A608 Interferon-induced GTP-binding protein MX1; interf 99.54
2ygr_A993 Uvrabc system protein A; hydrolase, nucleotide exc 99.54
1pzn_A349 RAD51, DNA repair and recombination protein RAD51, 99.54
1rj9_A304 FTSY, signal recognition protein; SRP-GTPase domai 99.54
1mv5_A 243 LMRA, multidrug resistance ABC transporter ATP-bin 99.54
2zu0_C 267 Probable ATP-dependent transporter SUFC; iron-sulf 99.53
2onk_A 240 Molybdate/tungstate ABC transporter, ATP-binding p 99.52
1ewq_A765 DNA mismatch repair protein MUTS; multiple domains 99.52
2w0m_A235 SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus 99.51
2ghi_A 260 Transport protein; multidrug resistance protein, M 99.51
1wb9_A800 DNA mismatch repair protein MUTS; DNA-binding, ATP 99.5
2qi9_C 249 Vitamin B12 import ATP-binding protein BTUD; inner 99.49
2pze_A 229 Cystic fibrosis transmembrane conductance regulat; 99.49
2nq2_C 253 Hypothetical ABC transporter ATP-binding protein H 99.48
2pjz_A 263 Hypothetical protein ST1066; ATP binding protein, 99.47
2cbz_A 237 Multidrug resistance-associated protein 1; ABC pro 99.47
4a82_A 578 Cystic fibrosis transmembrane conductance regulat; 99.47
3qf4_B 598 Uncharacterized ABC transporter ATP-binding prote 99.46
3gd7_A 390 Fusion complex of cystic fibrosis transmembrane co 99.46
3qf4_A 587 ABC transporter, ATP-binding protein; multidrug tr 99.45
1nlf_A279 Regulatory protein REPA; replicative DNA helicase 99.45
2yl4_A 595 ATP-binding cassette SUB-family B member 10, mitoc 99.45
3b60_A 582 Lipid A export ATP-binding/permease protein MSBA; 99.45
3b5x_A 582 Lipid A export ATP-binding/permease protein MSBA; 99.44
2bdt_A189 BH3686; alpha-beta protein, structural genomics, P 99.38
1lw7_A365 Transcriptional regulator NADR; NMN, NMN adenylyl 99.37
1zp6_A191 Hypothetical protein ATU3015; alpha-beta protein., 99.36
1s96_A219 Guanylate kinase, GMP kinase; E.coli, dimer, SAD, 99.36
3kta_B173 Chromosome segregation protein SMC; structural mai 99.36
2bbs_A 290 Cystic fibrosis transmembrane conductance regulato 99.36
2qag_C418 Septin-7; cell cycle, cell division, GTP-binding, 99.35
2cvh_A220 DNA repair and recombination protein RADB; filamen 99.35
3jvv_A356 Twitching mobility protein; hexameric P-loop ATPas 99.34
2gza_A361 Type IV secretion system protein VIRB11; ATPase, h 99.33
1pui_A210 ENGB, probable GTP-binding protein ENGB; structura 99.31
1htw_A158 HI0065; nucleotide-binding fold, structural genomi 99.31
2bbw_A246 Adenylate kinase 4, AK4; nucleotide kinase, nucleo 99.26
2qag_B427 Septin-6, protein NEDD5; cell cycle, cell division 99.24
1n0w_A243 DNA repair protein RAD51 homolog 1; DNA repair, ho 99.23
2f1r_A171 Molybdopterin-guanine dinucleotide biosynthesis pr 99.23
2ewv_A372 Twitching motility protein PILT; pilus retraction 99.21
1nij_A318 Hypothetical protein YJIA; structural genomics, P- 99.21
2yhs_A503 FTSY, cell division protein FTSY; cell cycle, prot 99.18
1htw_A158 HI0065; nucleotide-binding fold, structural genomi 99.17
3e70_C328 DPA, signal recognition particle receptor; FTSY, S 99.16
2rcn_A358 Probable GTPase ENGC; YJEQ, circularly permuted, G 99.16
3ec2_A180 DNA replication protein DNAC; helicase loader, rep 99.15
3auy_A371 DNA double-strand break repair RAD50 ATPase; DNA r 99.13
1odf_A290 YGR205W, hypothetical 33.3 kDa protein in ADE3-Ser 99.13
2qm8_A337 GTPase/ATPase; G protein, G3E, metallochaperone, c 99.11
1udx_A416 The GTP-binding protein OBG; TGS domain, riken str 99.08
1p9r_A418 General secretion pathway protein E; bacterial typ 99.05
2yv5_A302 YJEQ protein; hydrolase, GTPase, permutation, stru 99.04
2oap_1511 GSPE-2, type II secretion system protein; hexameri 99.03
3lda_A400 DNA repair protein RAD51; DNA binding protein, ATP 99.01
1lvg_A198 Guanylate kinase, GMP kinase; transferase; HET: AD 98.96
1sxj_E354 Activator 1 40 kDa subunit; clamp loader, processi 98.95
2kjq_A149 DNAA-related protein; solution structure, NESG, st 98.95
1ni3_A392 YCHF GTPase, YCHF GTP-binding protein; structural 98.94
3c8u_A208 Fructokinase; YP_612366.1, putative fructose trans 98.89
3sop_A 270 Neuronal-specific septin-3; hydrolase; HET: GDP; 2 98.88
2x8a_A274 Nuclear valosin-containing protein-like; nuclear p 98.88
1u0l_A301 Probable GTPase ENGC; permutation, OB-fold, zinc-f 98.87
1sq5_A308 Pantothenate kinase; P-loop, transferase; HET: PAU 98.86
2dpy_A 438 FLII, flagellum-specific ATP synthase; beta barrel 98.83
2jeo_A 245 Uridine-cytidine kinase 1; UCK, transferase, ATP-b 98.8
1z6g_A218 Guanylate kinase; structural genomics, SGC, struct 98.8
1in4_A334 RUVB, holliday junction DNA helicase RUVB; AAA+-cl 98.8
2gza_A361 Type IV secretion system protein VIRB11; ATPase, h 98.8
3b9q_A302 Chloroplast SRP receptor homolog, alpha subunit CP 98.78
1znw_A207 Guanylate kinase, GMP kinase; ATP:GMP-phosphotrans 98.76
1t9h_A307 YLOQ, probable GTPase ENGC; N-terminal beta-barrel 98.75
3aez_A 312 Pantothenate kinase; transferase, homodimer, COA b 98.72
1s96_A 219 Guanylate kinase, GMP kinase; E.coli, dimer, SAD, 98.7
3euj_A483 Chromosome partition protein MUKB, linker; MUKB, M 98.7
2eyu_A 261 Twitching motility protein PILT; pilus retraction 98.68
2v9p_A305 Replication protein E1; AAA+ molecular motor, DNA 98.68
1vma_A306 Cell division protein FTSY; TM0570, structural gen 98.67
2og2_A359 Putative signal recognition particle receptor; nuc 98.67
3b85_A208 Phosphate starvation-inducible protein; PHOH2, ATP 98.67
2npi_A 460 Protein CLP1; CLP1-PCF11 complex, ATP binding, ter 98.64
2dr3_A247 UPF0273 protein PH0284; RECA superfamily ATPase, h 98.64
2yhs_A 503 FTSY, cell division protein FTSY; cell cycle, prot 98.64
2px0_A296 Flagellar biosynthesis protein FLHF; SRP GTPase, f 98.62
1tq4_A 413 IIGP1, interferon-inducible GTPase; interferon gam 98.61
2qag_B 427 Septin-6, protein NEDD5; cell cycle, cell division 98.6
1sq5_A 308 Pantothenate kinase; P-loop, transferase; HET: PAU 98.59
3k1j_A604 LON protease, ATP-dependent protease LON; ATP-bind 98.59
2r6a_A454 DNAB helicase, replicative helicase; replication, 98.58
2pt7_A330 CAG-ALFA; ATPase, protein-protein complex, type IV 98.57
2rcn_A358 Probable GTPase ENGC; YJEQ, circularly permuted, G 98.56
1zp6_A191 Hypothetical protein ATU3015; alpha-beta protein., 98.56
3tr0_A205 Guanylate kinase, GMP kinase; purines, pyrimidines 98.54
1ls1_A295 Signal recognition particle protein; FFH, SRP54, S 98.53
1rj9_A304 FTSY, signal recognition protein; SRP-GTPase domai 98.5
1oix_A191 RAS-related protein RAB-11A; small G protein, intr 98.49
2ius_A512 DNA translocase FTSK; nucleotide-binding, chromoso 98.49
1u0l_A301 Probable GTPase ENGC; permutation, OB-fold, zinc-f 98.45
2zr9_A349 Protein RECA, recombinase A; recombination, RECA m 98.44
4aby_A 415 DNA repair protein RECN; hydrolase, double strand 98.43
2ewv_A 372 Twitching motility protein PILT; pilus retraction 98.42
3tr0_A 205 Guanylate kinase, GMP kinase; purines, pyrimidines 98.4
1iy2_A278 ATP-dependent metalloprotease FTSH; AAA domain fol 98.39
3e70_C328 DPA, signal recognition particle receptor; FTSY, S 98.38
1ixz_A254 ATP-dependent metalloprotease FTSH; AAA domain fol 98.34
2yv5_A302 YJEQ protein; hydrolase, GTPase, permutation, stru 98.34
3lnc_A231 Guanylate kinase, GMP kinase; ALS collaborative cr 98.34
1t9h_A307 YLOQ, probable GTPase ENGC; N-terminal beta-barrel 98.31
3hr8_A356 Protein RECA; alpha and beta proteins (A/B, A+B), 98.31
2obl_A 347 ESCN; ATPase, hydrolase; 1.80A {Escherichia coli O 98.3
3szr_A 608 Interferon-induced GTP-binding protein MX1; interf 98.29
1qhl_A227 Protein (cell division protein MUKB); SMC, chromos 98.29
2bdt_A189 BH3686; alpha-beta protein, structural genomics, P 98.28
2oap_1 511 GSPE-2, type II secretion system protein; hexameri 98.27
4a74_A 231 DNA repair and recombination protein RADA; hydrola 98.26
3asz_A 211 Uridine kinase; cytidine phosphorylation, transfer 98.25
2qnr_A 301 Septin-2, protein NEDD5; structural genomics conso 98.24
2qm8_A 337 GTPase/ATPase; G protein, G3E, metallochaperone, c 98.22
3euj_A 483 Chromosome partition protein MUKB, linker; MUKB, M 98.19
4eun_A200 Thermoresistant glucokinase; putative sugar kinase 98.17
3lnc_A 231 Guanylate kinase, GMP kinase; ALS collaborative cr 98.16
2ehv_A 251 Hypothetical protein PH0186; KAIC, RECA ATPase, un 98.16
2f9l_A199 RAB11B, member RAS oncogene family; RAB11B GTPase, 98.14
2i3b_A189 HCR-ntpase, human cancer-related ntpase; AAA, ross 98.12
4eun_A200 Thermoresistant glucokinase; putative sugar kinase 98.12
3jvv_A 356 Twitching mobility protein; hexameric P-loop ATPas 98.11
2qtf_A364 Protein HFLX, GTP-binding protein; beta-alpha-barr 98.1
2qag_C 418 Septin-7; cell cycle, cell division, GTP-binding, 98.09
4gp7_A171 Metallophosphoesterase; polynucleotide kinase phos 98.06
1p9r_A 418 General secretion pathway protein E; bacterial typ 98.06
2ce7_A476 Cell division protein FTSH; metalloprotease; HET: 98.03
3kta_A182 Chromosome segregation protein SMC; structural mai 98.02
1qhl_A227 Protein (cell division protein MUKB); SMC, chromos 97.99
1zu4_A320 FTSY; GTPase, signal recognition particle, SRP, re 97.97
2j41_A207 Guanylate kinase; GMP, GMK, transferase, ATP-bindi 97.95
1pzn_A 349 RAD51, DNA repair and recombination protein RAD51, 97.95
2bbw_A 246 Adenylate kinase 4, AK4; nucleotide kinase, nucleo 97.94
4a1f_A338 DNAB helicase, replicative DNA helicase; hydrolase 97.93
3c8u_A208 Fructokinase; YP_612366.1, putative fructose trans 97.9
1ye8_A178 Protein THEP1, hypothetical UPF0334 kinase-like pr 97.9
3a00_A186 Guanylate kinase, GMP kinase; domain movement, dim 97.89
2f1r_A171 Molybdopterin-guanine dinucleotide biosynthesis pr 97.88
1cr0_A 296 DNA primase/helicase; RECA-type protein fold, tran 97.87
2xau_A773 PRE-mRNA-splicing factor ATP-dependent RNA helica; 97.87
4e22_A252 Cytidylate kinase; P-loop, CMP/ATP binding, transf 97.82
1e69_A 322 Chromosome segregation SMC protein; structural mai 97.81
3vaa_A199 Shikimate kinase, SK; structural genomics, center 97.81
3uie_A200 Adenylyl-sulfate kinase 1, chloroplastic; rossmann 97.79
1nij_A 318 Hypothetical protein YJIA; structural genomics, P- 97.73
1pui_A210 ENGB, probable GTP-binding protein ENGB; structura 97.71
2x8a_A 274 Nuclear valosin-containing protein-like; nuclear p 97.71
1kgd_A180 CASK, peripheral plasma membrane CASK; maguk, guan 97.71
1lvg_A198 Guanylate kinase, GMP kinase; transferase; HET: AD 97.68
2vp4_A 230 Deoxynucleoside kinase; ATP-binding, DNA synthesis 97.68
1udx_A 416 The GTP-binding protein OBG; TGS domain, riken str 97.67
3nwj_A 250 ATSK2; P loop, shikimate, nucleoside monophosphate 97.66
1lw7_A365 Transcriptional regulator NADR; NMN, NMN adenylyl 97.66
2dhr_A499 FTSH; AAA+ protein, hexameric Zn metalloprotease, 97.66
3uie_A200 Adenylyl-sulfate kinase 1, chloroplastic; rossmann 97.65
2j41_A 207 Guanylate kinase; GMP, GMK, transferase, ATP-bindi 97.64
1in4_A 334 RUVB, holliday junction DNA helicase RUVB; AAA+-cl 97.6
3nwj_A250 ATSK2; P loop, shikimate, nucleoside monophosphate 97.6
4e22_A 252 Cytidylate kinase; P-loop, CMP/ATP binding, transf 97.58
3bh0_A315 DNAB-like replicative helicase; ATPase, replicatio 97.56
1knq_A175 Gluconate kinase; ALFA/beta structure, transferase 97.55
2vp4_A230 Deoxynucleoside kinase; ATP-binding, DNA synthesis 97.53
2e87_A357 Hypothetical protein PH1320; GTP-binding, GTPase, 97.51
3kta_A182 Chromosome segregation protein SMC; structural mai 97.51
1kgd_A180 CASK, peripheral plasma membrane CASK; maguk, guan 97.5
2kjq_A149 DNAA-related protein; solution structure, NESG, st 97.49
3tau_A208 Guanylate kinase, GMP kinase; structural genomics, 97.49
3vaa_A199 Shikimate kinase, SK; structural genomics, center 97.46
3ney_A197 55 kDa erythrocyte membrane protein; structural ge 97.46
3a00_A186 Guanylate kinase, GMP kinase; domain movement, dim 97.44
3t34_A360 Dynamin-related protein 1A, linker, dynamin-relat 97.44
1rz3_A201 Hypothetical protein rbstp0775; MCSG, structural g 97.43
1knq_A175 Gluconate kinase; ALFA/beta structure, transferase 97.42
1svm_A377 Large T antigen; AAA+ fold, viral protein; HET: AT 97.42
1svm_A 377 Large T antigen; AAA+ fold, viral protein; HET: AT 97.42
3b9p_A297 CG5977-PA, isoform A; AAA ATPase, ATP-binding, nuc 97.42
1ni3_A 392 YCHF GTPase, YCHF GTP-binding protein; structural 97.41
1v5w_A343 DMC1, meiotic recombination protein DMC1/LIM15 hom 97.41
1ewq_A 765 DNA mismatch repair protein MUTS; multiple domains 97.41
1wb9_A 800 DNA mismatch repair protein MUTS; DNA-binding, ATP 97.39
1n0w_A 243 DNA repair protein RAD51 homolog 1; DNA repair, ho 97.37
2w0m_A 235 SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus 97.37
2qt1_A207 Nicotinamide riboside kinase 1; non-protein kinase 97.36
2dy1_A665 Elongation factor G; translocation, GTP complex, s 97.35
1zu4_A 320 FTSY; GTPase, signal recognition particle, SRP, re 97.34
3tau_A 208 Guanylate kinase, GMP kinase; structural genomics, 97.3
3cr8_A552 Sulfate adenylyltranferase, adenylylsulfate kinase 97.28
2z4s_A440 Chromosomal replication initiator protein DNAA; AA 97.25
3tqc_A321 Pantothenate kinase; biosynthesis of cofactors, pr 97.24
2qt1_A207 Nicotinamide riboside kinase 1; non-protein kinase 97.23
2z43_A324 DNA repair and recombination protein RADA; archaea 97.23
3ney_A197 55 kDa erythrocyte membrane protein; structural ge 97.19
1fnn_A389 CDC6P, cell division control protein 6; ORC1, AAA 97.17
2cvh_A 220 DNA repair and recombination protein RADB; filamen 97.16
1kag_A173 SKI, shikimate kinase I; transferase, structural g 97.16
1f2t_A149 RAD50 ABC-ATPase; DNA double-strand break repair, 97.12
1lv7_A257 FTSH; alpha/beta domain, four helix bundle, hydrol 97.11
1odf_A 290 YGR205W, hypothetical 33.3 kDa protein in ADE3-Ser 97.09
2o5v_A 359 DNA replication and repair protein RECF; ABC ATPas 97.09
2gj8_A172 MNME, tRNA modification GTPase TRME; G-domain dime 97.09
1ega_A 301 Protein (GTP-binding protein ERA); GTPase, RNA-bin 97.07
3qf7_A 365 RAD50; ABC-ATPase, ATPase, hydrolase; HET: ANP; 1. 97.06
1oix_A191 RAS-related protein RAB-11A; small G protein, intr 97.05
3cf0_A301 Transitional endoplasmic reticulum ATPase; AAA, P9 97.03
3thx_B 918 DNA mismatch repair protein MSH3; ABC family ATPas 97.02
2f9l_A199 RAB11B, member RAS oncogene family; RAB11B GTPase, 97.02
2p67_A341 LAO/AO transport system kinase; ARGK, structural G 97.01
3kl4_A433 SRP54, signal recognition 54 kDa protein; signal r 96.97
1ixz_A 254 ATP-dependent metalloprotease FTSH; AAA domain fol 96.97
2qby_A386 CDC6 homolog 1, cell division control protein 6 ho 96.96
1iy2_A 278 ATP-dependent metalloprotease FTSH; AAA domain fol 96.95
2www_A349 Methylmalonic aciduria type A protein, mitochondri 96.92
1mky_A439 Probable GTP-binding protein ENGA; GTPase, DER, KH 96.85
3llm_A235 ATP-dependent RNA helicase A; alpha-beta-alpha, st 96.85
4ad8_A 517 DNA repair protein RECN; DNA binding protein, ATPa 96.85
1nlf_A 279 Regulatory protein REPA; replicative DNA helicase 96.84
1kag_A173 SKI, shikimate kinase I; transferase, structural g 96.84
2pez_A179 Bifunctional 3'-phosphoadenosine 5'- phosphosulfat 96.84
1u94_A356 RECA protein, recombinase A; homologous recombinat 96.83
4eaq_A229 DTMP kinase, thymidylate kinase; structural genomi 96.81
2gj8_A172 MNME, tRNA modification GTPase TRME; G-domain dime 96.8
1f6b_A198 SAR1; gtpases, N-terminal helix, Mg-containing com 96.8
1ypw_A806 Transitional endoplasmic reticulum ATPase; AAA, P9 96.79
4fcw_A311 Chaperone protein CLPB; AAA domain; HET: ADP; 2.35 96.79
3tqc_A 321 Pantothenate kinase; biosynthesis of cofactors, pr 96.78
1f2t_A149 RAD50 ABC-ATPase; DNA double-strand break repair, 96.78
1cke_A227 CK, MSSA, protein (cytidine monophosphate kinase); 96.77
3hr8_A 356 Protein RECA; alpha and beta proteins (A/B, A+B), 96.77
3thx_A 934 DNA mismatch repair protein MSH2; ABC family ATPas 96.76
3m6a_A543 ATP-dependent protease LA 1; alpha, beta, ATP-bind 96.75
1m2o_B190 GTP-binding protein SAR1, GTP binding protein; zin 96.73
2q6t_A444 DNAB replication FORK helicase; hydrolase; 2.90A { 96.72
1m2o_B190 GTP-binding protein SAR1, GTP binding protein; zin 96.72
1rz3_A201 Hypothetical protein rbstp0775; MCSG, structural g 96.71
3k1j_A 604 LON protease, ATP-dependent protease LON; ATP-bind 96.71
1m7g_A211 Adenylylsulfate kinase; APS kinase, transferase, s 96.67
3ec2_A180 DNA replication protein DNAC; helicase loader, rep 96.65
3cr8_A552 Sulfate adenylyltranferase, adenylylsulfate kinase 96.64
3ice_A 422 Transcription termination factor RHO; transcriptio 96.62
3lda_A 400 DNA repair protein RAD51; DNA binding protein, ATP 96.57
3qks_A203 DNA double-strand break repair RAD50 ATPase; RECA- 96.57
1f6b_A198 SAR1; gtpases, N-terminal helix, Mg-containing com 96.55
4eaq_A 229 DTMP kinase, thymidylate kinase; structural genomi 96.54
2qtf_A364 Protein HFLX, GTP-binding protein; beta-alpha-barr 96.51
1mky_A 439 Probable GTP-binding protein ENGA; GTPase, DER, KH 96.48
2qag_A361 Septin-2, protein NEDD5; cell cycle, cell division 96.47
1np6_A174 Molybdopterin-guanine dinucleotide biosynthesis pr 96.47
2qor_A204 Guanylate kinase; phosphotransferase, purine metab 96.46
2qor_A204 Guanylate kinase; phosphotransferase, purine metab 96.44
2o8b_B 1022 DNA mismatch repair protein MSH6; DNA damage respo 96.43
3bgw_A444 DNAB-like replicative helicase; ATPase, replicatio 96.42
1y63_A184 LMAJ004144AAA protein; structural genomics, protei 96.41
1l8q_A324 Chromosomal replication initiator protein DNAA; AA 96.37
3h4m_A285 Proteasome-activating nucleotidase; ATPase, PAN, A 96.36
2dr3_A 247 UPF0273 protein PH0284; RECA superfamily ATPase, h 96.3
2yvu_A186 Probable adenylyl-sulfate kinase; transferase, str 96.28
2wji_A165 Ferrous iron transport protein B homolog; membrane 96.26
2ffh_A425 Protein (FFH); SRP54, signal recognition particle, 96.26
2wjg_A188 FEOB, ferrous iron transport protein B homolog; me 96.26
3qks_A203 DNA double-strand break repair RAD50 ATPase; RECA- 96.25
2wji_A165 Ferrous iron transport protein B homolog; membrane 96.25
2qag_A 361 Septin-2, protein NEDD5; cell cycle, cell division 96.2
1w1w_A 430 Structural maintenance of chromosome 1; cohesin, c 96.19
3ice_A422 Transcription termination factor RHO; transcriptio 96.17
1jjv_A206 Dephospho-COA kinase; P-loop nucleotide-binding fo 96.16
2pez_A179 Bifunctional 3'-phosphoadenosine 5'- phosphosulfat 96.16
2ohf_A396 Protein OLA1, GTP-binding protein 9; ATPase, GTPas 96.11
3lxx_A239 GTPase IMAP family member 4; structural genomics c 96.09
3qkt_A 339 DNA double-strand break repair RAD50 ATPase; RECA- 96.08
2ga8_A359 Hypothetical 39.9 kDa protein; YFR007W, YFH7, unkn 96.07
2wjg_A188 FEOB, ferrous iron transport protein B homolog; me 96.07
2p67_A 341 LAO/AO transport system kinase; ARGK, structural G 96.06
1np6_A174 Molybdopterin-guanine dinucleotide biosynthesis pr 96.05
1cke_A 227 CK, MSSA, protein (cytidine monophosphate kinase); 96.03
1j8m_F297 SRP54, signal recognition 54 kDa protein; signalin 96.0
3m6a_A 543 ATP-dependent protease LA 1; alpha, beta, ATP-bind 95.99
2www_A 349 Methylmalonic aciduria type A protein, mitochondri 95.96
2p5t_B253 PEZT; postsegregational killing system, phosphoryl 95.95
2qz4_A262 Paraplegin; AAA+, SPG7, protease, ADP, structural 95.94
1sxj_E 354 Activator 1 40 kDa subunit; clamp loader, processi 95.91
2if2_A204 Dephospho-COA kinase; alpha-beta protein, structur 95.9
2b8t_A223 Thymidine kinase; deoxyribonucleoside kinase, zinc 95.88
3d8b_A357 Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, s 95.82
3cm0_A186 Adenylate kinase; ATP-binding, cytoplasm, nucleoti 95.82
1ega_A301 Protein (GTP-binding protein ERA); GTPase, RNA-bin 95.76
1qhx_A178 CPT, protein (chloramphenicol phosphotransferase); 95.74
3t61_A202 Gluconokinase; PSI-biology, structural genomics, p 95.74
3auy_A371 DNA double-strand break repair RAD50 ATPase; DNA r 95.72
1sxj_C340 Activator 1 40 kDa subunit; clamp loader, processi 95.64
2yvu_A186 Probable adenylyl-sulfate kinase; transferase, str 95.61
3kb2_A173 SPBC2 prophage-derived uncharacterized protein YOR 95.59
1ls1_A 295 Signal recognition particle protein; FFH, SRP54, S 95.58
1vma_A 306 Cell division protein FTSY; TM0570, structural gen 95.56
1m7g_A211 Adenylylsulfate kinase; APS kinase, transferase, s 95.52
3t61_A202 Gluconokinase; PSI-biology, structural genomics, p 95.5
2px0_A296 Flagellar biosynthesis protein FLHF; SRP GTPase, f 95.49
2ohf_A 396 Protein OLA1, GTP-binding protein 9; ATPase, GTPas 95.47
1y63_A184 LMAJ004144AAA protein; structural genomics, protei 95.46
3kb2_A173 SPBC2 prophage-derived uncharacterized protein YOR 95.45
3cmw_A 1706 Protein RECA, recombinase A; homologous recombinat 95.44
2rhm_A193 Putative kinase; P-loop containing nucleoside trip 95.44
1jjv_A 206 Dephospho-COA kinase; P-loop nucleotide-binding fo 95.39
2dhr_A 499 FTSH; AAA+ protein, hexameric Zn metalloprotease, 95.39
1qhx_A178 CPT, protein (chloramphenicol phosphotransferase); 95.37
1kht_A192 Adenylate kinase; phosphotransferase, signaling pr 95.36
2p5t_B 253 PEZT; postsegregational killing system, phosphoryl 95.35
2ga8_A 359 Hypothetical 39.9 kDa protein; YFR007W, YFH7, unkn 95.34
2v1u_A387 Cell division control protein 6 homolog; DNA repli 95.32
2zej_A184 Dardarin, leucine-rich repeat kinase 2; parkinson' 95.28
2zr9_A 349 Protein RECA, recombinase A; recombination, RECA m 95.27
1q57_A503 DNA primase/helicase; dntpase, DNA replication, tr 95.26
3r20_A233 Cytidylate kinase; structural genomics, seattle st 95.2
1q3t_A236 Cytidylate kinase; nucleotide monophosphate kinase 95.17
1ex7_A186 Guanylate kinase; substrate-induced FIT, domain mo 95.16
2v54_A204 DTMP kinase, thymidylate kinase; nucleotide biosyn 95.16
3trf_A185 Shikimate kinase, SK; amino acid biosynthesis, tra 95.13
2ze6_A253 Isopentenyl transferase; crown GALL tumor, cytokin 95.12
3r20_A 233 Cytidylate kinase; structural genomics, seattle st 95.1
2zej_A184 Dardarin, leucine-rich repeat kinase 2; parkinson' 95.08
3lw7_A179 Adenylate kinase related protein (ADKA-like); AMP, 95.08
2plr_A213 DTMP kinase, probable thymidylate kinase; TMP-bind 95.06
1ly1_A181 Polynucleotide kinase; PNK, phosphatase, transfera 95.0
2jaq_A205 Deoxyguanosine kinase; transferase, deoxyribonucle 94.99
1ex7_A186 Guanylate kinase; substrate-induced FIT, domain mo 94.97
2ze6_A 253 Isopentenyl transferase; crown GALL tumor, cytokin 94.95
3iij_A180 Coilin-interacting nuclear ATPase protein; alpha a 94.93
3t34_A 360 Dynamin-related protein 1A, linker, dynamin-relat 94.93
2if2_A 204 Dephospho-COA kinase; alpha-beta protein, structur 94.93
1xjc_A169 MOBB protein homolog; structural genomics, midwest 94.91
2r6a_A 454 DNAB helicase, replicative helicase; replication, 94.89
1via_A175 Shikimate kinase; structural genomics, transferase 94.86
3k53_A 271 Ferrous iron transport protein B; GTPase fold, hel 94.86
3hu3_A489 Transitional endoplasmic reticulum ATPase; VCP, tr 94.85
2wwf_A212 Thymidilate kinase, putative; transferase, malaria 94.82
1gvn_B287 Zeta; postsegregational killing system, plasmid; 1 94.81
2c95_A196 Adenylate kinase 1; transferase, AP4A, nucleotide 94.81
1vht_A218 Dephospho-COA kinase; structural genomics, transfe 94.78
3ihw_A184 Centg3; RAS, centaurin, GTPase, structural genomic 94.76
1gtv_A214 TMK, thymidylate kinase; transferase, transferase 94.76
2dy1_A 665 Elongation factor G; translocation, GTP complex, s 94.72
3cmw_A 1706 Protein RECA, recombinase A; homologous recombinat 94.7
1gtv_A 214 TMK, thymidylate kinase; transferase, transferase 94.67
1nn5_A215 Similar to deoxythymidylate kinase (thymidylate K; 94.64
1fzq_A181 ADP-ribosylation factor-like protein 3; protein-GD 94.63
2rhm_A193 Putative kinase; P-loop containing nucleoside trip 94.63
1tev_A196 UMP-CMP kinase; ploop, NMP binding region, LID reg 94.61
3iev_A 308 GTP-binding protein ERA; ERA, GTPase, KH domain, a 94.59
1aky_A220 Adenylate kinase; ATP:AMP phosphotransferase, myok 94.58
3ihw_A184 Centg3; RAS, centaurin, GTPase, structural genomic 94.57
2bwj_A199 Adenylate kinase 5; phosphoryl transfer reaction, 94.56
1nks_A194 Adenylate kinase; thermophilic, transferase; HET: 94.54
3cm0_A186 Adenylate kinase; ATP-binding, cytoplasm, nucleoti 94.54
1xx6_A191 Thymidine kinase; NESG, northeast structural genom 94.49
3lxx_A 239 GTPase IMAP family member 4; structural genomics c 94.48
1kht_A192 Adenylate kinase; phosphotransferase, signaling pr 94.47
3k53_A271 Ferrous iron transport protein B; GTPase fold, hel 94.43
1ko7_A314 HPR kinase/phosphatase; protein kinase, phosphotra 94.4
1uf9_A203 TT1252 protein; P-loop, nucleotide binding domain, 94.4
3lxw_A 247 GTPase IMAP family member 1; immunity, structural 94.39
1jal_A363 YCHF protein; nucleotide-binding fold, structural 94.32
2v54_A 204 DTMP kinase, thymidylate kinase; nucleotide biosyn 94.28
1xjc_A169 MOBB protein homolog; structural genomics, midwest 94.28
3q85_A169 GTP-binding protein REM 2; G-domain, CAV2 beta, si 94.25
1gvn_B 287 Zeta; postsegregational killing system, plasmid; 1 94.25
2jaq_A 205 Deoxyguanosine kinase; transferase, deoxyribonucle 94.22
3cbq_A195 GTP-binding protein REM 2; FLJ38964A, structural g 94.21
2h57_A190 ADP-ribosylation factor-like protein 6; GTP, GTPas 94.19
3trf_A185 Shikimate kinase, SK; amino acid biosynthesis, tra 94.17
>4f4c_A Multidrug resistance protein PGP-1; ABC transporter, ATPase, multi-drug transporter, exporter, A binding, hydrolase,protein transport; HET: NDG NAG BMA MAN 0SA; 3.40A {Caenorhabditis elegans} Back     alignment and structure
Probab=100.00  E-value=5.2e-53  Score=550.73  Aligned_cols=257  Identities=22%  Similarity=0.308  Sum_probs=198.9

Q ss_pred             HhHHHHHHHHHhhcccChHHHHHHHHHhhhhcCCCC--CceEEEEeeeEEEEEEecCCCCCCchHHHHHHHHHHHHhhhh
Q 001957           79 QERQRLIDKLVKVTDVDNERFLLKLKNRIDRVGIDL--PKVEVRYEHLNVEAEAFLASNALPSFIKFYTNIFEDILNYLR  156 (991)
Q Consensus        79 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~--p~~~v~f~~l~~~~~~~~~~~~~~t~~~~~~~~~~~~~~~~~  156 (991)
                      ++....++|+.++++..++     +.+ ....+...  ...+|+|+|+++.++.                          
T Consensus       380 ~~~~~s~~ri~~~l~~~~~-----~~~-~~~~~~~~~~~~g~I~~~nvsF~Y~~--------------------------  427 (1321)
T 4f4c_A          380 GTAQGAASGIYEVLDRKPV-----IDS-SSKAGRKDMKIKGDITVENVHFTYPS--------------------------  427 (1321)
T ss_dssp             HHHHHHHHHHHHHTTTSCC-----SSC-SSSCCCCCCCCCCCEEEEEEEECCSS--------------------------
T ss_pred             HHHHHHHHHHHHHHcCCcc-----ccc-cccccccCCCCCCcEEEEEeeeeCCC--------------------------
Confidence            4566677888777765443     111 11122222  2457999999998631                          


Q ss_pred             hcCCccccceeeeceEEEEeCCeEEEEEcCCCCcHHHHHHHHhcCcCCCCCeeeEEEECCeeCCCccc---cceEEEEec
Q 001957          157 IIPSKKRHLTILKDVSGVIKPGRLTLLLGPPSSGKTTLLLALAGKLDPTLKVSGTVTYNGHDMDEFVP---QRTAAYISQ  233 (991)
Q Consensus       157 ~~~~~~~~~~iL~~vs~~i~~Ge~~allGpsGsGKSTLL~~LaG~~~~~~~~~G~I~~nG~~~~~~~~---~~~~~yv~Q  233 (991)
                           ...+.+|+|||++|+||+++||+||||||||||+++|.|+++|+   +|+|++||+++++...   ++.++||+|
T Consensus       428 -----~~~~~vL~~isl~i~~G~~vaivG~sGsGKSTll~ll~~~~~~~---~G~I~idG~~i~~~~~~~lr~~i~~v~Q  499 (1321)
T 4f4c_A          428 -----RPDVPILRGMNLRVNAGQTVALVGSSGCGKSTIISLLLRYYDVL---KGKITIDGVDVRDINLEFLRKNVAVVSQ  499 (1321)
T ss_dssp             -----STTSCSEEEEEEEECTTCEEEEEECSSSCHHHHHHHHTTSSCCS---EEEEEETTEETTTSCHHHHHHHEEEECS
T ss_pred             -----CCCCceeeceEEeecCCcEEEEEecCCCcHHHHHHHhccccccc---cCcccCCCccchhccHHHHhhcccccCC
Confidence                 12346999999999999999999999999999999999999998   9999999999988764   467999999


Q ss_pred             CCCCCCCCCHHHHHHHHHHhcCCCchhhhhHHHHHHHHHcCCCCCCChHHHHHHHHhhhhhhhHHHHHHHHHcCCccccc
Q 001957          234 HDNHIGEMTVRETLAFSARCQGVGTRYEMLTELARREKAAGIKPDPDIDVYMKAIATEGQEANVITDYYLKVLGLDVCAD  313 (991)
Q Consensus       234 ~d~~~~~lTV~E~l~f~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~lgL~~~~d  313 (991)
                      ++. +++.||+|||.|+..    ...++.                     ..++....+.      +.  .+-.|++..|
T Consensus       500 ~~~-Lf~~TI~eNI~~g~~----~~~~~~---------------------v~~a~~~a~l------~~--~i~~lp~G~~  545 (1321)
T 4f4c_A          500 EPA-LFNCTIEENISLGKE----GITREE---------------------MVAACKMANA------EK--FIKTLPNGYN  545 (1321)
T ss_dssp             SCC-CCSEEHHHHHHTTCT----TCCHHH---------------------HHHHHHHTTC------HH--HHHHSTTTTS
T ss_pred             cce-eeCCchhHHHhhhcc----cchHHH---------------------HHHHHHHccc------hh--HHHcCCCCCc
Confidence            765 567899999999742    111111                     1111111110      11  1335789999


Q ss_pred             ccccCcccCCCChhHhHHHHHHHHHhcCCcEeEEeCCCCCCCHHHHHHHHHHHHHHhhccCceEEEEEecCCchhHhhcC
Q 001957          314 TMVGDEMIRGISGGQKKRVTTGEMMVGPALALFMDEISTGLDSSTTFQIVNCLRQNIHINSGTAVISLLQPAPETYDLFD  393 (991)
Q Consensus       314 t~vg~~~~~~LSGGqrqRvsia~~L~~~p~vLllDEPTsGLD~~t~~~i~~~L~~l~~~~~~t~ii~i~q~~~~~~~lfD  393 (991)
                      |.||++. ..||||||||++||||++++|+||+||||||+||+.+...|.++|+++.  .++|+|+..|+.  .+...||
T Consensus       546 T~vGe~G-~~LSGGQkQRiaiARAl~~~~~IliLDE~tSaLD~~te~~i~~~l~~~~--~~~T~iiiaHrl--s~i~~aD  620 (1321)
T 4f4c_A          546 TLVGDRG-TQLSGGQKQRIAIARALVRNPKILLLDEATSALDAESEGIVQQALDKAA--KGRTTIIIAHRL--STIRNAD  620 (1321)
T ss_dssp             SEESSSS-CCCCHHHHHHHHHHHHHTTCCSEEEEESTTTTSCTTTHHHHHHHHHHHH--TTSEEEEECSCT--TTTTTCS
T ss_pred             cEecCCC-CCCCHHHHHHHHHHHHHccCCCEEEEecccccCCHHHHHHHHHHHHHHh--CCCEEEEEcccH--HHHHhCC
Confidence            9999765 4699999999999999999999999999999999999999999999875  467887766554  5778999


Q ss_pred             eEEEecCCeEEEecCHHHHHH
Q 001957          394 DIILLSDGQIVYQGPRELVLE  414 (991)
Q Consensus       394 ~vilL~~G~iv~~G~~~~~~~  414 (991)
                      +|++|++|+|+++|+++++++
T Consensus       621 ~Iivl~~G~ive~Gth~eL~~  641 (1321)
T 4f4c_A          621 LIISCKNGQVVEVGDHRALMA  641 (1321)
T ss_dssp             EEEEEETTEEEEEECHHHHHT
T ss_pred             EEEEeeCCeeeccCCHHHHHH
Confidence            999999999999999999974



>3g5u_A MCG1178, multidrug resistance protein 1A; P-glycoprotein, PGP, cyclic peptide, membrane protein; 3.80A {Mus musculus} PDB: 3g61_A* 3g60_A* Back     alignment and structure
>3tui_C Methionine import ATP-binding protein METN; ABC-transporter, type I ABC type importer, methionine uptake transporter, membrane protein; HET: ADP; 2.90A {Escherichia coli} PDB: 3tuj_C 3tuz_C* 3dhw_C Back     alignment and structure
>3fvq_A Fe(3+) IONS import ATP-binding protein FBPC; nucleotide binding domain, ABC motor domain, ferric iron TRA ATP-binding, cell inner membrane; HET: ATP; 1.90A {Neisseria gonorrhoeae} Back     alignment and structure
>3rlf_A Maltose/maltodextrin import ATP-binding protein M; integral membrane protein, ATPase, ABC transporter, membrane transmembrane; HET: UMQ MAL PGV ANP; 2.20A {Escherichia coli} PDB: 1q1e_A 1q12_A* 2awo_A* 3fh6_A 3puv_A* 3puw_A* 3pux_A* 3puy_A* 3puz_A* 3pv0_A* 2awn_A* 2r6g_A* 1q1b_A Back     alignment and structure
>3tif_A Uncharacterized ABC transporter ATP-binding prote; nucleotide-binding domain, ABC transporter ATPase; HET: ADP; 1.80A {Methanocaldococcus jannaschii dsm 2661ORGANISM_TAXID} PDB: 1l2t_A* 1f3o_A* Back     alignment and structure
>2yyz_A Sugar ABC transporter, ATP-binding protein; sugar transport, alpha and beta proteins (A/B) TM0421, structural genomics, NPPSFA; 2.11A {Thermotoga maritima} Back     alignment and structure
>3gfo_A Cobalt import ATP-binding protein CBIO 1; structural genomics, cell membrane, cobalt transport, hydrolase, ION transport; 2.30A {Clostridium perfringens atcc 13124} Back     alignment and structure
>4g1u_C Hemin import ATP-binding protein HMUV; membrane transporter, type II ABC importer, HMUT, plasma MEM transport protein-hydrolase complex; 3.01A {Yersinia pestis} Back     alignment and structure
>2pcj_A ABC transporter, lipoprotein-releasing system ATP-binding protein; structural genomics; 1.70A {Aquifex aeolicus} PDB: 2pcl_A Back     alignment and structure
>2it1_A 362AA long hypothetical maltose/maltodextrin transport ATP-binding protein; structural genomics, NPPSFA; 1.94A {Pyrococcus horikoshii} Back     alignment and structure
>2olj_A Amino acid ABC transporter; ABC domain, ATPase, hydrolase; HET: ADP; 2.05A {Geobacillus stearothermophilus} PDB: 2olk_A* 2ouk_A 2q0h_A* 3c4j_A* 3c41_J* Back     alignment and structure
>1g29_1 MALK, maltose transport protein MALK; ATPase, active transport, maltose uptake and regulation, sugar binding protein; 1.90A {Thermococcus litoralis} SCOP: b.40.6.3 b.40.6.3 c.37.1.12 PDB: 2d62_A Back     alignment and structure
>1v43_A Sugar-binding transport ATP-binding protein; ATPase, active transport, sugar uptake and regulation, transport protein; 2.20A {Pyrococcus horikoshii} SCOP: b.40.6.3 b.40.6.3 c.37.1.12 PDB: 1vci_A* Back     alignment and structure
>1b0u_A Histidine permease; ABC transporter, transport protein; HET: ATP; 1.50A {Salmonella typhimurium} SCOP: c.37.1.12 Back     alignment and structure
>1oxx_K GLCV, glucose, ABC transporter, ATP binding protein; ABC-ATPase, ATP-binding cassette, ATPase, transport protein; 1.45A {Sulfolobus solfataricus} SCOP: b.40.6.3 c.37.1.12 PDB: 1oxs_C 1oxt_A 1oxu_A* 1oxv_A* Back     alignment and structure
>1z47_A CYSA, putative ABC-transporter ATP-binding protein; alpha/beta motif, beta sandwich, ligand binding protein; 1.90A {Alicyclobacillus acidocaldarius} Back     alignment and structure
>3d31_A Sulfate/molybdate ABC transporter, ATP-binding protein; ATP-binding, nucleotide-binding, membrane, transmembrane, transport protein; 3.00A {Methanosarcina acetivorans} SCOP: b.40.6.3 c.37.1.12 Back     alignment and structure
>3nh6_A ATP-binding cassette SUB-family B member 6, mitoc; ABC-transporter, ABCB6, nucleotide binding domain, heme BIOS transport protein; 2.00A {Homo sapiens} PDB: 3nh9_A* 3nha_A* 3nhb_A* Back     alignment and structure
>1g6h_A High-affinity branched-chain amino acid transport ATP-binding protein; beta-core domain; HET: ADP; 1.60A {Methanocaldococcus jannaschii} SCOP: c.37.1.12 PDB: 1gaj_A 1g9x_A* Back     alignment and structure
>1vpl_A ABC transporter, ATP-binding protein; TM0544, structural GENO joint center for structural genomics, JCSG, protein structu initiative, PSI; 2.10A {Thermotoga maritima} SCOP: c.37.1.12 Back     alignment and structure
>1ji0_A ABC transporter; ATP binding protein, structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; HET: ATP; 2.00A {Thermotoga maritima} SCOP: c.37.1.12 Back     alignment and structure
>2onk_A Molybdate/tungstate ABC transporter, ATP-binding protein; membrane protein; 3.10A {Archaeoglobus fulgidus} SCOP: c.37.1.12 Back     alignment and structure
>2yz2_A Putative ABC transporter ATP-binding protein TM_0; cobalt transport, TM02 hydrolase, inner membrane, membrane, nucleotide-binding; 2.30A {Thermotoga maritima} Back     alignment and structure
>2ihy_A ABC transporter, ATP-binding protein; ATPase, ABC cassette, hydrolase; HET: MSE; 1.90A {Staphylococcus aureus} Back     alignment and structure
>2ff7_A Alpha-hemolysin translocation ATP-binding protein HLYB; ABC-transporter, transport protein; HET: ADP; 1.60A {Escherichia coli} SCOP: c.37.1.12 PDB: 2ffb_A* 2fgk_A* 2ffa_A* 2fgj_A* 2pmk_A* 3b5j_A* 1mt0_A 1xef_A* Back     alignment and structure
>2d2e_A SUFC protein; ABC-ATPase, SUF protein, 310-helix, riken structural genomics/proteomics initiative, RSGI, structural genomics, binding; 1.70A {Thermus thermophilus} PDB: 2d2f_A* Back     alignment and structure
>2ixe_A Antigen peptide transporter 1; ABC ATPase, hydrolase; HET: ATP; 2.0A {Rattus norvegicus} PDB: 2ixg_A* 2ixf_A* 1jj7_A* Back     alignment and structure
>2zu0_C Probable ATP-dependent transporter SUFC; iron-sulfur cluster, ABC-ATPase, ATP-binding, cytoplasm, nucleotide-binding; HET: MES; 2.20A {Escherichia coli} PDB: 2d3w_A Back     alignment and structure
>2nq2_C Hypothetical ABC transporter ATP-binding protein HI1470; putative iron chelatin ABC transporter, nucleotide binding domain; 2.40A {Haemophilus influenzae} Back     alignment and structure
>2pjz_A Hypothetical protein ST1066; ATP binding protein, structural genomics, NPPSFA; 1.90A {Sulfolobus tokodaii} Back     alignment and structure
>4a82_A Cystic fibrosis transmembrane conductance regulat; CFTR, ION channel, transport protein, casse protein; 2.00A {Homo sapiens} PDB: 2onj_A* 2hyd_A Back     alignment and structure
>1mv5_A LMRA, multidrug resistance ABC transporter ATP-binding and permease protein; asymmetric dimer, tetramer, P-glycoprotein; HET: ATP ADP; 3.10A {Lactococcus lactis} SCOP: c.37.1.12 Back     alignment and structure
>2ghi_A Transport protein; multidrug resistance protein, MDR, structural genomics, structural genomics consortium, SGC; 2.20A {Plasmodium yoelii yoelii str} Back     alignment and structure
>2qi9_C Vitamin B12 import ATP-binding protein BTUD; inner membrane, membrane, transmembrane, transport, ATP- binding, hydrolase, nucleotide-binding, periplasm; HET: 1PE; 2.60A {Escherichia coli} PDB: 1l7v_C* 4dbl_C Back     alignment and structure
>3qf4_A ABC transporter, ATP-binding protein; multidrug transporter, transport protein; HET: ANP; 2.90A {Thermotoga maritima} Back     alignment and structure
>3gd7_A Fusion complex of cystic fibrosis transmembrane conductance regulator, residues 1193-1427...; CFTR, ABC transporter, nucleotide binding domain, NBD; HET: B44; 2.70A {Homo sapiens} Back     alignment and structure
>3b5x_A Lipid A export ATP-binding/permease protein MSBA; ABC transporter, lipid flippase, hydrolase, inner membrane, lipid transport, membrane; 5.50A {Vibrio cholerae} Back     alignment and structure
>3b60_A Lipid A export ATP-binding/permease protein MSBA; ABC transporter, lipid flippase, hydrolase, inner membrane, lipid transport, membrane; HET: ANP; 3.70A {Salmonella typhimurium} SCOP: c.37.1.12 f.37.1.1 PDB: 3b5y_A* 3b5z_A* 3b5w_A Back     alignment and structure
>1sgw_A Putative ABC transporter; structural genomics, P protein structure initiative, southeast collaboratory for S genomics, secsg; 1.70A {Pyrococcus furiosus} SCOP: c.37.1.12 Back     alignment and structure
>2cbz_A Multidrug resistance-associated protein 1; ABC proteins, MRP1/ABCC1, nucleotide-binding domain, ATP- binding, hydrolysis, transport; HET: ATP; 1.5A {Homo sapiens} Back     alignment and structure
>3qf4_B Uncharacterized ABC transporter ATP-binding prote TM_0288; multidrug transporter, transport protein; HET: ANP; 2.90A {Thermotoga maritima} Back     alignment and structure
>2pze_A Cystic fibrosis transmembrane conductance regulat; NBD, ABC transporter, CFTR, hydrolase; HET: ATP; 1.70A {Homo sapiens} PDB: 2pzg_A* 2pzf_A* 1ckx_A 1cky_A 1ckw_A 1ckz_A Back     alignment and structure
>4f4c_A Multidrug resistance protein PGP-1; ABC transporter, ATPase, multi-drug transporter, exporter, A binding, hydrolase,protein transport; HET: NDG NAG BMA MAN 0SA; 3.40A {Caenorhabditis elegans} Back     alignment and structure
>2bbs_A Cystic fibrosis transmembrane conductance regulator; ATP binding cassette, transport protein; HET: ATP; 2.05A {Homo sapiens} PDB: 2bbt_A* 1xmi_A* 1xmj_A* 2bbo_A* 3si7_A* 1r0w_A 1q3h_A 1r0x_A* 1r0y_A* 1r0z_A* 1r10_A* 1xf9_A* 1xfa_A* Back     alignment and structure
>3g5u_A MCG1178, multidrug resistance protein 1A; P-glycoprotein, PGP, cyclic peptide, membrane protein; 3.80A {Mus musculus} PDB: 3g61_A* 3g60_A* Back     alignment and structure
>3bk7_A ABC transporter ATP-binding protein; ABC ATPase, iron-sulfur cluster, adenosine diphosphate, nucleotide-binding; HET: ADP; 2.80A {Pyrococcus abyssi} PDB: 3j15_B* Back     alignment and structure
>1yqt_A RNAse L inhibitor; ATP-binding cassette, ribosome biogenesis, hydrolyase/translation complex; HET: ADP; 1.90A {Pyrococcus furiosus} Back     alignment and structure
>3ozx_A RNAse L inhibitor; ATP binding cassette protein, hydrolase, translation; HET: ADP; 2.05A {Sulfolobus solfataricus} Back     alignment and structure
>3j16_B RLI1P; ribosome recycling, translation, eukarya, ribosome; HET: ATP; 7.20A {Saccharomyces cerevisiae} Back     alignment and structure
>3ux8_A Excinuclease ABC, A subunit; UVRA, nucleotide excision repair, DNA repair, ABC ATPase, DN binding protein; HET: ADP; 2.10A {Geobacillus} Back     alignment and structure
>2iw3_A Elongation factor 3A; acetylation, ATP-binding, protein biosynthesis, nucleotide-binding, phosphorylation, RNA- binding, rRNA-binding; HET: ADP; 2.4A {Saccharomyces cerevisiae} PDB: 2iwh_A* 2ix3_A 2ix8_A Back     alignment and structure
>1yqt_A RNAse L inhibitor; ATP-binding cassette, ribosome biogenesis, hydrolyase/translation complex; HET: ADP; 1.90A {Pyrococcus furiosus} Back     alignment and structure
>3bk7_A ABC transporter ATP-binding protein; ABC ATPase, iron-sulfur cluster, adenosine diphosphate, nucleotide-binding; HET: ADP; 2.80A {Pyrococcus abyssi} PDB: 3j15_B* Back     alignment and structure
>2iw3_A Elongation factor 3A; acetylation, ATP-binding, protein biosynthesis, nucleotide-binding, phosphorylation, RNA- binding, rRNA-binding; HET: ADP; 2.4A {Saccharomyces cerevisiae} PDB: 2iwh_A* 2ix3_A 2ix8_A Back     alignment and structure
>3ux8_A Excinuclease ABC, A subunit; UVRA, nucleotide excision repair, DNA repair, ABC ATPase, DN binding protein; HET: ADP; 2.10A {Geobacillus} Back     alignment and structure
>3ozx_A RNAse L inhibitor; ATP binding cassette protein, hydrolase, translation; HET: ADP; 2.05A {Sulfolobus solfataricus} Back     alignment and structure
>3j16_B RLI1P; ribosome recycling, translation, eukarya, ribosome; HET: ATP; 7.20A {Saccharomyces cerevisiae} Back     alignment and structure
>3pih_A Uvrabc system protein A; hydrolase, ABC ATPase, DNA repair, nucleotide excision repai hydrolase-DNA complex; HET: DNA; 2.90A {Thermotoga maritima} Back     alignment and structure
>2r6f_A Excinuclease ABC subunit A; UVRA, nucleotide excision repair, DNA repair, ABC ATPase, at cassette, DNA damage, DNA excision; HET: ADP; 3.20A {Geobacillus stearothermophilus} PDB: 3uwx_A Back     alignment and structure
>2vf7_A UVRA2, excinuclease ABC, subunit A.; DNA-binding protein, nucleotide-binding, zinc-binding domain, SOS response, metal-binding; HET: ADP; 2.30A {Deinococcus radiodurans} PDB: 2vf8_A* Back     alignment and structure
>2npi_A Protein CLP1; CLP1-PCF11 complex, ATP binding, ternary complex, transcript; HET: ATP; 2.95A {Saccharomyces cerevisiae} Back     alignment and structure
>4aby_A DNA repair protein RECN; hydrolase, double strand break repair, ATPase, nucleotide binding domain; HET: DNA; 3.00A {Deinococcus radiodurans} Back     alignment and structure
>3qf7_A RAD50; ABC-ATPase, ATPase, hydrolase; HET: ANP; 1.90A {Thermotoga maritima} PDB: 3qg5_A 3tho_A* Back     alignment and structure
>3b85_A Phosphate starvation-inducible protein; PHOH2, ATPase, PFAM: PF02562, ST genomics, PSI-2, protein structure initiative; 2.35A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>1e69_A Chromosome segregation SMC protein; structural maintenance of chromosomes, coiled coil; 3.1A {Thermotoga maritima} SCOP: c.37.1.12 Back     alignment and structure
>1tq4_A IIGP1, interferon-inducible GTPase; interferon gamma, dimer, immunology, signaling protein; HET: GDP; 1.95A {Mus musculus} SCOP: c.37.1.8 PDB: 1tqd_A* 1tq6_A* 1tpz_A* 1tq2_A* Back     alignment and structure
>1ye8_A Protein THEP1, hypothetical UPF0334 kinase-like protein AQ_1292; mixed alpha-beta protein, rossman fold, signaling protein, transferase; 1.40A {Aquifex aeolicus} SCOP: c.37.1.11 Back     alignment and structure
>2v9p_A Replication protein E1; AAA+ molecular motor, DNA replication, DNA translocation, nucleotide-binding, DNA-binding; 3.00A {Bovine papillomavirus type 1} PDB: 2gxa_A* Back     alignment and structure
>4gp7_A Metallophosphoesterase; polynucleotide kinase phosphatase, RNA repair, transferase; HET: ATP CIT; 2.00A {Clostridium thermocellum} PDB: 4gp6_A* Back     alignment and structure
>3b9q_A Chloroplast SRP receptor homolog, alpha subunit CPFTSY; protein translocation, GTP-binding, nucleotide-binding, protein transport; 1.75A {Arabidopsis thaliana} Back     alignment and structure
>2o5v_A DNA replication and repair protein RECF; ABC ATPase, walker A motif, P-loop, signature motif, replication/recombination complex; HET: DNA; 1.61A {Deinococcus radiodurans} Back     alignment and structure
>3sop_A Neuronal-specific septin-3; hydrolase; HET: GDP; 2.88A {Homo sapiens} Back     alignment and structure
>2dpy_A FLII, flagellum-specific ATP synthase; beta barrel, alpha-beta structure, hydrolase; HET: ADP; 2.40A {Salmonella typhimurium} Back     alignment and structure
>2og2_A Putative signal recognition particle receptor; nucleotide-binding, protein transport; 2.00A {Arabidopsis thaliana} Back     alignment and structure
>1znw_A Guanylate kinase, GMP kinase; ATP:GMP-phosphotransferase, TR; 2.10A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1znx_A* 1zny_A* 1znz_A* 1s4q_A 1z8f_A Back     alignment and structure
>1z6g_A Guanylate kinase; structural genomics, SGC, structural genom consortium, transferase; HET: EPE; 2.18A {Plasmodium falciparum} Back     alignment and structure
>2pt7_A CAG-ALFA; ATPase, protein-protein complex, type IV secretion, hydrolas binding complex; 2.40A {Helicobacter pylori} SCOP: c.37.1.11 PDB: 1nly_A* 1nlz_A 1opx_A* 1g6o_A Back     alignment and structure
>3qkt_A DNA double-strand break repair RAD50 ATPase; RECA-like fold, coiled-coils, ATP binding, DNA bindi MRE11, replication; HET: DNA ANP; 1.90A {Pyrococcus furiosus} PDB: 3qku_A* 1ii8_A 3qks_B* 3qkr_B* 1ii8_B Back     alignment and structure
>1cr0_A DNA primase/helicase; RECA-type protein fold, transferase; HET: DNA; 2.30A {Enterobacteria phage T7} SCOP: c.37.1.11 PDB: 1cr1_A* 1cr2_A* 1cr4_A* 1e0j_A* 1e0k_A* Back     alignment and structure
>3aez_A Pantothenate kinase; transferase, homodimer, COA biosynthesis, nucleotide binding binding, cytoplasm, nucleotide-binding; HET: GDP PAZ; 2.20A {Mycobacterium tuberculosis} PDB: 2ges_A* 2geu_A* 2gev_A* 2zs7_A* 2zs8_A* 2zs9_A* 2zsa_A* 2zsb_A* 2zsd_A* 2zse_A* 2zsf_A* 2get_A* 3af0_A* 3af1_A* 3af2_A* 3af3_A* 3af4_A* 3avp_A* 3avo_A* 3avq_A* Back     alignment and structure
>4ad8_A DNA repair protein RECN; DNA binding protein, ATPase domain; HET: DNA; 4.00A {Deinococcus radiodurans} Back     alignment and structure
>2jeo_A Uridine-cytidine kinase 1; UCK, transferase, ATP-binding, nucleoside kinase, nucleotide-binding; 2.50A {Homo sapiens} PDB: 2uvq_A* Back     alignment and structure
>3tif_A Uncharacterized ABC transporter ATP-binding prote; nucleotide-binding domain, ABC transporter ATPase; HET: ADP; 1.80A {Methanocaldococcus jannaschii dsm 2661ORGANISM_TAXID} PDB: 1l2t_A* 1f3o_A* Back     alignment and structure
>3pih_A Uvrabc system protein A; hydrolase, ABC ATPase, DNA repair, nucleotide excision repai hydrolase-DNA complex; HET: DNA; 2.90A {Thermotoga maritima} Back     alignment and structure
>3thx_A DNA mismatch repair protein MSH2; ABC family ATPase, mismatch recognition, mismatched unpaired DNA binding protein-DNA complex; HET: DNA ADP; 2.70A {Homo sapiens} PDB: 2o8c_A* 2o8d_A* 2o8f_A* 3thw_A* 2o8b_A* 3thy_A* 3thz_A* 2o8e_A* Back     alignment and structure
>3fvq_A Fe(3+) IONS import ATP-binding protein FBPC; nucleotide binding domain, ABC motor domain, ferric iron TRA ATP-binding, cell inner membrane; HET: ATP; 1.90A {Neisseria gonorrhoeae} Back     alignment and structure
>3rlf_A Maltose/maltodextrin import ATP-binding protein M; integral membrane protein, ATPase, ABC transporter, membrane transmembrane; HET: UMQ MAL PGV ANP; 2.20A {Escherichia coli} PDB: 1q1e_A 1q12_A* 2awo_A* 3fh6_A 3puv_A* 3puw_A* 3pux_A* 3puy_A* 3puz_A* 3pv0_A* 2awn_A* 2r6g_A* 1q1b_A Back     alignment and structure
>1tf7_A KAIC; homohexamer, hexamer, circadian clock protein; HET: ATP; 2.80A {Synechococcus SP} SCOP: c.37.1.11 c.37.1.11 PDB: 3s1a_A* 1u9i_A* 2gbl_A* 3dvl_A* 3k0a_A* 3k09_A* 3jzm_A* 3k0e_A* 4dug_A* 3ua2_A* 3k0c_A* 3k0f_A* Back     alignment and structure
>3tui_C Methionine import ATP-binding protein METN; ABC-transporter, type I ABC type importer, methionine uptake transporter, membrane protein; HET: ADP; 2.90A {Escherichia coli} PDB: 3tuj_C 3tuz_C* 3dhw_C Back     alignment and structure
>1b0u_A Histidine permease; ABC transporter, transport protein; HET: ATP; 1.50A {Salmonella typhimurium} SCOP: c.37.1.12 Back     alignment and structure
>2obl_A ESCN; ATPase, hydrolase; 1.80A {Escherichia coli O127} PDB: 2obm_A* Back     alignment and structure
>2pcj_A ABC transporter, lipoprotein-releasing system ATP-binding protein; structural genomics; 1.70A {Aquifex aeolicus} PDB: 2pcl_A Back     alignment and structure
>1sgw_A Putative ABC transporter; structural genomics, P protein structure initiative, southeast collaboratory for S genomics, secsg; 1.70A {Pyrococcus furiosus} SCOP: c.37.1.12 Back     alignment and structure
>2olj_A Amino acid ABC transporter; ABC domain, ATPase, hydrolase; HET: ADP; 2.05A {Geobacillus stearothermophilus} PDB: 2olk_A* 2ouk_A 2q0h_A* 3c4j_A* 3c41_J* Back     alignment and structure
>1vpl_A ABC transporter, ATP-binding protein; TM0544, structural GENO joint center for structural genomics, JCSG, protein structu initiative, PSI; 2.10A {Thermotoga maritima} SCOP: c.37.1.12 Back     alignment and structure
>2yyz_A Sugar ABC transporter, ATP-binding protein; sugar transport, alpha and beta proteins (A/B) TM0421, structural genomics, NPPSFA; 2.11A {Thermotoga maritima} Back     alignment and structure
>1g29_1 MALK, maltose transport protein MALK; ATPase, active transport, maltose uptake and regulation, sugar binding protein; 1.90A {Thermococcus litoralis} SCOP: b.40.6.3 b.40.6.3 c.37.1.12 PDB: 2d62_A Back     alignment and structure
>2it1_A 362AA long hypothetical maltose/maltodextrin transport ATP-binding protein; structural genomics, NPPSFA; 1.94A {Pyrococcus horikoshii} Back     alignment and structure
>1oxx_K GLCV, glucose, ABC transporter, ATP binding protein; ABC-ATPase, ATP-binding cassette, ATPase, transport protein; 1.45A {Sulfolobus solfataricus} SCOP: b.40.6.3 c.37.1.12 PDB: 1oxs_C 1oxt_A 1oxu_A* 1oxv_A* Back     alignment and structure
>1z47_A CYSA, putative ABC-transporter ATP-binding protein; alpha/beta motif, beta sandwich, ligand binding protein; 1.90A {Alicyclobacillus acidocaldarius} Back     alignment and structure
>2r6f_A Excinuclease ABC subunit A; UVRA, nucleotide excision repair, DNA repair, ABC ATPase, at cassette, DNA damage, DNA excision; HET: ADP; 3.20A {Geobacillus stearothermophilus} PDB: 3uwx_A Back     alignment and structure
>1ji0_A ABC transporter; ATP binding protein, structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; HET: ATP; 2.00A {Thermotoga maritima} SCOP: c.37.1.12 Back     alignment and structure
>1v43_A Sugar-binding transport ATP-binding protein; ATPase, active transport, sugar uptake and regulation, transport protein; 2.20A {Pyrococcus horikoshii} SCOP: b.40.6.3 b.40.6.3 c.37.1.12 PDB: 1vci_A* Back     alignment and structure
>4a74_A DNA repair and recombination protein RADA; hydrolase, recombinase; HET: DNA ANP; 1.48A {Pyrococcus furiosus} PDB: 4a6x_A* 4a6p_A* 4a7o_A* Back     alignment and structure
>3gfo_A Cobalt import ATP-binding protein CBIO 1; structural genomics, cell membrane, cobalt transport, hydrolase, ION transport; 2.30A {Clostridium perfringens atcc 13124} Back     alignment and structure
>4g1u_C Hemin import ATP-binding protein HMUV; membrane transporter, type II ABC importer, HMUT, plasma MEM transport protein-hydrolase complex; 3.01A {Yersinia pestis} Back     alignment and structure
>2yz2_A Putative ABC transporter ATP-binding protein TM_0; cobalt transport, TM02 hydrolase, inner membrane, membrane, nucleotide-binding; 2.30A {Thermotoga maritima} Back     alignment and structure
>1g6h_A High-affinity branched-chain amino acid transport ATP-binding protein; beta-core domain; HET: ADP; 1.60A {Methanocaldococcus jannaschii} SCOP: c.37.1.12 PDB: 1gaj_A 1g9x_A* Back     alignment and structure
>1tf7_A KAIC; homohexamer, hexamer, circadian clock protein; HET: ATP; 2.80A {Synechococcus SP} SCOP: c.37.1.11 c.37.1.11 PDB: 3s1a_A* 1u9i_A* 2gbl_A* 3dvl_A* 3k0a_A* 3k09_A* 3jzm_A* 3k0e_A* 4dug_A* 3ua2_A* 3k0c_A* 3k0f_A* Back     alignment and structure
>3nh6_A ATP-binding cassette SUB-family B member 6, mitoc; ABC-transporter, ABCB6, nucleotide binding domain, heme BIOS transport protein; 2.00A {Homo sapiens} PDB: 3nh9_A* 3nha_A* 3nhb_A* Back     alignment and structure
>2vf7_A UVRA2, excinuclease ABC, subunit A.; DNA-binding protein, nucleotide-binding, zinc-binding domain, SOS response, metal-binding; HET: ADP; 2.30A {Deinococcus radiodurans} PDB: 2vf8_A* Back     alignment and structure
>1f2t_B RAD50 ABC-ATPase; DNA double-strand break repair, replication; 1.60A {Pyrococcus furiosus} SCOP: c.37.1.12 PDB: 1f2u_B* 1us8_B* Back     alignment and structure
>3d31_A Sulfate/molybdate ABC transporter, ATP-binding protein; ATP-binding, nucleotide-binding, membrane, transmembrane, transport protein; 3.00A {Methanosarcina acetivorans} SCOP: b.40.6.3 c.37.1.12 Back     alignment and structure
>2i3b_A HCR-ntpase, human cancer-related ntpase; AAA, rossmann, hydrolase; NMR {Homo sapiens} SCOP: c.37.1.11 Back     alignment and structure
>2eyu_A Twitching motility protein PILT; pilus retraction motor, C-terminal domain PILT, protein transport; 1.87A {Aquifex aeolicus} Back     alignment and structure
>3thx_B DNA mismatch repair protein MSH3; ABC family ATPase, mismatch recognition, mismatched unpaired DNA binding protein-DNA complex; HET: DNA ADP; 2.70A {Homo sapiens} PDB: 3thw_B* 3thy_B* 3thz_B* Back     alignment and structure
>2qnr_A Septin-2, protein NEDD5; structural genomics consortium, SGC, mitosis, GDP, C cycle, cell division, GTP-binding, nucleotide-binding; HET: GDP; 2.60A {Homo sapiens} PDB: 2qa5_A* 3ftq_A* Back     alignment and structure
>1w1w_A Structural maintenance of chromosome 1; cohesin, chromosome segregation, cell adhesion, kleisin, MIT cell cycle; HET: ATG; 2.90A {Saccharomyces cerevisiae} SCOP: c.37.1.12 Back     alignment and structure
>2ihy_A ABC transporter, ATP-binding protein; ATPase, ABC cassette, hydrolase; HET: MSE; 1.90A {Staphylococcus aureus} Back     alignment and structure
>2o8b_B DNA mismatch repair protein MSH6; DNA damage response, somatic hypermutat protein-DNA complex, DNA mispair, cancer; HET: DNA ADP; 2.75A {Homo sapiens} PDB: 2o8c_B* 2o8d_B* 2o8e_B* 2o8f_B* Back     alignment and structure
>2d2e_A SUFC protein; ABC-ATPase, SUF protein, 310-helix, riken structural genomics/proteomics initiative, RSGI, structural genomics, binding; 1.70A {Thermus thermophilus} PDB: 2d2f_A* Back     alignment and structure
>3asz_A Uridine kinase; cytidine phosphorylation, transferase; HET: C5P; 2.25A {Thermus thermophilus} PDB: 3asy_A* Back     alignment and structure
>2ixe_A Antigen peptide transporter 1; ABC ATPase, hydrolase; HET: ATP; 2.0A {Rattus norvegicus} PDB: 2ixg_A* 2ixf_A* 1jj7_A* Back     alignment and structure
>2ff7_A Alpha-hemolysin translocation ATP-binding protein HLYB; ABC-transporter, transport protein; HET: ADP; 1.60A {Escherichia coli} SCOP: c.37.1.12 PDB: 2ffb_A* 2fgk_A* 2ffa_A* 2fgj_A* 2pmk_A* 3b5j_A* 1mt0_A 1xef_A* Back     alignment and structure
>3szr_A Interferon-induced GTP-binding protein MX1; interferon-induced antiviral GTPase, membrane associated, PR binding; 3.50A {Homo sapiens} PDB: 3zys_B Back     alignment and structure
>1pzn_A RAD51, DNA repair and recombination protein RAD51, RADA; heptameric ring, heptamer, ring, oligomer, RAD51 polymerizat motif; HET: DNA; 2.85A {Pyrococcus furiosus} SCOP: a.60.4.1 c.37.1.11 Back     alignment and structure
>1rj9_A FTSY, signal recognition protein; SRP-GTPase domain, heterodimer, nucleotide twinning, protein complex, protein transport; HET: GCP; 1.90A {Thermus aquaticus} SCOP: a.24.13.1 c.37.1.10 PDB: 2q9c_A* 2q9b_A* 2q9a_A* 1okk_D* 2xkv_D 2iyl_D* 2cnw_D* 2j7p_D* Back     alignment and structure
>1mv5_A LMRA, multidrug resistance ABC transporter ATP-binding and permease protein; asymmetric dimer, tetramer, P-glycoprotein; HET: ATP ADP; 3.10A {Lactococcus lactis} SCOP: c.37.1.12 Back     alignment and structure
>2zu0_C Probable ATP-dependent transporter SUFC; iron-sulfur cluster, ABC-ATPase, ATP-binding, cytoplasm, nucleotide-binding; HET: MES; 2.20A {Escherichia coli} PDB: 2d3w_A Back     alignment and structure
>2onk_A Molybdate/tungstate ABC transporter, ATP-binding protein; membrane protein; 3.10A {Archaeoglobus fulgidus} SCOP: c.37.1.12 Back     alignment and structure
>1ewq_A DNA mismatch repair protein MUTS; multiple domains of protein, mostly mixed alpha-beta structures, one domain is entirely helical; HET: DNA; 2.20A {Thermus aquaticus} SCOP: a.113.1.1 c.37.1.12 c.55.6.1 d.75.2.1 PDB: 1nne_A* 1fw6_A* 1ewr_A* Back     alignment and structure
>2w0m_A SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus solfataricus P2} Back     alignment and structure
>2ghi_A Transport protein; multidrug resistance protein, MDR, structural genomics, structural genomics consortium, SGC; 2.20A {Plasmodium yoelii yoelii str} Back     alignment and structure
>1wb9_A DNA mismatch repair protein MUTS; DNA-binding, ATP-binding, DNA binding, DNA repair, mismatch recognition; HET: DNA ADP; 2.10A {Escherichia coli} SCOP: a.113.1.1 c.37.1.12 c.55.6.1 d.75.2.1 PDB: 1wbb_A* 1e3m_A* 1oh5_A* 1oh6_A* 1oh7_A* 1oh8_A* 1w7a_A* 2wtu_A* 1wbd_A* 1ng9_A* 3k0s_A* Back     alignment and structure
>2qi9_C Vitamin B12 import ATP-binding protein BTUD; inner membrane, membrane, transmembrane, transport, ATP- binding, hydrolase, nucleotide-binding, periplasm; HET: 1PE; 2.60A {Escherichia coli} PDB: 1l7v_C* 4dbl_C Back     alignment and structure
>2pze_A Cystic fibrosis transmembrane conductance regulat; NBD, ABC transporter, CFTR, hydrolase; HET: ATP; 1.70A {Homo sapiens} PDB: 2pzg_A* 2pzf_A* 1ckx_A 1cky_A 1ckw_A 1ckz_A Back     alignment and structure
>2nq2_C Hypothetical ABC transporter ATP-binding protein HI1470; putative iron chelatin ABC transporter, nucleotide binding domain; 2.40A {Haemophilus influenzae} Back     alignment and structure
>2pjz_A Hypothetical protein ST1066; ATP binding protein, structural genomics, NPPSFA; 1.90A {Sulfolobus tokodaii} Back     alignment and structure
>2cbz_A Multidrug resistance-associated protein 1; ABC proteins, MRP1/ABCC1, nucleotide-binding domain, ATP- binding, hydrolysis, transport; HET: ATP; 1.5A {Homo sapiens} Back     alignment and structure
>4a82_A Cystic fibrosis transmembrane conductance regulat; CFTR, ION channel, transport protein, casse protein; 2.00A {Homo sapiens} PDB: 2onj_A* 2hyd_A Back     alignment and structure
>3qf4_B Uncharacterized ABC transporter ATP-binding prote TM_0288; multidrug transporter, transport protein; HET: ANP; 2.90A {Thermotoga maritima} Back     alignment and structure
>3gd7_A Fusion complex of cystic fibrosis transmembrane conductance regulator, residues 1193-1427...; CFTR, ABC transporter, nucleotide binding domain, NBD; HET: B44; 2.70A {Homo sapiens} Back     alignment and structure
>3qf4_A ABC transporter, ATP-binding protein; multidrug transporter, transport protein; HET: ANP; 2.90A {Thermotoga maritima} Back     alignment and structure
>1nlf_A Regulatory protein REPA; replicative DNA helicase structural changes, replication; 1.95A {Escherichia coli} SCOP: c.37.1.11 PDB: 1g8y_A 1olo_A Back     alignment and structure
>3b60_A Lipid A export ATP-binding/permease protein MSBA; ABC transporter, lipid flippase, hydrolase, inner membrane, lipid transport, membrane; HET: ANP; 3.70A {Salmonella typhimurium} SCOP: c.37.1.12 f.37.1.1 PDB: 3b5y_A* 3b5z_A* 3b5w_A Back     alignment and structure
>3b5x_A Lipid A export ATP-binding/permease protein MSBA; ABC transporter, lipid flippase, hydrolase, inner membrane, lipid transport, membrane; 5.50A {Vibrio cholerae} Back     alignment and structure
>2bdt_A BH3686; alpha-beta protein, structural genomics, PSI, protein struct initiative, northeast structural genomics consortium, NESG, function; 2.40A {Bacillus halodurans} SCOP: c.37.1.25 Back     alignment and structure
>1lw7_A Transcriptional regulator NADR; NMN, NMN adenylyl transferase, ribosylnicotinamide KINA transferase; HET: NAD; 2.90A {Haemophilus influenzae} SCOP: c.26.1.3 c.37.1.1 Back     alignment and structure
>1zp6_A Hypothetical protein ATU3015; alpha-beta protein., structural genomics, PSI, protein struc initiative; 3.20A {Agrobacterium tumefaciens str} SCOP: c.37.1.25 Back     alignment and structure
>1s96_A Guanylate kinase, GMP kinase; E.coli, dimer, SAD, transferase; 2.00A {Escherichia coli} SCOP: c.37.1.1 PDB: 2an9_A* 2anb_A* 2anc_A 2f3r_A* 2f3t_A* Back     alignment and structure
>3kta_B Chromosome segregation protein SMC; structural maintenance of chromosomes, ABC ATPase, CFTR adenylate kinase, AP5A, transferase; HET: AP5; 1.63A {Pyrococcus furiosus} PDB: 1xew_Y 1xex_B* Back     alignment and structure
>2bbs_A Cystic fibrosis transmembrane conductance regulator; ATP binding cassette, transport protein; HET: ATP; 2.05A {Homo sapiens} PDB: 2bbt_A* 1xmi_A* 1xmj_A* 2bbo_A* 3si7_A* 1r0w_A 1q3h_A 1r0x_A* 1r0y_A* 1r0z_A* 1r10_A* 1xf9_A* 1xfa_A* Back     alignment and structure
>2qag_C Septin-7; cell cycle, cell division, GTP-binding, nucleotide-binding, phosphorylation, acetylation, alternative splicing, coiled coil; HET: GDP GTP; 4.00A {Homo sapiens} Back     alignment and structure
>2cvh_A DNA repair and recombination protein RADB; filament formation, homologous recombination, ATPase domain, hyperthermophIle; HET: DNA; 2.20A {Thermococcus kodakarensis} PDB: 2cvf_A* Back     alignment and structure
>3jvv_A Twitching mobility protein; hexameric P-loop ATPase, secretion ATPase, ATP-binding, FIMB nucleotide-binding, transport; HET: ACP CIT; 2.60A {Pseudomonas aeruginosa} PDB: 3jvu_A* Back     alignment and structure
>2gza_A Type IV secretion system protein VIRB11; ATPase, hydrolase; 2.60A {Brucella suis} Back     alignment and structure
>1pui_A ENGB, probable GTP-binding protein ENGB; structural genomics, nysgxrc T16, GTPase, PSI, protein structure initiative; 2.00A {Escherichia coli} SCOP: c.37.1.8 Back     alignment and structure
>1htw_A HI0065; nucleotide-binding fold, structural genomics, structure 2 function project, S2F, unknown function; HET: ADP; 1.70A {Haemophilus influenzae} SCOP: c.37.1.18 PDB: 1fl9_A Back     alignment and structure
>2bbw_A Adenylate kinase 4, AK4; nucleotide kinase, nucleotide binding, human, structura genomics, structural genomics consortium, SGC, transferase; HET: GP5; 2.05A {Homo sapiens} PDB: 2ar7_A* 3ndp_A Back     alignment and structure
>2qag_B Septin-6, protein NEDD5; cell cycle, cell division, GTP-binding, nucleotide-binding, phosphorylation, acetylation, alternative splicing, coiled coil; HET: GDP GTP; 4.00A {Homo sapiens} Back     alignment and structure
>1n0w_A DNA repair protein RAD51 homolog 1; DNA repair, homologous recombination, breast cancer susceptibility, RECA-like ATPase, protein complex; HET: DNA MSE; 1.70A {Homo sapiens} SCOP: c.37.1.11 Back     alignment and structure
>2f1r_A Molybdopterin-guanine dinucleotide biosynthesis protein B (MOBB); structural genomics, PSI, protein structure initiative; 2.10A {Archaeoglobus fulgidus} Back     alignment and structure
>2ewv_A Twitching motility protein PILT; pilus retraction motor, ATPase, hexameric PILT, protein TRAN; HET: ADP; 2.80A {Aquifex aeolicus} PDB: 2eww_A* 2gsz_A* Back     alignment and structure
>1nij_A Hypothetical protein YJIA; structural genomics, P-loop protein, GTP binding, structure function project, S2F, unknown function; 2.00A {Escherichia coli} SCOP: c.37.1.10 d.237.1.1 Back     alignment and structure
>2yhs_A FTSY, cell division protein FTSY; cell cycle, protein targeting, simibi class GTPase, GTP-BIND membrane, nucleotide-binding; 1.60A {Escherichia coli} PDB: 2qy9_A 2xxa_B* 1fts_A Back     alignment and structure
>1htw_A HI0065; nucleotide-binding fold, structural genomics, structure 2 function project, S2F, unknown function; HET: ADP; 1.70A {Haemophilus influenzae} SCOP: c.37.1.18 PDB: 1fl9_A Back     alignment and structure
>3e70_C DPA, signal recognition particle receptor; FTSY, SRP-GTPase, protein-targeting, transport protein; HET: GDP; 1.97A {Pyrococcus furiosus} PDB: 3dmd_B 3dm9_B* Back     alignment and structure
>2rcn_A Probable GTPase ENGC; YJEQ, circularly permuted, GTP-binding, hydrolase, nucleotide-binding; HET: GDP; 2.25A {Salmonella typhimurium} PDB: 2ykr_W 4a2i_V Back     alignment and structure
>3ec2_A DNA replication protein DNAC; helicase loader, replication initiation factor, ATP-binding, nucleotide-binding; HET: DNA ADP; 2.70A {Aquifex aeolicus} PDB: 3ecc_A* Back     alignment and structure
>3auy_A DNA double-strand break repair RAD50 ATPase; DNA repair, ABC transporter ATPase domain-like; HET: DNA ADP; 2.70A {Methanocaldococcus jannaschii} PDB: 3aux_A* 3av0_B* Back     alignment and structure
>1odf_A YGR205W, hypothetical 33.3 kDa protein in ADE3-Ser2 intergenic region; yeast protein, ATP binding protein; 2.25A {Saccharomyces cerevisiae} SCOP: c.37.1.6 Back     alignment and structure
>2qm8_A GTPase/ATPase; G protein, G3E, metallochaperone, chaperone; HET: MSE; 1.70A {Methylobacterium extorquens} SCOP: c.37.1.10 PDB: 2qm7_A* Back     alignment and structure
>1udx_A The GTP-binding protein OBG; TGS domain, riken structural genomics/proteomics initiative, RSGI, structural genomics; 2.07A {Thermus thermophilus} SCOP: b.117.1.1 c.37.1.8 d.242.1.1 Back     alignment and structure
>1p9r_A General secretion pathway protein E; bacterial type II secretion system cytoplasmic protein - GSPE, putative ATPase/ ATP binding protein; 2.50A {Vibrio cholerae} SCOP: c.37.1.11 PDB: 1p9w_A* Back     alignment and structure
>2yv5_A YJEQ protein; hydrolase, GTPase, permutation, structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: GDP; 1.90A {Aquifex aeolicus} Back     alignment and structure
>2oap_1 GSPE-2, type II secretion system protein; hexameric ATPase, hydrolase; HET: ANP; 2.95A {Archaeoglobus fulgidus} PDB: 2oaq_1 Back     alignment and structure
>3lda_A DNA repair protein RAD51; DNA binding protein, ATP-binding, DNA damage, DNA recombinat repair, nucleotide-binding; HET: DNA; 2.50A {Saccharomyces cerevisiae} PDB: 1szp_A* Back     alignment and structure
>1lvg_A Guanylate kinase, GMP kinase; transferase; HET: ADP 5GP; 2.10A {Mus musculus} SCOP: c.37.1.1 Back     alignment and structure
>1sxj_E Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>2kjq_A DNAA-related protein; solution structure, NESG, structural genomics, PSI-2, protei structure initiative; NMR {Neisseria meningitidis serogroup B} Back     alignment and structure
>1ni3_A YCHF GTPase, YCHF GTP-binding protein; structural genomics, GTP1OBG, PSI, protein structure initiative; 2.80A {Schizosaccharomyces pombe} SCOP: c.37.1.8 d.15.10.2 Back     alignment and structure
>3c8u_A Fructokinase; YP_612366.1, putative fructose transport system kinase, STRU genomics, joint center for structural genomics, JCSG; 1.95A {Silicibacter SP} Back     alignment and structure
>3sop_A Neuronal-specific septin-3; hydrolase; HET: GDP; 2.88A {Homo sapiens} Back     alignment and structure
>2x8a_A Nuclear valosin-containing protein-like; nuclear protein; 2.60A {Homo sapiens} Back     alignment and structure
>1u0l_A Probable GTPase ENGC; permutation, OB-fold, zinc-finger, structural genomics, BSGC structure funded by NIH, protein structure initiative, PSI; HET: GDP; 2.80A {Thermotoga maritima} SCOP: b.40.4.5 c.37.1.8 Back     alignment and structure
>1sq5_A Pantothenate kinase; P-loop, transferase; HET: PAU ADP; 2.20A {Escherichia coli} SCOP: c.37.1.6 PDB: 1esm_A* 1esn_A* Back     alignment and structure
>2dpy_A FLII, flagellum-specific ATP synthase; beta barrel, alpha-beta structure, hydrolase; HET: ADP; 2.40A {Salmonella typhimurium} Back     alignment and structure
>2jeo_A Uridine-cytidine kinase 1; UCK, transferase, ATP-binding, nucleoside kinase, nucleotide-binding; 2.50A {Homo sapiens} PDB: 2uvq_A* Back     alignment and structure
>1z6g_A Guanylate kinase; structural genomics, SGC, structural genom consortium, transferase; HET: EPE; 2.18A {Plasmodium falciparum} Back     alignment and structure
>1in4_A RUVB, holliday junction DNA helicase RUVB; AAA+-class ATPase, winged-helix domain, ATP hydrolysis, walker A, walker B, sensor 1, sensor 2; HET: ADP; 1.60A {Thermotoga maritima} SCOP: a.4.5.11 c.37.1.20 PDB: 1in5_A* 1in6_A* 1in8_A* 1in7_A* 1j7k_A* Back     alignment and structure
>2gza_A Type IV secretion system protein VIRB11; ATPase, hydrolase; 2.60A {Brucella suis} Back     alignment and structure
>3b9q_A Chloroplast SRP receptor homolog, alpha subunit CPFTSY; protein translocation, GTP-binding, nucleotide-binding, protein transport; 1.75A {Arabidopsis thaliana} Back     alignment and structure
>1znw_A Guanylate kinase, GMP kinase; ATP:GMP-phosphotransferase, TR; 2.10A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1znx_A* 1zny_A* 1znz_A* 1s4q_A 1z8f_A Back     alignment and structure
>1t9h_A YLOQ, probable GTPase ENGC; N-terminal beta-barrel domain with oligonucleotide binding fold, central GTP binding domain; 1.60A {Bacillus subtilis} SCOP: b.40.4.5 c.37.1.8 Back     alignment and structure
>3aez_A Pantothenate kinase; transferase, homodimer, COA biosynthesis, nucleotide binding binding, cytoplasm, nucleotide-binding; HET: GDP PAZ; 2.20A {Mycobacterium tuberculosis} PDB: 2ges_A* 2geu_A* 2gev_A* 2zs7_A* 2zs8_A* 2zs9_A* 2zsa_A* 2zsb_A* 2zsd_A* 2zse_A* 2zsf_A* 2get_A* 3af0_A* 3af1_A* 3af2_A* 3af3_A* 3af4_A* 3avp_A* 3avo_A* 3avq_A* Back     alignment and structure
>1s96_A Guanylate kinase, GMP kinase; E.coli, dimer, SAD, transferase; 2.00A {Escherichia coli} SCOP: c.37.1.1 PDB: 2an9_A* 2anb_A* 2anc_A 2f3r_A* 2f3t_A* Back     alignment and structure
>3euj_A Chromosome partition protein MUKB, linker; MUKB, MUKE, chromosome condensation, condensin, SMC, N subunit, ABC-type ATPase, WHD, ATP-binding; HET: AGS; 3.10A {Haemophilus ducreyi} PDB: 3euk_A* Back     alignment and structure
>2eyu_A Twitching motility protein PILT; pilus retraction motor, C-terminal domain PILT, protein transport; 1.87A {Aquifex aeolicus} Back     alignment and structure
>2v9p_A Replication protein E1; AAA+ molecular motor, DNA replication, DNA translocation, nucleotide-binding, DNA-binding; 3.00A {Bovine papillomavirus type 1} PDB: 2gxa_A* Back     alignment and structure
>1vma_A Cell division protein FTSY; TM0570, structural genomics, JCS protein structure initiative, PSI, joint center for structu genomics; HET: CIT; 1.60A {Thermotoga maritima} SCOP: a.24.13.1 c.37.1.10 Back     alignment and structure
>2og2_A Putative signal recognition particle receptor; nucleotide-binding, protein transport; 2.00A {Arabidopsis thaliana} Back     alignment and structure
>3b85_A Phosphate starvation-inducible protein; PHOH2, ATPase, PFAM: PF02562, ST genomics, PSI-2, protein structure initiative; 2.35A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>2npi_A Protein CLP1; CLP1-PCF11 complex, ATP binding, ternary complex, transcript; HET: ATP; 2.95A {Saccharomyces cerevisiae} Back     alignment and structure
>2dr3_A UPF0273 protein PH0284; RECA superfamily ATPase, hexamer, structural genomics; HET: ADP; 2.00A {Pyrococcus horikoshii} Back     alignment and structure
>2yhs_A FTSY, cell division protein FTSY; cell cycle, protein targeting, simibi class GTPase, GTP-BIND membrane, nucleotide-binding; 1.60A {Escherichia coli} PDB: 2qy9_A 2xxa_B* 1fts_A Back     alignment and structure
>2px0_A Flagellar biosynthesis protein FLHF; SRP GTPase, flagellum, protein transport, biosynthetic protein; HET: GNP; 3.00A {Bacillus subtilis} PDB: 2px3_A* 3syn_A* Back     alignment and structure
>1tq4_A IIGP1, interferon-inducible GTPase; interferon gamma, dimer, immunology, signaling protein; HET: GDP; 1.95A {Mus musculus} SCOP: c.37.1.8 PDB: 1tqd_A* 1tq6_A* 1tpz_A* 1tq2_A* Back     alignment and structure
>2qag_B Septin-6, protein NEDD5; cell cycle, cell division, GTP-binding, nucleotide-binding, phosphorylation, acetylation, alternative splicing, coiled coil; HET: GDP GTP; 4.00A {Homo sapiens} Back     alignment and structure
>1sq5_A Pantothenate kinase; P-loop, transferase; HET: PAU ADP; 2.20A {Escherichia coli} SCOP: c.37.1.6 PDB: 1esm_A* 1esn_A* Back     alignment and structure
>3k1j_A LON protease, ATP-dependent protease LON; ATP-binding, nucleotide-binding, Pro hydrolase; HET: ADP PE8; 2.00A {Thermococcus onnurineus} Back     alignment and structure
>2r6a_A DNAB helicase, replicative helicase; replication, DNAB; 2.90A {Geobacillus stearothermophilus} PDB: 2r6c_A 2r6d_A 2r6e_A 2vyf_A 2vye_A Back     alignment and structure
>2pt7_A CAG-ALFA; ATPase, protein-protein complex, type IV secretion, hydrolas binding complex; 2.40A {Helicobacter pylori} SCOP: c.37.1.11 PDB: 1nly_A* 1nlz_A 1opx_A* 1g6o_A Back     alignment and structure
>2rcn_A Probable GTPase ENGC; YJEQ, circularly permuted, GTP-binding, hydrolase, nucleotide-binding; HET: GDP; 2.25A {Salmonella typhimurium} PDB: 2ykr_W 4a2i_V Back     alignment and structure
>1zp6_A Hypothetical protein ATU3015; alpha-beta protein., structural genomics, PSI, protein struc initiative; 3.20A {Agrobacterium tumefaciens str} SCOP: c.37.1.25 Back     alignment and structure
>3tr0_A Guanylate kinase, GMP kinase; purines, pyrimidines, nucleosides, nucleotides, transferase; HET: 5GP; 1.85A {Coxiella burnetii} Back     alignment and structure
>1ls1_A Signal recognition particle protein; FFH, SRP54, SRP, GTPase, ultrahigh resolution, protein transport; 1.10A {Thermus aquaticus} SCOP: a.24.13.1 c.37.1.10 PDB: 1jpn_B* 1jpj_A* 1ry1_U* 2j45_A* 1o87_A* 2c04_A* 2j46_A* 1rj9_B* 2c03_A* 2j7p_A* 1okk_A* 2cnw_A* 1ng1_A* 2xkv_A 3ng1_A 1ffh_A 2ng1_A* Back     alignment and structure
>1rj9_A FTSY, signal recognition protein; SRP-GTPase domain, heterodimer, nucleotide twinning, protein complex, protein transport; HET: GCP; 1.90A {Thermus aquaticus} SCOP: a.24.13.1 c.37.1.10 PDB: 2q9c_A* 2q9b_A* 2q9a_A* 1okk_D* 2xkv_D 2iyl_D* 2cnw_D* 2j7p_D* Back     alignment and structure
>1oix_A RAS-related protein RAB-11A; small G protein, intracellular trafficking, GTP-binding, lipoprotein, prenylation, protein transport; HET: GDP; 1.7A {Homo sapiens} SCOP: c.37.1.8 PDB: 1oiw_A* 1oiv_A* 3rwo_B* 3rwm_B* Back     alignment and structure
>2ius_A DNA translocase FTSK; nucleotide-binding, chromosome partition, ATP-binding, DNA- binding, cell division, transmembrane, inner membrane; HET: DNA; 2.7A {Escherichia coli} PDB: 2j5p_A* Back     alignment and structure
>1u0l_A Probable GTPase ENGC; permutation, OB-fold, zinc-finger, structural genomics, BSGC structure funded by NIH, protein structure initiative, PSI; HET: GDP; 2.80A {Thermotoga maritima} SCOP: b.40.4.5 c.37.1.8 Back     alignment and structure
>2zr9_A Protein RECA, recombinase A; recombination, RECA mutants, DNA-repair, ATP-binding, DNA DA recombination, DNA repair, DNA-binding; HET: DTP; 2.50A {Mycobacterium smegmatis str} PDB: 2zr0_A* 2zra_A* 2zrb_A 2zrm_A* 1ubc_A* 1ubf_A* 1ubg_A* 1ube_A* 2g88_A* 2odw_A* 2oe2_A 2oep_A* 2oes_A 2ofo_A 2zr7_A 2odn_A* 2zrn_A 2zro_A* 2zrp_A* 2zre_A* ... Back     alignment and structure
>4aby_A DNA repair protein RECN; hydrolase, double strand break repair, ATPase, nucleotide binding domain; HET: DNA; 3.00A {Deinococcus radiodurans} Back     alignment and structure
>2ewv_A Twitching motility protein PILT; pilus retraction motor, ATPase, hexameric PILT, protein TRAN; HET: ADP; 2.80A {Aquifex aeolicus} PDB: 2eww_A* 2gsz_A* Back     alignment and structure
>3tr0_A Guanylate kinase, GMP kinase; purines, pyrimidines, nucleosides, nucleotides, transferase; HET: 5GP; 1.85A {Coxiella burnetii} Back     alignment and structure
>1iy2_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 3.20A {Thermus thermophilus} SCOP: c.37.1.20 Back     alignment and structure
>3e70_C DPA, signal recognition particle receptor; FTSY, SRP-GTPase, protein-targeting, transport protein; HET: GDP; 1.97A {Pyrococcus furiosus} PDB: 3dmd_B 3dm9_B* Back     alignment and structure
>1ixz_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 2.20A {Thermus thermophilus} SCOP: c.37.1.20 PDB: 1iy0_A* 1iy1_A* Back     alignment and structure
>2yv5_A YJEQ protein; hydrolase, GTPase, permutation, structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: GDP; 1.90A {Aquifex aeolicus} Back     alignment and structure
>3lnc_A Guanylate kinase, GMP kinase; ALS collaborative crystallography, emerald biostructures, ATP-binding, cytoplasm, nucleotide-binding; HET: 5GP; 1.95A {Anaplasma phagocytophilum} Back     alignment and structure
>1t9h_A YLOQ, probable GTPase ENGC; N-terminal beta-barrel domain with oligonucleotide binding fold, central GTP binding domain; 1.60A {Bacillus subtilis} SCOP: b.40.4.5 c.37.1.8 Back     alignment and structure
>3hr8_A Protein RECA; alpha and beta proteins (A/B, A+B), ATP-binding, cytoplasm, damage, DNA recombination, DNA repair, DNA-binding; 1.95A {Thermotoga maritima} Back     alignment and structure
>2obl_A ESCN; ATPase, hydrolase; 1.80A {Escherichia coli O127} PDB: 2obm_A* Back     alignment and structure
>3szr_A Interferon-induced GTP-binding protein MX1; interferon-induced antiviral GTPase, membrane associated, PR binding; 3.50A {Homo sapiens} PDB: 3zys_B Back     alignment and structure
>1qhl_A Protein (cell division protein MUKB); SMC, chromosome partitioning; 2.20A {Escherichia coli} SCOP: c.37.1.12 Back     alignment and structure
>2bdt_A BH3686; alpha-beta protein, structural genomics, PSI, protein struct initiative, northeast structural genomics consortium, NESG, function; 2.40A {Bacillus halodurans} SCOP: c.37.1.25 Back     alignment and structure
>2oap_1 GSPE-2, type II secretion system protein; hexameric ATPase, hydrolase; HET: ANP; 2.95A {Archaeoglobus fulgidus} PDB: 2oaq_1 Back     alignment and structure
>4a74_A DNA repair and recombination protein RADA; hydrolase, recombinase; HET: DNA ANP; 1.48A {Pyrococcus furiosus} PDB: 4a6x_A* 4a6p_A* 4a7o_A* Back     alignment and structure
>3asz_A Uridine kinase; cytidine phosphorylation, transferase; HET: C5P; 2.25A {Thermus thermophilus} PDB: 3asy_A* Back     alignment and structure
>2qnr_A Septin-2, protein NEDD5; structural genomics consortium, SGC, mitosis, GDP, C cycle, cell division, GTP-binding, nucleotide-binding; HET: GDP; 2.60A {Homo sapiens} PDB: 2qa5_A* 3ftq_A* Back     alignment and structure
>2qm8_A GTPase/ATPase; G protein, G3E, metallochaperone, chaperone; HET: MSE; 1.70A {Methylobacterium extorquens} SCOP: c.37.1.10 PDB: 2qm7_A* Back     alignment and structure
>3euj_A Chromosome partition protein MUKB, linker; MUKB, MUKE, chromosome condensation, condensin, SMC, N subunit, ABC-type ATPase, WHD, ATP-binding; HET: AGS; 3.10A {Haemophilus ducreyi} PDB: 3euk_A* Back     alignment and structure
>4eun_A Thermoresistant glucokinase; putative sugar kinase, enzyme function initiative, EFI, STRU genomics, transferase; 1.60A {Janibacter SP} Back     alignment and structure
>3lnc_A Guanylate kinase, GMP kinase; ALS collaborative crystallography, emerald biostructures, ATP-binding, cytoplasm, nucleotide-binding; HET: 5GP; 1.95A {Anaplasma phagocytophilum} Back     alignment and structure
>2f9l_A RAB11B, member RAS oncogene family; RAB11B GTPase, vesicle transport, hydrolase; HET: GDP; 1.55A {Homo sapiens} SCOP: c.37.1.8 PDB: 2f9m_A* 1yzk_A* 2hv8_A* 2gzd_A* 2gzh_A* 2d7c_A* 3bfk_A* Back     alignment and structure
>2i3b_A HCR-ntpase, human cancer-related ntpase; AAA, rossmann, hydrolase; NMR {Homo sapiens} SCOP: c.37.1.11 Back     alignment and structure
>4eun_A Thermoresistant glucokinase; putative sugar kinase, enzyme function initiative, EFI, STRU genomics, transferase; 1.60A {Janibacter SP} Back     alignment and structure
>3jvv_A Twitching mobility protein; hexameric P-loop ATPase, secretion ATPase, ATP-binding, FIMB nucleotide-binding, transport; HET: ACP CIT; 2.60A {Pseudomonas aeruginosa} PDB: 3jvu_A* Back     alignment and structure
>2qtf_A Protein HFLX, GTP-binding protein; beta-alpha-barrels, nucleotide-binding, nucleotide binding protein; 2.00A {Sulfolobus solfataricus P2} PDB: 2qth_A* 3kxi_A* 3kxl_A 3kxk_A Back     alignment and structure
>2qag_C Septin-7; cell cycle, cell division, GTP-binding, nucleotide-binding, phosphorylation, acetylation, alternative splicing, coiled coil; HET: GDP GTP; 4.00A {Homo sapiens} Back     alignment and structure
>4gp7_A Metallophosphoesterase; polynucleotide kinase phosphatase, RNA repair, transferase; HET: ATP CIT; 2.00A {Clostridium thermocellum} PDB: 4gp6_A* Back     alignment and structure
>1p9r_A General secretion pathway protein E; bacterial type II secretion system cytoplasmic protein - GSPE, putative ATPase/ ATP binding protein; 2.50A {Vibrio cholerae} SCOP: c.37.1.11 PDB: 1p9w_A* Back     alignment and structure
>2ce7_A Cell division protein FTSH; metalloprotease; HET: ADP; 2.44A {Thermotoga maritima} SCOP: a.269.1.1 c.37.1.20 PDB: 2cea_A* 3kds_E* Back     alignment and structure
>3kta_A Chromosome segregation protein SMC; structural maintenance of chromosomes, ABC ATPase, CFTR adenylate kinase, AP5A, transferase; HET: AP5; 1.63A {Pyrococcus furiosus} PDB: 1xex_A* 1xew_X* Back     alignment and structure
>1qhl_A Protein (cell division protein MUKB); SMC, chromosome partitioning; 2.20A {Escherichia coli} SCOP: c.37.1.12 Back     alignment and structure
>1zu4_A FTSY; GTPase, signal recognition particle, SRP, receptor, protein transport; 1.95A {Mycoplasma mycoides} PDB: 1zu5_A Back     alignment and structure
>2j41_A Guanylate kinase; GMP, GMK, transferase, ATP-binding, nucleotide- binding; HET: 5GP; 1.9A {Staphylococcus aureus} Back     alignment and structure
>1pzn_A RAD51, DNA repair and recombination protein RAD51, RADA; heptameric ring, heptamer, ring, oligomer, RAD51 polymerizat motif; HET: DNA; 2.85A {Pyrococcus furiosus} SCOP: a.60.4.1 c.37.1.11 Back     alignment and structure
>2bbw_A Adenylate kinase 4, AK4; nucleotide kinase, nucleotide binding, human, structura genomics, structural genomics consortium, SGC, transferase; HET: GP5; 2.05A {Homo sapiens} PDB: 2ar7_A* 3ndp_A Back     alignment and structure
>4a1f_A DNAB helicase, replicative DNA helicase; hydrolase, DNA replication, ATPase; HET: FLC; 2.50A {Helicobacter pylori} Back     alignment and structure
>3c8u_A Fructokinase; YP_612366.1, putative fructose transport system kinase, STRU genomics, joint center for structural genomics, JCSG; 1.95A {Silicibacter SP} Back     alignment and structure
>1ye8_A Protein THEP1, hypothetical UPF0334 kinase-like protein AQ_1292; mixed alpha-beta protein, rossman fold, signaling protein, transferase; 1.40A {Aquifex aeolicus} SCOP: c.37.1.11 Back     alignment and structure
>2f1r_A Molybdopterin-guanine dinucleotide biosynthesis protein B (MOBB); structural genomics, PSI, protein structure initiative; 2.10A {Archaeoglobus fulgidus} Back     alignment and structure
>1cr0_A DNA primase/helicase; RECA-type protein fold, transferase; HET: DNA; 2.30A {Enterobacteria phage T7} SCOP: c.37.1.11 PDB: 1cr1_A* 1cr2_A* 1cr4_A* 1e0j_A* 1e0k_A* Back     alignment and structure
>2xau_A PRE-mRNA-splicing factor ATP-dependent RNA helica; hydrolase, ribosome biogenesis, ATPase, ATP-binding, OB-fold; HET: ADP; 1.90A {Saccharomyces cerevisiae} PDB: 3kx2_B* Back     alignment and structure
>4e22_A Cytidylate kinase; P-loop, CMP/ATP binding, transferase; 2.32A {Yersinia pseudotuberculosis} Back     alignment and structure
>1e69_A Chromosome segregation SMC protein; structural maintenance of chromosomes, coiled coil; 3.1A {Thermotoga maritima} SCOP: c.37.1.12 Back     alignment and structure
>3vaa_A Shikimate kinase, SK; structural genomics, center for structural genomics of infec diseases, csgid, metal binding, transferase; 1.70A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3uie_A Adenylyl-sulfate kinase 1, chloroplastic; rossmann fold, transferase-transferase complex; HET: ADX ANP; 1.79A {Arabidopsis thaliana} SCOP: c.37.1.0 PDB: 4fxp_A* Back     alignment and structure
>1nij_A Hypothetical protein YJIA; structural genomics, P-loop protein, GTP binding, structure function project, S2F, unknown function; 2.00A {Escherichia coli} SCOP: c.37.1.10 d.237.1.1 Back     alignment and structure
>1pui_A ENGB, probable GTP-binding protein ENGB; structural genomics, nysgxrc T16, GTPase, PSI, protein structure initiative; 2.00A {Escherichia coli} SCOP: c.37.1.8 Back     alignment and structure
>2x8a_A Nuclear valosin-containing protein-like; nuclear protein; 2.60A {Homo sapiens} Back     alignment and structure
>1kgd_A CASK, peripheral plasma membrane CASK; maguk, guanylate kinase like domain, protein binding; 1.31A {Homo sapiens} SCOP: c.37.1.1 Back     alignment and structure
>1lvg_A Guanylate kinase, GMP kinase; transferase; HET: ADP 5GP; 2.10A {Mus musculus} SCOP: c.37.1.1 Back     alignment and structure
>2vp4_A Deoxynucleoside kinase; ATP-binding, DNA synthesis, phosphoprotein, feedback inhibition, deoxyribonucleoside kinase, salvage pathway; HET: DCP; 2.20A {Drosophila melanogaster} SCOP: c.37.1.1 PDB: 1j90_A* 2jj8_A* 2vp2_A* 1oe0_A* 2vp5_A* 2vp6_A* 2vp9_A* 2vpp_A* 2vqs_A* 2vp0_A* 1ot3_A* 2jcs_A* 1zm7_A* 1zmx_A* Back     alignment and structure
>1udx_A The GTP-binding protein OBG; TGS domain, riken structural genomics/proteomics initiative, RSGI, structural genomics; 2.07A {Thermus thermophilus} SCOP: b.117.1.1 c.37.1.8 d.242.1.1 Back     alignment and structure
>3nwj_A ATSK2; P loop, shikimate, nucleoside monophosphate kinase, shikimat ATP binding, chloroplast, transferase; 2.35A {Arabidopsis thaliana} Back     alignment and structure
>1lw7_A Transcriptional regulator NADR; NMN, NMN adenylyl transferase, ribosylnicotinamide KINA transferase; HET: NAD; 2.90A {Haemophilus influenzae} SCOP: c.26.1.3 c.37.1.1 Back     alignment and structure
>2dhr_A FTSH; AAA+ protein, hexameric Zn metalloprotease, hydrolase; HET: ADP; 3.90A {Thermus thermophilus} Back     alignment and structure
>3uie_A Adenylyl-sulfate kinase 1, chloroplastic; rossmann fold, transferase-transferase complex; HET: ADX ANP; 1.79A {Arabidopsis thaliana} SCOP: c.37.1.0 PDB: 4fxp_A* Back     alignment and structure
>2j41_A Guanylate kinase; GMP, GMK, transferase, ATP-binding, nucleotide- binding; HET: 5GP; 1.9A {Staphylococcus aureus} Back     alignment and structure
>1in4_A RUVB, holliday junction DNA helicase RUVB; AAA+-class ATPase, winged-helix domain, ATP hydrolysis, walker A, walker B, sensor 1, sensor 2; HET: ADP; 1.60A {Thermotoga maritima} SCOP: a.4.5.11 c.37.1.20 PDB: 1in5_A* 1in6_A* 1in8_A* 1in7_A* 1j7k_A* Back     alignment and structure
>3nwj_A ATSK2; P loop, shikimate, nucleoside monophosphate kinase, shikimat ATP binding, chloroplast, transferase; 2.35A {Arabidopsis thaliana} Back     alignment and structure
>4e22_A Cytidylate kinase; P-loop, CMP/ATP binding, transferase; 2.32A {Yersinia pseudotuberculosis} Back     alignment and structure
>3bh0_A DNAB-like replicative helicase; ATPase, replication; 2.35A {Bacillus phage SPP1} Back     alignment and structure
>1knq_A Gluconate kinase; ALFA/beta structure, transferase; 2.00A {Escherichia coli} SCOP: c.37.1.17 PDB: 1ko1_A 1ko4_A 1ko5_A* 1ko8_A* 1kof_A* Back     alignment and structure
>2vp4_A Deoxynucleoside kinase; ATP-binding, DNA synthesis, phosphoprotein, feedback inhibition, deoxyribonucleoside kinase, salvage pathway; HET: DCP; 2.20A {Drosophila melanogaster} SCOP: c.37.1.1 PDB: 1j90_A* 2jj8_A* 2vp2_A* 1oe0_A* 2vp5_A* 2vp6_A* 2vp9_A* 2vpp_A* 2vqs_A* 2vp0_A* 1ot3_A* 2jcs_A* 1zm7_A* 1zmx_A* Back     alignment and structure
>2e87_A Hypothetical protein PH1320; GTP-binding, GTPase, OBG, bundle, GDP, complex, structural G NPPSFA; HET: GDP; 2.35A {Pyrococcus horikoshii} Back     alignment and structure
>3kta_A Chromosome segregation protein SMC; structural maintenance of chromosomes, ABC ATPase, CFTR adenylate kinase, AP5A, transferase; HET: AP5; 1.63A {Pyrococcus furiosus} PDB: 1xex_A* 1xew_X* Back     alignment and structure
>1kgd_A CASK, peripheral plasma membrane CASK; maguk, guanylate kinase like domain, protein binding; 1.31A {Homo sapiens} SCOP: c.37.1.1 Back     alignment and structure
>2kjq_A DNAA-related protein; solution structure, NESG, structural genomics, PSI-2, protei structure initiative; NMR {Neisseria meningitidis serogroup B} Back     alignment and structure
>3tau_A Guanylate kinase, GMP kinase; structural genomics, center for structural genomics of infec diseases, csgid, putative guanylate kinase; HET: MSE; 2.05A {Listeria monocytogenes} Back     alignment and structure
>3vaa_A Shikimate kinase, SK; structural genomics, center for structural genomics of infec diseases, csgid, metal binding, transferase; 1.70A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3ney_A 55 kDa erythrocyte membrane protein; structural genomics consortium, SGC, 55 kDa erythrocyte MEMB protein; 2.26A {Homo sapiens} SCOP: c.37.1.0 Back     alignment and structure
>3t34_A Dynamin-related protein 1A, linker, dynamin-relat 1A; dynamin-like protein 1A, GTPase, membrane fission, motor Pro; HET: GDP; 2.40A {Arabidopsis thaliana} PDB: 3t35_A* Back     alignment and structure
>1rz3_A Hypothetical protein rbstp0775; MCSG, structural genomics, PSI, protein structure initiative; 1.90A {Geobacillus stearothermophilus} SCOP: c.37.1.6 Back     alignment and structure
>1knq_A Gluconate kinase; ALFA/beta structure, transferase; 2.00A {Escherichia coli} SCOP: c.37.1.17 PDB: 1ko1_A 1ko4_A 1ko5_A* 1ko8_A* 1kof_A* Back     alignment and structure
>1svm_A Large T antigen; AAA+ fold, viral protein; HET: ATP; 1.94A {Simian virus 40} SCOP: c.37.1.20 PDB: 1svl_A* 1svo_A 1n25_A 2h1l_A Back     alignment and structure
>1svm_A Large T antigen; AAA+ fold, viral protein; HET: ATP; 1.94A {Simian virus 40} SCOP: c.37.1.20 PDB: 1svl_A* 1svo_A 1n25_A 2h1l_A Back     alignment and structure
>3b9p_A CG5977-PA, isoform A; AAA ATPase, ATP-binding, nucleotide-binding, hydrolase; 2.70A {Drosophila melanogaster} Back     alignment and structure
>1ni3_A YCHF GTPase, YCHF GTP-binding protein; structural genomics, GTP1OBG, PSI, protein structure initiative; 2.80A {Schizosaccharomyces pombe} SCOP: c.37.1.8 d.15.10.2 Back     alignment and structure
>1v5w_A DMC1, meiotic recombination protein DMC1/LIM15 homolog; DNA-binding protein, ring protein, octamer, AAA ATPase; 3.20A {Homo sapiens} SCOP: c.37.1.11 PDB: 2zjb_A Back     alignment and structure
>1ewq_A DNA mismatch repair protein MUTS; multiple domains of protein, mostly mixed alpha-beta structures, one domain is entirely helical; HET: DNA; 2.20A {Thermus aquaticus} SCOP: a.113.1.1 c.37.1.12 c.55.6.1 d.75.2.1 PDB: 1nne_A* 1fw6_A* 1ewr_A* Back     alignment and structure
>1wb9_A DNA mismatch repair protein MUTS; DNA-binding, ATP-binding, DNA binding, DNA repair, mismatch recognition; HET: DNA ADP; 2.10A {Escherichia coli} SCOP: a.113.1.1 c.37.1.12 c.55.6.1 d.75.2.1 PDB: 1wbb_A* 1e3m_A* 1oh5_A* 1oh6_A* 1oh7_A* 1oh8_A* 1w7a_A* 2wtu_A* 1wbd_A* 1ng9_A* 3k0s_A* Back     alignment and structure
>1n0w_A DNA repair protein RAD51 homolog 1; DNA repair, homologous recombination, breast cancer susceptibility, RECA-like ATPase, protein complex; HET: DNA MSE; 1.70A {Homo sapiens} SCOP: c.37.1.11 Back     alignment and structure
>2w0m_A SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus solfataricus P2} Back     alignment and structure
>2qt1_A Nicotinamide riboside kinase 1; non-protein kinase, NAD+, NRK1, nicotinic acid riboside kinase activity, NAD biosynthesis; HET: NNR; 1.32A {Homo sapiens} PDB: 2qsy_A* 2qsz_A* 2qt0_A* 2p0e_A* 2qg6_A* 2ql6_A* Back     alignment and structure
>2dy1_A Elongation factor G; translocation, GTP complex, structural genomics, NPPSFA; HET: GTP; 1.60A {Thermus thermophilus} SCOP: b.43.3.1 c.37.1.8 d.14.1.1 d.58.11.1 d.58.11.1 PDB: 1wdt_A* Back     alignment and structure
>1zu4_A FTSY; GTPase, signal recognition particle, SRP, receptor, protein transport; 1.95A {Mycoplasma mycoides} PDB: 1zu5_A Back     alignment and structure
>3tau_A Guanylate kinase, GMP kinase; structural genomics, center for structural genomics of infec diseases, csgid, putative guanylate kinase; HET: MSE; 2.05A {Listeria monocytogenes} Back     alignment and structure
>3cr8_A Sulfate adenylyltranferase, adenylylsulfate kinase; APS kinase, transferase, sulfate metabolism, nucleotide 2 kinase; 2.95A {Thiobacillus denitrificans} Back     alignment and structure
>2z4s_A Chromosomal replication initiator protein DNAA; AAA+ ATPase, domain III (ATPase domain), ATP-binding, cytoplasm, DNA replication; HET: ADP; 3.00A {Thermotoga maritima} PDB: 2z4r_A* Back     alignment and structure
>3tqc_A Pantothenate kinase; biosynthesis of cofactors, prosthetic groups, carriers, TRAN; HET: ADP; 2.30A {Coxiella burnetii} Back     alignment and structure
>2qt1_A Nicotinamide riboside kinase 1; non-protein kinase, NAD+, NRK1, nicotinic acid riboside kinase activity, NAD biosynthesis; HET: NNR; 1.32A {Homo sapiens} PDB: 2qsy_A* 2qsz_A* 2qt0_A* 2p0e_A* 2qg6_A* 2ql6_A* Back     alignment and structure
>2z43_A DNA repair and recombination protein RADA; archaea, filament, DNA binding, molecular SWI RECA, DMC1; HET: DNA; 1.93A {Sulfolobus solfataricus} PDB: 2bke_A* 2dfl_A* 2zub_A* 2zuc_A* 2zud_A* Back     alignment and structure
>3ney_A 55 kDa erythrocyte membrane protein; structural genomics consortium, SGC, 55 kDa erythrocyte MEMB protein; 2.26A {Homo sapiens} SCOP: c.37.1.0 Back     alignment and structure
>1fnn_A CDC6P, cell division control protein 6; ORC1, AAA protein, DNA replication initation factor, cell cycle control factor; HET: ADP; 2.00A {Pyrobaculum aerophilum} SCOP: a.4.5.11 c.37.1.20 Back     alignment and structure
>2cvh_A DNA repair and recombination protein RADB; filament formation, homologous recombination, ATPase domain, hyperthermophIle; HET: DNA; 2.20A {Thermococcus kodakarensis} PDB: 2cvf_A* Back     alignment and structure
>1kag_A SKI, shikimate kinase I; transferase, structural genomics, PSI, protein structure initiative; 2.05A {Escherichia coli} SCOP: c.37.1.2 Back     alignment and structure
>1f2t_A RAD50 ABC-ATPase; DNA double-strand break repair, replication; 1.60A {Pyrococcus furiosus} SCOP: c.37.1.12 PDB: 1f2u_A* 1us8_A* Back     alignment and structure
>1lv7_A FTSH; alpha/beta domain, four helix bundle, hydrolase; 1.50A {Escherichia coli} SCOP: c.37.1.20 Back     alignment and structure
>1odf_A YGR205W, hypothetical 33.3 kDa protein in ADE3-Ser2 intergenic region; yeast protein, ATP binding protein; 2.25A {Saccharomyces cerevisiae} SCOP: c.37.1.6 Back     alignment and structure
>2o5v_A DNA replication and repair protein RECF; ABC ATPase, walker A motif, P-loop, signature motif, replication/recombination complex; HET: DNA; 1.61A {Deinococcus radiodurans} Back     alignment and structure
>2gj8_A MNME, tRNA modification GTPase TRME; G-domain dimer, alpha-beta-sandwich, hydrolase; HET: GDP; 1.70A {Escherichia coli BL21} SCOP: c.37.1.8 PDB: 2gj9_A* 2gja_A* 1rfl_A Back     alignment and structure
>1ega_A Protein (GTP-binding protein ERA); GTPase, RNA-binding, RAS-like, hydrolase; 2.40A {Escherichia coli} SCOP: c.37.1.8 d.52.3.1 PDB: 1x1l_X 3ieu_A* 1x18_X Back     alignment and structure
>3qf7_A RAD50; ABC-ATPase, ATPase, hydrolase; HET: ANP; 1.90A {Thermotoga maritima} PDB: 3qg5_A 3tho_A* Back     alignment and structure
>1oix_A RAS-related protein RAB-11A; small G protein, intracellular trafficking, GTP-binding, lipoprotein, prenylation, protein transport; HET: GDP; 1.7A {Homo sapiens} SCOP: c.37.1.8 PDB: 1oiw_A* 1oiv_A* 3rwo_B* 3rwm_B* Back     alignment and structure
>3cf0_A Transitional endoplasmic reticulum ATPase; AAA, P97/VCP, ERAD, CDC48, ATP-binding, lipid-binding, nucle binding, nucleus, phosphoprotein, transport; HET: ADP; 3.00A {Mus musculus} Back     alignment and structure
>3thx_B DNA mismatch repair protein MSH3; ABC family ATPase, mismatch recognition, mismatched unpaired DNA binding protein-DNA complex; HET: DNA ADP; 2.70A {Homo sapiens} PDB: 3thw_B* 3thy_B* 3thz_B* Back     alignment and structure
>2f9l_A RAB11B, member RAS oncogene family; RAB11B GTPase, vesicle transport, hydrolase; HET: GDP; 1.55A {Homo sapiens} SCOP: c.37.1.8 PDB: 2f9m_A* 1yzk_A* 2hv8_A* 2gzd_A* 2gzh_A* 2d7c_A* 3bfk_A* Back     alignment and structure
>2p67_A LAO/AO transport system kinase; ARGK, structural GEN PSI-2, protein structure initiative, NEW YORK SGX research for structural genomics; 1.80A {Escherichia coli} SCOP: c.37.1.10 Back     alignment and structure
>3kl4_A SRP54, signal recognition 54 kDa protein; signal recognition particle, SRP, SRP54, FFH, signal sequenc peptide; 3.50A {Sulfolobus solfataricus} PDB: 1qzx_A 1qzw_A Back     alignment and structure
>1ixz_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 2.20A {Thermus thermophilus} SCOP: c.37.1.20 PDB: 1iy0_A* 1iy1_A* Back     alignment and structure
>2qby_A CDC6 homolog 1, cell division control protein 6 homolog 1; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} Back     alignment and structure
>1iy2_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 3.20A {Thermus thermophilus} SCOP: c.37.1.20 Back     alignment and structure
>2www_A Methylmalonic aciduria type A protein, mitochondrial; transport protein, nucleotide-binding; HET: GDP 2PE; 2.64A {Homo sapiens} Back     alignment and structure
>1mky_A Probable GTP-binding protein ENGA; GTPase, DER, KH-domain, tandem G-domains, ligand binding protein; HET: GDP; 1.90A {Thermotoga maritima} SCOP: c.37.1.8 c.37.1.8 d.52.5.1 Back     alignment and structure
>3llm_A ATP-dependent RNA helicase A; alpha-beta-alpha, structural genomics, structural genomics consortium, SGC, activator, ATP-binding, DNA-binding; HET: ADP; 2.80A {Homo sapiens} Back     alignment and structure
>4ad8_A DNA repair protein RECN; DNA binding protein, ATPase domain; HET: DNA; 4.00A {Deinococcus radiodurans} Back     alignment and structure
>1nlf_A Regulatory protein REPA; replicative DNA helicase structural changes, replication; 1.95A {Escherichia coli} SCOP: c.37.1.11 PDB: 1g8y_A 1olo_A Back     alignment and structure
>1kag_A SKI, shikimate kinase I; transferase, structural genomics, PSI, protein structure initiative; 2.05A {Escherichia coli} SCOP: c.37.1.2 Back     alignment and structure
>2pez_A Bifunctional 3'-phosphoadenosine 5'- phosphosulfate synthetase 1 (PAPS synthetase...; NMP-kinase fold, protein in complex with nucleic acid; HET: GGZ DAT; 1.40A {Homo sapiens} PDB: 2pey_A* 2ax4_A* Back     alignment and structure
>1u94_A RECA protein, recombinase A; homologous recombination, ATPase, DNA repair, DNA binding protein; 1.90A {Escherichia coli} SCOP: c.37.1.11 d.48.1.1 PDB: 1u98_A 1u99_A 1xms_A* 1xmv_A* 2rec_A 2reb_A 1n03_A* 1rea_A 1aa3_A Back     alignment and structure
>4eaq_A DTMP kinase, thymidylate kinase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, MTBI, transferase; HET: ATM; 1.85A {Staphylococcus aureus subsp} PDB: 4dwj_A* 4f4i_A Back     alignment and structure
>2gj8_A MNME, tRNA modification GTPase TRME; G-domain dimer, alpha-beta-sandwich, hydrolase; HET: GDP; 1.70A {Escherichia coli BL21} SCOP: c.37.1.8 PDB: 2gj9_A* 2gja_A* 1rfl_A Back     alignment and structure
>1f6b_A SAR1; gtpases, N-terminal helix, Mg-containing complex, protein transport; HET: GDP; 1.70A {Cricetulus griseus} SCOP: c.37.1.8 PDB: 2fmx_A* 2fa9_A* 2gao_A* Back     alignment and structure
>4fcw_A Chaperone protein CLPB; AAA domain; HET: ADP; 2.35A {Thermus thermophilus} PDB: 4fcv_A* 4fd2_A* 4fct_A* Back     alignment and structure
>3tqc_A Pantothenate kinase; biosynthesis of cofactors, prosthetic groups, carriers, TRAN; HET: ADP; 2.30A {Coxiella burnetii} Back     alignment and structure
>1f2t_A RAD50 ABC-ATPase; DNA double-strand break repair, replication; 1.60A {Pyrococcus furiosus} SCOP: c.37.1.12 PDB: 1f2u_A* 1us8_A* Back     alignment and structure
>1cke_A CK, MSSA, protein (cytidine monophosphate kinase); nucleotide monophosphate kinase,, transferase; 1.75A {Escherichia coli} SCOP: c.37.1.1 PDB: 1kdo_A* 1kdp_A* 1kdr_A* 1kdt_A* 2cmk_A* 2fem_A 2feo_A* Back     alignment and structure
>3hr8_A Protein RECA; alpha and beta proteins (A/B, A+B), ATP-binding, cytoplasm, damage, DNA recombination, DNA repair, DNA-binding; 1.95A {Thermotoga maritima} Back     alignment and structure
>3thx_A DNA mismatch repair protein MSH2; ABC family ATPase, mismatch recognition, mismatched unpaired DNA binding protein-DNA complex; HET: DNA ADP; 2.70A {Homo sapiens} PDB: 2o8c_A* 2o8d_A* 2o8f_A* 3thw_A* 2o8b_A* 3thy_A* 3thz_A* 2o8e_A* Back     alignment and structure
>3m6a_A ATP-dependent protease LA 1; alpha, beta, ATP-binding, hydrolase, nucleotide-binding, Pro serine protease, stress response; HET: ADP; 3.40A {Bacillus subtilis} PDB: 1x37_A Back     alignment and structure
>1m2o_B GTP-binding protein SAR1, GTP binding protein; zinc-finger, beta barrel, VWA domain, gelsolin domain,; HET: GNP; 2.50A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 2qtv_B* Back     alignment and structure
>2q6t_A DNAB replication FORK helicase; hydrolase; 2.90A {Thermus aquaticus} Back     alignment and structure
>1m2o_B GTP-binding protein SAR1, GTP binding protein; zinc-finger, beta barrel, VWA domain, gelsolin domain,; HET: GNP; 2.50A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 2qtv_B* Back     alignment and structure
>1rz3_A Hypothetical protein rbstp0775; MCSG, structural genomics, PSI, protein structure initiative; 1.90A {Geobacillus stearothermophilus} SCOP: c.37.1.6 Back     alignment and structure
>3k1j_A LON protease, ATP-dependent protease LON; ATP-binding, nucleotide-binding, Pro hydrolase; HET: ADP PE8; 2.00A {Thermococcus onnurineus} Back     alignment and structure
>1m7g_A Adenylylsulfate kinase; APS kinase, transferase, sulfate Met nucleotide 2 kinase; HET: AV2 ADX ADP; 1.43A {Penicillium chrysogenum} SCOP: c.37.1.4 PDB: 1d6j_A* 1m7h_A* 3cr7_A* Back     alignment and structure
>3ec2_A DNA replication protein DNAC; helicase loader, replication initiation factor, ATP-binding, nucleotide-binding; HET: DNA ADP; 2.70A {Aquifex aeolicus} PDB: 3ecc_A* Back     alignment and structure
>3cr8_A Sulfate adenylyltranferase, adenylylsulfate kinase; APS kinase, transferase, sulfate metabolism, nucleotide 2 kinase; 2.95A {Thiobacillus denitrificans} Back     alignment and structure
>3ice_A Transcription termination factor RHO; transcription, ATPase, hexamer, helicase, RNA, RECA, OB fold ATP-binding, hydrolase; HET: MSE ADP SPD; 2.80A {Escherichia coli k-12} PDB: 1pv4_A 1pvo_A* 1xpo_A* 1xpr_A* 1xpu_A* 2ht1_A Back     alignment and structure
>3lda_A DNA repair protein RAD51; DNA binding protein, ATP-binding, DNA damage, DNA recombinat repair, nucleotide-binding; HET: DNA; 2.50A {Saccharomyces cerevisiae} PDB: 1szp_A* Back     alignment and structure
>3qks_A DNA double-strand break repair RAD50 ATPase; RECA-like fold, coiled-coils, ATPase, exonuclease, endonucle binding, DNA binding; HET: DNA; 2.10A {Pyrococcus furiosus} PDB: 3qkr_A* Back     alignment and structure
>1f6b_A SAR1; gtpases, N-terminal helix, Mg-containing complex, protein transport; HET: GDP; 1.70A {Cricetulus griseus} SCOP: c.37.1.8 PDB: 2fmx_A* 2fa9_A* 2gao_A* Back     alignment and structure
>4eaq_A DTMP kinase, thymidylate kinase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, MTBI, transferase; HET: ATM; 1.85A {Staphylococcus aureus subsp} PDB: 4dwj_A* 4f4i_A Back     alignment and structure
>2qtf_A Protein HFLX, GTP-binding protein; beta-alpha-barrels, nucleotide-binding, nucleotide binding protein; 2.00A {Sulfolobus solfataricus P2} PDB: 2qth_A* 3kxi_A* 3kxl_A 3kxk_A Back     alignment and structure
>1mky_A Probable GTP-binding protein ENGA; GTPase, DER, KH-domain, tandem G-domains, ligand binding protein; HET: GDP; 1.90A {Thermotoga maritima} SCOP: c.37.1.8 c.37.1.8 d.52.5.1 Back     alignment and structure
>2qag_A Septin-2, protein NEDD5; cell cycle, cell division, GTP-binding, nucleotide-binding, phosphorylation, acetylation, alternative splicing, coiled coil; HET: GDP GTP; 4.00A {Homo sapiens} Back     alignment and structure
>1np6_A Molybdopterin-guanine dinucleotide biosynthesis protein B; mixed alpha-beta fold, elongated beta-sheet, walker A motif, P-loop structural motif; 1.90A {Escherichia coli} SCOP: c.37.1.10 PDB: 1p9n_A Back     alignment and structure
>2qor_A Guanylate kinase; phosphotransferase, purine metabolism, structural genomics, structural genomics of pathogenic protozoa consortium; HET: 5GP POP; 1.80A {Plasmodium vivax} Back     alignment and structure
>2qor_A Guanylate kinase; phosphotransferase, purine metabolism, structural genomics, structural genomics of pathogenic protozoa consortium; HET: 5GP POP; 1.80A {Plasmodium vivax} Back     alignment and structure
>2o8b_B DNA mismatch repair protein MSH6; DNA damage response, somatic hypermutat protein-DNA complex, DNA mispair, cancer; HET: DNA ADP; 2.75A {Homo sapiens} PDB: 2o8c_B* 2o8d_B* 2o8e_B* 2o8f_B* Back     alignment and structure
>3bgw_A DNAB-like replicative helicase; ATPase, replication; 3.91A {Bacillus phage SPP1} Back     alignment and structure
>1y63_A LMAJ004144AAA protein; structural genomics, protein structure initiative, PSI, SGPP structural genomics of pathogenic protozoa consortium; HET: ADP; 1.70A {Leishmania major} SCOP: c.37.1.1 Back     alignment and structure
>1l8q_A Chromosomal replication initiator protein DNAA; AAA+, helix-turn-helix, nucleotide-binding, DNA binding, REP initiation, DNA binding protein; HET: ADP; 2.70A {Aquifex aeolicus} SCOP: a.4.12.2 c.37.1.20 PDB: 3r8f_A* 2hcb_A* Back     alignment and structure
>3h4m_A Proteasome-activating nucleotidase; ATPase, PAN, ATP-binding, nucleotide-binding, HY; HET: ADP; 3.11A {Methanocaldococcus jannaschii} Back     alignment and structure
>2dr3_A UPF0273 protein PH0284; RECA superfamily ATPase, hexamer, structural genomics; HET: ADP; 2.00A {Pyrococcus horikoshii} Back     alignment and structure
>2yvu_A Probable adenylyl-sulfate kinase; transferase, structural genomics, NPPSFA, national P protein structural and functional analyses; 2.10A {Aeropyrum pernix} Back     alignment and structure
>2wji_A Ferrous iron transport protein B homolog; membrane G-proteins, cell membrane, ION transport, transmembrane; HET: GNP; 1.90A {Methanocaldococcus jannaschii} PDB: 2wjj_A* 2wjh_A* Back     alignment and structure
>2ffh_A Protein (FFH); SRP54, signal recognition particle, GTPase, M domain, RNA-binding, signal sequence-binding, helix-turn-helix, protein targeting; 3.20A {Thermus aquaticus} SCOP: a.24.13.1 a.36.1.1 c.37.1.10 PDB: 2iy3_A Back     alignment and structure
>2wjg_A FEOB, ferrous iron transport protein B homolog; membrane G-proteins, cell membrane, ION transport, transmembrane; HET: GDP; 2.20A {Methanocaldococcus jannaschii} Back     alignment and structure
>3qks_A DNA double-strand break repair RAD50 ATPase; RECA-like fold, coiled-coils, ATPase, exonuclease, endonucle binding, DNA binding; HET: DNA; 2.10A {Pyrococcus furiosus} PDB: 3qkr_A* Back     alignment and structure
>2wji_A Ferrous iron transport protein B homolog; membrane G-proteins, cell membrane, ION transport, transmembrane; HET: GNP; 1.90A {Methanocaldococcus jannaschii} PDB: 2wjj_A* 2wjh_A* Back     alignment and structure
>2qag_A Septin-2, protein NEDD5; cell cycle, cell division, GTP-binding, nucleotide-binding, phosphorylation, acetylation, alternative splicing, coiled coil; HET: GDP GTP; 4.00A {Homo sapiens} Back     alignment and structure
>1w1w_A Structural maintenance of chromosome 1; cohesin, chromosome segregation, cell adhesion, kleisin, MIT cell cycle; HET: ATG; 2.90A {Saccharomyces cerevisiae} SCOP: c.37.1.12 Back     alignment and structure
>3ice_A Transcription termination factor RHO; transcription, ATPase, hexamer, helicase, RNA, RECA, OB fold ATP-binding, hydrolase; HET: MSE ADP SPD; 2.80A {Escherichia coli k-12} PDB: 1pv4_A 1pvo_A* 1xpo_A* 1xpr_A* 1xpu_A* 2ht1_A Back     alignment and structure
>1jjv_A Dephospho-COA kinase; P-loop nucleotide-binding fold, structure 2 function project, S2F, structural genomics, transferase; HET: ATP; 2.00A {Haemophilus influenzae} SCOP: c.37.1.1 Back     alignment and structure
>2pez_A Bifunctional 3'-phosphoadenosine 5'- phosphosulfate synthetase 1 (PAPS synthetase...; NMP-kinase fold, protein in complex with nucleic acid; HET: GGZ DAT; 1.40A {Homo sapiens} PDB: 2pey_A* 2ax4_A* Back     alignment and structure
>2ohf_A Protein OLA1, GTP-binding protein 9; ATPase, GTPase, P-loop, OBG-like, hydrolase; HET: ACP; 2.70A {Homo sapiens} Back     alignment and structure
>3lxx_A GTPase IMAP family member 4; structural genomics consortium, SGC, coiled coil, GTP- binding, nucleotide-binding, immune system; HET: GDP; 2.15A {Homo sapiens} Back     alignment and structure
>3qkt_A DNA double-strand break repair RAD50 ATPase; RECA-like fold, coiled-coils, ATP binding, DNA bindi MRE11, replication; HET: DNA ANP; 1.90A {Pyrococcus furiosus} PDB: 3qku_A* 1ii8_A 3qks_B* 3qkr_B* 1ii8_B Back     alignment and structure
>2ga8_A Hypothetical 39.9 kDa protein; YFR007W, YFH7, unknown function; HET: CME; 1.77A {Saccharomyces cerevisiae} PDB: 2gaa_A* Back     alignment and structure
>2wjg_A FEOB, ferrous iron transport protein B homolog; membrane G-proteins, cell membrane, ION transport, transmembrane; HET: GDP; 2.20A {Methanocaldococcus jannaschii} Back     alignment and structure
>2p67_A LAO/AO transport system kinase; ARGK, structural GEN PSI-2, protein structure initiative, NEW YORK SGX research for structural genomics; 1.80A {Escherichia coli} SCOP: c.37.1.10 Back     alignment and structure
>1np6_A Molybdopterin-guanine dinucleotide biosynthesis protein B; mixed alpha-beta fold, elongated beta-sheet, walker A motif, P-loop structural motif; 1.90A {Escherichia coli} SCOP: c.37.1.10 PDB: 1p9n_A Back     alignment and structure
>1cke_A CK, MSSA, protein (cytidine monophosphate kinase); nucleotide monophosphate kinase,, transferase; 1.75A {Escherichia coli} SCOP: c.37.1.1 PDB: 1kdo_A* 1kdp_A* 1kdr_A* 1kdt_A* 2cmk_A* 2fem_A 2feo_A* Back     alignment and structure
>1j8m_F SRP54, signal recognition 54 kDa protein; signaling protein; 2.00A {Acidianus ambivalens} SCOP: a.24.13.1 c.37.1.10 PDB: 1j8y_F Back     alignment and structure
>3m6a_A ATP-dependent protease LA 1; alpha, beta, ATP-binding, hydrolase, nucleotide-binding, Pro serine protease, stress response; HET: ADP; 3.40A {Bacillus subtilis} PDB: 1x37_A Back     alignment and structure
>2www_A Methylmalonic aciduria type A protein, mitochondrial; transport protein, nucleotide-binding; HET: GDP 2PE; 2.64A {Homo sapiens} Back     alignment and structure
>2p5t_B PEZT; postsegregational killing system, phosphoryltransferase, HEL helix motif, transcription regulator; 3.20A {Streptococcus pneumoniae} Back     alignment and structure
>2qz4_A Paraplegin; AAA+, SPG7, protease, ADP, structural genomics, structural G consortium, SGC, ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.22A {Homo sapiens} Back     alignment and structure
>1sxj_E Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>2if2_A Dephospho-COA kinase; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium, NESG; 3.00A {Aquifex aeolicus} Back     alignment and structure
>2b8t_A Thymidine kinase; deoxyribonucleoside kinase, zinc-binding domain, TK1, UU-TK, transferase; HET: THM; 2.00A {Ureaplasma parvum} SCOP: c.37.1.24 g.39.1.14 PDB: 2uz3_A* Back     alignment and structure
>3d8b_A Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, structural genomics consortium, ATP- hydrolase, magnesium, metal-binding, nucleotide-binding; HET: ADP; 2.00A {Homo sapiens} Back     alignment and structure
>3cm0_A Adenylate kinase; ATP-binding, cytoplasm, nucleotide biosynthesis, nucleotide-binding, transferase, structural genomics; 1.80A {Thermus thermophilus} Back     alignment and structure
>1ega_A Protein (GTP-binding protein ERA); GTPase, RNA-binding, RAS-like, hydrolase; 2.40A {Escherichia coli} SCOP: c.37.1.8 d.52.3.1 PDB: 1x1l_X 3ieu_A* 1x18_X Back     alignment and structure
>1qhx_A CPT, protein (chloramphenicol phosphotransferase); kinase, antibiotic resistance, phosphorylation, mononucleoti binding fold; HET: ATP; 2.50A {Streptomyces venezuelae} SCOP: c.37.1.3 PDB: 1grr_A* 1grq_A 1qhs_A* 1qhn_A* 1qhy_A* Back     alignment and structure
>3t61_A Gluconokinase; PSI-biology, structural genomics, protein structure initiati YORK structural genomics research consortium, nysgrc; 2.20A {Sinorhizobium meliloti} Back     alignment and structure
>3auy_A DNA double-strand break repair RAD50 ATPase; DNA repair, ABC transporter ATPase domain-like; HET: DNA ADP; 2.70A {Methanocaldococcus jannaschii} PDB: 3aux_A* 3av0_B* Back     alignment and structure
>1sxj_C Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>2yvu_A Probable adenylyl-sulfate kinase; transferase, structural genomics, NPPSFA, national P protein structural and functional analyses; 2.10A {Aeropyrum pernix} Back     alignment and structure
>3kb2_A SPBC2 prophage-derived uncharacterized protein YORR; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; HET: G3D; 2.20A {Bacillus subtilis} SCOP: c.37.1.1 PDB: 2axp_A* Back     alignment and structure
>1ls1_A Signal recognition particle protein; FFH, SRP54, SRP, GTPase, ultrahigh resolution, protein transport; 1.10A {Thermus aquaticus} SCOP: a.24.13.1 c.37.1.10 PDB: 1jpn_B* 1jpj_A* 1ry1_U* 2j45_A* 1o87_A* 2c04_A* 2j46_A* 1rj9_B* 2c03_A* 2j7p_A* 1okk_A* 2cnw_A* 1ng1_A* 2xkv_A 3ng1_A 1ffh_A 2ng1_A* Back     alignment and structure
>1vma_A Cell division protein FTSY; TM0570, structural genomics, JCS protein structure initiative, PSI, joint center for structu genomics; HET: CIT; 1.60A {Thermotoga maritima} SCOP: a.24.13.1 c.37.1.10 Back     alignment and structure
>1m7g_A Adenylylsulfate kinase; APS kinase, transferase, sulfate Met nucleotide 2 kinase; HET: AV2 ADX ADP; 1.43A {Penicillium chrysogenum} SCOP: c.37.1.4 PDB: 1d6j_A* 1m7h_A* 3cr7_A* Back     alignment and structure
>3t61_A Gluconokinase; PSI-biology, structural genomics, protein structure initiati YORK structural genomics research consortium, nysgrc; 2.20A {Sinorhizobium meliloti} Back     alignment and structure
>2px0_A Flagellar biosynthesis protein FLHF; SRP GTPase, flagellum, protein transport, biosynthetic protein; HET: GNP; 3.00A {Bacillus subtilis} PDB: 2px3_A* 3syn_A* Back     alignment and structure
>2ohf_A Protein OLA1, GTP-binding protein 9; ATPase, GTPase, P-loop, OBG-like, hydrolase; HET: ACP; 2.70A {Homo sapiens} Back     alignment and structure
>1y63_A LMAJ004144AAA protein; structural genomics, protein structure initiative, PSI, SGPP structural genomics of pathogenic protozoa consortium; HET: ADP; 1.70A {Leishmania major} SCOP: c.37.1.1 Back     alignment and structure
>3kb2_A SPBC2 prophage-derived uncharacterized protein YORR; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; HET: G3D; 2.20A {Bacillus subtilis} SCOP: c.37.1.1 PDB: 2axp_A* Back     alignment and structure
>3cmw_A Protein RECA, recombinase A; homologous recombination, recombination/DNA complex; HET: DNA ADP; 2.80A {Escherichia coli} PDB: 3cmt_A* 3cmx_A* 3cmv_A* Back     alignment and structure
>2rhm_A Putative kinase; P-loop containing nucleoside triphosphate hydrolases fold, S genomics, joint center for structural genomics, JCSG; HET: MSE; 1.70A {Chloroflexus aurantiacus} Back     alignment and structure
>1jjv_A Dephospho-COA kinase; P-loop nucleotide-binding fold, structure 2 function project, S2F, structural genomics, transferase; HET: ATP; 2.00A {Haemophilus influenzae} SCOP: c.37.1.1 Back     alignment and structure
>2dhr_A FTSH; AAA+ protein, hexameric Zn metalloprotease, hydrolase; HET: ADP; 3.90A {Thermus thermophilus} Back     alignment and structure
>1qhx_A CPT, protein (chloramphenicol phosphotransferase); kinase, antibiotic resistance, phosphorylation, mononucleoti binding fold; HET: ATP; 2.50A {Streptomyces venezuelae} SCOP: c.37.1.3 PDB: 1grr_A* 1grq_A 1qhs_A* 1qhn_A* 1qhy_A* Back     alignment and structure
>1kht_A Adenylate kinase; phosphotransferase, signaling protein, transferase; HET: AMP; 2.50A {Methanococcus voltae} SCOP: c.37.1.1 PDB: 3h86_B* 1ki9_A Back     alignment and structure
>2p5t_B PEZT; postsegregational killing system, phosphoryltransferase, HEL helix motif, transcription regulator; 3.20A {Streptococcus pneumoniae} Back     alignment and structure
>2ga8_A Hypothetical 39.9 kDa protein; YFR007W, YFH7, unknown function; HET: CME; 1.77A {Saccharomyces cerevisiae} PDB: 2gaa_A* Back     alignment and structure
>2v1u_A Cell division control protein 6 homolog; DNA replication, nucleotide-binding, replication, archaea; HET: ADP; 3.10A {Aeropyrum pernix} Back     alignment and structure
>2zej_A Dardarin, leucine-rich repeat kinase 2; parkinson'S disease, LRRK2, ROC, GTPase, ROCO, ATP-B disease mutation, GTP-binding, GTPase activation; HET: GDP; 2.00A {Homo sapiens} PDB: 3d6t_B* Back     alignment and structure
>2zr9_A Protein RECA, recombinase A; recombination, RECA mutants, DNA-repair, ATP-binding, DNA DA recombination, DNA repair, DNA-binding; HET: DTP; 2.50A {Mycobacterium smegmatis str} PDB: 2zr0_A* 2zra_A* 2zrb_A 2zrm_A* 1ubc_A* 1ubf_A* 1ubg_A* 1ube_A* 2g88_A* 2odw_A* 2oe2_A 2oep_A* 2oes_A 2ofo_A 2zr7_A 2odn_A* 2zrn_A 2zro_A* 2zrp_A* 2zre_A* ... Back     alignment and structure
>1q57_A DNA primase/helicase; dntpase, DNA replication, transferase; HET: DNA; 3.45A {Enterobacteria phage T7} SCOP: c.37.1.11 e.13.1.2 Back     alignment and structure
>3r20_A Cytidylate kinase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, ADP, DCMP, D transferase; 2.00A {Mycobacterium smegmatis} SCOP: c.37.1.0 PDB: 3r8c_A 4die_A* Back     alignment and structure
>1q3t_A Cytidylate kinase; nucleotide monophosphate kinase, CMP kinase, transferase; NMR {Streptococcus pneumoniae} SCOP: c.37.1.1 Back     alignment and structure
>1ex7_A Guanylate kinase; substrate-induced FIT, domain movement, GMP, ATP, substrate specificity, X-RAY diffraction, transferase; HET: 5GP; 1.90A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 1ex6_A* 1gky_A* 3sqk_A 4f4j_A Back     alignment and structure
>2v54_A DTMP kinase, thymidylate kinase; nucleotide biosynthesis, ATP-binding, nucleotide-binding, poxvirus, transferase; HET: TYD POP; 2.4A {Vaccinia virus copenhagen} PDB: 2w0s_A* Back     alignment and structure
>3trf_A Shikimate kinase, SK; amino acid biosynthesis, transferase; 2.60A {Coxiella burnetii} Back     alignment and structure
>2ze6_A Isopentenyl transferase; crown GALL tumor, cytokinin biosynthesis; HET: DST AMP; 2.10A {Agrobacterium tumefaciens} PDB: 2ze5_A* 2ze7_A* 2ze8_A Back     alignment and structure
>3r20_A Cytidylate kinase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, ADP, DCMP, D transferase; 2.00A {Mycobacterium smegmatis} SCOP: c.37.1.0 PDB: 3r8c_A 4die_A* Back     alignment and structure
>2zej_A Dardarin, leucine-rich repeat kinase 2; parkinson'S disease, LRRK2, ROC, GTPase, ROCO, ATP-B disease mutation, GTP-binding, GTPase activation; HET: GDP; 2.00A {Homo sapiens} PDB: 3d6t_B* Back     alignment and structure
>3lw7_A Adenylate kinase related protein (ADKA-like); AMP, PSI, MCSG, structural genomics, midwest center for structural genomics; HET: AMP; 2.30A {Sulfolobus solfataricus} PDB: 3h0k_A Back     alignment and structure
>2plr_A DTMP kinase, probable thymidylate kinase; TMP-binding, ATP-binding, structural GEN NPPSFA; HET: 1PE PGE EPE PG4; 1.60A {Sulfolobus tokodaii} Back     alignment and structure
>1ly1_A Polynucleotide kinase; PNK, phosphatase, transferase; 2.00A {Enterobacteria phage T4} SCOP: c.37.1.1 Back     alignment and structure
>2jaq_A Deoxyguanosine kinase; transferase, deoxyribonucleoside kinase; HET: DCP; 2.3A {Mycoplasma mycoides subsp} PDB: 2jat_A* 2jas_A* Back     alignment and structure
>1ex7_A Guanylate kinase; substrate-induced FIT, domain movement, GMP, ATP, substrate specificity, X-RAY diffraction, transferase; HET: 5GP; 1.90A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 1ex6_A* 1gky_A* 3sqk_A 4f4j_A Back     alignment and structure
>2ze6_A Isopentenyl transferase; crown GALL tumor, cytokinin biosynthesis; HET: DST AMP; 2.10A {Agrobacterium tumefaciens} PDB: 2ze5_A* 2ze7_A* 2ze8_A Back     alignment and structure
>3iij_A Coilin-interacting nuclear ATPase protein; alpha and beta proteins (A/B), protein binding, transferase, phosphotransferase; HET: ADP; 1.76A {Homo sapiens} SCOP: c.37.1.1 PDB: 3iik_A 3iil_A* 3iim_A* 1rkb_A Back     alignment and structure
>3t34_A Dynamin-related protein 1A, linker, dynamin-relat 1A; dynamin-like protein 1A, GTPase, membrane fission, motor Pro; HET: GDP; 2.40A {Arabidopsis thaliana} PDB: 3t35_A* Back     alignment and structure
>2if2_A Dephospho-COA kinase; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium, NESG; 3.00A {Aquifex aeolicus} Back     alignment and structure
>1xjc_A MOBB protein homolog; structural genomics, midwest center for structural GEN PSI, protein structure initiative, MCSG; 2.10A {Geobacillus stearothermophilus} SCOP: c.37.1.10 Back     alignment and structure
>2r6a_A DNAB helicase, replicative helicase; replication, DNAB; 2.90A {Geobacillus stearothermophilus} PDB: 2r6c_A 2r6d_A 2r6e_A 2vyf_A 2vye_A Back     alignment and structure
>1via_A Shikimate kinase; structural genomics, transferase; HET: MSE; 1.57A {Campylobacter jejuni} SCOP: c.37.1.2 Back     alignment and structure
>3k53_A Ferrous iron transport protein B; GTPase fold, helical bundle, G-protein, prokaryote, GTP-BIND nucleotide-binding, metal transport; 2.70A {Pyrococcus furiosus} Back     alignment and structure
>3hu3_A Transitional endoplasmic reticulum ATPase; VCP, transport protein; HET: AGS; 2.20A {Homo sapiens} PDB: 3hu2_A* 3hu1_A* 1e32_A* 1s3s_A* Back     alignment and structure
>2wwf_A Thymidilate kinase, putative; transferase, malaria; HET: TMP ADP; 1.89A {Plasmodium falciparum} PDB: 2wwg_A* 2wwh_A* 2wwi_A* Back     alignment and structure
>1gvn_B Zeta; postsegregational killing system, plasmid; 1.95A {Streptococcus pyogenes} SCOP: c.37.1.21 PDB: 3q8x_B* Back     alignment and structure
>2c95_A Adenylate kinase 1; transferase, AP4A, nucleotide kinase, transferase ATP-bindi; HET: B4P; 1.71A {Homo sapiens} PDB: 1z83_A* 3adk_A Back     alignment and structure
>1vht_A Dephospho-COA kinase; structural genomics, transferase; HET: BA3; 1.59A {Escherichia coli} SCOP: c.37.1.1 PDB: 1vhl_A* 1viy_A 1t3h_A 1n3b_A Back     alignment and structure
>3ihw_A Centg3; RAS, centaurin, GTPase, structural genomics, structural genomics consortium, SGC, alternative splicing, ANK repeat, cytoplasm, GTP-binding; 1.92A {Homo sapiens} SCOP: c.37.1.0 Back     alignment and structure
>1gtv_A TMK, thymidylate kinase; transferase, transferase (ATP:TMP phosphotransferase); HET: TYD TMP; 1.55A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1g3u_A* 1gsi_A* 1mrn_A* 1mrs_A* 1n5i_A* 1n5j_A* 1n5k_A* 1n5l_A* 1w2g_A* 1w2h_A* Back     alignment and structure
>2dy1_A Elongation factor G; translocation, GTP complex, structural genomics, NPPSFA; HET: GTP; 1.60A {Thermus thermophilus} SCOP: b.43.3.1 c.37.1.8 d.14.1.1 d.58.11.1 d.58.11.1 PDB: 1wdt_A* Back     alignment and structure
>3cmw_A Protein RECA, recombinase A; homologous recombination, recombination/DNA complex; HET: DNA ADP; 2.80A {Escherichia coli} PDB: 3cmt_A* 3cmx_A* 3cmv_A* Back     alignment and structure
>1gtv_A TMK, thymidylate kinase; transferase, transferase (ATP:TMP phosphotransferase); HET: TYD TMP; 1.55A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1g3u_A* 1gsi_A* 1mrn_A* 1mrs_A* 1n5i_A* 1n5j_A* 1n5k_A* 1n5l_A* 1w2g_A* 1w2h_A* Back     alignment and structure
>1nn5_A Similar to deoxythymidylate kinase (thymidylate K; P-loop, D4TMP, transferase; HET: 2DT ANP; 1.50A {Homo sapiens} SCOP: c.37.1.1 PDB: 1e2e_A* 1e2d_A* 1e2g_A* 1e2q_A* 1e99_A* 1e9a_A* 1e9b_A* 1nmx_A* 1nmz_A* 1nn0_A* 1nn1_A* 1e2f_A* 1nn3_A* 2xx3_A* 1e9c_A* 1e9d_A* 1e9e_A* 1e98_A* 1nmy_A* 1e9f_A* Back     alignment and structure
>1fzq_A ADP-ribosylation factor-like protein 3; protein-GDP complex without magnesium, ARF family, RAS superfamily, G-domain, signaling protein; HET: MES GDP; 1.70A {Mus musculus} SCOP: c.37.1.8 PDB: 3bh7_A* 3bh6_A* Back     alignment and structure
>2rhm_A Putative kinase; P-loop containing nucleoside triphosphate hydrolases fold, S genomics, joint center for structural genomics, JCSG; HET: MSE; 1.70A {Chloroflexus aurantiacus} Back     alignment and structure
>1tev_A UMP-CMP kinase; ploop, NMP binding region, LID region, conformational changes, transferase; 2.10A {Homo sapiens} SCOP: c.37.1.1 Back     alignment and structure
>3iev_A GTP-binding protein ERA; ERA, GTPase, KH domain, anti-SD, 16S rRNA, 30S ribosome ASSE GTP-binding, nucleotide-binding; HET: GNP; 1.90A {Aquifex aeolicus} PDB: 3r9w_A* 3r9x_A* Back     alignment and structure
>1aky_A Adenylate kinase; ATP:AMP phosphotransferase, myokinase, transferase (phosphotransferase); HET: AP5; 1.63A {Saccharomyces cerevisiae} SCOP: c.37.1.1 g.41.2.1 PDB: 2aky_A* 3aky_A* 1dvr_A* Back     alignment and structure
>3ihw_A Centg3; RAS, centaurin, GTPase, structural genomics, structural genomics consortium, SGC, alternative splicing, ANK repeat, cytoplasm, GTP-binding; 1.92A {Homo sapiens} SCOP: c.37.1.0 Back     alignment and structure
>2bwj_A Adenylate kinase 5; phosphoryl transfer reaction, transferase; HET: AMP; 2.3A {Homo sapiens} Back     alignment and structure
>1nks_A Adenylate kinase; thermophilic, transferase; HET: AMP ADP; 2.57A {Sulfolobus acidocaldarius} SCOP: c.37.1.1 Back     alignment and structure
>3cm0_A Adenylate kinase; ATP-binding, cytoplasm, nucleotide biosynthesis, nucleotide-binding, transferase, structural genomics; 1.80A {Thermus thermophilus} Back     alignment and structure
>1xx6_A Thymidine kinase; NESG, northeast structural genomics consortium, protein STRU initiative, PSI, structural genomics, DNA synthesis; HET: ADP; 2.00A {Clostridium acetobutylicum} SCOP: c.37.1.24 g.39.1.14 Back     alignment and structure
>3lxx_A GTPase IMAP family member 4; structural genomics consortium, SGC, coiled coil, GTP- binding, nucleotide-binding, immune system; HET: GDP; 2.15A {Homo sapiens} Back     alignment and structure
>1kht_A Adenylate kinase; phosphotransferase, signaling protein, transferase; HET: AMP; 2.50A {Methanococcus voltae} SCOP: c.37.1.1 PDB: 3h86_B* 1ki9_A Back     alignment and structure
>3k53_A Ferrous iron transport protein B; GTPase fold, helical bundle, G-protein, prokaryote, GTP-BIND nucleotide-binding, metal transport; 2.70A {Pyrococcus furiosus} Back     alignment and structure
>1ko7_A HPR kinase/phosphatase; protein kinase, phosphotransfer, protein phosphatase, dual activity, product, substrate, transferase, hydrolase; 1.95A {Staphylococcus xylosus} SCOP: c.98.2.1 c.91.1.2 Back     alignment and structure
>1uf9_A TT1252 protein; P-loop, nucleotide binding domain, structural genomics, riken structural genomics/proteomics initiative, RSGI; HET: ATP; 2.80A {Thermus thermophilus} SCOP: c.37.1.1 Back     alignment and structure
>1jal_A YCHF protein; nucleotide-binding fold, structural genomics, structure 2 function project, S2F, unknown function; 2.40A {Haemophilus influenzae} SCOP: c.37.1.8 d.15.10.2 Back     alignment and structure
>2v54_A DTMP kinase, thymidylate kinase; nucleotide biosynthesis, ATP-binding, nucleotide-binding, poxvirus, transferase; HET: TYD POP; 2.4A {Vaccinia virus copenhagen} PDB: 2w0s_A* Back     alignment and structure
>1xjc_A MOBB protein homolog; structural genomics, midwest center for structural GEN PSI, protein structure initiative, MCSG; 2.10A {Geobacillus stearothermophilus} SCOP: c.37.1.10 Back     alignment and structure
>3q85_A GTP-binding protein REM 2; G-domain, CAV2 beta, signaling protein; HET: GNP; 1.76A {Mus musculus} SCOP: c.37.1.8 PDB: 4aii_A* Back     alignment and structure
>1gvn_B Zeta; postsegregational killing system, plasmid; 1.95A {Streptococcus pyogenes} SCOP: c.37.1.21 PDB: 3q8x_B* Back     alignment and structure
>2jaq_A Deoxyguanosine kinase; transferase, deoxyribonucleoside kinase; HET: DCP; 2.3A {Mycoplasma mycoides subsp} PDB: 2jat_A* 2jas_A* Back     alignment and structure
>3cbq_A GTP-binding protein REM 2; FLJ38964A, structural genomics consortium, SGC, GDP, membrane, nucleotide-binding, nucleotide binding protein; HET: GDP; 1.82A {Homo sapiens} Back     alignment and structure
>2h57_A ADP-ribosylation factor-like protein 6; GTP, GTPase, membrane trafficking, structural genomics consortium, SGC, transport protein; HET: GTP; 2.00A {Homo sapiens} Back     alignment and structure
>3trf_A Shikimate kinase, SK; amino acid biosynthesis, transferase; 2.60A {Coxiella burnetii} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 991
d1v43a3239 c.37.1.12 (A:7-245) Hypothetical protein PH0022, N 5e-29
d1v43a3 239 c.37.1.12 (A:7-245) Hypothetical protein PH0022, N 5e-08
d1g6ha_254 c.37.1.12 (A:) MJ1267 {Archaeon Methanococcus jann 2e-25
d1g6ha_ 254 c.37.1.12 (A:) MJ1267 {Archaeon Methanococcus jann 2e-09
d2hyda1255 c.37.1.12 (A:324-578) Putative multidrug export AT 4e-25
d2hyda1 255 c.37.1.12 (A:324-578) Putative multidrug export AT 7e-06
d3dhwc1240 c.37.1.12 (C:1-240) Methionine import ATP-binding 1e-24
d3dhwc1 240 c.37.1.12 (C:1-240) Methionine import ATP-binding 2e-08
d1r0wa_281 c.37.1.12 (A:) Cystic fibrosis transmembrane condu 5e-23
d1r0wa_ 281 c.37.1.12 (A:) Cystic fibrosis transmembrane condu 4e-05
d1jj7a_251 c.37.1.12 (A:) Peptide transporter Tap1, C-termina 1e-22
d1jj7a_ 251 c.37.1.12 (A:) Peptide transporter Tap1, C-termina 6e-05
d1vpla_238 c.37.1.12 (A:) Putative ABC transporter TM0544 {Th 3e-22
d1vpla_ 238 c.37.1.12 (A:) Putative ABC transporter TM0544 {Th 4e-08
d1l2ta_230 c.37.1.12 (A:) MJ0796 {Archaeon Methanococcus jann 3e-22
d1l2ta_230 c.37.1.12 (A:) MJ0796 {Archaeon Methanococcus jann 2e-09
d1b0ua_258 c.37.1.12 (A:) ATP-binding subunit of the histidin 1e-21
d1b0ua_ 258 c.37.1.12 (A:) ATP-binding subunit of the histidin 5e-06
d1mv5a_242 c.37.1.12 (A:) Multidrug resistance ABC transporte 6e-21
d1mv5a_ 242 c.37.1.12 (A:) Multidrug resistance ABC transporte 3e-05
d2awna2232 c.37.1.12 (A:4-235) Maltose transport protein MalK 8e-21
d2awna2 232 c.37.1.12 (A:4-235) Maltose transport protein MalK 3e-08
d3b60a1253 c.37.1.12 (A:329-581) Multidrug resistance ABC tra 2e-20
d3b60a1 253 c.37.1.12 (A:329-581) Multidrug resistance ABC tra 7e-05
d3d31a2229 c.37.1.12 (A:1-229) Sulfate/molybdate ABC transpor 3e-20
d3d31a2 229 c.37.1.12 (A:1-229) Sulfate/molybdate ABC transpor 1e-06
d1oxxk2242 c.37.1.12 (K:1-242) Glucose transport protein GlcV 7e-20
d1oxxk2 242 c.37.1.12 (K:1-242) Glucose transport protein GlcV 2e-08
d2pmka1241 c.37.1.12 (A:467-707) Haemolysin B ATP-binding pro 1e-19
d2pmka1 241 c.37.1.12 (A:467-707) Haemolysin B ATP-binding pro 7e-05
d1l7vc_231 c.37.1.12 (C:) ABC transporter involved in vitamin 5e-19
d1l7vc_ 231 c.37.1.12 (C:) ABC transporter involved in vitamin 1e-07
d1ji0a_240 c.37.1.12 (A:) Branched chain aminoacid ABC transp 1e-18
d1ji0a_ 240 c.37.1.12 (A:) Branched chain aminoacid ABC transp 9e-10
d1sgwa_200 c.37.1.12 (A:) Putative ABC transporter PF0895 {Py 2e-18
d1sgwa_200 c.37.1.12 (A:) Putative ABC transporter PF0895 {Py 2e-08
d1g2912240 c.37.1.12 (1:1-240) Maltose transport protein MalK 2e-18
d1g2912 240 c.37.1.12 (1:1-240) Maltose transport protein MalK 5e-05
d2onka1240 c.37.1.12 (A:1-240) Molybdate/tungstate import ATP 7e-16
d2onka1 240 c.37.1.12 (A:1-240) Molybdate/tungstate import ATP 1e-04
d1ye8a1178 c.37.1.11 (A:1-178) Hypothetical kinase-like prote 7e-06
g1f2t.1292 c.37.1.12 (A:,B:) Rad50 {Archaeon Pyrococcus furio 4e-05
g1f2t.1 292 c.37.1.12 (A:,B:) Rad50 {Archaeon Pyrococcus furio 0.001
d1n0wa_242 c.37.1.11 (A:) DNA repair protein Rad51, catalytic 6e-05
d1svma_362 c.37.1.20 (A:) Papillomavirus large T antigen heli 7e-05
d1np6a_170 c.37.1.10 (A:) Molybdopterin-guanine dinucleotide 4e-04
d1szpa2251 c.37.1.11 (A:145-395) DNA repair protein Rad51, ca 0.001
d2i1qa2258 c.37.1.11 (A:65-322) DNA repair protein Rad51, cat 0.002
d1nlfa_274 c.37.1.11 (A:) Hexameric replicative helicase repA 0.002
d1tf7a2242 c.37.1.11 (A:256-497) Circadian clock protein KaiC 0.004
>d1v43a3 c.37.1.12 (A:7-245) Hypothetical protein PH0022, N-terminal domain {Pyrococcus horikoshii [TaxId: 53953]} Length = 239 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: ABC transporter ATPase domain-like
domain: Hypothetical protein PH0022, N-terminal domain
species: Pyrococcus horikoshii [TaxId: 53953]
 Score =  114 bits (286), Expect = 5e-29
 Identities = 56/271 (20%), Positives = 98/271 (36%), Gaps = 54/271 (19%)

Query: 165 LTILKDVSGVIKPGRLTLLLGPPSSGKTTLLLALAGKLDPTLKVSGTVTYNGHDMDEFVP 224
            T +  ++  IK G   +LLGP   GKTT L  +AG  +PT    G + +   D+    P
Sbjct: 19  FTAVNKLNLTIKDGEFLVLLGPSGCGKTTTLRMIAGLEEPT---EGRIYFGDRDVTYLPP 75

Query: 225 -QRTAAYISQHDNHIGEMTVRETLAFSARCQGVGTRYEMLTELARREKAAGIKPDPDIDV 283
             R  + + Q       MTV E +AF  + +                             
Sbjct: 76  KDRNISMVFQSYAVWPHMTVYENIAFPLKIKKFP-------------------------- 109

Query: 284 YMKAIATEGQEANVITDYYLKVLGLDVCADTMVGDEMIRGISGGQKKRVTTGEMMVGPAL 343
                     E +    +  ++L ++   +          +SGGQ++RV     +V    
Sbjct: 110 --------KDEIDKRVRWAAELLQIEELLNRYPAQ-----LSGGQRQRVAVARAIVVEPD 156

Query: 344 ALFMDEISTGLDSSTTFQIVNCLRQNIHINSGTAVISLLQPAPETYDLFDDIILLSDGQI 403
            L MDE  + LD+     +   +++ +        I +     E   + D I +++ GQ+
Sbjct: 157 VLLMDEPLSNLDAKLRVAMRAEIKK-LQQKLKVTTIYVTHDQVEAMTMGDRIAVMNRGQL 215

Query: 404 VYQG-PRELVLEFFASMGFRCPKRKGVADFL 433
           +  G P E+         +  P    VA F+
Sbjct: 216 LQIGSPTEV---------YLRPNSVFVATFI 237


>d1v43a3 c.37.1.12 (A:7-245) Hypothetical protein PH0022, N-terminal domain {Pyrococcus horikoshii [TaxId: 53953]} Length = 239 Back     information, alignment and structure
>d1g6ha_ c.37.1.12 (A:) MJ1267 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Length = 254 Back     information, alignment and structure
>d1g6ha_ c.37.1.12 (A:) MJ1267 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Length = 254 Back     information, alignment and structure
>d2hyda1 c.37.1.12 (A:324-578) Putative multidrug export ATP-binding/permease protein SAV1866 {Staphylococcus aureus [TaxId: 1280]} Length = 255 Back     information, alignment and structure
>d2hyda1 c.37.1.12 (A:324-578) Putative multidrug export ATP-binding/permease protein SAV1866 {Staphylococcus aureus [TaxId: 1280]} Length = 255 Back     information, alignment and structure
>d3dhwc1 c.37.1.12 (C:1-240) Methionine import ATP-binding protein MetN {Escherichia coli [TaxId: 562]} Length = 240 Back     information, alignment and structure
>d3dhwc1 c.37.1.12 (C:1-240) Methionine import ATP-binding protein MetN {Escherichia coli [TaxId: 562]} Length = 240 Back     information, alignment and structure
>d1r0wa_ c.37.1.12 (A:) Cystic fibrosis transmembrane conductance regulator, CFTR, nucleotide-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 281 Back     information, alignment and structure
>d1r0wa_ c.37.1.12 (A:) Cystic fibrosis transmembrane conductance regulator, CFTR, nucleotide-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 281 Back     information, alignment and structure
>d1jj7a_ c.37.1.12 (A:) Peptide transporter Tap1, C-terminal ABC domain {Human (Homo sapiens) [TaxId: 9606]} Length = 251 Back     information, alignment and structure
>d1jj7a_ c.37.1.12 (A:) Peptide transporter Tap1, C-terminal ABC domain {Human (Homo sapiens) [TaxId: 9606]} Length = 251 Back     information, alignment and structure
>d1vpla_ c.37.1.12 (A:) Putative ABC transporter TM0544 {Thermotoga maritima [TaxId: 2336]} Length = 238 Back     information, alignment and structure
>d1vpla_ c.37.1.12 (A:) Putative ABC transporter TM0544 {Thermotoga maritima [TaxId: 2336]} Length = 238 Back     information, alignment and structure
>d1l2ta_ c.37.1.12 (A:) MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Length = 230 Back     information, alignment and structure
>d1l2ta_ c.37.1.12 (A:) MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Length = 230 Back     information, alignment and structure
>d1b0ua_ c.37.1.12 (A:) ATP-binding subunit of the histidine permease {Salmonella typhimurium [TaxId: 90371]} Length = 258 Back     information, alignment and structure
>d1b0ua_ c.37.1.12 (A:) ATP-binding subunit of the histidine permease {Salmonella typhimurium [TaxId: 90371]} Length = 258 Back     information, alignment and structure
>d1mv5a_ c.37.1.12 (A:) Multidrug resistance ABC transporter LmrA, C-terminal domain {Lactococcus lactis [TaxId: 1358]} Length = 242 Back     information, alignment and structure
>d1mv5a_ c.37.1.12 (A:) Multidrug resistance ABC transporter LmrA, C-terminal domain {Lactococcus lactis [TaxId: 1358]} Length = 242 Back     information, alignment and structure
>d2awna2 c.37.1.12 (A:4-235) Maltose transport protein MalK, N-terminal domain {Escherichia coli [TaxId: 562]} Length = 232 Back     information, alignment and structure
>d2awna2 c.37.1.12 (A:4-235) Maltose transport protein MalK, N-terminal domain {Escherichia coli [TaxId: 562]} Length = 232 Back     information, alignment and structure
>d3b60a1 c.37.1.12 (A:329-581) Multidrug resistance ABC transporter MsbA, C-terminal domain {Salmonella typhimurium [TaxId: 90371]} Length = 253 Back     information, alignment and structure
>d3b60a1 c.37.1.12 (A:329-581) Multidrug resistance ABC transporter MsbA, C-terminal domain {Salmonella typhimurium [TaxId: 90371]} Length = 253 Back     information, alignment and structure
>d3d31a2 c.37.1.12 (A:1-229) Sulfate/molybdate ABC transporter, ATP-binding protein {Methanosarcina acetivorans [TaxId: 2214]} Length = 229 Back     information, alignment and structure
>d3d31a2 c.37.1.12 (A:1-229) Sulfate/molybdate ABC transporter, ATP-binding protein {Methanosarcina acetivorans [TaxId: 2214]} Length = 229 Back     information, alignment and structure
>d1oxxk2 c.37.1.12 (K:1-242) Glucose transport protein GlcV, N-terminal domain {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Length = 242 Back     information, alignment and structure
>d1oxxk2 c.37.1.12 (K:1-242) Glucose transport protein GlcV, N-terminal domain {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Length = 242 Back     information, alignment and structure
>d2pmka1 c.37.1.12 (A:467-707) Haemolysin B ATP-binding protein {Escherichia coli [TaxId: 562]} Length = 241 Back     information, alignment and structure
>d2pmka1 c.37.1.12 (A:467-707) Haemolysin B ATP-binding protein {Escherichia coli [TaxId: 562]} Length = 241 Back     information, alignment and structure
>d1l7vc_ c.37.1.12 (C:) ABC transporter involved in vitamin B12 uptake, BtuD {Escherichia coli [TaxId: 562]} Length = 231 Back     information, alignment and structure
>d1l7vc_ c.37.1.12 (C:) ABC transporter involved in vitamin B12 uptake, BtuD {Escherichia coli [TaxId: 562]} Length = 231 Back     information, alignment and structure
>d1ji0a_ c.37.1.12 (A:) Branched chain aminoacid ABC transporter {Thermotoga maritima, TM1139 [TaxId: 2336]} Length = 240 Back     information, alignment and structure
>d1ji0a_ c.37.1.12 (A:) Branched chain aminoacid ABC transporter {Thermotoga maritima, TM1139 [TaxId: 2336]} Length = 240 Back     information, alignment and structure
>d1sgwa_ c.37.1.12 (A:) Putative ABC transporter PF0895 {Pyrococcus furiosus [TaxId: 2261]} Length = 200 Back     information, alignment and structure
>d1sgwa_ c.37.1.12 (A:) Putative ABC transporter PF0895 {Pyrococcus furiosus [TaxId: 2261]} Length = 200 Back     information, alignment and structure
>d1g2912 c.37.1.12 (1:1-240) Maltose transport protein MalK, N-terminal domain {Archaeon Thermococcus litoralis [TaxId: 2265]} Length = 240 Back     information, alignment and structure
>d1g2912 c.37.1.12 (1:1-240) Maltose transport protein MalK, N-terminal domain {Archaeon Thermococcus litoralis [TaxId: 2265]} Length = 240 Back     information, alignment and structure
>d2onka1 c.37.1.12 (A:1-240) Molybdate/tungstate import ATP-binding protein WtpC (ModC) {Archaeoglobus fulgidus [TaxId: 2234]} Length = 240 Back     information, alignment and structure
>d2onka1 c.37.1.12 (A:1-240) Molybdate/tungstate import ATP-binding protein WtpC (ModC) {Archaeoglobus fulgidus [TaxId: 2234]} Length = 240 Back     information, alignment and structure
>d1ye8a1 c.37.1.11 (A:1-178) Hypothetical kinase-like protein Aq_1292 {Aquifex aeolicus [TaxId: 63363]} Length = 178 Back     information, alignment and structure
>d1n0wa_ c.37.1.11 (A:) DNA repair protein Rad51, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d1svma_ c.37.1.20 (A:) Papillomavirus large T antigen helicase domain {Simian virus 40 [TaxId: 10633]} Length = 362 Back     information, alignment and structure
>d1np6a_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Escherichia coli [TaxId: 562]} Length = 170 Back     information, alignment and structure
>d1szpa2 c.37.1.11 (A:145-395) DNA repair protein Rad51, catalytic domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 251 Back     information, alignment and structure
>d2i1qa2 c.37.1.11 (A:65-322) DNA repair protein Rad51, catalytic domain {Archaeon Methanococcus voltae [TaxId: 2188]} Length = 258 Back     information, alignment and structure
>d1nlfa_ c.37.1.11 (A:) Hexameric replicative helicase repA {Escherichia coli [TaxId: 562]} Length = 274 Back     information, alignment and structure
>d1tf7a2 c.37.1.11 (A:256-497) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} Length = 242 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query991
d1v43a3239 Hypothetical protein PH0022, N-terminal domain {Py 100.0
d2awna2232 Maltose transport protein MalK, N-terminal domain 100.0
d1g2912240 Maltose transport protein MalK, N-terminal domain 100.0
d1oxxk2242 Glucose transport protein GlcV, N-terminal domain 100.0
d3d31a2229 Sulfate/molybdate ABC transporter, ATP-binding pro 100.0
d3dhwc1240 Methionine import ATP-binding protein MetN {Escher 100.0
d1l2ta_230 MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 100.0
d1vpla_238 Putative ABC transporter TM0544 {Thermotoga mariti 100.0
d2onka1240 Molybdate/tungstate import ATP-binding protein Wtp 100.0
d1b0ua_258 ATP-binding subunit of the histidine permease {Sal 100.0
d1ji0a_240 Branched chain aminoacid ABC transporter {Thermoto 100.0
d2pmka1241 Haemolysin B ATP-binding protein {Escherichia coli 100.0
d1jj7a_251 Peptide transporter Tap1, C-terminal ABC domain {H 100.0
d1g6ha_254 MJ1267 {Archaeon Methanococcus jannaschii [TaxId: 100.0
d2hyda1255 Putative multidrug export ATP-binding/permease pro 100.0
d1mv5a_242 Multidrug resistance ABC transporter LmrA, C-termi 100.0
d3b60a1253 Multidrug resistance ABC transporter MsbA, C-termi 100.0
d1r0wa_281 Cystic fibrosis transmembrane conductance regulato 100.0
d1l7vc_231 ABC transporter involved in vitamin B12 uptake, Bt 100.0
d1sgwa_200 Putative ABC transporter PF0895 {Pyrococcus furios 100.0
d2awna2 232 Maltose transport protein MalK, N-terminal domain 99.76
d1l2ta_230 MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 99.76
d1v43a3 239 Hypothetical protein PH0022, N-terminal domain {Py 99.75
d1g2912 240 Maltose transport protein MalK, N-terminal domain 99.73
d1oxxk2 242 Glucose transport protein GlcV, N-terminal domain 99.72
d3dhwc1 240 Methionine import ATP-binding protein MetN {Escher 99.72
d3d31a2 229 Sulfate/molybdate ABC transporter, ATP-binding pro 99.7
d1vpla_ 238 Putative ABC transporter TM0544 {Thermotoga mariti 99.7
g1f2t.1292 Rad50 {Archaeon Pyrococcus furiosus [TaxId: 2261]} 99.69
d1mv5a_ 242 Multidrug resistance ABC transporter LmrA, C-termi 99.67
d1sgwa_200 Putative ABC transporter PF0895 {Pyrococcus furios 99.67
d2pmka1 241 Haemolysin B ATP-binding protein {Escherichia coli 99.67
d1jj7a_ 251 Peptide transporter Tap1, C-terminal ABC domain {H 99.66
d2hyda1 255 Putative multidrug export ATP-binding/permease pro 99.66
d1ji0a_ 240 Branched chain aminoacid ABC transporter {Thermoto 99.66
d3b60a1 253 Multidrug resistance ABC transporter MsbA, C-termi 99.6
d1g6ha_ 254 MJ1267 {Archaeon Methanococcus jannaschii [TaxId: 99.6
d1b0ua_ 258 ATP-binding subunit of the histidine permease {Sal 99.6
d2onka1 240 Molybdate/tungstate import ATP-binding protein Wtp 99.55
d1ye8a1178 Hypothetical kinase-like protein Aq_1292 {Aquifex 99.44
g1ii8.1369 Rad50 {Archaeon Pyrococcus furiosus [TaxId: 2261]} 99.4
d1r0wa_ 281 Cystic fibrosis transmembrane conductance regulato 99.39
d1l7vc_ 231 ABC transporter involved in vitamin B12 uptake, Bt 99.22
d1e69a_308 Smc head domain {Thermotoga maritima [TaxId: 2336] 98.73
g1xew.1329 Smc head domain {Pyrococcus furiosus [TaxId: 2261] 98.31
d1w1wa_427 Smc head domain {Baker's yeast (Saccharomyces cere 98.21
d1ewqa2224 DNA repair protein MutS, the C-terminal domain {Th 97.66
d1wb9a2234 DNA repair protein MutS, the C-terminal domain {Es 97.65
d1ye8a1178 Hypothetical kinase-like protein Aq_1292 {Aquifex 97.19
d1u0la2225 Probable GTPase EngC (YjeQ), C-terminal domain {Th 97.05
d1tf7a2242 Circadian clock protein KaiC {Synechococcus sp. st 97.01
g1f2t.1 292 Rad50 {Archaeon Pyrococcus furiosus [TaxId: 2261]} 96.9
d1cr2a_277 Gene 4 protein (g4p, DNA primase), helicase domain 96.89
d1u0la2225 Probable GTPase EngC (YjeQ), C-terminal domain {Th 96.87
d1np6a_170 Molybdopterin-guanine dinucleotide biosynthesis pr 96.79
d1zp6a1176 Hypothetical protein Atu3015 {Agrobacterium tumefa 96.75
d1znwa1182 Guanylate kinase {Mycobacterium tuberculosis [TaxI 96.73
d1t9ha2231 Probable GTPase EngC (YjeQ), C-terminal domain {Ba 96.69
d1tf7a1242 Circadian clock protein KaiC {Synechococcus sp. st 96.64
d1qhla_222 Cell division protein MukB {Escherichia coli [TaxI 96.61
d1znwa1182 Guanylate kinase {Mycobacterium tuberculosis [TaxI 96.57
d1xjca_165 Molybdopterin-guanine dinucleotide biosynthesis pr 96.51
d1knqa_171 Gluconate kinase {Escherichia coli [TaxId: 562]} 96.47
d1t9ha2231 Probable GTPase EngC (YjeQ), C-terminal domain {Ba 96.44
d1nlfa_274 Hexameric replicative helicase repA {Escherichia c 96.42
d1m8pa3183 ATP sulfurylase C-terminal domain {Fungus (Penicil 96.41
d1np6a_170 Molybdopterin-guanine dinucleotide biosynthesis pr 96.36
d2i3ba1189 Cancer-related NTPase, C1orf57 {Human (Homo sapien 96.26
d1lw7a2192 Transcriptional regulator NadR, ribosylnicotinamid 96.21
d1zp6a1176 Hypothetical protein Atu3015 {Agrobacterium tumefa 96.16
d2bdta1176 Hypothetical protein BH3686 {Bacillus halodurans [ 96.1
d1ly1a_152 Polynucleotide kinase, kinase domain {Bacteriophag 96.09
g1ii8.1 369 Rad50 {Archaeon Pyrococcus furiosus [TaxId: 2261]} 96.07
g1xew.1 329 Smc head domain {Pyrococcus furiosus [TaxId: 2261] 96.01
d1y63a_174 Probable kinase LmjF30.1890 {Leishmania major [Tax 95.99
d1s96a_ 205 Guanylate kinase {Escherichia coli [TaxId: 562]} 95.98
d1qhxa_178 Chloramphenicol phosphotransferase {Streptomyces v 95.97
d1qhla_ 222 Cell division protein MukB {Escherichia coli [TaxI 95.9
d1svia_195 Probable GTPase EngB {Bacillus subtilis [TaxId: 14 95.88
d1s96a_205 Guanylate kinase {Escherichia coli [TaxId: 562]} 95.86
d1rkba_173 Adenylate kinase {Human (Homo sapiens), isoenzyme 95.84
d1knqa_171 Gluconate kinase {Escherichia coli [TaxId: 562]} 95.82
d1n0wa_242 DNA repair protein Rad51, catalytic domain {Human 95.8
d1svia_195 Probable GTPase EngB {Bacillus subtilis [TaxId: 14 95.77
d1xjca_165 Molybdopterin-guanine dinucleotide biosynthesis pr 95.76
d1nrjb_ 209 Signal recognition particle receptor beta-subunit 95.68
d1khta_190 Adenylate kinase {Archaeon Methanococcus voltae [T 95.68
d1x6va3195 Adenosine-5'phosphosulfate kinase (APS kinase) {Hu 95.65
d1mkya2186 Probable GTPase Der, N-terminal and middle domains 95.62
d1w1wa_427 Smc head domain {Baker's yeast (Saccharomyces cere 95.62
d1mkya2186 Probable GTPase Der, N-terminal and middle domains 95.59
d2gj8a1161 Probable tRNA modification GTPase TrmE (MnmE), G d 95.58
d2cxxa1184 GTP-binding protein engB {Pyrococcus horikoshii [T 95.56
d1kaga_169 Shikimate kinase (AroK) {Escherichia coli [TaxId: 95.54
d1kgda_178 Guanylate kinase-like domain of Cask {Human (Homo 95.52
d1lnza2185 Obg GTP-binding protein middle domain {Bacillus su 95.49
d1qf9a_194 UMP/CMP kinase {Dictyostelium discoideum [TaxId: 4 95.49
d3adka_194 Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} 95.42
d1yrba1244 ATP(GTP)-binding protein PAB0955 {Pyrococcus abyss 95.42
d1mkya1171 Probable GTPase Der, N-terminal and middle domains 95.4
d1m8pa3183 ATP sulfurylase C-terminal domain {Fungus (Penicil 95.38
d1mkya1171 Probable GTPase Der, N-terminal and middle domains 95.37
d1lnza2185 Obg GTP-binding protein middle domain {Bacillus su 95.34
d2cxxa1184 GTP-binding protein engB {Pyrococcus horikoshii [T 95.32
d1y63a_174 Probable kinase LmjF30.1890 {Leishmania major [Tax 95.31
d1ukza_196 Uridylate kinase {Baker's yeast (Saccharomyces cer 95.26
d1ak2a1190 Adenylate kinase {Cow (Bos taurus), mitochondrial 95.24
d1n0wa_ 242 DNA repair protein Rad51, catalytic domain {Human 95.22
d1nrjb_209 Signal recognition particle receptor beta-subunit 95.18
d1zina1182 Adenylate kinase {Bacillus stearothermophilus [Tax 95.1
d1gkya_186 Guanylate kinase {Baker's yeast (Saccharomyces cer 95.09
d1egaa1179 GTPase Era, N-terminal domain {Escherichia coli [T 95.09
d1cr2a_ 277 Gene 4 protein (g4p, DNA primase), helicase domain 95.07
d1e69a_ 308 Smc head domain {Thermotoga maritima [TaxId: 2336] 95.04
d1rz3a_198 Hypothetical protein rbstp0775 {Bacillus stearothe 95.03
d1teva_194 UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606] 95.01
d1gkya_186 Guanylate kinase {Baker's yeast (Saccharomyces cer 95.0
d1kgda_178 Guanylate kinase-like domain of Cask {Human (Homo 94.98
d1gvnb_273 Plasmid maintenance system epsilon/zeta, toxin zet 94.95
d2qtvb1166 SAR1 {Baker's yeast (Saccharomyces cerevisiae) [Ta 94.95
d1wf3a1178 GTPase Era, N-terminal domain {Thermus thermophilu 94.94
d1viaa_161 Shikimate kinase (AroK) {Campylobacter jejuni [Tax 94.93
d1egaa1179 GTPase Era, N-terminal domain {Escherichia coli [T 94.92
d1zaka1189 Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} 94.9
d1f6ba_186 SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: 94.89
d1lw7a2192 Transcriptional regulator NadR, ribosylnicotinamid 94.89
d1udxa2180 Obg GTP-binding protein middle domain {Thermus the 94.89
d1r8sa_160 ADP-ribosylation factor {Human (Homo sapiens), ARF 94.89
d1yj5a2172 5' polynucleotide kinase-3' phosphatase, C-termina 94.82
d1szpa2251 DNA repair protein Rad51, catalytic domain {Baker' 94.79
d1wf3a1178 GTPase Era, N-terminal domain {Thermus thermophilu 94.74
d1lvga_190 Guanylate kinase {Mouse (Mus musculus) [TaxId: 100 94.73
d2gj8a1161 Probable tRNA modification GTPase TrmE (MnmE), G d 94.72
d1s3ga1182 Adenylate kinase {Bacillus globisporus [TaxId: 145 94.71
d1puia_188 Probable GTPase EngB {Escherichia coli [TaxId: 562 94.71
d1nksa_194 Adenylate kinase {Archaeon Sulfolobus acidocaldari 94.68
d1g6oa_323 Hexameric traffic ATPase, HP0525 {Helicobacter pyl 94.68
d1lvga_190 Guanylate kinase {Mouse (Mus musculus) [TaxId: 100 94.64
d1h65a_ 257 Chloroplast protein translocon GTPase Toc34 {Garde 94.63
d1e6ca_170 Shikimate kinase (AroK) {Erwinia chrysanthemi [Tax 94.62
d2bdta1176 Hypothetical protein BH3686 {Bacillus halodurans [ 94.61
d1bifa1213 6-phosphofructo-2-kinase/fructose-2,6-bisphosphata 94.61
d1upta_169 ADP-ribosylation factor {Human (Homo sapiens), ARL 94.58
d1ly1a_152 Polynucleotide kinase, kinase domain {Bacteriophag 94.58
d1udxa2180 Obg GTP-binding protein middle domain {Thermus the 94.49
d2iyva1165 Shikimate kinase (AroK) {Mycobacterium tuberculosi 94.46
d2cdna1181 Adenylate kinase {Mycobacterium tuberculosis [TaxI 94.43
d2qtvb1166 SAR1 {Baker's yeast (Saccharomyces cerevisiae) [Ta 94.43
d1ksha_165 ADP-ribosylation factor {Mouse (Mus musculus), ARL 94.41
d1ksha_165 ADP-ribosylation factor {Mouse (Mus musculus), ARL 94.41
d1e4va1179 Adenylate kinase {Escherichia coli [TaxId: 562]} 94.4
d2ak3a1189 Adenylate kinase {Cow (Bos taurus), mitochondrial 94.38
d1puia_188 Probable GTPase EngB {Escherichia coli [TaxId: 562 94.37
d1rkba_173 Adenylate kinase {Human (Homo sapiens), isoenzyme 94.37
d1akya1180 Adenylate kinase {Baker's yeast (Saccharomyces cer 94.37
d1f6ba_186 SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: 94.28
d1yrba1 244 ATP(GTP)-binding protein PAB0955 {Pyrococcus abyss 94.25
d1pzna2254 DNA repair protein Rad51, catalytic domain {Archae 94.23
d1wb1a4179 Elongation factor SelB, N-terminal domain {Methano 94.21
d1ckea_225 CMP kinase {Escherichia coli [TaxId: 562]} 94.18
d2p67a1327 LAO/AO transport system kinase ArgK {Escherichia c 94.17
d2fh5b1207 Signal recognition particle receptor beta-subunit 94.1
d1qhxa_178 Chloramphenicol phosphotransferase {Streptomyces v 94.08
d2i1qa2258 DNA repair protein Rad51, catalytic domain {Archae 94.05
d1xzpa2160 TrmE GTPase domain {Thermotoga maritima [TaxId: 23 94.02
d1r8sa_160 ADP-ribosylation factor {Human (Homo sapiens), ARF 93.99
d1q3ta_223 CMP kinase {Streptococcus pneumoniae [TaxId: 1313] 93.98
d1x6va3195 Adenosine-5'phosphosulfate kinase (APS kinase) {Hu 93.97
d1uj2a_213 Uridine-cytidine kinase 2 {Human (Homo sapiens) [T 93.96
d1xzpa2160 TrmE GTPase domain {Thermotoga maritima [TaxId: 23 93.95
d1upta_169 ADP-ribosylation factor {Human (Homo sapiens), ARL 93.94
d1zj6a1177 ADP-ribosylation factor {Human (Homo sapiens), ARL 93.85
d1h65a_257 Chloroplast protein translocon GTPase Toc34 {Garde 93.75
d1v5wa_258 Meiotic recombination protein DMC1/LIM15 homolog { 93.66
d1m7ga_208 Adenosine-5'phosphosulfate kinase (APS kinase) {Fu 93.57
d1viaa_161 Shikimate kinase (AroK) {Campylobacter jejuni [Tax 93.53
d2p67a1 327 LAO/AO transport system kinase ArgK {Escherichia c 93.51
d2i1qa2 258 DNA repair protein Rad51, catalytic domain {Archae 93.43
d1khta_190 Adenylate kinase {Archaeon Methanococcus voltae [T 93.42
d1sxja2253 Replication factor C1 {Baker's yeast (Saccharomyce 93.39
d2iyva1165 Shikimate kinase (AroK) {Mycobacterium tuberculosi 93.38
d1e6ca_170 Shikimate kinase (AroK) {Erwinia chrysanthemi [Tax 93.32
d1ofha_309 HslU {Haemophilus influenzae [TaxId: 727]} 93.3
d2qm8a1323 Metallochaperone MeaB {Methylobacterium extorquens 93.3
d1in4a2238 Holliday junction helicase RuvB {Thermotoga mariti 93.28
d1iqpa2231 Replication factor C {Archaeon Pyrococcus furiosus 93.28
d1ixsb2239 Holliday junction helicase RuvB {Thermus thermophi 93.25
d1rz3a_198 Hypothetical protein rbstp0775 {Bacillus stearothe 93.23
d1zd9a1164 ADP-ribosylation factor {Human (Homo sapiens), ARL 93.22
d1zd9a1164 ADP-ribosylation factor {Human (Homo sapiens), ARL 93.21
d1sq5a_308 Pantothenate kinase PanK {Escherichia coli [TaxId: 93.2
d2fh5b1 207 Signal recognition particle receptor beta-subunit 93.14
d2i3ba1189 Cancer-related NTPase, C1orf57 {Human (Homo sapien 93.12
d1kaga_169 Shikimate kinase (AroK) {Escherichia coli [TaxId: 92.99
d1qf9a_194 UMP/CMP kinase {Dictyostelium discoideum [TaxId: 4 92.92
d1fzqa_176 ADP-ribosylation factor {Mouse (Mus musculus), ARL 92.91
d2fnaa2283 Archaeal ATPase SSO1545 {Sulfolobus solfataricus [ 92.86
d1zj6a1177 ADP-ribosylation factor {Human (Homo sapiens), ARL 92.83
d1nksa_194 Adenylate kinase {Archaeon Sulfolobus acidocaldari 92.81
d1szpa2 251 DNA repair protein Rad51, catalytic domain {Baker' 92.81
d1uf9a_191 Dephospho-CoA kinase {Thermus thermophilus [TaxId: 92.77
d2vp4a1197 Deoxyribonucleoside kinase {Fruit fly (Drosophila 92.67
d1d2na_246 Hexamerization domain of N-ethylmalemide-sensitive 92.64
d1lv7a_256 AAA domain of cell division protein FtsH {Escheric 92.64
d1knxa2177 HPr kinase HprK C-terminal domain {Mycoplasma pneu 92.63
d1nn5a_209 Thymidylate kinase {Human (Homo sapiens) [TaxId: 9 92.56
d2vp4a1197 Deoxyribonucleoside kinase {Fruit fly (Drosophila 92.52
d3raba_169 Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} 92.5
d1ky3a_175 Rab-related protein ypt7p {Baker's yeast (Saccharo 92.49
d1tq4a_400 Interferon-inducible GTPase {Mouse (Mus musculus) 92.45
d1p5zb_241 Deoxycytidine kinase {Human (Homo sapiens) [TaxId: 92.43
d1g7sa4227 Initiation factor IF2/eIF5b, N-terminal (G) domain 92.39
d1wb1a4179 Elongation factor SelB, N-terminal domain {Methano 92.34
d1fzqa_176 ADP-ribosylation factor {Mouse (Mus musculus), ARL 92.31
d1fnna2276 CDC6, N-domain {Archaeon Pyrobaculum aerophilum [T 92.3
d1okkd2207 GTPase domain of the signal recognition particle r 92.28
d1ctqa_166 cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9 92.23
d1zaka1189 Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} 92.21
d2gjsa1168 Rad {Human (Homo sapiens) [TaxId: 9606]} 92.16
d1z2aa1164 Rab23 {Mouse (Mus musculus) [TaxId: 10090]} 92.15
d1pzna2 254 DNA repair protein Rad51, catalytic domain {Archae 92.11
d1v5wa_ 258 Meiotic recombination protein DMC1/LIM15 homolog { 92.11
d1r7ra3265 Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu 92.1
d4tmka_210 Thymidylate kinase {Escherichia coli [TaxId: 562]} 92.07
d2f9la1175 Rab11b {Human (Homo sapiens) [TaxId: 9606]} 92.04
d1sxjd2237 Replication factor C2 {Baker's yeast (Saccharomyce 92.01
d1ixza_247 AAA domain of cell division protein FtsH {Thermus 91.96
d1yj5a2172 5' polynucleotide kinase-3' phosphatase, C-termina 91.92
d2f7sa1186 Rab27b {Human (Homo sapiens) [TaxId: 9606]} 91.89
d1tf7a1 242 Circadian clock protein KaiC {Synechococcus sp. st 91.66
d1wmsa_174 Rab9a {Human (Homo sapiens) [TaxId: 9606]} 91.63
d1e32a2258 Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu 91.61
d2a5ja1173 Rab2b {Human (Homo sapiens) [TaxId: 9606]} 91.55
d1g16a_166 Rab-related protein Sec4 {Baker's yeast (Saccharom 91.53
d1ls1a2207 GTPase domain of the signal sequence recognition p 91.53
d1g8pa_333 ATPase subunit of magnesium chelatase, BchI {Rhodo 91.51
d1ukza_196 Uridylate kinase {Baker's yeast (Saccharomyces cer 91.45
d2erxa1171 di-Ras2 {Human (Homo sapiens) [TaxId: 9606]} 91.44
d2gjsa1168 Rad {Human (Homo sapiens) [TaxId: 9606]} 91.35
d1xtqa1167 GTP-binding protein RheB {Human (Homo sapiens) [Ta 91.34
d1kkma_176 HPr kinase HprK C-terminal domain {Lactobacillus c 91.34
d2ew1a1171 Rab30 {Human (Homo sapiens) [TaxId: 9606]} 91.32
d3raba_169 Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} 91.29
d2erya1171 r-Ras2 {Human (Homo sapiens) [TaxId: 9606]} 91.28
d1uj2a_ 213 Uridine-cytidine kinase 2 {Human (Homo sapiens) [T 91.24
d1ky3a_175 Rab-related protein ypt7p {Baker's yeast (Saccharo 91.21
d1sxjb2224 Replication factor C4 {Baker's yeast (Saccharomyce 91.18
d1kaoa_167 Rap2a {Human (Homo sapiens) [TaxId: 9606]} 91.18
d1moza_182 ADP-ribosylation factor {Baker's yeast (Saccharomy 91.16
d1u94a1263 RecA protein, ATPase-domain {Escherichia coli [Tax 91.13
d1p5zb_ 241 Deoxycytidine kinase {Human (Homo sapiens) [TaxId: 91.13
d1tq4a_ 400 Interferon-inducible GTPase {Mouse (Mus musculus) 91.09
d1ctqa_166 cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9 91.08
d2f7sa1186 Rab27b {Human (Homo sapiens) [TaxId: 9606]} 91.08
d1nn5a_ 209 Thymidylate kinase {Human (Homo sapiens) [TaxId: 9 91.07
d1xtqa1167 GTP-binding protein RheB {Human (Homo sapiens) [Ta 91.03
d1tf7a2 242 Circadian clock protein KaiC {Synechococcus sp. st 91.01
d1z0fa1166 Rab14 {Human (Homo sapiens) [TaxId: 9606]} 91.0
d1bifa1 213 6-phosphofructo-2-kinase/fructose-2,6-bisphosphata 90.98
d1vg8a_184 Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]} 90.91
d1okkd2207 GTPase domain of the signal recognition particle r 90.91
d1x3sa1177 Rab18 {Human (Homo sapiens) [TaxId: 9606]} 90.89
d2bmja1175 Centaurin gamma 1, G domain {Human (Homo sapiens) 90.86
d2g3ya1172 GTP-binding protein GEM {Human (Homo sapiens) [Tax 90.83
d1w5sa2287 CDC6-like protein APE0152, N-terminal domain {Aero 90.82
d1sxjc2227 Replication factor C3 {Baker's yeast (Saccharomyce 90.81
d1tmka_214 Thymidylate kinase {Baker's yeast (Saccharomyces c 90.81
d1z2aa1164 Rab23 {Mouse (Mus musculus) [TaxId: 10090]} 90.8
d2ew1a1171 Rab30 {Human (Homo sapiens) [TaxId: 9606]} 90.79
d1z06a1165 Rab-33b {Mouse (Mus musculus) [TaxId: 10090]} 90.78
d1yzqa1164 Rab6 {Human (Homo sapiens) [TaxId: 9606]} 90.75
d1ak2a1190 Adenylate kinase {Cow (Bos taurus), mitochondrial 90.66
d1e0sa_173 ADP-ribosylation factor {Human (Homo sapiens), ARF 90.64
d1moza_182 ADP-ribosylation factor {Baker's yeast (Saccharomy 90.62
d1u8za_168 Ras-related protein RalA {Cotton-top tamarin (Sagu 90.6
d2bmea1174 Rab4a {Human (Homo sapiens) [TaxId: 9606]} 90.59
d1jjva_205 Dephospho-CoA kinase {Haemophilus influenzae [TaxI 90.57
d2bcgy1194 GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisi 90.54
d1q3ta_ 223 CMP kinase {Streptococcus pneumoniae [TaxId: 1313] 90.47
d2fu5c1173 Rab8a {Mouse (Mus musculus) [TaxId: 10090]} 90.44
d1vmaa2213 GTPase domain of the signal recognition particle r 90.4
d1ko7a2169 HPr kinase HprK C-terminal domain {Staphylococcus 90.37
d1ni3a1296 YchF GTP-binding protein N-terminal domain {Fissio 90.33
d1j8yf2211 GTPase domain of the signal sequence recognition p 90.3
d1sxje2252 Replication factor C5 {Baker's yeast (Saccharomyce 90.29
d1vmaa2 213 GTPase domain of the signal recognition particle r 90.22
d1gvnb_ 273 Plasmid maintenance system epsilon/zeta, toxin zet 90.2
d1u94a1 263 RecA protein, ATPase-domain {Escherichia coli [Tax 90.15
d1kk1a3195 Initiation factor eIF2 gamma subunit, N-terminal ( 90.13
d1m7ga_208 Adenosine-5'phosphosulfate kinase (APS kinase) {Fu 90.12
d1z0ja1167 Rab-22a {Mouse (Mus musculus) [TaxId: 10090]} 90.03
d1z08a1167 Rab21 {Human (Homo sapiens) [TaxId: 9606]} 90.0
d1j8yf2211 GTPase domain of the signal sequence recognition p 89.96
d1vhta_208 Dephospho-CoA kinase {Escherichia coli [TaxId: 562 89.93
d1kmqa_177 RhoA {Human (Homo sapiens) [TaxId: 9606]} 89.92
d2erya1171 r-Ras2 {Human (Homo sapiens) [TaxId: 9606]} 89.92
d1htwa_158 Hypothetical protein HI0065 {Haemophilus influenza 89.87
d1kaoa_167 Rap2a {Human (Homo sapiens) [TaxId: 9606]} 89.84
d1g41a_443 HslU {Haemophilus influenzae [TaxId: 727]} 89.83
d2f9la1175 Rab11b {Human (Homo sapiens) [TaxId: 9606]} 89.63
d1g7sa4 227 Initiation factor IF2/eIF5b, N-terminal (G) domain 89.63
d1g16a_166 Rab-related protein Sec4 {Baker's yeast (Saccharom 89.63
d2qy9a2211 GTPase domain of the signal recognition particle r 89.62
d2fn4a1173 r-Ras {Human (Homo sapiens) [TaxId: 9606]} 89.59
d1wxqa1319 GTP-binding protein PH0525 {Pyrococcus horikoshii 89.58
d2atva1168 Ras-like estrogen-regulated growth inhibitor, RERG 89.57
d1i2ma_170 Ran {Human (Homo sapiens) [TaxId: 9606]} 89.53
d1e0sa_173 ADP-ribosylation factor {Human (Homo sapiens), ARF 89.52
d2fn4a1173 r-Ras {Human (Homo sapiens) [TaxId: 9606]} 89.5
d1nlfa_ 274 Hexameric replicative helicase repA {Escherichia c 89.49
d1zina1182 Adenylate kinase {Bacillus stearothermophilus [Tax 89.46
d3adka_194 Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} 89.44
d1ek0a_170 Ypt51 {Baker's yeast (Saccharomyces cerevisiae) [T 89.41
d1z06a1165 Rab-33b {Mouse (Mus musculus) [TaxId: 10090]} 89.37
d2erxa1171 di-Ras2 {Human (Homo sapiens) [TaxId: 9606]} 89.37
d1vg8a_184 Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]} 89.35
d1mh1a_183 Rac {Human (Homo sapiens) [TaxId: 9606]} 89.31
d2g6ba1170 Rab26 {Human (Homo sapiens) [TaxId: 9606]} 89.22
d1svma_362 Papillomavirus large T antigen helicase domain {Si 89.22
d1z0fa1166 Rab14 {Human (Homo sapiens) [TaxId: 9606]} 89.2
d2qy9a2211 GTPase domain of the signal recognition particle r 89.15
d1teva_194 UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606] 89.14
d1r2qa_170 Rab5a {Human (Homo sapiens) [TaxId: 9606]} 89.13
d2bcgy1194 GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisi 89.1
d1wmsa_174 Rab9a {Human (Homo sapiens) [TaxId: 9606]} 89.07
d1gsia_208 Thymidylate kinase {Mycobacterium tuberculosis [Ta 89.03
d1a7ja_288 Phosphoribulokinase {Rhodobacter sphaeroides [TaxI 89.03
d2fu5c1173 Rab8a {Mouse (Mus musculus) [TaxId: 10090]} 89.01
d2g3ya1172 GTP-binding protein GEM {Human (Homo sapiens) [Tax 88.97
d1g6oa_323 Hexameric traffic ATPase, HP0525 {Helicobacter pyl 88.96
d1uf9a_191 Dephospho-CoA kinase {Thermus thermophilus [TaxId: 88.96
d1kkma_176 HPr kinase HprK C-terminal domain {Lactobacillus c 88.9
d1a7ja_ 288 Phosphoribulokinase {Rhodobacter sphaeroides [TaxI 88.89
d1ls1a2207 GTPase domain of the signal sequence recognition p 88.88
d1p9ra_401 Extracellular secretion NTPase EpsE {Vibrio choler 88.84
d1u8za_168 Ras-related protein RalA {Cotton-top tamarin (Sagu 88.84
d1x1ra1169 Ras-related protein M-Ras (XRas) {Mouse (Mus muscu 88.79
d2fnaa2 283 Archaeal ATPase SSO1545 {Sulfolobus solfataricus [ 88.77
d1i2ma_170 Ran {Human (Homo sapiens) [TaxId: 9606]} 88.68
d1yzqa1164 Rab6 {Human (Homo sapiens) [TaxId: 9606]} 88.62
d1tmka_ 214 Thymidylate kinase {Baker's yeast (Saccharomyces c 88.59
d1e4va1179 Adenylate kinase {Escherichia coli [TaxId: 562]} 88.54
d2a5ja1173 Rab2b {Human (Homo sapiens) [TaxId: 9606]} 88.53
d1z08a1167 Rab21 {Human (Homo sapiens) [TaxId: 9606]} 88.52
d1x3sa1177 Rab18 {Human (Homo sapiens) [TaxId: 9606]} 88.36
d1ckea_ 225 CMP kinase {Escherichia coli [TaxId: 562]} 88.32
d1zcba2200 Transducin (alpha subunit) {Mouse (Mus musculus) [ 88.23
d1sq5a_ 308 Pantothenate kinase PanK {Escherichia coli [TaxId: 88.21
d1mh1a_183 Rac {Human (Homo sapiens) [TaxId: 9606]} 88.19
d1knxa2177 HPr kinase HprK C-terminal domain {Mycoplasma pneu 88.13
d1r6bx3315 ClpA, an Hsp100 chaperone, AAA+ modules {Escherich 88.09
d1odfa_286 Hypothetical protein Ygr205W {Baker's yeast (Sacch 88.07
d1jala1278 YchF GTP-binding protein N-terminal domain {Haemop 88.02
d1s3ga1182 Adenylate kinase {Bacillus globisporus [TaxId: 145 88.01
d1z0ja1167 Rab-22a {Mouse (Mus musculus) [TaxId: 10090]} 87.96
d2cdna1181 Adenylate kinase {Mycobacterium tuberculosis [TaxI 87.81
d1jwyb_306 Dynamin G domain {Dictyostelium discoideum [TaxId: 87.79
d2bmja1175 Centaurin gamma 1, G domain {Human (Homo sapiens) 87.67
d1x1ra1169 Ras-related protein M-Ras (XRas) {Mouse (Mus muscu 87.64
d1f5na2277 Interferon-induced guanylate-binding protein 1 (GB 87.62
d2atxa1185 RhoQ {Human (Homo sapiens) [TaxId: 9606]} 87.61
d1kmqa_177 RhoA {Human (Homo sapiens) [TaxId: 9606]} 87.55
d1c1ya_167 Rap1A {Human (Homo sapiens) [TaxId: 9606]} 87.48
d2qm8a1 323 Metallochaperone MeaB {Methylobacterium extorquens 87.37
d1mo6a1 269 RecA protein, ATPase-domain {Mycobacterium tubercu 87.28
d1azta2221 Transducin (alpha subunit) {Cow (Bos taurus) [TaxI 87.24
d2bmea1174 Rab4a {Human (Homo sapiens) [TaxId: 9606]} 87.21
d4tmka_ 210 Thymidylate kinase {Escherichia coli [TaxId: 562]} 87.1
d1htwa_158 Hypothetical protein HI0065 {Haemophilus influenza 87.03
d2ngra_191 CDC42 {Human (Homo sapiens) [TaxId: 9606]} 86.97
d2akab1299 Dynamin G domain {Rat (Rattus norvegicus) [TaxId: 86.85
d1w44a_321 NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} 86.84
d1ek0a_170 Ypt51 {Baker's yeast (Saccharomyces cerevisiae) [T 86.84
d1mo6a1269 RecA protein, ATPase-domain {Mycobacterium tubercu 86.76
d1ko7a2169 HPr kinase HprK C-terminal domain {Staphylococcus 86.75
d2atxa1185 RhoQ {Human (Homo sapiens) [TaxId: 9606]} 86.62
d1f5na2 277 Interferon-induced guanylate-binding protein 1 (GB 86.53
d2dy1a2 267 Elongation factor G (EF-G), N-terminal (G) domain 86.42
d2bv3a2 276 Elongation factor G (EF-G), N-terminal (G) domain 86.36
d1m7ba_179 RhoE (RND3) {Mouse (Mus musculus) [TaxId: 10090]} 86.23
d2c78a3204 Elongation factor Tu (EF-Tu), N-terminal (G) domai 86.21
d1xpua3289 Transcription termination factor Rho, ATPase domai 86.19
d1xp8a1 268 RecA protein, ATPase-domain {Deinococcus radiodura 85.98
d2atva1168 Ras-like estrogen-regulated growth inhibitor, RERG 85.89
d1ofha_ 309 HslU {Haemophilus influenzae [TaxId: 727]} 85.89
d1r2qa_170 Rab5a {Human (Homo sapiens) [TaxId: 9606]} 85.76
d1nija1222 Hypothetical protein YjiA, N-terminal domain {Esch 85.7
d1xp8a1268 RecA protein, ATPase-domain {Deinococcus radiodura 85.46
d2g6ba1170 Rab26 {Human (Homo sapiens) [TaxId: 9606]} 85.43
d1akya1180 Adenylate kinase {Baker's yeast (Saccharomyces cer 85.42
d2qn6a3205 Initiation factor eIF2 gamma subunit, N-terminal ( 85.39
d1iqpa2231 Replication factor C {Archaeon Pyrococcus furiosus 85.37
d1gsia_ 208 Thymidylate kinase {Mycobacterium tuberculosis [Ta 85.09
d2bv3a2276 Elongation factor G (EF-G), N-terminal (G) domain 84.96
d1kk1a3195 Initiation factor eIF2 gamma subunit, N-terminal ( 84.94
d1sxja2 253 Replication factor C1 {Baker's yeast (Saccharomyce 84.57
d2ngra_191 CDC42 {Human (Homo sapiens) [TaxId: 9606]} 84.51
d1in4a2 238 Holliday junction helicase RuvB {Thermotoga mariti 84.49
d1lv7a_ 256 AAA domain of cell division protein FtsH {Escheric 84.39
d2ak3a1189 Adenylate kinase {Cow (Bos taurus), mitochondrial 84.3
d1zcba2200 Transducin (alpha subunit) {Mouse (Mus musculus) [ 84.2
d2dy1a2267 Elongation factor G (EF-G), N-terminal (G) domain 83.91
d1c1ya_167 Rap1A {Human (Homo sapiens) [TaxId: 9606]} 83.84
d1l8qa2213 Chromosomal replication initiation factor DnaA {Aq 83.62
d1m7ba_179 RhoE (RND3) {Mouse (Mus musculus) [TaxId: 10090]} 83.52
d1deka_241 Deoxynucleoside monophosphate kinase {Bacteriophag 83.48
d2bcjq2200 Transducin (alpha subunit) {Mouse (Mus musculus) [ 83.42
d1uaaa1306 DEXX box DNA helicase {Escherichia coli, RepD [Tax 83.15
d1r6bx2268 ClpA, an Hsp100 chaperone, AAA+ modules {Escherich 82.5
d1azta2 221 Transducin (alpha subunit) {Cow (Bos taurus) [TaxI 82.49
d1svsa1195 Transducin (alpha subunit) {Rat (Rattus norvegicus 82.47
d1ixsb2 239 Holliday junction helicase RuvB {Thermus thermophi 82.39
d2c78a3 204 Elongation factor Tu (EF-Tu), N-terminal (G) domai 82.17
d2akab1 299 Dynamin G domain {Rat (Rattus norvegicus) [TaxId: 82.16
d1jjva_ 205 Dephospho-CoA kinase {Haemophilus influenzae [TaxI 82.02
d2ocpa1241 Deoxyguanosine kinase {Human (Homo sapiens) [TaxId 81.78
d1a5ta2207 delta prime subunit of DNA polymerase III, N-domai 81.67
d1jbka_195 ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} 81.53
d2qn6a3205 Initiation factor eIF2 gamma subunit, N-terminal ( 81.48
d1pjra1318 DEXX box DNA helicase {Bacillus stearothermophilus 81.3
d1r6bx3 315 ClpA, an Hsp100 chaperone, AAA+ modules {Escherich 81.19
d1sxjb2224 Replication factor C4 {Baker's yeast (Saccharomyce 81.14
d1jwyb_ 306 Dynamin G domain {Dictyostelium discoideum [TaxId: 81.02
d1nija1 222 Hypothetical protein YjiA, N-terminal domain {Esch 80.9
d2a5yb3277 CED-4, NB-ARC domain {Caenorhabditis elegans [TaxI 80.64
d1vhta_ 208 Dephospho-CoA kinase {Escherichia coli [TaxId: 562 80.5
d1e9ra_433 Bacterial conjugative coupling protein TrwB {Esche 80.21
d1sxjd2 237 Replication factor C2 {Baker's yeast (Saccharomyce 80.18
>d1v43a3 c.37.1.12 (A:7-245) Hypothetical protein PH0022, N-terminal domain {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: ABC transporter ATPase domain-like
domain: Hypothetical protein PH0022, N-terminal domain
species: Pyrococcus horikoshii [TaxId: 53953]
Probab=100.00  E-value=8.5e-49  Score=413.52  Aligned_cols=206  Identities=25%  Similarity=0.359  Sum_probs=175.8

Q ss_pred             ceeeeceEEEEeCCeEEEEEcCCCCcHHHHHHHHhcCcCCCCCeeeEEEECCeeCCCccc-cceEEEEecCCCCCCCCCH
Q 001957          165 LTILKDVSGVIKPGRLTLLLGPPSSGKTTLLLALAGKLDPTLKVSGTVTYNGHDMDEFVP-QRTAAYISQHDNHIGEMTV  243 (991)
Q Consensus       165 ~~iL~~vs~~i~~Ge~~allGpsGsGKSTLL~~LaG~~~~~~~~~G~I~~nG~~~~~~~~-~~~~~yv~Q~d~~~~~lTV  243 (991)
                      +++|+||||+|++||+++|+||||||||||+++|+|+++|+   +|+|.+||+++....+ +|.+|||+|++.+++.+||
T Consensus        19 ~~al~~vsl~v~~Ge~~~liGpsGaGKSTLl~~i~Gl~~p~---sG~I~i~g~~i~~~~~~~r~ig~v~Q~~~l~~~ltv   95 (239)
T d1v43a3          19 FTAVNKLNLTIKDGEFLVLLGPSGCGKTTTLRMIAGLEEPT---EGRIYFGDRDVTYLPPKDRNISMVFQSYAVWPHMTV   95 (239)
T ss_dssp             EEEEEEEEEEECTTCEEEEECCTTSSHHHHHHHHHTSSCCS---EEEEEETTEECTTSCGGGGTEEEEEC------CCCH
T ss_pred             EEEEcceeEEECCCCEEEEECCCCChHHHHHHHHHcCCCCC---CCEEEEcceecccCCcccceEEEEeechhhcccchH
Confidence            46999999999999999999999999999999999999999   9999999999976554 3679999999999999999


Q ss_pred             HHHHHHHHHhcCCCchhhhhHHHHHHHHHcCCCCCCChHHHHHHHHhhhhhhhHHHHHHHHHcCCcccccccccCcccCC
Q 001957          244 RETLAFSARCQGVGTRYEMLTELARREKAAGIKPDPDIDVYMKAIATEGQEANVITDYYLKVLGLDVCADTMVGDEMIRG  323 (991)
Q Consensus       244 ~E~l~f~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~lgL~~~~dt~vg~~~~~~  323 (991)
                      +||+.|.+++++...                                  .+.+..++++|+.+||++.+|     +++.+
T Consensus        96 ~enl~~~~~~~~~~~----------------------------------~~~~~~~~~~l~~~~l~~~~~-----~~~~~  136 (239)
T d1v43a3          96 YENIAFPLKIKKFPK----------------------------------DEIDKRVRWAAELLQIEELLN-----RYPAQ  136 (239)
T ss_dssp             HHHHHTTCC--CCCH----------------------------------HHHHHHHHHHHHHTTCGGGTT-----SCTTT
T ss_pred             HHHHHHHHHHcCCCH----------------------------------HHHHHHHHHHHHHcCChhhhc-----CChhh
Confidence            999999987765421                                  112235678999999998776     45678


Q ss_pred             CChhHhHHHHHHHHHhcCCcEeEEeCCCCCCCHHHHHHHHHHHHHHhhccCceEEEEEecCCchhHhhcCeEEEecCCeE
Q 001957          324 ISGGQKKRVTTGEMMVGPALALFMDEISTGLDSSTTFQIVNCLRQNIHINSGTAVISLLQPAPETYDLFDDIILLSDGQI  403 (991)
Q Consensus       324 LSGGqrqRvsia~~L~~~p~vLllDEPTsGLD~~t~~~i~~~L~~l~~~~~~t~ii~i~q~~~~~~~lfD~vilL~~G~i  403 (991)
                      |||||||||+|||||+.+|++|+|||||+|||+.++.++++.|+++.++.+.|+|+ ++|+.+++.++||||++|++|+|
T Consensus       137 LSGGq~QRvaiAraL~~~P~iLllDEPts~LD~~~~~~i~~ll~~l~~~~g~tii~-vTHd~~~a~~~~dri~vm~~G~i  215 (239)
T d1v43a3         137 LSGGQRQRVAVARAIVVEPDVLLMDEPLSNLDAKLRVAMRAEIKKLQQKLKVTTIY-VTHDQVEAMTMGDRIAVMNRGQL  215 (239)
T ss_dssp             CCSSCHHHHHHHHHHTTCCSEEEEESTTTTSCHHHHHHHHHHHHHHHHHHTCEEEE-EESCHHHHHHHCSEEEEEETTEE
T ss_pred             CCHHHHHHHHHHhhhccCCCceeecCCcccCCHHHHHHHHHHHHHHHHhcCCeEEE-EeCCHHHHHHhCCEEEEEECCEE
Confidence            99999999999999999999999999999999999999999999997755666555 56788999999999999999999


Q ss_pred             EEecCHHHHH
Q 001957          404 VYQGPRELVL  413 (991)
Q Consensus       404 v~~G~~~~~~  413 (991)
                      +++|+++++.
T Consensus       216 v~~G~~~el~  225 (239)
T d1v43a3         216 LQIGSPTEVY  225 (239)
T ss_dssp             EEEECHHHHH
T ss_pred             EEEcCHHHHH
Confidence            9999999984



>d2awna2 c.37.1.12 (A:4-235) Maltose transport protein MalK, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1g2912 c.37.1.12 (1:1-240) Maltose transport protein MalK, N-terminal domain {Archaeon Thermococcus litoralis [TaxId: 2265]} Back     information, alignment and structure
>d1oxxk2 c.37.1.12 (K:1-242) Glucose transport protein GlcV, N-terminal domain {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d3d31a2 c.37.1.12 (A:1-229) Sulfate/molybdate ABC transporter, ATP-binding protein {Methanosarcina acetivorans [TaxId: 2214]} Back     information, alignment and structure
>d3dhwc1 c.37.1.12 (C:1-240) Methionine import ATP-binding protein MetN {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1l2ta_ c.37.1.12 (A:) MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1vpla_ c.37.1.12 (A:) Putative ABC transporter TM0544 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2onka1 c.37.1.12 (A:1-240) Molybdate/tungstate import ATP-binding protein WtpC (ModC) {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1b0ua_ c.37.1.12 (A:) ATP-binding subunit of the histidine permease {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1ji0a_ c.37.1.12 (A:) Branched chain aminoacid ABC transporter {Thermotoga maritima, TM1139 [TaxId: 2336]} Back     information, alignment and structure
>d2pmka1 c.37.1.12 (A:467-707) Haemolysin B ATP-binding protein {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1jj7a_ c.37.1.12 (A:) Peptide transporter Tap1, C-terminal ABC domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g6ha_ c.37.1.12 (A:) MJ1267 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d2hyda1 c.37.1.12 (A:324-578) Putative multidrug export ATP-binding/permease protein SAV1866 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1mv5a_ c.37.1.12 (A:) Multidrug resistance ABC transporter LmrA, C-terminal domain {Lactococcus lactis [TaxId: 1358]} Back     information, alignment and structure
>d3b60a1 c.37.1.12 (A:329-581) Multidrug resistance ABC transporter MsbA, C-terminal domain {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1r0wa_ c.37.1.12 (A:) Cystic fibrosis transmembrane conductance regulator, CFTR, nucleotide-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1l7vc_ c.37.1.12 (C:) ABC transporter involved in vitamin B12 uptake, BtuD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1sgwa_ c.37.1.12 (A:) Putative ABC transporter PF0895 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d2awna2 c.37.1.12 (A:4-235) Maltose transport protein MalK, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1l2ta_ c.37.1.12 (A:) MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1v43a3 c.37.1.12 (A:7-245) Hypothetical protein PH0022, N-terminal domain {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1g2912 c.37.1.12 (1:1-240) Maltose transport protein MalK, N-terminal domain {Archaeon Thermococcus litoralis [TaxId: 2265]} Back     information, alignment and structure
>d1oxxk2 c.37.1.12 (K:1-242) Glucose transport protein GlcV, N-terminal domain {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d3dhwc1 c.37.1.12 (C:1-240) Methionine import ATP-binding protein MetN {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d3d31a2 c.37.1.12 (A:1-229) Sulfate/molybdate ABC transporter, ATP-binding protein {Methanosarcina acetivorans [TaxId: 2214]} Back     information, alignment and structure
>d1vpla_ c.37.1.12 (A:) Putative ABC transporter TM0544 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1mv5a_ c.37.1.12 (A:) Multidrug resistance ABC transporter LmrA, C-terminal domain {Lactococcus lactis [TaxId: 1358]} Back     information, alignment and structure
>d1sgwa_ c.37.1.12 (A:) Putative ABC transporter PF0895 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d2pmka1 c.37.1.12 (A:467-707) Haemolysin B ATP-binding protein {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1jj7a_ c.37.1.12 (A:) Peptide transporter Tap1, C-terminal ABC domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2hyda1 c.37.1.12 (A:324-578) Putative multidrug export ATP-binding/permease protein SAV1866 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1ji0a_ c.37.1.12 (A:) Branched chain aminoacid ABC transporter {Thermotoga maritima, TM1139 [TaxId: 2336]} Back     information, alignment and structure
>d3b60a1 c.37.1.12 (A:329-581) Multidrug resistance ABC transporter MsbA, C-terminal domain {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1g6ha_ c.37.1.12 (A:) MJ1267 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1b0ua_ c.37.1.12 (A:) ATP-binding subunit of the histidine permease {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d2onka1 c.37.1.12 (A:1-240) Molybdate/tungstate import ATP-binding protein WtpC (ModC) {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1ye8a1 c.37.1.11 (A:1-178) Hypothetical kinase-like protein Aq_1292 {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1r0wa_ c.37.1.12 (A:) Cystic fibrosis transmembrane conductance regulator, CFTR, nucleotide-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1l7vc_ c.37.1.12 (C:) ABC transporter involved in vitamin B12 uptake, BtuD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1e69a_ c.37.1.12 (A:) Smc head domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1w1wa_ c.37.1.12 (A:) Smc head domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ewqa2 c.37.1.12 (A:542-765) DNA repair protein MutS, the C-terminal domain {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1wb9a2 c.37.1.12 (A:567-800) DNA repair protein MutS, the C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ye8a1 c.37.1.11 (A:1-178) Hypothetical kinase-like protein Aq_1292 {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1u0la2 c.37.1.8 (A:69-293) Probable GTPase EngC (YjeQ), C-terminal domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1tf7a2 c.37.1.11 (A:256-497) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} Back     information, alignment and structure
>d1cr2a_ c.37.1.11 (A:) Gene 4 protein (g4p, DNA primase), helicase domain {Bacteriophage T7 [TaxId: 10760]} Back     information, alignment and structure
>d1u0la2 c.37.1.8 (A:69-293) Probable GTPase EngC (YjeQ), C-terminal domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1np6a_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1zp6a1 c.37.1.25 (A:6-181) Hypothetical protein Atu3015 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1znwa1 c.37.1.1 (A:20-201) Guanylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1t9ha2 c.37.1.8 (A:68-298) Probable GTPase EngC (YjeQ), C-terminal domain {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1tf7a1 c.37.1.11 (A:14-255) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} Back     information, alignment and structure
>d1qhla_ c.37.1.12 (A:) Cell division protein MukB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1znwa1 c.37.1.1 (A:20-201) Guanylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1xjca_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1knqa_ c.37.1.17 (A:) Gluconate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1t9ha2 c.37.1.8 (A:68-298) Probable GTPase EngC (YjeQ), C-terminal domain {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1nlfa_ c.37.1.11 (A:) Hexameric replicative helicase repA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1m8pa3 c.37.1.15 (A:391-573) ATP sulfurylase C-terminal domain {Fungus (Penicillium chrysogenum) [TaxId: 5076]} Back     information, alignment and structure
>d1np6a_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2i3ba1 c.37.1.11 (A:1-189) Cancer-related NTPase, C1orf57 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lw7a2 c.37.1.1 (A:220-411) Transcriptional regulator NadR, ribosylnicotinamide kinase domain {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1zp6a1 c.37.1.25 (A:6-181) Hypothetical protein Atu3015 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d2bdta1 c.37.1.25 (A:1-176) Hypothetical protein BH3686 {Bacillus halodurans [TaxId: 86665]} Back     information, alignment and structure
>d1ly1a_ c.37.1.1 (A:) Polynucleotide kinase, kinase domain {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d1y63a_ c.37.1.1 (A:) Probable kinase LmjF30.1890 {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d1s96a_ c.37.1.1 (A:) Guanylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1qhxa_ c.37.1.3 (A:) Chloramphenicol phosphotransferase {Streptomyces venezuelae [TaxId: 54571]} Back     information, alignment and structure
>d1qhla_ c.37.1.12 (A:) Cell division protein MukB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1svia_ c.37.1.8 (A:) Probable GTPase EngB {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1s96a_ c.37.1.1 (A:) Guanylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1rkba_ c.37.1.1 (A:) Adenylate kinase {Human (Homo sapiens), isoenzyme 6 [TaxId: 9606]} Back     information, alignment and structure
>d1knqa_ c.37.1.17 (A:) Gluconate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1n0wa_ c.37.1.11 (A:) DNA repair protein Rad51, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1svia_ c.37.1.8 (A:) Probable GTPase EngB {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1xjca_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1nrjb_ c.37.1.8 (B:) Signal recognition particle receptor beta-subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1khta_ c.37.1.1 (A:) Adenylate kinase {Archaeon Methanococcus voltae [TaxId: 2188]} Back     information, alignment and structure
>d1x6va3 c.37.1.4 (A:34-228) Adenosine-5'phosphosulfate kinase (APS kinase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mkya2 c.37.1.8 (A:173-358) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1w1wa_ c.37.1.12 (A:) Smc head domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1mkya2 c.37.1.8 (A:173-358) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2gj8a1 c.37.1.8 (A:216-376) Probable tRNA modification GTPase TrmE (MnmE), G domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2cxxa1 c.37.1.8 (A:2-185) GTP-binding protein engB {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1kaga_ c.37.1.2 (A:) Shikimate kinase (AroK) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1kgda_ c.37.1.1 (A:) Guanylate kinase-like domain of Cask {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lnza2 c.37.1.8 (A:158-342) Obg GTP-binding protein middle domain {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1qf9a_ c.37.1.1 (A:) UMP/CMP kinase {Dictyostelium discoideum [TaxId: 44689]} Back     information, alignment and structure
>d3adka_ c.37.1.1 (A:) Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1yrba1 c.37.1.10 (A:1-244) ATP(GTP)-binding protein PAB0955 {Pyrococcus abyssi [TaxId: 29292]} Back     information, alignment and structure
>d1mkya1 c.37.1.8 (A:2-172) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1m8pa3 c.37.1.15 (A:391-573) ATP sulfurylase C-terminal domain {Fungus (Penicillium chrysogenum) [TaxId: 5076]} Back     information, alignment and structure
>d1mkya1 c.37.1.8 (A:2-172) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1lnza2 c.37.1.8 (A:158-342) Obg GTP-binding protein middle domain {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2cxxa1 c.37.1.8 (A:2-185) GTP-binding protein engB {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1y63a_ c.37.1.1 (A:) Probable kinase LmjF30.1890 {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d1ukza_ c.37.1.1 (A:) Uridylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ak2a1 c.37.1.1 (A:14-146,A:177-233) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-2 [TaxId: 9913]} Back     information, alignment and structure
>d1n0wa_ c.37.1.11 (A:) DNA repair protein Rad51, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nrjb_ c.37.1.8 (B:) Signal recognition particle receptor beta-subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1zina1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1gkya_ c.37.1.1 (A:) Guanylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1egaa1 c.37.1.8 (A:4-182) GTPase Era, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1cr2a_ c.37.1.11 (A:) Gene 4 protein (g4p, DNA primase), helicase domain {Bacteriophage T7 [TaxId: 10760]} Back     information, alignment and structure
>d1e69a_ c.37.1.12 (A:) Smc head domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1rz3a_ c.37.1.6 (A:) Hypothetical protein rbstp0775 {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1teva_ c.37.1.1 (A:) UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gkya_ c.37.1.1 (A:) Guanylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1kgda_ c.37.1.1 (A:) Guanylate kinase-like domain of Cask {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gvnb_ c.37.1.21 (B:) Plasmid maintenance system epsilon/zeta, toxin zeta subunit {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d2qtvb1 c.37.1.8 (B:24-189) SAR1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1wf3a1 c.37.1.8 (A:3-180) GTPase Era, N-terminal domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1viaa_ c.37.1.2 (A:) Shikimate kinase (AroK) {Campylobacter jejuni [TaxId: 197]} Back     information, alignment and structure
>d1egaa1 c.37.1.8 (A:4-182) GTPase Era, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1zaka1 c.37.1.1 (A:3-127,A:159-222) Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} Back     information, alignment and structure
>d1f6ba_ c.37.1.8 (A:) SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d1lw7a2 c.37.1.1 (A:220-411) Transcriptional regulator NadR, ribosylnicotinamide kinase domain {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1udxa2 c.37.1.8 (A:157-336) Obg GTP-binding protein middle domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1r8sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF1 [TaxId: 9606]} Back     information, alignment and structure
>d1yj5a2 c.37.1.1 (A:351-522) 5' polynucleotide kinase-3' phosphatase, C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1szpa2 c.37.1.11 (A:145-395) DNA repair protein Rad51, catalytic domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1wf3a1 c.37.1.8 (A:3-180) GTPase Era, N-terminal domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1lvga_ c.37.1.1 (A:) Guanylate kinase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2gj8a1 c.37.1.8 (A:216-376) Probable tRNA modification GTPase TrmE (MnmE), G domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1s3ga1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus globisporus [TaxId: 1459]} Back     information, alignment and structure
>d1puia_ c.37.1.8 (A:) Probable GTPase EngB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1nksa_ c.37.1.1 (A:) Adenylate kinase {Archaeon Sulfolobus acidocaldarius [TaxId: 2285]} Back     information, alignment and structure
>d1g6oa_ c.37.1.11 (A:) Hexameric traffic ATPase, HP0525 {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1lvga_ c.37.1.1 (A:) Guanylate kinase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1h65a_ c.37.1.8 (A:) Chloroplast protein translocon GTPase Toc34 {Garden pea (Pisum sativum) [TaxId: 3888]} Back     information, alignment and structure
>d1e6ca_ c.37.1.2 (A:) Shikimate kinase (AroK) {Erwinia chrysanthemi [TaxId: 556]} Back     information, alignment and structure
>d2bdta1 c.37.1.25 (A:1-176) Hypothetical protein BH3686 {Bacillus halodurans [TaxId: 86665]} Back     information, alignment and structure
>d1bifa1 c.37.1.7 (A:37-249) 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase, kinase domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1upta_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARL1 [TaxId: 9606]} Back     information, alignment and structure
>d1ly1a_ c.37.1.1 (A:) Polynucleotide kinase, kinase domain {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d1udxa2 c.37.1.8 (A:157-336) Obg GTP-binding protein middle domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2iyva1 c.37.1.2 (A:2-166) Shikimate kinase (AroK) {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2cdna1 c.37.1.1 (A:1-181) Adenylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2qtvb1 c.37.1.8 (B:24-189) SAR1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ksha_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL2 [TaxId: 10090]} Back     information, alignment and structure
>d1ksha_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL2 [TaxId: 10090]} Back     information, alignment and structure
>d1e4va1 c.37.1.1 (A:1-121,A:157-214) Adenylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2ak3a1 c.37.1.1 (A:0-124,A:162-225) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-3 [TaxId: 9913]} Back     information, alignment and structure
>d1puia_ c.37.1.8 (A:) Probable GTPase EngB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1rkba_ c.37.1.1 (A:) Adenylate kinase {Human (Homo sapiens), isoenzyme 6 [TaxId: 9606]} Back     information, alignment and structure
>d1akya1 c.37.1.1 (A:3-130,A:169-220) Adenylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1f6ba_ c.37.1.8 (A:) SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d1yrba1 c.37.1.10 (A:1-244) ATP(GTP)-binding protein PAB0955 {Pyrococcus abyssi [TaxId: 29292]} Back     information, alignment and structure
>d1pzna2 c.37.1.11 (A:96-349) DNA repair protein Rad51, catalytic domain {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1wb1a4 c.37.1.8 (A:1-179) Elongation factor SelB, N-terminal domain {Methanococcus maripaludis [TaxId: 39152]} Back     information, alignment and structure
>d1ckea_ c.37.1.1 (A:) CMP kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2p67a1 c.37.1.10 (A:1-327) LAO/AO transport system kinase ArgK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2fh5b1 c.37.1.8 (B:63-269) Signal recognition particle receptor beta-subunit {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1qhxa_ c.37.1.3 (A:) Chloramphenicol phosphotransferase {Streptomyces venezuelae [TaxId: 54571]} Back     information, alignment and structure
>d2i1qa2 c.37.1.11 (A:65-322) DNA repair protein Rad51, catalytic domain {Archaeon Methanococcus voltae [TaxId: 2188]} Back     information, alignment and structure
>d1xzpa2 c.37.1.8 (A:212-371) TrmE GTPase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1r8sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF1 [TaxId: 9606]} Back     information, alignment and structure
>d1q3ta_ c.37.1.1 (A:) CMP kinase {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d1x6va3 c.37.1.4 (A:34-228) Adenosine-5'phosphosulfate kinase (APS kinase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uj2a_ c.37.1.6 (A:) Uridine-cytidine kinase 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xzpa2 c.37.1.8 (A:212-371) TrmE GTPase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1upta_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARL1 [TaxId: 9606]} Back     information, alignment and structure
>d1zj6a1 c.37.1.8 (A:2-178) ADP-ribosylation factor {Human (Homo sapiens), ARL5A [TaxId: 9606]} Back     information, alignment and structure
>d1h65a_ c.37.1.8 (A:) Chloroplast protein translocon GTPase Toc34 {Garden pea (Pisum sativum) [TaxId: 3888]} Back     information, alignment and structure
>d1v5wa_ c.37.1.11 (A:) Meiotic recombination protein DMC1/LIM15 homolog {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m7ga_ c.37.1.4 (A:) Adenosine-5'phosphosulfate kinase (APS kinase) {Fungus (Penicillium chrysogenum) [TaxId: 5076]} Back     information, alignment and structure
>d1viaa_ c.37.1.2 (A:) Shikimate kinase (AroK) {Campylobacter jejuni [TaxId: 197]} Back     information, alignment and structure
>d2p67a1 c.37.1.10 (A:1-327) LAO/AO transport system kinase ArgK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2i1qa2 c.37.1.11 (A:65-322) DNA repair protein Rad51, catalytic domain {Archaeon Methanococcus voltae [TaxId: 2188]} Back     information, alignment and structure
>d1khta_ c.37.1.1 (A:) Adenylate kinase {Archaeon Methanococcus voltae [TaxId: 2188]} Back     information, alignment and structure
>d1sxja2 c.37.1.20 (A:295-547) Replication factor C1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2iyva1 c.37.1.2 (A:2-166) Shikimate kinase (AroK) {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1e6ca_ c.37.1.2 (A:) Shikimate kinase (AroK) {Erwinia chrysanthemi [TaxId: 556]} Back     information, alignment and structure
>d1ofha_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d2qm8a1 c.37.1.10 (A:5-327) Metallochaperone MeaB {Methylobacterium extorquens [TaxId: 408]} Back     information, alignment and structure
>d1in4a2 c.37.1.20 (A:17-254) Holliday junction helicase RuvB {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1iqpa2 c.37.1.20 (A:2-232) Replication factor C {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1ixsb2 c.37.1.20 (B:4-242) Holliday junction helicase RuvB {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1rz3a_ c.37.1.6 (A:) Hypothetical protein rbstp0775 {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1zd9a1 c.37.1.8 (A:18-181) ADP-ribosylation factor {Human (Homo sapiens), ARL8A [TaxId: 9606]} Back     information, alignment and structure
>d1zd9a1 c.37.1.8 (A:18-181) ADP-ribosylation factor {Human (Homo sapiens), ARL8A [TaxId: 9606]} Back     information, alignment and structure
>d1sq5a_ c.37.1.6 (A:) Pantothenate kinase PanK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2fh5b1 c.37.1.8 (B:63-269) Signal recognition particle receptor beta-subunit {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2i3ba1 c.37.1.11 (A:1-189) Cancer-related NTPase, C1orf57 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kaga_ c.37.1.2 (A:) Shikimate kinase (AroK) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1qf9a_ c.37.1.1 (A:) UMP/CMP kinase {Dictyostelium discoideum [TaxId: 44689]} Back     information, alignment and structure
>d1fzqa_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL3 [TaxId: 10090]} Back     information, alignment and structure
>d2fnaa2 c.37.1.20 (A:1-283) Archaeal ATPase SSO1545 {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1zj6a1 c.37.1.8 (A:2-178) ADP-ribosylation factor {Human (Homo sapiens), ARL5A [TaxId: 9606]} Back     information, alignment and structure
>d1nksa_ c.37.1.1 (A:) Adenylate kinase {Archaeon Sulfolobus acidocaldarius [TaxId: 2285]} Back     information, alignment and structure
>d1szpa2 c.37.1.11 (A:145-395) DNA repair protein Rad51, catalytic domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1uf9a_ c.37.1.1 (A:) Dephospho-CoA kinase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2vp4a1 c.37.1.1 (A:12-208) Deoxyribonucleoside kinase {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1d2na_ c.37.1.20 (A:) Hexamerization domain of N-ethylmalemide-sensitive fusion (NSF) protein {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d1lv7a_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1knxa2 c.91.1.2 (A:133-309) HPr kinase HprK C-terminal domain {Mycoplasma pneumoniae [TaxId: 2104]} Back     information, alignment and structure
>d1nn5a_ c.37.1.1 (A:) Thymidylate kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2vp4a1 c.37.1.1 (A:12-208) Deoxyribonucleoside kinase {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d3raba_ c.37.1.8 (A:) Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1ky3a_ c.37.1.8 (A:) Rab-related protein ypt7p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1tq4a_ c.37.1.8 (A:) Interferon-inducible GTPase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1p5zb_ c.37.1.1 (B:) Deoxycytidine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g7sa4 c.37.1.8 (A:1-227) Initiation factor IF2/eIF5b, N-terminal (G) domain {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1wb1a4 c.37.1.8 (A:1-179) Elongation factor SelB, N-terminal domain {Methanococcus maripaludis [TaxId: 39152]} Back     information, alignment and structure
>d1fzqa_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL3 [TaxId: 10090]} Back     information, alignment and structure
>d1fnna2 c.37.1.20 (A:1-276) CDC6, N-domain {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d1okkd2 c.37.1.10 (D:97-303) GTPase domain of the signal recognition particle receptor FtsY {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1ctqa_ c.37.1.8 (A:) cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zaka1 c.37.1.1 (A:3-127,A:159-222) Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} Back     information, alignment and structure
>d2gjsa1 c.37.1.8 (A:91-258) Rad {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z2aa1 c.37.1.8 (A:8-171) Rab23 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1pzna2 c.37.1.11 (A:96-349) DNA repair protein Rad51, catalytic domain {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1v5wa_ c.37.1.11 (A:) Meiotic recombination protein DMC1/LIM15 homolog {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1r7ra3 c.37.1.20 (A:471-735) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d4tmka_ c.37.1.1 (A:) Thymidylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2f9la1 c.37.1.8 (A:8-182) Rab11b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sxjd2 c.37.1.20 (D:26-262) Replication factor C2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ixza_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1yj5a2 c.37.1.1 (A:351-522) 5' polynucleotide kinase-3' phosphatase, C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2f7sa1 c.37.1.8 (A:5-190) Rab27b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tf7a1 c.37.1.11 (A:14-255) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} Back     information, alignment and structure
>d1wmsa_ c.37.1.8 (A:) Rab9a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1e32a2 c.37.1.20 (A:201-458) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2a5ja1 c.37.1.8 (A:9-181) Rab2b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g16a_ c.37.1.8 (A:) Rab-related protein Sec4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ls1a2 c.37.1.10 (A:89-295) GTPase domain of the signal sequence recognition protein Ffh {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1g8pa_ c.37.1.20 (A:) ATPase subunit of magnesium chelatase, BchI {Rhodobacter capsulatus [TaxId: 1061]} Back     information, alignment and structure
>d1ukza_ c.37.1.1 (A:) Uridylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2erxa1 c.37.1.8 (A:6-176) di-Ras2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2gjsa1 c.37.1.8 (A:91-258) Rad {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xtqa1 c.37.1.8 (A:3-169) GTP-binding protein RheB {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kkma_ c.91.1.2 (A:) HPr kinase HprK C-terminal domain {Lactobacillus casei [TaxId: 1582]} Back     information, alignment and structure
>d2ew1a1 c.37.1.8 (A:4-174) Rab30 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3raba_ c.37.1.8 (A:) Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2erya1 c.37.1.8 (A:10-180) r-Ras2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uj2a_ c.37.1.6 (A:) Uridine-cytidine kinase 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ky3a_ c.37.1.8 (A:) Rab-related protein ypt7p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1sxjb2 c.37.1.20 (B:7-230) Replication factor C4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1kaoa_ c.37.1.8 (A:) Rap2a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1moza_ c.37.1.8 (A:) ADP-ribosylation factor {Baker's yeast (Saccharomyces cerevisiae), ARL1 [TaxId: 4932]} Back     information, alignment and structure
>d1u94a1 c.37.1.11 (A:6-268) RecA protein, ATPase-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1p5zb_ c.37.1.1 (B:) Deoxycytidine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tq4a_ c.37.1.8 (A:) Interferon-inducible GTPase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ctqa_ c.37.1.8 (A:) cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2f7sa1 c.37.1.8 (A:5-190) Rab27b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nn5a_ c.37.1.1 (A:) Thymidylate kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xtqa1 c.37.1.8 (A:3-169) GTP-binding protein RheB {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tf7a2 c.37.1.11 (A:256-497) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} Back     information, alignment and structure
>d1z0fa1 c.37.1.8 (A:8-173) Rab14 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bifa1 c.37.1.7 (A:37-249) 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase, kinase domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1vg8a_ c.37.1.8 (A:) Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1okkd2 c.37.1.10 (D:97-303) GTPase domain of the signal recognition particle receptor FtsY {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1x3sa1 c.37.1.8 (A:2-178) Rab18 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bmja1 c.37.1.8 (A:66-240) Centaurin gamma 1, G domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2g3ya1 c.37.1.8 (A:73-244) GTP-binding protein GEM {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w5sa2 c.37.1.20 (A:7-293) CDC6-like protein APE0152, N-terminal domain {Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1sxjc2 c.37.1.20 (C:12-238) Replication factor C3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1tmka_ c.37.1.1 (A:) Thymidylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1z2aa1 c.37.1.8 (A:8-171) Rab23 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2ew1a1 c.37.1.8 (A:4-174) Rab30 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z06a1 c.37.1.8 (A:32-196) Rab-33b {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1yzqa1 c.37.1.8 (A:14-177) Rab6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ak2a1 c.37.1.1 (A:14-146,A:177-233) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-2 [TaxId: 9913]} Back     information, alignment and structure
>d1e0sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF6 [TaxId: 9606]} Back     information, alignment and structure
>d1moza_ c.37.1.8 (A:) ADP-ribosylation factor {Baker's yeast (Saccharomyces cerevisiae), ARL1 [TaxId: 4932]} Back     information, alignment and structure
>d1u8za_ c.37.1.8 (A:) Ras-related protein RalA {Cotton-top tamarin (Saguinus oedipus) [TaxId: 9490]} Back     information, alignment and structure
>d2bmea1 c.37.1.8 (A:6-179) Rab4a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jjva_ c.37.1.1 (A:) Dephospho-CoA kinase {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d2bcgy1 c.37.1.8 (Y:3-196) GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1q3ta_ c.37.1.1 (A:) CMP kinase {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d2fu5c1 c.37.1.8 (C:3-175) Rab8a {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1vmaa2 c.37.1.10 (A:82-294) GTPase domain of the signal recognition particle receptor FtsY {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1ko7a2 c.91.1.2 (A:130-298) HPr kinase HprK C-terminal domain {Staphylococcus xylosus [TaxId: 1288]} Back     information, alignment and structure
>d1ni3a1 c.37.1.8 (A:11-306) YchF GTP-binding protein N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1j8yf2 c.37.1.10 (F:87-297) GTPase domain of the signal sequence recognition protein Ffh {Archaeon Acidianus ambivalens [TaxId: 2283]} Back     information, alignment and structure
>d1sxje2 c.37.1.20 (E:4-255) Replication factor C5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1vmaa2 c.37.1.10 (A:82-294) GTPase domain of the signal recognition particle receptor FtsY {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1gvnb_ c.37.1.21 (B:) Plasmid maintenance system epsilon/zeta, toxin zeta subunit {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1u94a1 c.37.1.11 (A:6-268) RecA protein, ATPase-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1kk1a3 c.37.1.8 (A:6-200) Initiation factor eIF2 gamma subunit, N-terminal (G) domain {Archaeon Pyrococcus abyssi [TaxId: 29292]} Back     information, alignment and structure
>d1m7ga_ c.37.1.4 (A:) Adenosine-5'phosphosulfate kinase (APS kinase) {Fungus (Penicillium chrysogenum) [TaxId: 5076]} Back     information, alignment and structure
>d1z0ja1 c.37.1.8 (A:2-168) Rab-22a {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1z08a1 c.37.1.8 (A:17-183) Rab21 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1j8yf2 c.37.1.10 (F:87-297) GTPase domain of the signal sequence recognition protein Ffh {Archaeon Acidianus ambivalens [TaxId: 2283]} Back     information, alignment and structure
>d1vhta_ c.37.1.1 (A:) Dephospho-CoA kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1kmqa_ c.37.1.8 (A:) RhoA {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2erya1 c.37.1.8 (A:10-180) r-Ras2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1htwa_ c.37.1.18 (A:) Hypothetical protein HI0065 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1kaoa_ c.37.1.8 (A:) Rap2a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g41a_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d2f9la1 c.37.1.8 (A:8-182) Rab11b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g7sa4 c.37.1.8 (A:1-227) Initiation factor IF2/eIF5b, N-terminal (G) domain {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1g16a_ c.37.1.8 (A:) Rab-related protein Sec4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2qy9a2 c.37.1.10 (A:285-495) GTPase domain of the signal recognition particle receptor FtsY {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2fn4a1 c.37.1.8 (A:24-196) r-Ras {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wxqa1 c.37.1.8 (A:1-319) GTP-binding protein PH0525 {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d2atva1 c.37.1.8 (A:5-172) Ras-like estrogen-regulated growth inhibitor, RERG {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1i2ma_ c.37.1.8 (A:) Ran {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1e0sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF6 [TaxId: 9606]} Back     information, alignment and structure
>d2fn4a1 c.37.1.8 (A:24-196) r-Ras {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nlfa_ c.37.1.11 (A:) Hexameric replicative helicase repA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1zina1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d3adka_ c.37.1.1 (A:) Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1ek0a_ c.37.1.8 (A:) Ypt51 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1z06a1 c.37.1.8 (A:32-196) Rab-33b {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2erxa1 c.37.1.8 (A:6-176) di-Ras2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vg8a_ c.37.1.8 (A:) Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1mh1a_ c.37.1.8 (A:) Rac {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2g6ba1 c.37.1.8 (A:58-227) Rab26 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1svma_ c.37.1.20 (A:) Papillomavirus large T antigen helicase domain {Simian virus 40 [TaxId: 10633]} Back     information, alignment and structure
>d1z0fa1 c.37.1.8 (A:8-173) Rab14 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2qy9a2 c.37.1.10 (A:285-495) GTPase domain of the signal recognition particle receptor FtsY {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1teva_ c.37.1.1 (A:) UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1r2qa_ c.37.1.8 (A:) Rab5a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bcgy1 c.37.1.8 (Y:3-196) GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1wmsa_ c.37.1.8 (A:) Rab9a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gsia_ c.37.1.1 (A:) Thymidylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1a7ja_ c.37.1.6 (A:) Phosphoribulokinase {Rhodobacter sphaeroides [TaxId: 1063]} Back     information, alignment and structure
>d2fu5c1 c.37.1.8 (C:3-175) Rab8a {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2g3ya1 c.37.1.8 (A:73-244) GTP-binding protein GEM {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g6oa_ c.37.1.11 (A:) Hexameric traffic ATPase, HP0525 {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1uf9a_ c.37.1.1 (A:) Dephospho-CoA kinase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1kkma_ c.91.1.2 (A:) HPr kinase HprK C-terminal domain {Lactobacillus casei [TaxId: 1582]} Back     information, alignment and structure
>d1a7ja_ c.37.1.6 (A:) Phosphoribulokinase {Rhodobacter sphaeroides [TaxId: 1063]} Back     information, alignment and structure
>d1ls1a2 c.37.1.10 (A:89-295) GTPase domain of the signal sequence recognition protein Ffh {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1p9ra_ c.37.1.11 (A:) Extracellular secretion NTPase EpsE {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1u8za_ c.37.1.8 (A:) Ras-related protein RalA {Cotton-top tamarin (Saguinus oedipus) [TaxId: 9490]} Back     information, alignment and structure
>d1x1ra1 c.37.1.8 (A:10-178) Ras-related protein M-Ras (XRas) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2fnaa2 c.37.1.20 (A:1-283) Archaeal ATPase SSO1545 {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1i2ma_ c.37.1.8 (A:) Ran {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yzqa1 c.37.1.8 (A:14-177) Rab6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tmka_ c.37.1.1 (A:) Thymidylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1e4va1 c.37.1.1 (A:1-121,A:157-214) Adenylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2a5ja1 c.37.1.8 (A:9-181) Rab2b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z08a1 c.37.1.8 (A:17-183) Rab21 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x3sa1 c.37.1.8 (A:2-178) Rab18 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ckea_ c.37.1.1 (A:) CMP kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1zcba2 c.37.1.8 (A:47-75,A:202-372) Transducin (alpha subunit) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1sq5a_ c.37.1.6 (A:) Pantothenate kinase PanK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1mh1a_ c.37.1.8 (A:) Rac {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1knxa2 c.91.1.2 (A:133-309) HPr kinase HprK C-terminal domain {Mycoplasma pneumoniae [TaxId: 2104]} Back     information, alignment and structure
>d1r6bx3 c.37.1.20 (X:437-751) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1odfa_ c.37.1.6 (A:) Hypothetical protein Ygr205W {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1jala1 c.37.1.8 (A:1-278) YchF GTP-binding protein N-terminal domain {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1s3ga1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus globisporus [TaxId: 1459]} Back     information, alignment and structure
>d1z0ja1 c.37.1.8 (A:2-168) Rab-22a {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cdna1 c.37.1.1 (A:1-181) Adenylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1jwyb_ c.37.1.8 (B:) Dynamin G domain {Dictyostelium discoideum [TaxId: 44689]} Back     information, alignment and structure
>d2bmja1 c.37.1.8 (A:66-240) Centaurin gamma 1, G domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x1ra1 c.37.1.8 (A:10-178) Ras-related protein M-Ras (XRas) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1f5na2 c.37.1.8 (A:7-283) Interferon-induced guanylate-binding protein 1 (GBP1), N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2atxa1 c.37.1.8 (A:9-193) RhoQ {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kmqa_ c.37.1.8 (A:) RhoA {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1c1ya_ c.37.1.8 (A:) Rap1A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2qm8a1 c.37.1.10 (A:5-327) Metallochaperone MeaB {Methylobacterium extorquens [TaxId: 408]} Back     information, alignment and structure
>d1mo6a1 c.37.1.11 (A:1-269) RecA protein, ATPase-domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1azta2 c.37.1.8 (A:35-65,A:202-391) Transducin (alpha subunit) {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2bmea1 c.37.1.8 (A:6-179) Rab4a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d4tmka_ c.37.1.1 (A:) Thymidylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1htwa_ c.37.1.18 (A:) Hypothetical protein HI0065 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d2ngra_ c.37.1.8 (A:) CDC42 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2akab1 c.37.1.8 (B:6-304) Dynamin G domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1w44a_ c.37.1.11 (A:) NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} Back     information, alignment and structure
>d1ek0a_ c.37.1.8 (A:) Ypt51 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1mo6a1 c.37.1.11 (A:1-269) RecA protein, ATPase-domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1ko7a2 c.91.1.2 (A:130-298) HPr kinase HprK C-terminal domain {Staphylococcus xylosus [TaxId: 1288]} Back     information, alignment and structure
>d2atxa1 c.37.1.8 (A:9-193) RhoQ {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1f5na2 c.37.1.8 (A:7-283) Interferon-induced guanylate-binding protein 1 (GBP1), N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dy1a2 c.37.1.8 (A:8-274) Elongation factor G (EF-G), N-terminal (G) domain {Thermus thermophilus, EF-G-2 [TaxId: 274]} Back     information, alignment and structure
>d2bv3a2 c.37.1.8 (A:7-282) Elongation factor G (EF-G), N-terminal (G) domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1m7ba_ c.37.1.8 (A:) RhoE (RND3) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2c78a3 c.37.1.8 (A:9-212) Elongation factor Tu (EF-Tu), N-terminal (G) domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1xpua3 c.37.1.11 (A:129-417) Transcription termination factor Rho, ATPase domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xp8a1 c.37.1.11 (A:15-282) RecA protein, ATPase-domain {Deinococcus radiodurans [TaxId: 1299]} Back     information, alignment and structure
>d2atva1 c.37.1.8 (A:5-172) Ras-like estrogen-regulated growth inhibitor, RERG {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ofha_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1r2qa_ c.37.1.8 (A:) Rab5a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nija1 c.37.1.10 (A:2-223) Hypothetical protein YjiA, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xp8a1 c.37.1.11 (A:15-282) RecA protein, ATPase-domain {Deinococcus radiodurans [TaxId: 1299]} Back     information, alignment and structure
>d2g6ba1 c.37.1.8 (A:58-227) Rab26 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1akya1 c.37.1.1 (A:3-130,A:169-220) Adenylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2qn6a3 c.37.1.8 (A:2-206) Initiation factor eIF2 gamma subunit, N-terminal (G) domain {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1iqpa2 c.37.1.20 (A:2-232) Replication factor C {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1gsia_ c.37.1.1 (A:) Thymidylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2bv3a2 c.37.1.8 (A:7-282) Elongation factor G (EF-G), N-terminal (G) domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1kk1a3 c.37.1.8 (A:6-200) Initiation factor eIF2 gamma subunit, N-terminal (G) domain {Archaeon Pyrococcus abyssi [TaxId: 29292]} Back     information, alignment and structure
>d1sxja2 c.37.1.20 (A:295-547) Replication factor C1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2ngra_ c.37.1.8 (A:) CDC42 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1in4a2 c.37.1.20 (A:17-254) Holliday junction helicase RuvB {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1lv7a_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2ak3a1 c.37.1.1 (A:0-124,A:162-225) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-3 [TaxId: 9913]} Back     information, alignment and structure
>d1zcba2 c.37.1.8 (A:47-75,A:202-372) Transducin (alpha subunit) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2dy1a2 c.37.1.8 (A:8-274) Elongation factor G (EF-G), N-terminal (G) domain {Thermus thermophilus, EF-G-2 [TaxId: 274]} Back     information, alignment and structure
>d1c1ya_ c.37.1.8 (A:) Rap1A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1l8qa2 c.37.1.20 (A:77-289) Chromosomal replication initiation factor DnaA {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1m7ba_ c.37.1.8 (A:) RhoE (RND3) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1deka_ c.37.1.1 (A:) Deoxynucleoside monophosphate kinase {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d2bcjq2 c.37.1.8 (Q:38-66,Q:184-354) Transducin (alpha subunit) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1uaaa1 c.37.1.19 (A:2-307) DEXX box DNA helicase {Escherichia coli, RepD [TaxId: 562]} Back     information, alignment and structure
>d1r6bx2 c.37.1.20 (X:169-436) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1azta2 c.37.1.8 (A:35-65,A:202-391) Transducin (alpha subunit) {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1svsa1 c.37.1.8 (A:32-60,A:182-347) Transducin (alpha subunit) {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1ixsb2 c.37.1.20 (B:4-242) Holliday junction helicase RuvB {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2c78a3 c.37.1.8 (A:9-212) Elongation factor Tu (EF-Tu), N-terminal (G) domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2akab1 c.37.1.8 (B:6-304) Dynamin G domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1jjva_ c.37.1.1 (A:) Dephospho-CoA kinase {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d2ocpa1 c.37.1.1 (A:37-277) Deoxyguanosine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a5ta2 c.37.1.20 (A:1-207) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1jbka_ c.37.1.20 (A:) ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2qn6a3 c.37.1.8 (A:2-206) Initiation factor eIF2 gamma subunit, N-terminal (G) domain {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1pjra1 c.37.1.19 (A:1-318) DEXX box DNA helicase {Bacillus stearothermophilus, PcrA [TaxId: 1422]} Back     information, alignment and structure
>d1r6bx3 c.37.1.20 (X:437-751) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1sxjb2 c.37.1.20 (B:7-230) Replication factor C4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1jwyb_ c.37.1.8 (B:) Dynamin G domain {Dictyostelium discoideum [TaxId: 44689]} Back     information, alignment and structure
>d1nija1 c.37.1.10 (A:2-223) Hypothetical protein YjiA, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2a5yb3 c.37.1.20 (B:109-385) CED-4, NB-ARC domain {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1vhta_ c.37.1.1 (A:) Dephospho-CoA kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1e9ra_ c.37.1.11 (A:) Bacterial conjugative coupling protein TrwB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1sxjd2 c.37.1.20 (D:26-262) Replication factor C2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure